Improved selection criteria for H II regions, based on IRAS sources

Science.gov (United States)

Yan, Qing-Zeng; Xu, Ye; Walsh, A. J.; Macquart, J. P.; MacLeod, G. C.; Zhang, Bo; Hancock, P. J.; Chen, Xi; Tang, Zheng-Hong

2018-05-01

We present new criteria for selecting H II regions from the Infrared Astronomical Satellite (IRAS) Point Source Catalogue (PSC), based on an H II region catalogue derived manually from the all-sky Wide-field Infrared Survey Explorer (WISE). The criteria are used to augment the number of H II region candidates in the Milky Way. The criteria are defined by the linear decision boundary of two samples: IRAS point sources associated with known H II regions, which serve as the H II region sample, and IRAS point sources at high Galactic latitudes, which serve as the non-H II region sample. A machine learning classifier, specifically a support vector machine, is used to determine the decision boundary. We investigate all combinations of four IRAS bands and suggest that the optimal criterion is log(F_{60}/F_{12})≥ ( -0.19 × log(F_{100}/F_{25})+ 1.52), with detections at 60 and 100 {μ}m. This selects 3041 H II region candidates from the IRAS PSC. We find that IRAS H II region candidates show evidence of evolution on the two-colour diagram. Merging the WISE H II catalogue with IRAS H II region candidates, we estimate a lower limit of approximately 10 200 for the number of H II regions in the Milky Way.

HUBBLE VISION: A Planetarium Show About Hubble Space Telescope

Science.gov (United States)

Petersen, Carolyn Collins

1995-05-01

In 1991, a planetarium show called "Hubble: Report From Orbit" outlining the current achievements of the Hubble Space Telescope was produced by the independent planetarium production company Loch Ness Productions, for distribution to facilities around the world. The program was subsequently converted to video. In 1994, that program was updated and re-produced under the name "Hubble Vision" and offered to the planetarium community. It is periodically updated and remains a sought-after and valuable resource within the community. This paper describes the production of the program, and the role of the astronomical community in the show's production (and subsequent updates). The paper is accompanied by a video presentation of Hubble Vision.

Application of MCM image construction to IRAS comet observations

Science.gov (United States)

Schlapfer, Martin F.; Walker, Russell G.

1994-01-01

There is a wealth of IRAS comet data, obtained in both the survey and pointed observations modes. However, these measurements have remained largely untouched due to difficulties in removing instrumental effects from the data. We have developed a version of the Maximum Correlation Method for Image Construction algorithm (MCM) which operates in the moving coordinate system of the comet and properly treats both real cometary motion and apparent motion due to spacecraft parallax. This algorithm has been implemented on a 486/33 PC in FORTRAN and IDL codes. Preprocessing of the IRAS CRDD includes baseline removal, deglitching, and removal of long tails due to dielectric time constants of the detectors. The resulting images are virtually free from instrumental effects and have the highest possible spatial resolution consistent with the data sampling. We present examples of high resolution IRAS images constructed from survey observations of Comets P/Tempel 1 and P/Tempel 2, and pointed observations of IRAS-Araki-Alcock.

IRAS 20050+2720: ANATOMY OF A YOUNG STELLAR CLUSTER

International Nuclear Information System (INIS)

Günther, H. M.; Wolk, S. J.; Spitzbart, B.; Forbrich, J.; Wright, N. J.; Bourke, T. L.; Gutermuth, R. A.; Allen, L.; Megeath, S. T.; Pipher, J. L.

2012-01-01

IRAS 20050+2720 is young star-forming region at a distance of 700 pc without apparent high-mass stars. We present results of our multi-wavelength study of IRAS 20050+2720 which includes observations by Chandra and Spitzer, and Two Micron All Sky Survey and UBVRI photometry. In total, about 300 young stellar objects (YSOs) in different evolutionary stages are found. We characterize the distribution of YSOs in this region using a minimum spanning tree analysis. We newly identify a second cluster core, which consists mostly of class II objects, about 10' from the center of the cloud. YSOs of earlier evolutionary stages are more clustered than more evolved objects. The X-ray luminosity function (XLF) of IRAS 20050+2720 is roughly lognormal, but steeper than the XLF of the more massive Orion Nebula complex. IRAS 20050+2720 shows a lower N H /A K ratio compared with the diffuse interstellar medium.

IRAS 20050+2720: ANATOMY OF A YOUNG STELLAR CLUSTER

Energy Technology Data Exchange (ETDEWEB)

Guenther, H. M.; Wolk, S. J.; Spitzbart, B.; Forbrich, J.; Wright, N. J.; Bourke, T. L. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Gutermuth, R. A. [Department of Astronomy, University of Massachusetts, Amherst, MA 01003 (United States); Allen, L. [National Optical Astronomy Observatory, 950 North Cherry Avenue, Tucson, AZ 85719 (United States); Megeath, S. T. [Department of Physics and Astronomy, MS-113, University of Toledo, 2801 W. Bancroft St., Toledo, OH 43606 (United States); Pipher, J. L., E-mail: hguenther@cfa.harvard.edu [Department of Physics and Astronomy, University of Rochester, 500 Wilson Boulevard, Rochester, NY 14627 (United States)

2012-10-01

IRAS 20050+2720 is young star-forming region at a distance of 700 pc without apparent high-mass stars. We present results of our multi-wavelength study of IRAS 20050+2720 which includes observations by Chandra and Spitzer, and Two Micron All Sky Survey and UBVRI photometry. In total, about 300 young stellar objects (YSOs) in different evolutionary stages are found. We characterize the distribution of YSOs in this region using a minimum spanning tree analysis. We newly identify a second cluster core, which consists mostly of class II objects, about 10' from the center of the cloud. YSOs of earlier evolutionary stages are more clustered than more evolved objects. The X-ray luminosity function (XLF) of IRAS 20050+2720 is roughly lognormal, but steeper than the XLF of the more massive Orion Nebula complex. IRAS 20050+2720 shows a lower N{sub H}/A{sub K} ratio compared with the diffuse interstellar medium.

Infrared Astronomical Satellite (IRAS) Catalogs and Atlases. Explanatory Supplement

Science.gov (United States)

Beichman, C. A. (Editor); Neugebauer, G. (Editor); Habing, H. J. (Editor); Clegg, P. E. (Editor); Chester, T. J. (Editor)

1985-01-01

The Infrared Astronomical Satellite (IRAS) mission is described. An overview of the mission, a description of the satellite and its telescope system, and a discussion of the mission design, requirements, and inflight modifications are given. Data reduction, flight tests, flux reconstruction and calibration, data processing, and the formats of the IRAS catalogs and atlases are also considered.

IRAS far-infrared colours of normal stars

Science.gov (United States)

Waters, L. B. F. M.; Cote, J.; Aumann, H. H.

1987-01-01

The analysis of IRAS observations at 12, 25, 60 and 100 microns of bright stars of spectral type O to M is presented. The objective is to identify the 'normal' stellar population and to characterize it in terms of the relationships between (B-V) and (V-/12/), between (R-I) and (V-/12/), and as a function of spectral type and luminosity class. A well-defined relation is found between the color of normal stars in the visual (B-V), (R-I) and in the IR, which does not depend on luminosity class. Using the (B-V), (V-/12/) relation for normal stars, it is found that B and M type stars show a large fraction of deviating stars, mostly with IR excess that is probably caused by circumstellar material. A comparison of IRAS colors with the Johnson colors as a function of spectral type shows good agreement except for the K0 to M5 type stars. The results will be useful in identifying the deviating stars detected with IRAS.

The Tully-Fisher relation of the IRAS minisurvey galaxies

Science.gov (United States)

Van Driel, W.; Van Den Broek, A. C.; Baan, W. A.

1995-01-01

We investigated the possible influence on the Tully-Fisher relation of active massive star formation in IRAS galaxies, in order to estimate the contribution of star formation to their near-infrared luminosity. We observed 60 galaxies from the infrared complete so-called IRAS Minisurvey sample in the 21 cm H1 line at Arecibo, determined the near-infrared (H-band) Tully-Fisher relation for the 36 objects in the sample we judged to be usable for this purpose, and compared this relation with that of optically selected normal galaxies. The results show no significant enhancement of the near-infrared luminosities of the IRAS Minisurvey galaxies compared to those of the optically selected normal glaxies. From these results we inferred that in the minisurvey galaxies the average contribution of the active massive star formation to the total near-infrared luminosity is less and that exponential decay times for the starbursts occurring in the Minisurvey galaxies are of the order of 10 Myr. The Tully-Fisher relation shows one exceptional galaxy (IRAS 03565+2139) with an about 25 times higher luminosity than average for its rotational velocity.

Detection of OH radicals from IRAS sources

International Nuclear Information System (INIS)

Lewis, B.M.; Eder, J.; Terzian, Y.

1985-01-01

An efficient method for detecting new OH/infrared stars is to begin with IRAS source positions, selected for appropriate infrared colours, and using radio-line observations to confirm the OH properties. The authors demonstrate the validity of this approach here, using the Arecibo 305 m radio-telescope to confirm the 1,612 MHz line observations of sources in IRAS Circulars 8 and 9; the present observations identify 21 new OH/infrared stars. The new sources have weaker 1,612 MHz fluxes, bluer (60-25) μm colours and a smaller mean separation between the principal emission peaks than previous samples. (author)

IRAS colors of VLA identified objects in the galaxy

International Nuclear Information System (INIS)

Fich, M.; Terebey, S.

1987-01-01

Infrared Astronomy Satellite (IRAS) sources found within 4 degrees of l = 125 deg, b = 2 deg on the 3rd HCON 60 micron Sky Brightness Images were observed at the Very Large Array (VLA). Regions were to be identified where massive stars are forming by looking for small areas of radio continuum emissions. The IRAS sources could be divided into three groups by their IRAS 12 micron/25 micron and 60 micron/100 micron color. The group identified with star forming regions contained essentially all of the objects with extended radio emission. In all of these cases the extended radio emission showed a morphology consistent with the identification of these objects as HII regions. The conclusion drawn is that star formation regions can be distinguished from other objects by their infrared colors

Radio identifications of IRAS point sources with b greater than 30 deg

International Nuclear Information System (INIS)

Condon, J.J.; Broderick, J.J.; Virginia Polytechnic Institute and State Univ., Blacksburg)

1986-01-01

The present radio identifications of IRAS point sources on the basis of Green Bank 1400 MHz survey maps notes that 365 hot IR sources are not detectable radio sources, and that nearly all cool high latitude IRAS sources are extragalactic. The fainter IR-source identifications encompass optically bright quasars, BL Lac objects, Seyfert galaxies, and elliptical galaxies. No IRAS sources could be identified with distant elliptical radio galaxies, so that although the radio and IR fluxes of most IRAS extragalactic sources are tightly correlated, complete samples of strong radio and IR sources are almost completely disjoint; no more than 1 percent of the IR sources are radio sources and less than 1 percent of the radio sources are IR ones. 35 references

Chandra X-ray observations of the hyper-luminous infrared galaxy IRAS F15307+3252

Science.gov (United States)

Hlavacek-Larrondo, J.; Gandhi, P.; Hogan, M. T.; Gendron-Marsolais, M.-L.; Edge, A. C.; Fabian, A. C.; Russell, H. R.; Iwasawa, K.; Mezcua, M.

2017-01-01

Hyper-luminous infrared galaxies (HyLIRGs) lie at the extreme luminosity end of the IR galaxy population with LIR > 1013 L⊙. They are thought to be closer counterparts of the more distant sub-millimeter galaxies, and should therefore be optimal targets to study the most massive systems in formation. We present deep Chandra observations of IRAS F15307+3252 (100 ks), a classical HyLIRG located at z = 0.93 and hosting a radio-loud AGN (L1.4 GHz ˜ 3.5 × 1025 W Hz-1). The Chandra images reveal the presence of extended (r = 160 kpc), asymmetric X-ray emission in the soft 0.3-2.0 keV band that has no radio counterpart. We therefore argue that the emission is of thermal origin originating from a hot intragroup or intracluster medium virializing in the potential. We find that the temperature (˜2 keV) and bolometric X-ray luminosity (˜3 × 1043 erg s-1) of the gas follow the expected LX-ray-T correlation for groups and clusters, and that the gas has a remarkably short cooling time of 1.2 Gyr. In addition, VLA radio observations reveal that the galaxy hosts an unresolved compact steep-spectrum (CSS) source, most likely indicating the presence of a young radio source similar to 3C186. We also confirm that the nucleus is dominated by a redshifted 6.4 keV Fe Kα line, strongly suggesting that the AGN is Compton-thick. Finally, Hubble images reveal an overdensity of galaxies and sub-structure in the galaxy that correlates with soft X-ray emission. This could be a snapshot view of on-going groupings expected in a growing cluster environment. IRAS F15307+3252 might therefore be a rare example of a group in the process of transforming into a cluster.

Infrared astronomical satellite (IRAS) catalogs and atlases. Volume 1: Explanatory supplement

Science.gov (United States)

Beichman, C. A. (Editor); Neugebauer, G. (Editor); Habing, H. J. (Editor); Clegg, P. E. (Editor); Chester, Thomas J. (Editor)

1988-01-01

The Infrared Astronomical Satellite (IRAS) was launched on January 26, 1983. During its 300-day mission, IRAS surveyed over 96 pct of the celestial sphere at four infrared wavelengths, centered approximately at 12, 25, 60, and 100 microns. Volume 1 describes the instrument, the mission, and data reduction.

IRAS associations with dark clouds of opacity class 6

International Nuclear Information System (INIS)

Parker, N.D.

1988-01-01

Accurate positions of the opacity class 6 clouds from the Lynds Catalog of Dark Nebulae have been measured on blue and red prints from the Polomar Observatory Sky Survey (POSS) plates. These revised positions and the dimensions of ellipses fitted to the clouds are listed. The IRAS point source catalog has been searched for sources lying within the boundaries of the 147 clouds in the sample. The distribution and properties of these IRAS sources are discussed briefly. (author)

Water-filtered infrared-A (wIRA overcomes swallowing disorders and hypersalivation – a case report

Directory of Open Access Journals (Sweden)

Hoffmann, Gerd

2017-08-01

Full Text Available Case description: A patient with a Barrett oesophageal carcinoma and a resection of the oesophagus with gastric pull-up developed swallowing disorders 6 years and 2 months after the operation. Within 1 year and 7 months two recurrences of the tumor at the anastomosis were found and treated with combined chemoradiotherapy or chemotherapy respectively. 7 years and 9 months after the operation local tumor masses and destruction were present with no ability to orally drink or eat (full feeding by jejunal PEG tube: quality of life was poor, as saliva and mucus were very viscous (pulling filaments and could not be swallowed and had to be spat out throughout the day and night resulting in short periods of sleep (awaking from the necessity to spit out. In total the situation was interpreted more as a problem related to a feeling of choking (with food or fluid in the sense of a functional dysphagia rather than as a swallowing disorder from a structural stenosis. At that time acetylcysteine (2 times 200 mg per day, given via the PEG tube and irradiation with water-filtered infrared-A (wIRA, a special form of heat radiation, of the ventral part of the neck and the thorax were added to the therapy. Within 1 day with acetylcysteine saliva and mucus became less viscous. Within 2 days with wIRA (one day with 4 to 5 hours with irradiation with wIRA at home salivation decreased markedly and quality of life clearly improved: For the first time the patient slept without interruption and without the need for sleep-inducing medication. After 5 days with wIRA the patient could eat his first soft dumpling although drinking of fluids was still not possible. After 2½ weeks with wIRA the patient could eat his first minced schnitzel (escalope. Following the commencement of wIRA (with typically approximately 90–150 minutes irradiation with wIRA per day the patient had 8 months with good quality of life with only small amounts of liquid saliva and mucus and without the

Symbiotic stars observed from the IRAS satellite

International Nuclear Information System (INIS)

Luud, L.; Tuvikene, T.

1987-01-01

Symbiotic stars according to Alfven's catalogue have been checked for coincidence with the IRAS-observed for-infrared sources. 72 symbiotic and possible symbiotic stars have been identified with the IRAS-observed sources. A catalogue of identified stars and energy distributions of representative stars are given. It turns out that the dust in symbiotic stars is a more widespread phenomenon than that it was believed before. Almost 40% of systems are the dusty ones. Among objects with dust temperature some tens of K have been found. It is shown that the only useful two-color diagram is (K-m 12 )-(m 12 -m 25 ). Attention is paid to a type of symbiotic stars with G spectral class cold component which needs special investigation

IRAS 10479 - 2808: a quasar

International Nuclear Information System (INIS)

Clowes, R.G.; Leggett, S.K.; Savage, A.

1991-01-01

The IRAS point source 10479-2808 is a quasar with B J ∼ 16 and z = 0.190. It is not in the Parkes and Molonglo radio catalogues. At the resolution of the UK and ESO Schmidt telescopes it appears to be star-like, with no sign of surrounding fuzz or interactions; it is probably optically variable. (author)

An IRAS-Based Search for New Dusty Late-Type WC Wolf-Rayet Stars

Science.gov (United States)

Cohen, Martin

1995-01-01

I have examined all Infrared Astronomical Satellite (IRAS) data relevant to the 173 Galactic Wolf-Rayet (W-R) stars in an updated catalog, including the 13 stars newly discovered by Shara and coworkers. Using the W-R coordinates in these lists, I have examined the IRAS Point Source Catalog (PSC), the Faint Source Catalog, and the Faint Source Reject Catalog, and have generated one-dimensional spatial profiles, 'ADDSCANs', and two-dimensional full-resolution images, 'FRESCOS'. The goal was to assemble the best set of observed IRAS color indices for different W-R types, in particular for known dusty late-type WC Wolf-Rayet (WCL) objects. I have also unsuccessfully sought differences in IRAS colors and absolute magnitudes between single and binary W-R stars. The color indices for the entire ensemble of W-R stars define zones in the IRAS color-color ([12] - [25], [25] - [60])-plane. By searching the PSC for otherwise unassociated sources that satisfy these colors, I have identified potential new W-R candidates, perhaps too faint to have been recognized in previous optical searches. I have extracted these candidates' IRAS low-resolution spectrometer (LRS) data and compared the spectra with the highly characteristic LRS shape for known dusty WCL stars. The 13 surviving candidates must now be ex amined by optical spectroscopy. This work represents a much more rigorous and exhaustive version of the LRS study that identified IRAS 17380 - 3031 (WR98a) as the first new W-R (WC9) star discovered by IPAS. This search should have detected dusty WCL stars to a distance of 7.0 kpc from the Sun, for l is greater than 30 degrees, and to 2.9 kpc even in the innermost galaxy. For free-free-dominated W-R stars the corresponding distances are 2.5 and 1.0 kpc, respectively.

29 CFR 2509.99-1 - Interpretive Bulletin Relating to Payroll Deduction IRAs.

Science.gov (United States)

2010-07-01

... 29 Labor 9 2010-07-01 2010-07-01 false Interpretive Bulletin Relating to Payroll Deduction IRAs... SECURITY ACT OF 1974 § 2509.99-1 Interpretive Bulletin Relating to Payroll Deduction IRAs. (a) Scope. This...), as applied to payroll deduction programs established by employers 1 for the purpose of enabling...

IRAS IDENTIFICATION OF PRE-MAIN-SEQUENCE STARS IN THE CHAMELEON-II ASSOCIATION

NARCIS (Netherlands)

PRUSTI, T; WHITTET, DCB; ASSENDORP, R; WESSELIUS, PR

We report the results of a search for new pre-main sequence candidates in the Chamaeleon II dark cloud based on three IRAS catalogues (the Point Source Catalog, the Serendipitous Survey Catalog and the Faint Source Survey). A total of 30 sources were selected. Twelve of these display IRAS colours

IMAGE CONSTRUCTION FROM THE IRAS SURVEY

NARCIS (Netherlands)

BONTEKOE, TR; KESTER, DJM; PRICE, SD; DEJONGE, ARW; WESSELIUS, PR

IRAS survery data can be used successfully to produce images of extended objects. The major difficulties, viz. non-uniform sampling, different response functions for each detector, and varying signal-to-noise levels for each detector for each scan, have been resolved. The results of three different

Hubble 15 years of discovery

CERN Document Server

Lindberg Christensen, Lars; Kornmesser, M

2006-01-01

Hubble: 15 Years of Discovery was a key element of the European Space Agency's 15th anniversary celebration activities for the 1990 launch of the NASA/ESA Hubble Space Telescope. As an observatory in space, Hubble is one of the most successful scientific projects of all time, both in terms of scientific output and its immediate public appeal.

Star formation and gas inflows in the OH Megamaser galaxy IRAS03056+2034

Science.gov (United States)

Hekatelyne, C.; Riffel, Rogemar A.; Sales, Dinalva; Robinson, Andrew; Storchi-Bergmann, Thaisa; Kharb, Preeti; Gallimore, Jack; Baum, Stefi; O'Dea, Christopher

2018-06-01

We have obtained observations of the OH Megamaser galaxy IRAS03056+0234 using Gemini Multi-Object Spectrograph (GMOS) Integral Field Unit (IFU), Very Large Array (VLA) and Hubble Space Telescope (HST). The HST data reveals spiral arms containing knots of emission associated to star forming regions. The GMOS-IFU data cover the spectral range of 4500 to 7500 Å at a velocity resolution of 90 km s-1 and spatial resolution of 506 pc. The emission-line flux distributions reveal a ring of star forming regions with radius of 786 pc centred at the nucleus of the galaxy, with an ionized gas mass of 1.2× 108M⊙, an ionizing photon luminosity of log Q[H+]=53.8 and a star formation rate of 4.9 M⊙ yr-1. The emission-line ratios and radio emission suggest that the gas at the nuclear region is excited by both starburst activity and an active galactic nucleus. The gas velocity fields are partially reproduced by rotation in the galactic plane, but show, in addition, excess redshifts to the east of the nucleus, consistent with gas inflows towards the nucleus, with velocity of ˜45 km s-1 and a mass inflow rate of ˜7.7 × 10-3 M⊙ yr-1.

A practical approach to the classification of IRAS sources using infrared colors alone

International Nuclear Information System (INIS)

Walker, H.J.; Volk, K.; Wainscoat, R.J.; Schwartz, D.E.; Cohen, M.

1989-01-01

Zones of the IRAS color-color planes in which a variety of different types of known source occur, have been defined for the purpose of obtaining representative IRAS colors for them. There is considerable overlap between many of these zones, rendering a unique classification difficult on the basis of IRAS colors alone, although galactic latitude can resolve ambiguities between galactic and extragalactic populations. The color dependence of these zones on the presence of spectral emission/absorption features and on the spatial extent of the sources has been investigated. It is found that silicate emission features do not significantly influence the IRAS colors. Planetary nebulae may show a dependence of color on the presence of atomic or molecular features in emission, although the dominant cause of this effect may be the underlying red continua of nebulae with strong atomic lines. Only small shifts are detected in the colors of individual spatially extended sources when total flux measurements are substituted for point-source measurements. 36 refs

Photodynamic therapy (PDT and waterfiltered infrared A (wIRA in patients with recalcitrant common hand and foot warts

Directory of Open Access Journals (Sweden)

Hoffmann, Gerd

2004-10-01

Full Text Available Background: Common warts (verrucae vulgares are human papilloma virus (HPV infections with a high incidence and prevalence, most often affecting hands and feet, being able to impair quality of life. About 30 different therapeutic regimens described in literature reveal a lack of a single striking strategy. Recent publications showed positive results of photodynamic therapy (PDT with 5-aminolevulinic acid (5-ALA in the treatment of HPV-induced skin diseases, especially warts, using visible light (VIS to stimulate an absorption band of endogenously formed protoporphyrin IX. Additional experiences adding waterfiltered infrared A (wIRA during 5-ALA-PDT revealed positive effects. Aim of the study: First prospective randomised controlled blind study including PDT and wIRA in the treatment of recalcitrant common hand and foot warts. Comparison of "5-ALA cream (ALA vs. placebo cream (PLC" and "irradiation with visible light and wIRA (VIS+wIRA vs. irradiation with visible light alone (VIS". Methods: Pre-treatment with keratolysis (salicylic acid and curettage. PDT treatment: topical application of 5-ALA (Medac in "unguentum emulsificans aquosum" vs. placebo; irradiation: combination of VIS and a large amount of wIRA (Hydrosun® radiator type 501, 4 mm water cuvette, waterfiltered spectrum 590-1400 nm, contact-free, typically painless vs. VIS alone. Post-treatment with retinoic acid ointment. One to three therapy cycles every 3 weeks. Main variable of interest: "Percent change of total wart area of each patient over the time" (18 weeks. Global judgement by patient and by physician and subjective rating of feeling/pain (visual analogue scales. 80 patients with therapy-resistant common hand and foot warts were assigned randomly into one of the four therapy groups with comparable numbers of warts at comparable sites in all groups. Results: The individual total wart area decreased during 18 weeks in group 1 (ALA+VIS+wIRA and in group 2 (PLC+VIS+wIRA

AN EXTREME HIGH-VELOCITY BIPOLAR OUTFLOW IN THE PRE-PLANETARY NEBULA IRAS 08005-2356

Energy Technology Data Exchange (ETDEWEB)

Sahai, R. [Jet Propulsion Laboratory, California Institute of Technology, MS 183-900, Pasadena, CA 91109 (United States); Patel, N. A., E-mail: raghvendra.sahai@jpl.nasa.gov [Harvard-Smithsonian Center for Astrophysics, Cambridge, MA (United States)

2015-09-01

We report interferometric mapping of the bipolar pre-planetary nebula IRAS 08005-2356 (I 08005) with an angular resolution of ∼1″–5″, using the Submillimeter Array, in the {sup 12}CO J = 2–1, 3–2, {sup 13}CO J = 2–1, and SiO J = 5–4 (v = 0) lines. Single-dish observations, using the SMT 10 m, were made in these lines as well as in the CO J = 4–3 and SiO J = 6–5 (v = 0) lines. The line profiles are very broad, showing the presence of a massive (>0.1 M{sub ⊙}), extreme high velocity outflow (V ∼ 200 km s{sup −1}) directed along the nebular symmetry axis derived from the Hubble Space Telescope imaging of this object. The outflow's scalar momentum far exceeds that available from radiation pressure of the central post-AGB star, and it may be launched from an accretion disk around a main-sequence companion. We provide indirect evidence for such a disk from its previously published, broad Hα emission profile, which we propose results from Lyβ emission generated in the disk followed by Raman-scattering in the innermost regions of a fast, neutral wind.

The new European Hubble archive

Science.gov (United States)

De Marchi, Guido; Arevalo, Maria; Merin, Bruno

2016-01-01

The European Hubble Archive (hereafter eHST), hosted at ESA's European Space Astronomy Centre, has been released for public use in October 2015. The eHST is now fully integrated with the other ESA science archives to ensure long-term preservation of the Hubble data, consisting of more than 1 million observations from 10 different scientific instruments. The public HST data, the Hubble Legacy Archive, and the high-level science data products are now all available to scientists through a single, carefully designed and user friendly web interface. In this talk, I will show how the the eHST can help boost archival research, including how to search on sources in the field of view thanks to precise footprints projected onto the sky, how to obtain enhanced previews of imaging data and interactive spectral plots, and how to directly link observations with already published papers. To maximise the scientific exploitation of Hubble's data, the eHST offers connectivity to virtual observatory tools, easily integrates with the recently released Hubble Source Catalog, and is fully accessible through ESA's archives multi-mission interface.

IRAS 06562-0337, The Ironclad Nebula: A New Young Star Cluster

International Nuclear Information System (INIS)

Alves, D.R.; Hoard, D.W.; Rodgers, B.

1998-01-01

IRAS 06562-0337 has been the recent subject of a classic debate: is it a proto endash planetary nebula or a young stellar object? We present the first 2 μm image of IRAS 06562-0337, which reveals an extended diffuse nebula containing approximately 70 stars inside a 30 double-prime radius around a bright, possibly resolved, central object. The derived stellar luminosity function is consistent with that expected from a single coeval population, and the brightness of the nebulosity is consistent with the predicted flux of unresolved low-mass stars. The stars and nebulosity are spatially coincident with strong CO line emission. We therefore identify IRAS 06562-0337 as a new young star cluster embedded in its placental molecular cloud. The central object is likely a Herbig Be star, M ∼ 20 M circle-dot , which may be seen in reflection. We present medium-resolution high signal-to-noise ratio 1997 epoch optical spectra of the central object. Comparison with previously published spectra shows new evidence for time-variable permitted and forbidden line emission, including Si ii, Fe ii, [Fe ii], and [O i]. We suggest that the origin is a dynamic stellar wind in the extended stratified atmosphere of the massive central star in IRAS 06562-0337. copyright copyright 1998. The American Astronomical Society

WIDE FIELD CO MAPPING IN THE REGION OF IRAS 19312+1950

Energy Technology Data Exchange (ETDEWEB)

Nakashima, Jun-ichi [Department of Astronomy and Geodesy, Ural Federal University, Lenin Avenue 51, 620000, Ekaterinburg (Russian Federation); Ladeyschikov, Dmitry A.; Sobolev, Andrej M. [Astronomical Observatory, Ural Federal University, Lenin Avenue 51, 620000, Ekaterinburg (Russian Federation); Zhang, Yong; Hsia, Chih-Hao [Department of Physics, University of Hong Kong, Pokfulam Road, Hong Kong (China); Yung, Bosco H. K., E-mail: nakashima.junichi@gmail.com [N. Copernicus Astronomical Center, Rabiańska 8, 87-100 Toruń (Poland)

2016-07-01

We report the results of wide field CO mapping in the region of IRAS 19312+1950. This Infrared Astronomical Satellite ( IRAS ) object exhibits SiO/H{sub 2}O/OH maser emission, and is embedded in a chemically rich molecular component, the origin of which is still unknown. In order to reveal the entire structure and gas mass of the surrounding molecular component for the first time, we have mapped a wide region around IRAS 19312+1950 in the {sup 12}CO J = 1–0, {sup 13}CO J = 1–0 and C{sup 18}O J = 1–0 lines using the Nobeyama 45 m telescope. In conjunction with archival CO maps, we investigated a region up to 20′ × 20′ in size around this IRAS object. We calculated the CO gas mass assuming local thermal equilibrium, the stellar velocity through the interstellar medium assuming an analytic model of bow shock, and the absolute luminosity, using the latest archival data and trigonometric parallax distance. The derived gas mass (225 M {sub ⊙}–478 M {sub ⊙}) of the molecular component and the relatively large luminosity (2.63 × 10{sup 4} L {sub ☉}) suggest that the central SiO/H{sub 2}O/OH maser source is a red supergiant rather than an asymptotic giant branch (AGB) star or post-AGB star.

Análisis factorial confirmatorio del inventario multicultural de la expresión de la ira y hostilidad

Directory of Open Access Journals (Sweden)

Manolete S. Moscoso

2016-12-01

Full Text Available El propósito principal del presente estudio fue verificar la estructura factorial de las dos escalas que componen el Inventario Multicultural de la Expresión de la Ira y Hostilidad desde una perspectiva confirmatoria. Se utilizó el Análisis Factorial Confirmatorio en una muestra de 264 participantes provenientes de una universidad privada de Lima, Perú. El muestreo fue no probabilístico e incluyó estudiantes (25%, personal docente (17.8% y personal administrativo (57.2%. La confiabilidad del instrumento fue evaluada mediante los modelos congenérico, tau-equivalente y paralelo para cada una de las seis subescalas del instrumento, así como también calculada en base al coeficiente alfa de Cronbach con intervalos de confianza. Resultados: El análisis factorial realizado en la presente muestra peruana identificó cuatro dimensiones para la Escala de la Ira (ira manifiesta, ira contenida, control de la ira manifiesta y control de la ira contenida y dos factores para la Escala de la Hostilidad (reacción impulsiva a la ira; y temperamento, lo cual replica sustancialmente los resultados de estudios previos realizados en América Latina con muestras hispanoparlantes. El modelo congenérico nos indica un ajuste adecuado para cada una de las subescalas de la ira y hostilidad. En base a los resultados del Análisis Factorial Confirmatorio realizado en el presente estudio, la estructura factorial de ambas escalas del Inventario Multicultural de la Ira y Hostilidad es robusta y demuestra sustancial evidencia empírica de validez de construcción y consistencia interna del instrumento.

A search for hot post-AGE stars in the IRAS Point Source Catalog

NARCIS (Netherlands)

Oudmaijer, RD

In this paper a first step is made to search for hot post-AGB stars in the IRAS Point Source Catalog. In order to find objects that evolved off the AGE a longer time ago than post-AGB objects discussed in the literature, objects that were not detected at 12 mu m by IRAS were selected. The selection

IRAS observations of the Pleiades

Science.gov (United States)

Cox, P.; he ultraviolet.

1987-01-01

The Infrared Astronomy Satellite (IRAS) observations of the Pleiades region are reported. The data show large flux densities at 12 and 25 microns, extended over the optical nebulosity. This strong excess emission, implying temperatures of a few hundred degrees Kelvin, indicates a population of very small grains in the Pleiades. It is suggested that these grains are similar to the small grains needed to explain the surface brightness measurements made in the ultraviolet.

IRAS observations of the Pleiades

International Nuclear Information System (INIS)

Cox, P.; Leene, A.

1987-01-01

The Infrared Astronomy Satellite (IRAS) observations of the Pleiades region are reported. The data show large flux densities at 12 and 25 microns, extended over the optical nebulosity. This strong excess emission, implying temperatures of a few hundred degrees Kelvin, indicates a population of very small grains in the Pleiades. It is suggested that these grains are similar to the small grains needed to explain the surface brightness measurements made in the ultraviolet

IRAS colors of carbon stars - An optical spectroscopic test

International Nuclear Information System (INIS)

Cohen, M.; Wainscoat, R.J.; Walker, H.J.; Volk, K.; Schwartz, D.E.

1989-01-01

Optical spectra are obtained of 57 photographic counterparts to IRAS sources not previously studied spectroscopically, and expected on the basis of their IRAS colors to be M or C type stars. Confirmed carbon stars are found only in a restricted range of 12-25 index, and constitute a striking vertical sequence in the 12-25-60 micron color-color diagram. This sequence is in accord with evolutionary models for AGB stars that convert M into C stars by dredge-up, and follow loops in the color-color plane. Optically visible and optically invisible carbon stars occupy different color-color locations consistent with their representations of different evolutionary states in the life of relatively low-mass stars. 16 refs

Expresión de la ira y autoconcepto en adolescentes tempranos

Directory of Open Access Journals (Sweden)

Yuri Arsenio Sanz-Martínez

2012-01-01

Full Text Available Abordó la exploración de las implicaciones de las modalidades de expresión de la ira entre adolescentes tempranos de la zona oriental de Cuba. La muestra estuvo compuesta por 498 adolescentes tempranos de Holguín y Santiago de Cuba respectivamente. Se obtuvo que la expresión abierta, y destructiva de la ira correlacionó negativamente con el autoconcepto en dominios de la escuela y las relaciones con el sexo opuesto. La expresión inhibida o interiorizada de esta emoción predijo fuertemente aspectos del autoconcepto relacionados con el dominio de la escuela. La ira expresada de forma controlada, calmada y asertiva se relacionó fuertemente con el autoconcepto en dimensiones generales, del ámbito escolar, de las relaciones interpersonales y de cualidades de honestidad y seguridad. Se recomienda realizar estudios paralelos para obtener información en otras etapas del desarrollo humano.

IRAS variables as galactic structure tracers - Classification of the bright variables

Science.gov (United States)

Allen, L. E.; Kleinmann, S. G.; Weinberg, M. D.

1993-01-01

The characteristics of the 'bright infrared variables' (BIRVs), a sample consisting of the 300 brightest stars in the IRAS Point Source Catalog with IRAS variability index VAR of 98 or greater, are investigated with the purpose of establishing which of IRAS variables are AGB stars (e.g., oxygen-rich Miras and carbon stars, as was assumed by Weinberg (1992)). Results of the analysis of optical, infrared, and microwave spectroscopy of these stars indicate that, out of 88 stars in the BIRV sample identified with cataloged variables, 86 can be classified as Miras. Results of a similar analysis performed for a color-selected sample of stars, using the color limits employed by Habing (1988) to select AGB stars, showed that, out of 52 percent of classified stars, 38 percent are non-AGB stars, including H II regions, planetary nebulae, supergiants, and young stellar objects, indicating that studies using color-selected samples are subject to misinterpretation.

The infrared emission of carbonaceous particles around C-rich IRAS sources

International Nuclear Information System (INIS)

Blanco, A.; Borghesi, A.; Fonti, S.; Orofino, V.; Strafella, F.

1997-01-01

The IRAS spectra of 23 carbon-rich sources have been fitted by means of an improved theoretical model based on the Leung-Spagna radiative transfer code and using extinction data obtained in their laboratory for different types of amorphous carbon and silicon carbide submicron particles. The agreement between observations and theoretical spectra is rather good. A comparison between the IRAS spectrum of the object 12447 + 0425 (RU Vir) and that recently obtained at UKIRT, for the same object but with higher resolution, seems to open new problems

Warm water deuterium fractionation in IRAS 16293-2422

DEFF Research Database (Denmark)

Persson, Magnus Vilhelm; Jørgensen, Jes Kristian; van Dishoeck, E. F.

2013-01-01

observations reveal the physical and chemical structure of water vapor close to the protostars on solar-system scales. The red-shifted absorption detected toward source B is indicative of infall. The excitation temperature is consistent with the picture of water ice evaporation close to the protostar. The low......Context. Measuring the water deuterium fractionation in the inner warm regions of low-mass protostars has so far been hampered by poor angular resolution obtainable with single-dish ground- and space-based telescopes. Observations of water isotopologues using (sub)millimeter wavelength...... interferometers have the potential to shed light on this matter. Aims: To measure the water deuterium fractionation in the warm gas of the deeply-embedded protostellar binary IRAS 16293-2422. Methods: Observations toward IRAS 16293-2422 of the 53,2 - 44,1 transition of H218O at 692.07914 GHz from Atacama Large...

IRAS observations of the ISM in the gamma CAS reflection nebula

Science.gov (United States)

Buss, Richard H., Jr.; Werner, Michael W.

1990-01-01

Mid-infrared emission from other galaxies originates both from interstellar grains heated by diffuse starlight and local excitation of grains by hot OB stars. Thus, a detailed examination of the Infrared Astronomy Satellite (IRAS) data from a B star interacting with the interstellar medium (ISM) could provide insight into infrared (IR) emission processes in external galaxies. Researchers have therefore used IRAS data to study the B0 IVe star gamma Cas and its surroundings, which they find to exhibit evidence of grain heating, destruction, and possible star formation.

ESTUDIO DESCRIPTIVO CORRELACIONAL ENTRE IRA Y PERSONALIDAD A LA LUZ DE LA TEORÍA DE HANS EYSENCK

Directory of Open Access Journals (Sweden)

Clemencia Montaña de Barragán

2002-07-01

Full Text Available Este trabajo presenta una cuidadosa revisión teórica sobre el tema de la ira, su evaluación e intervención, relacionada muy directamente con la agresividad y teorías importantes de la personalidad, enfocándose principalmente a la teoría de H. Eysenck. Se aplicaron dos instrumentos, uno para medir ira (escala MAG de Ira y otro para medir dimensiones de personalidad Extroversión – Neuroticismo – Psicoticismo (EPQ-J, a 200 niños de ambos sexos, con edades comprendidas entre 9 y 11 años, en tres colegios de Santafé de Bogotá. Se realizó una aplicación piloto y validación por jueces para la Escala MAG de ira con el objetivo de verificar su efectividad, mostrando unos buenos resultados mediante una consistencia interna de 0.8236. Al relacionar esta dos pruebas se encontró que hay niveles muy significativos de correlación entre personalidad e ira, a la vez que hay buenas intercorrelaciones entre las dimensiones del EPQ-J. Se encontraron correlaciones significativas entre ira y conducta antisocial. El aporte del trabajo es la presentación de la escala MAG para aplicarla en población infantil.

NEBULAR EMISSION-LINES IN IRAS 10215-5916

NARCIS (Netherlands)

GARCIALARIO, P; MANCHADO, A; PARTHASARATHY, M; POTTASCH, [No Value

From low and high resolution spectroscopic observations of IRAS 10215 - 5916 we have discovered the presence of nebular emission lines in this G-type supergiant star in the post-AGB stage. From its high resolution spectrum we derived an expansion velocity of 17 km s-1 for the shell, similar to the

The Far-Field Hubble Constant

Science.gov (United States)

Lauer, Tod

1995-07-01

We request deep, near-IR (F814W) WFPC2 images of five nearby Brightest Cluster Galaxies (BCG) to calibrate the BCG Hubble diagram by the Surface Brightness Fluctuation (SBF) method. Lauer & Postman (1992) show that the BCG Hubble diagram measured out to 15,000 km s^-1 is highly linear. Calibration of the Hubble diagram zeropoint by SBF will thus yield an accurate far-field measure of H_0 based on the entire volume within 15,000 km s^-1, thus circumventing any strong biases caused by local peculiar velocity fields. This method of reaching the far field is contrasted with those using distance ratios between Virgo and Coma, or any other limited sample of clusters. HST is required as the ground-based SBF method is limited to team developed the SBF method, the first BCG Hubble diagram based on a full-sky, volume-limited BCG sample, played major roles in the calibration of WFPC and WFPC2, and are conducting observations of local galaxies that will validate the SBF zeropoint (through GTO programs). This work uses the SBF method to tie both the Cepheid and Local Group giant-branch distances generated by HST to the large scale Hubble flow, which is most accurately traced by BCGs.

Insights into the working mechanism of water filtered infrared A (wIRA) irradiation on Chlamydia trachomatis serovar E

Science.gov (United States)

Kuratli, Jasmin; Pesch, Theresa; Marti, Hanna; Blenn, Christian; Borel, Nicole

2018-02-01

Infections with Chlamydia trachomatis are the major cause for infectious blindness and still represent the most common bacterial sexually transmitted disease worldwide. Considering the possible side effects of antibiotic therapy and the increasing threat of antibiotic resistance, alternative therapeutic strategies are needed. Previous studies showed a reduction of C. trachomatis infectivity after irradiation with water filtered infrared A alone (wIRA) or in combination with visible light (wIRA/VIS). In this study, we aimed to gain further insight into the working mechanism of wIRA/VIS by analyzing cytokine and chemokine levels of infected and non-infected HeLa cells following triple dose irradiation at 24, 36 and 40 hours post infection. Subsequently, we examined the influence of cytokines on irradiation and chlamydial infection using a cytokine/chemokine inhibitor (Azelastine) and by IL-6 and IL-8 gene silencing. A triple dose irradiation significantly reduced chlamydial infectivity in HeLa cells without inducing the chlamydial stress response. The reducing effect was present regardless of the addition of cycloheximide (CHX), a host protein synthesis inhibitor. Chlamydial infection, wIRA/VIS treatment and the combination of both revealed a similar release pattern of a subset of pro-inflammatory cytokines (IL-6, IL-8, RANTES, Serpin E1). The addition of Azelastine induced the chlamydial stress response in non-irradiated samples. This effect was even more pronounced in wIRA/VIS-treated conditions. Silencing of IL-6 and IL-8 resulted in a lower chlamydial infectivity. However, wIRA/VIS treatment of infected and silenced cells reduced the chlamydial infectivity similar to wIRA/VIS treated control cells. Further studies are needed to elucidate the working mechanism of wIRA/VIS.

Radio and optical studies of high luminosity Iras galaxies

International Nuclear Information System (INIS)

Wolstencroft, R.D.; Parker, Q.A.; Savage, A.; MacGillivray, H.T.; Leggett, S.K.; Clowes, R.G.; Unger, S.W.; Pedlar, A.; Heasley, J.N.; Menzies, J.W.

1987-01-01

Follow-up observations of a complete sample of 154 IRAS galaxies, optically identified down to B=21, indicate that between 3 and 9% of the sample are ultraluminous depending on the choice of H 0 . VLA observations at 20 cm of the complete sample indicate that 85% are detected above 1mJy and for the most part the radio emission is centrally concentrated. The tight linear relation between radio and infrared luminosities is valid at the highest luminosities. Of the 11 most luminous objects one is a quasar: it fits the radio infrared relation very well which suggests that the infrared and radio emission has the same origin as in the other IRAS galaxies, ie. it probably originates primarily in regions of star formation in the host galaxy. The other 10 very luminous galaxies are either close but resolved mergers or double galaxies, presumably interacting. Radio observations of the 10 original empty field sources in our sample with no optical counterpart (B ≤ 21) allow us to conclude that 4 of these are fainter galaxies just outside the IRAS error ellipse with high values of L IR /L B . One other object, with a radio source at the edge of the error ellipse but no optical counterpart brighter than B = 23, may prove to be a highly luminous galaxy with L IR /L B > ∼ 1250

The peculiar acceleration of the Local Group as deduced from the optical and IRAS flux dipoles

International Nuclear Information System (INIS)

Lahav, O.; Lynden-Bell, D.

1988-01-01

The relation between the peculiar acceleration of the Local Group and the surface brightness dipole moments of all-sky optical and IRAS samples is studied. Our revised optical dipole lies within 7 0 of the direction of the Local Group's motion through the Microwave Background Radiation (MBR). The directions of the optical, IRAS and MBR dipoles are all consistent with each other. To analyse the optical dipole we have calculated diameter functions for the UGC and ESO galaxy catalogues from redshift surveys. Most of the optical dipole arises from the Centaurus-Virgo direction and from the 'Local Void' on the opposite side of the sky. The sources of the IRAS dipole are more evenly distributed around the sky. A simple 'shell model', fitted to the variation of the dipoles as a function of flux, suggests that the dipoles arise from galaxies whose recession velocities are smaller than 4000 kms -1 . We find a high Ω 0 value for the IRAS sample and a low one for the optical sample. These results may be reconciled if the optical galaxy distribution is more biased relative to the matter distribution than the IRAS galaxy distribution. (author)

Estrategias terapéuticas e intelectualismo en el De ira de Séneca

Directory of Open Access Journals (Sweden)

Rodrigo Sebastián Braicovich

2015-01-01

Full Text Available Pretendo demostrar que a el tratado De IRA de Séneca incluye no una sino dos estrategias terapéuticas diseñadas para evitar la ira, y que b que la segunda de estasestrategiasla cual ha sido desatendida en la literatura secundaria– presenta problemas irresolubles cuando la contrastamos contra la teoría estoica de la acción, lacual se funda en premisas intelectualistas.

Radiation effects in IRAS extrinsic infrared detectors

Science.gov (United States)

Varnell, L.; Langford, D. E.

1982-01-01

During the calibration and testing of the Infrared Astronomy Satellite (IRAS) focal plane, it was observed that the extrinsic photoconductor detectors were affected by gamma radiation at dose levels of the order of one rad. Since the flight environment will subject the focal plane to dose levels of this order from protons in single pass through the South Atlantic Anomaly, an extensive program of radiation tests was carried out to measure the radiation effects and to devise a method to counteract these effects. The effects observed after irradiation are increased responsivity, noise, and rate of spiking of the detectors after gamma-ray doses of less than 0.1 rad. The detectors can be returned almost to pre-irradiation performance by increasing the detector bias to breakdown and allowing a large current to flow for several minutes. No adverse effects on the detectors have been observed from this bias boost, and this technique will be used for IRAS with frequent calibration to ensure the accuracy of observations made with the instrument.

BRDF measurements of sunshield and baffle materials for the IRAS telescope

Science.gov (United States)

Smith, S. M.

1982-01-01

Measurements of the far-infrared bidirectional reflectance distribution functions (BRDF) of four samples of Martin Black coating and one sample of gold coated aluminum from the telescope to be flown on the Infrared Astronomy Satellite (IRAS) are presented. At incidence angles near 35 deg Martin Black is a diffuse reflector at wavelengths as long as 36 microns. The gold coated aluminum sample from the IRAS sunshield has a visible grain which causes a strong diffraction enhancement of the BRDF at large nonspecular angles. This enhancement from the sunshield will increase the stray light level inside the telescope.

OH masers associated with IRAS point sources

NARCIS (Netherlands)

Masheder, MRW; Cohen, RJ; Martin-Hernandez, NL; Migenes,; Reid, MJ

2002-01-01

We report a search for masers from the Lambda-doublet of the ground-state of OH at 18cm, carried out with the Jodrell Bank Lovell Telescope and with the 25m Dwingeloo telescope. All objects north of delta = -20degrees which appear in the IRAS Point Source Catalog with fluxes > 1000 Jy at 60mum and

IRAS 17423-1755 (HEN 3-1475) REVISITED: AN O-RICH HIGH-MASS POST-ASYMPTOTIC GIANT BRANCH STAR

International Nuclear Information System (INIS)

Manteiga, M.; GarcIa-Hernandez, D. A.; Manchado, A.; Ulla, A.; GarcIa-Lario, P.

2011-01-01

The high-resolution (R ∼ 600) Spitzer/IRS spectrum of the bipolar protoplanetary nebula (PN) IRAS 17423-1755 is presented in order to clarify the dominant chemistry (C-rich versus O-rich) of its circumstellar envelope as well as to constrain its evolutionary stage. The high-quality Spitzer/IRS spectrum shows weak 9.7 μm absorption from amorphous silicates. This confirms for the first time the O-rich nature of IRAS 17423-1755 in contradiction to a previous C-rich classification, which was based on the wrong identification of the strong 3.1 μm absorption feature seen in the Infrared Space Observatory spectrum as due to acetylene (C 2 H 2 ). The high-resolution Spitzer/IRS spectrum displays a complete lack of C-rich mid-IR features such as molecular absorption features (e.g., 13.7 μm C 2 H 2 , 14.0 μm HCN, etc.) or the classical polycyclic aromatic hydrocarbon infrared emission bands. Thus, the strong 3.1 μm absorption band toward IRAS 17423-1755 has to be identified as water ice. In addition, an [Ne II] nebular emission line at 12.8 μm is clearly detected, indicating that the ionization of its central region may be already started. The spectral energy distribution in the infrared (∼2-200 μm) and other observational properties of IRAS 17423-1755 are discussed in comparison with the similar post-asymptotic giant branch (AGB) objects IRAS 19343+2926 and IRAS 17393-2727. We conclude that IRAS 17423-1755 is an O-rich high-mass post-AGB object that represents a link between OH/IR stars with extreme outflows and highly bipolar PN.

Análisis de la ira en pacientes con cardiopatía isquémica de la ciudad de Medellín (Colombia

Directory of Open Access Journals (Sweden)

Andrea Ochoa Ochoa

2010-01-01

Full Text Available Este estudio tuvo como objetivo comparar los niveles de ira, y sus componentes, entre un grupo de personas con Cardiopatía Isquémica y un grupo control sin esta enfermedad. Participaron 90 pacientes con cardiopatía isquémica de la Clínica Cardiovascular en Medellín y 78 controles sin la enfermedad. A cada uno de los participantes de les administró la prueba del STAXI- 2. Los resultados muestran que, comparado con los controles, los pacientes con cardiopatía isquémica tuvieron niveles significativamente más altos de ira como rasgo (p < 0.01, específicamente en la subescala reacción de ira (p < 0.05, y expresión interna de ira (p < 0.05. Los pacientes con cardiopatía isquémica experimentan más frecuentemente sentimientos de ira (ira rasgo, aparentemente debido a que son más sensibles a las críticas de los demás (reacción de ira, pero tienden a suprimir la expresión de esta emoción (expresión de ira interna. Estos datos confirman la necesidad de implementar programas dirigidos al manejo adecuado de la ira en estos pacientes y entender mejor las implicaciones que pueda tener la ira en la progresión de su enfermedad.

IRAS 18113-2503: THE WATER FOUNTAIN WITH THE FASTEST JET?

International Nuclear Information System (INIS)

Gomez, Jose F.; Guerrero, MartIn A.; Ricardo Rizzo, J.; Suarez, Olga; Miranda, Luis F.; Ramos-Larios, Gerardo

2011-01-01

We present Expanded Very Large Array water maser observations at 22 GHz toward the source IRAS 18113-2503. Maser components span over a very high velocity range of ≅ 500 km s -1 , the second largest found in a Galactic maser, only surpassed by the high-mass star-forming region W49N. Maser components are grouped into a blueshifted and a redshifted cluster, separated by 0.''12. Further mid-IR and radio data suggest that IRAS 18113-2503 is a post-asymptotic giant branch star, thus a new bona fide member of the rare class of 'water fountains' (WFs). It is the evolved object with the largest total velocity spread in its water masers and with the highest velocity dispersion within its redshifted and blueshifted lobes (≅ 170 km s -1 ). The large total velocity range of emission probably indicates that IRAS 18113-2503 has the fastest jet among the known WF stars. On the other hand, the remarkably high velocity dispersion within each lobe may be interpreted in terms of shocks produced by an episode of mass ejection whose velocity increased up to very high values or, alternatively, by projection effects in a jet with a large opening angle and/or precessing motions.

Estudio descriptivo correlacional entre ira y personalidad, a la luz de la teoría de Hans Eysenck

Directory of Open Access Journals (Sweden)

Clemencia Montaña de Barragán

2002-01-01

Full Text Available Este trabajo presenta una cuidadosa revisión teórica sobre el tema de la ira, su evaluación e intervención, relacionada muy directamente con la agresividad y teorías importantes de la personalidad, enfocándose principalmente a la teoría de H. Eysenck. Se aplicaron dos instrumentos, uno para medir ira (escala MAG de Ira y otro para medir dimensiones de personalidad Extroversión – Neuroticismo – Psicoticismo (EPQ-J, a 200 niños de ambos sexos, con edades comprendidas entre 9 y 11 años, en tres colegios de Santafé de Bogotá. Se realizó una aplicación piloto y validación por jueces para la Escala MAG de ira con el objetivo de verificar su efectividad, mostrando unos buenos resultados mediante una consistencia interna de 0.8236. Al relacionar esta dos pruebas se encontró que hay niveles muy significativos de correlación entre personalidad e ira, a la vez que hay buenas intercorrelaciones entre las dimensiones del EPQ-J. Se encontraron correlaciones significativas entre ira y conducta antisocial. El aporte del trabajo es la presentación de la escala MAG para aplicarla en población infantil

Optical identifications of IRAS point sources: the Fornax, Hydra I and Coma clusters

International Nuclear Information System (INIS)

Wang, G.; Leggett, S.K.; Savage, A.

1991-01-01

We present optical identifications for 66 IRAS point sources in the region of the Fornax cluster of galaxies, 106 IRAS point sources in the region of the Hydra I cluster of galaxies (Abell 1060) and 59 IRAS point sources in the region of the Coma cluster of galaxies (Abell 1656). Eight other sources in Hydra I do not have optical counterparts and are very probably due to infrared cirrus. Twenty-three (35 per cent) of the Fornax sources are associated with stars and 43 (65 per cent) with galaxies; 48 (42 per cent) of the Hydra I sources are associated with stars and 58 (51 per cent) with galaxies; 18 (31 per cent) of the Coma sources are associated with stars and 41 (69 per cent) with galaxies. The stellar and infrared cirrus surface density is consistent with the galactic latitude of each field. (author)

Unidentified point sources in the IRAS minisurvey

Science.gov (United States)

Houck, J. R.; Soifer, B. T.; Neugebauer, G.; Beichman, C. A.; Aumann, H. H.; Clegg, P. E.; Gillett, F. C.; Habing, H. J.; Hauser, M. G.; Low, F. J.

1984-01-01

Nine bright, point-like 60 micron sources have been selected from the sample of 8709 sources in the IRAS minisurvey. These sources have no counterparts in a variety of catalogs of nonstellar objects. Four objects have no visible counterparts, while five have faint stellar objects visible in the error ellipse. These sources do not resemble objects previously known to be bright infrared sources.

Finding charts for southern IRAS galaxies

International Nuclear Information System (INIS)

Sutherland, W.J.; Maddox, S.J.; Saunders, W.

1991-01-01

Using the APM Galaxy Survey, we have generated a collection of finding charts for 4614 sources with non-stellar colours in the IRAS Faint Source Catalogue south of δ= -17.5 o . Over 90 per cent of the sources are reliably identified with an optical object, and we provide 1-arcsec positions and B J magnitudes for these. We will provide paper copies of the charts on request, at a small charge to cover photocopying costs. (author)

New CO and HCN sources associated with IRAS carbon stars

Science.gov (United States)

NGUYEN-Q-RIEU; Epchtein, N.; TRUONG-BACH; Cohen, M.

1987-01-01

Emission of CO and HCN was detected in 22 out of a sample of 53 IRAS sources classified as unidentified carbon-rich objects. The sample was selected according to the presence of the silicon carbide feature as revealed by low-resolution spectra. The molecular line widths indicate that the CO and HCN emission arises from the circumstellar envelopes of very highly evolved stars undergoing mass loss. The visible stars tend to be deficient in CO as compared with unidentified sources. Most the detected CO and HCN IRAS stars are distinct and thick-shelled objects, but their infrared and CO luminosities are similar to those of IRC + 102156 AFGL and IRC-CO evolved stars. The 12 micron flux seems to be a good indicator of the distance, hence a guide for molecular searches.

Changes of MMP-1 and collagen type Ialpha1 by UVA, UVB and IRA are differentially regulated by Trx-1.

Science.gov (United States)

Buechner, Nicole; Schroeder, Peter; Jakob, Sascha; Kunze, Kerstin; Maresch, Tanja; Calles, Christian; Krutmann, Jean; Haendeler, Judith

2008-07-01

Exposure of human skin to solar radiation, which includes ultraviolet (UV) radiation (UVA and UVB) visible light and infrared radiation, induces skin aging. The effects of light have been attributed to irradiation-induced reactive oxygen species (ROS) formation, but the specific signaling pathways are not well understood. Detrimental effects of solar radiation are dermal diseases and photoaging. Exposure of cultured human dermal fibroblasts to UVA, UVB or IRA increased ROS formation in vitro. One important redox regulator is the oxidoreductase thioredoxin-1 (Trx). Trx is ubiquitously expressed and has anti-oxidative and anti-apoptotic properties. Besides its function to reduce H(2)O(2), Trx binds to and regulates transcription factors. The aim of this study was to investigate whether Trx influences the regulation of MMP-1 and collagen Ialpha1 by UVA, UVB and IRA. We irradiated human dermal fibroblasts with UVA, UVB and IRA. UVA, UVB and IRA upregulated MMP-1 expression. Trx inhibited UVA-induced MMP-1 upregulation in a NFkappaB dependent manner. UVA, UVB and IRA reduced collagen Ialpha1 expression. Incubation with Trx inhibited the effects of UVB and IRA on collagen Ialpha1 expression. In conclusion, MMP-1 and collagen Ialpha1, which play important roles in aging processes, seems to be regulated by different transcriptional mechanisms and Trx can only influence distinct signaling pathways induced by UVA, UVB and probably IRA. Thus, Trx may serve as an important contributor to an "anti-aging therapeutic cocktail".

Complex molecules in the hot core of the low-mass protostar NGC 1333 IRAS 4A

NARCIS (Netherlands)

Bottinelli, S; Ceccarelli, C; Lefloch, B; Williams, JP; Castets, A; Caux, E; Cazaux, S; Maret, S; Parise, B; Tielens, AGGM

2004-01-01

We report the detection of complex molecules (HCOOCH3, HCOOH, and CH3CN), signposts of a hot core like region, toward the low-mass Class 0 source NGC 1333 IRAS 4A. This is the second low-mass protostar in which such complex molecules have been searched for and reported, the other source being IRAS

Dialogic & Critical Pedagogies: An Interview with Ira Shor

Science.gov (United States)

Shor, Ira; Matusov, Eugene; Marjanovic-Shane, Ana; Cresswel, lJames

2017-01-01

In 2016, the Main Editors of "Dialogic Pedagogy Journal" issued a call for papers and contributions to a wide range of dialogic pedagogy scholars and practitioners. One of the scholars who responded to our call is famous American educator Ira Shor, a professor at the College of Staten Island, City University of New York. Shor has been…

A Unique test for Hubble's new Solar Arrays

Science.gov (United States)

2000-10-01

In mid-October, a team from the European Space Agency (ESA) and NASA will perform a difficult, never-before-done test on one of the Hubble Space Telescope's new solar array panels. Two of these panels, or arrays, will be installed by astronauts in November 2001, when the Space Shuttle Columbia visits Hubble on a routine service mission. The test will ensure that the new arrays are solid and vibration free before they are installed on orbit. The test will be conducted at ESA's European Space Research and Technology Center (ESTEC) in Noordwijk, The Netherlands. Because of the array's size, the facility's special features, and ESA's longstanding experience with Hubble's solar arrays, ESTEC is the only place in the world the test can be performed. This test is the latest chapter in a longstanding partnership between ESA and NASA on the Hubble Space Telescope. The Large Space Simulator at ESTEC, ESA's world-class test facility, features a huge vacuum chamber containing a bank of extremely bright lights that simulate the Sun's intensity - including sunrise and sunset. By exposing the solar wing to the light and temperature extremes of Hubble's orbit, engineers can verify how the new set of arrays will act in space. Hubble orbits the Earth once every 90 minutes. During each orbit, the telescope experiences 45 minutes of searing sunlight and 45 minutes of frigid darkness. This test will detect any tiny vibrations, or jitters, caused by these dramatic, repeated changes. Even a small amount of jitter can affect Hubble's sensitive instruments and interfere with observations. Hubble's first set of solar arrays experienced mild jitter and was replaced in 1993 with a much more stable pair. Since that time, advances in solar cell technology have led to the development of even more efficient arrays. In 2001, NASA will take advantage of these improvements, by fitting Hubble with a third-generation set of arrays. Though smaller, this new set generates more power than the previous

THE VLA NASCENT DISK AND MULTIPLICITY (VANDAM) SURVEY OF PERSEUS PROTOSTARS. RESOLVING THE SUB-ARCSECOND BINARY SYSTEM IN NGC 1333 IRAS2A

International Nuclear Information System (INIS)

Tobin, John J.; Looney, Leslie W.; Dunham, Michael M.; Li, Zhi-Yun; Chandler, Claire J.; Perez, Laura M.; Segura-Cox, Dominique; Harris, Robert J.; Hull, Charles L. H.; Sadavoy, Sarah I.; Melis, Carl; Kratter, Kaitlin; Jørgensen, Jes K.; Plunkett, Adele L.

2015-01-01

We are conducting a Jansky Very Large Array (VLA) Ka-band (8 mm and 1 cm) and C-band (4 cm and 6.4 cm) survey of all known protostars in the Perseus Molecular Cloud, providing resolution down to ∼0.''06 and ∼0.''35 in the Ka band and C band, respectively. Here we present first results from this survey that enable us to examine the source NGC 1333 IRAS2A in unprecedented detail and resolve it into a protobinary system separated by 0.''621 ± 0.''006 (∼143 AU) at 8 mm, 1 cm, and 4 cm. These two sources (IRAS2A VLA1 and VLA2) are likely driving the two orthogonal outflows known to originate from IRAS2A. The brighter source IRAS2A VLA1 is extended perpendicular to its outflow in the VLA data, with a deconvolved size of 0.''055 (∼13 AU), possibly tracing a protostellar disk. The recently reported candidate companions (IRAS2A MM2 and MM3) are not detected in either our VLA data, Combined Array for Research in Millimeter-wave Astronomy (CARMA) 1.3 mm data, or Submillimeter Array (SMA) 850 μm data. SMA CO (J = 3 → 2), CARMA CO (J = 2 → 1), and lower-resolution CARMA CO (J = 1 → 0) observations are used to examine the outflow origins and the nature of the candidate companions to IRAS2A VLA1. The CO (J = 3 → 2) and (J = 2 → 1) data show that IRAS2A MM2 is coincident with a bright CO emission spot in the east-west outflow, and IRAS2A MM3 is within the north-south outflow. In contrast, IRAS2A VLA2 lies at the east-west outflow symmetry point. We propose that IRAS2A VLA2 is the driving source of the east-west outflow and a true companion to IRAS2A VLA1, whereas IRAS2A MM2 and MM3 may not be protostellar

THE VLA NASCENT DISK AND MULTIPLICITY (VANDAM) SURVEY OF PERSEUS PROTOSTARS. RESOLVING THE SUB-ARCSECOND BINARY SYSTEM IN NGC 1333 IRAS2A

Energy Technology Data Exchange (ETDEWEB)

Tobin, John J.; Looney, Leslie W. [National Radio Astronomy Observatory, Charlottesville, VA 22903 (United States); Dunham, Michael M. [Harvard-Smithsonian Center for Astrophysics, Cambridge, MA 02138 (United States); Li, Zhi-Yun [Department of Astronomy, University of Virginia, Charlottesville, VA 22903 (United States); Chandler, Claire J.; Perez, Laura M. [National Radio Astronomy Observatory, Socorro, NM 87801 (United States); Segura-Cox, Dominique; Harris, Robert J.; Hull, Charles L. H. [Department of Astronomy, University of Illinois, Urbana, IL 61801 (United States); Sadavoy, Sarah I. [Max-Planck-Institut für Astronomie, D-69117 Heidelberg (Germany); Melis, Carl [Center for Astrophysics and Space Sciences, University of California, San Diego, CA 92093 (United States); Kratter, Kaitlin [Steward Observatory, University of Arizona, Tucson, AZ 85721 (United States); Jørgensen, Jes K. [Niels Bohr Institute, University of Copenhagen, Juliane Maries Vej 30, DK-2100 Copenhagen Ø. (Denmark); Plunkett, Adele L., E-mail: jtobin@nrao.edu, E-mail: jeskj@nbi.dk [Department of Astronomy, Yale University, New Haven, CT 06520 (United States)

2015-01-01

We are conducting a Jansky Very Large Array (VLA) Ka-band (8 mm and 1 cm) and C-band (4 cm and 6.4 cm) survey of all known protostars in the Perseus Molecular Cloud, providing resolution down to ∼0.''06 and ∼0.''35 in the Ka band and C band, respectively. Here we present first results from this survey that enable us to examine the source NGC 1333 IRAS2A in unprecedented detail and resolve it into a protobinary system separated by 0.''621 ± 0.''006 (∼143 AU) at 8 mm, 1 cm, and 4 cm. These two sources (IRAS2A VLA1 and VLA2) are likely driving the two orthogonal outflows known to originate from IRAS2A. The brighter source IRAS2A VLA1 is extended perpendicular to its outflow in the VLA data, with a deconvolved size of 0.''055 (∼13 AU), possibly tracing a protostellar disk. The recently reported candidate companions (IRAS2A MM2 and MM3) are not detected in either our VLA data, Combined Array for Research in Millimeter-wave Astronomy (CARMA) 1.3 mm data, or Submillimeter Array (SMA) 850 μm data. SMA CO (J = 3 → 2), CARMA CO (J = 2 → 1), and lower-resolution CARMA CO (J = 1 → 0) observations are used to examine the outflow origins and the nature of the candidate companions to IRAS2A VLA1. The CO (J = 3 → 2) and (J = 2 → 1) data show that IRAS2A MM2 is coincident with a bright CO emission spot in the east-west outflow, and IRAS2A MM3 is within the north-south outflow. In contrast, IRAS2A VLA2 lies at the east-west outflow symmetry point. We propose that IRAS2A VLA2 is the driving source of the east-west outflow and a true companion to IRAS2A VLA1, whereas IRAS2A MM2 and MM3 may not be protostellar.

A highly embedded protostar in SFO 18: IRAS 05417+0907

Science.gov (United States)

Saha, Piyali; Gopinathan, Maheswar; Puravankara, Manoj; Sharma, Neha; Soam, Archana

2018-04-01

Bright-rimmed clouds, located at the periphery of relatively evolved HIT regions, are considered to be the sites of star formation possibly triggered by the implosion caused due to the ionizing radiation from nearby massive stars. SFO 18 is one such region showing a bright-rim on the side facing the 0-type star, A Ori. A point source, IRAS 05417+0907, is detected towards the high density region of the cloud. A molecular outflow has been found to be associated with the source. The outflow is directed towards a Herbig-Haro object, HH 175. From the Spitzer and WISE observations, we show evidence of a physical connection between the molecular outflow, IRAS 05417+0907 and the HH object. The spectral energy distribution constructed using multi-wavelength data shows that the point source is most likely a highly embedded protostar.

A catalog of pre-main-sequence emission-line stars with IRAS source associations

International Nuclear Information System (INIS)

Weintraub, D.A.

1990-01-01

To aid in finding premain-sequence (PMS) emission-line stars that might have dusty circumstellar environments, 361 PMS stars that are associated with 304 separate IRAS sources were identified. These stars include 200 classical T Tauri stars, 25 weak-lined (naked) T Tauri stars, 56 Herbig Ae/Be stars, six FU Orionis stars, and two SU Aurigae stars. All six of the FU Orionis stars surveyed by IRAS were detected. Of the PMS-IRAS Point Source Catalog (PSC) associations, 90 are new and are not noted in the PSC. The other 271 entries include 104 that are correctly identified in the PSC but have not yet appeared in the literature, 56 more that can be found in both the PSC and in the published and unpublished iterature, and 111 that are in the literature but not in the PSC. Spectral slope diagrams constructed from the 12-, 25-, and 60-micron flux densities reveal unique distributions for the different PMS subclasses; these diagrams may help identify the best candidate PMS stars for observations of circumstellar dust. 30 refs

Dark Energy and the Hubble Law

Science.gov (United States)

Chernin, A. D.; Dolgachev, V. P.; Domozhilova, L. M.

The Big Bang predicted by Friedmann could not be empirically discovered in the 1920th, since global cosmological distances (more than 300-1000 Mpc) were not available for observations at that time. Lemaitre and Hubble studied receding motions of galaxies at local distances of less than 20-30 Mpc and found that the motions followed the (nearly) linear velocity-distance relation, known now as Hubble's law. For decades, the real nature of this phenomenon has remained a mystery, in Sandage's words. After the discovery of dark energy, it was suggested that the dynamics of local expansion flows is dominated by omnipresent dark energy, and it is the dark energy antigravity that is able to introduce the linear velocity-distance relation to the flows. It implies that Hubble's law observed at local distances was in fact the first observational manifestation of dark energy. If this is the case, the commonly accepted criteria of scientific discovery lead to the conclusion: In 1927, Lemaitre discovered dark energy and Hubble confirmed this in 1929.

Galaxy evolution and large-scale structure in the far-infrared. I. IRAS pointed observations

International Nuclear Information System (INIS)

Lonsdale, C.J.; Hacking, P.B.

1989-01-01

Redshifts for 66 galaxies were obtained from a sample of 93 60-micron sources detected serendipitously in 22 IRAS deep pointed observations, covering a total area of 18.4 sq deg. The flux density limit of this survey is 150 mJy, 4 times fainter than the IRAS Point Source Catalog (PSC). The luminosity function is similar in shape with those previously published for samples selected from the PSC, with a median redshift of 0.048 for the fainter sample, but shifted to higher space densities. There is evidence that some of the excess number counts in the deeper sample can be explained in terms of a large-scale density enhancement beyond the Pavo-Indus supercluster. In addition, the faintest counts in the new sample confirm the result of Hacking et al. (1989) that faint IRAS 60-micron source counts lie significantly in excess of an extrapolation of the PSC counts assuming no luminosity or density evolution. 81 refs

IRAS low-resolution spectra of galaxies

International Nuclear Information System (INIS)

Cohen, M.; Volk, K.

1989-01-01

The spectra of external galaxies are selected and extracted from the IRAS LRS database. Twenty-one objects present viable spectra. One is a peculiar star-forming E-S0 galaxy. The remainder are all starburst or H II region galaxies. Their average spectrum demonstrates the importance of the PAH emission bands in the 8-23-micron region and reinforces the conclusion reached from ground-based spectra, that there is a strong correlation between the PAH bands and the starburst or H II region character of a galaxy. 32 refs

Expresión de la ira en adolescentes holguineros. Repercusión psicológica y diferencias de género

Directory of Open Access Journals (Sweden)

Yuri Arsenio Sanz Martínez

2006-01-01

Full Text Available Aborda el proceso de validación de dos instrumentos diagnósticos: Escala Pediátrica de la Expresión de la Ira y Juego Clase, aplicados a un grupo de adolescentes tempranos. Se obtiene que ambos instrumentos poseen índices aceptables y altos de confiabilidad y se reporta validez de constructo. Se comprueba que los adolescentes que externalizan la ira emiten menos comportamientos prosociales que aquellos que la manejan de forma controlada, quienes son más sociables, aceptados, y tienen más amigos. Los adolescentes que reprimen su ira son los que menos comportamientos prosociales emiten. Los varones expresan de forma más abierta su ira que las hembras.

Hubble expansion in a Euclidean framework

International Nuclear Information System (INIS)

Alfven, H.

1979-01-01

There now seems to be strong evidence for a non-cosmological interpretation of the QSO redshift - in any case, so strong that it is of interest to investigate the consequences. The purpose of this paper is to construct a model of the Hubble expansion which is as far as possible from the conventional Big Bang model without coming in conflict with any well-established observational results (while introducing no new laws of physics). This leads to an essentially Euclidean metagalactic model (see Table I) with very little mass outside one-third or half of the Hubble radius. The total kinetic energy of the Hubble expansion need only to be about 5% of the rest mass energy. Present observations support backwards in time extrapolation of the Hubble expansion to a 'minimum size galaxy' Rsub(m), which may have any value in 0 26 cm. Other arguments speak in favor of a size close to the upper value, say Rsub(m) = 10 26 cm (Table II). As this size is probably about 100 times the Schwarzschild limit, an essentially Euclidean description is allowed. The kinetic energy of the Hubble expansion may derive from an intense QSO-like activity in the minimum size metagalaxy, with an energy release corresponding to the annihilation of a few solar masses per galaxy per year. Some of the conclusions based on the Big Bang hypothesis are criticized and in several cases alternative interpretations are suggested. A comparison between the Euclidean and the conventional models is given in Table III. (orig.)

HST's 10th anniversary, ESA and Hubble : changing our vision

Science.gov (United States)

2000-04-01

With the astronauts who took part in the most recent Servicing Mission (SM3A) in attendance, ESA is taking the opportunity to give a - first - complete overview of Europe's major contribution to the HST mission. It will also review the first ten years of operations and the outstanding results that have "changed our vision" of the cosmos. A new fully European outreach initiative - the "European Space Agency Hubble Information Centre" - will be presented and officially launched; it has been set up by ESA to provide information on Hubble from a European perspective. A public conference will take place in the afternoon to celebrate Hubble's achievements midway through its life. Ten years of outstanding performance Launched on 24 April 1990, Hubble is now midway through its operating life and it is considered one of the most successful space science missions ever. So far more than 10,000 scientific papers based on Hubble results have been published and European scientists have contributed to more than 25% of these. Not only has Hubble produced a rich harvest of scientific results, it has impressed the man in the street with its beautiful images of the sky. Thousands of headlines all over the world have given direct proof of the public's great interest in the mission - 'The deepest images ever', 'The sharpest view of the Universe', 'Measurements of the earliest galaxies' and many others, all reflecting Hubble's performance as a top-class observatory. The Servicing Missions that keep the observatory and its instruments in prime condition are one of the innovative ideas behind Hubble. Astronauts have serviced Hubble three times, and ESA astronauts have taken part in two of these missions. Claude Nicollier (CH) worked with American colleagues on the First Servicing Mission, when Hubble's initial optical problems were repaired. On the latest, Servicing Mission 3A, both Claude Nicollier and Jean-François Clervoy (F) were members of the crew. Over the next 10 years European

Search for brown dwarfs in the IRAS data bases

International Nuclear Information System (INIS)

Low, F.J.

1986-01-01

A report is given on the initial searches for brown dwarf stars in the IRAS data bases. The paper was presented to the workshop on 'Astrophysics of brown dwarfs', Virginia, USA, 1985. To date no brown dwarfs have been discovered in the solar neighbourhood. Opportunities for future searches with greater sensitivity and different wavelengths are outlined. (U.K.)

IRAS constraints on a cold cloud around the solar system

International Nuclear Information System (INIS)

Aumann, H.H.; Good, J.C.

1990-01-01

IRAS 60- and 100-micron observations of G-stars in the solar neighborhood indicate that the typical G star is surrounded by a cold cloud. The assumption that the sun is archetypical requires that a cloud of typical G star extent and temperature surrounds our solar system. IRAS ecliptic plane scans, which are dominated by a 40-deg wide band of zodiacal dust, asteroid debris trails, and the Galactic plane, are consistent with a larger than typical G star cold cloud. Consistency with the typical G star and the direct observations constrain the width of the cold cloud perpendicular to the ecliptic plane to be larger than 5 deg. The 100-150 AU radius of this cloud is larger, but not inconsistent with the inner boundary of a cloud of comets, postulated previously at a radius of 50 AU based on Neptune orbital perturbations and models of short period comets. 17 refs

IRAS surface brightness maps of visible reflection nebulae: evidence for non-equilibrium infrared emission

International Nuclear Information System (INIS)

Castelaz, M.W.; Werner, M.W.; Sellgren, K.

1986-01-01

Surface brightness maps at 12, 25, 60, and 100 microns of 16 visible reflection nebulae were extracted from the Infrared Astronomy Satellite (IRAS) database. The maps were produced by coadding IRAS survey scans over areas centered on the illuminating stars, and have spatial resolutions of 0.9' x 4' at 12 and 25 microns, 1.8' x 4.5' at 60 microns, and 3.6' x 5' at 100 microns. Extended emission in the four IRAS bandpasses was detected in fourteen of the reflection nebulae. The IRAS data were used to measure the flux of the infrared emission associated with each source. The energy distributions show that the 12 micron flux is greater than the 25 micron flux in 11 of the nebulae, and the peak flux occurs in the 60 or 100 micron bandpass in all 16 nebular. The 60 and 100 micron flux can be approximated by blackbodies with temperatures between 30 and 50 K, consistent with temperatures expected from extrapolation of greybody fits to the 60 and 100 micron data. The excess 12 and 25 micron emission is attributed to a nonequilibrium process such as emission from thermal fluctuations of very small grains excited by single ultraviolet photons, or emission from polycyclic aromatic hydrocarbons (PAHs) excited by ultraviolet radiation. The common features of the energy distributions of the 16 reflection nebulae, also seen in the reflection nebulae associated with the Pleiades, suggest that PAHs or very small grains may be found in most reflection nebulae

The Hubble Constant

Directory of Open Access Journals (Sweden)

Neal Jackson

2015-09-01

Full Text Available I review the current state of determinations of the Hubble constant, which gives the length scale of the Universe by relating the expansion velocity of objects to their distance. There are two broad categories of measurements. The first uses individual astrophysical objects which have some property that allows their intrinsic luminosity or size to be determined, or allows the determination of their distance by geometric means. The second category comprises the use of all-sky cosmic microwave background, or correlations between large samples of galaxies, to determine information about the geometry of the Universe and hence the Hubble constant, typically in a combination with other cosmological parameters. Many, but not all, object-based measurements give H_0 values of around 72–74 km s^–1 Mpc^–1, with typical errors of 2–3 km s^–1 Mpc^–1. This is in mild discrepancy with CMB-based measurements, in particular those from the Planck satellite, which give values of 67–68 km s^–1 Mpc^–1 and typical errors of 1–2 km s^–1 Mpc^–1. The size of the remaining systematics indicate that accuracy rather than precision is the remaining problem in a good determination of the Hubble constant. Whether a discrepancy exists, and whether new physics is needed to resolve it, depends on details of the systematics of the object-based methods, and also on the assumptions about other cosmological parameters and which datasets are combined in the case of the all-sky methods.

Circumstellar envelopes seen in radio (OH masers) and in the infrared observations (IRAS)

International Nuclear Information System (INIS)

David, Pedro-Correia-de-Matos

1992-01-01

Intermediate mass stars, namely from one to nine solar masses, eject mass into the surrounding interstellar medium at high rates (up to 1/10000 solar masses per year) in their late stages of evolution on the so called asymptotic giant branch (AGB). Indeed, the presence of a circumstellar envelope (CSE) composed of dust and gas is one of the principal features of the objects on the AGB. Because of the high opacity at visible wavelength of the CSE, most of these objects can only be observed at infrared and radio frequencies. This study was undertaken using infrared and radio data from a large sample of CSE sources. The infrared data was obtained from the infrared astronomical satellite (IRAS) data base. For a selection of IRAS objects, radio observations were made of the OH maser at 1612 and 1667 MHz at the Nancay radio telescope, France. This work consists in two parts, one is theoretical in nature, the other observational. The theoretical part is concerned with the modeling of IRAS low resolution spectra (LRS catalog) and IRAS photometry through the use of a radiative transfer code. Confrontation between models and data has yielded such results as a better definition of the grain optical properties and the behavior of the CSE as it evolves. A model of a shock wave (a possible lifting engine of the CSE) propagating in the atmosphere of Mira stars (AGB) is described. On the observational side, a large number of objects has been surveyed for the presence of OH masers at 1612 and 1667 MHz. A statistical analysis has established more clearly the evolutionary status of CSE and the OH maser characteristics. A compiling of detection rates for the occurrence of masers, average location of these masing CSEs in the Galaxy, and OH maser characteristics is reported for use in future work. (author) [fr

Chandra Independently Determines Hubble Constant

Science.gov (United States)

2006-08-01

A critically important number that specifies the expansion rate of the Universe, the so-called Hubble constant, has been independently determined using NASA's Chandra X-ray Observatory. This new value matches recent measurements using other methods and extends their validity to greater distances, thus allowing astronomers to probe earlier epochs in the evolution of the Universe. "The reason this result is so significant is that we need the Hubble constant to tell us the size of the Universe, its age, and how much matter it contains," said Max Bonamente from the University of Alabama in Huntsville and NASA's Marshall Space Flight Center (MSFC) in Huntsville, Ala., lead author on the paper describing the results. "Astronomers absolutely need to trust this number because we use it for countless calculations." Illustration of Sunyaev-Zeldovich Effect Illustration of Sunyaev-Zeldovich Effect The Hubble constant is calculated by measuring the speed at which objects are moving away from us and dividing by their distance. Most of the previous attempts to determine the Hubble constant have involved using a multi-step, or distance ladder, approach in which the distance to nearby galaxies is used as the basis for determining greater distances. The most common approach has been to use a well-studied type of pulsating star known as a Cepheid variable, in conjunction with more distant supernovae to trace distances across the Universe. Scientists using this method and observations from the Hubble Space Telescope were able to measure the Hubble constant to within 10%. However, only independent checks would give them the confidence they desired, considering that much of our understanding of the Universe hangs in the balance. Chandra X-ray Image of MACS J1149.5+223 Chandra X-ray Image of MACS J1149.5+223 By combining X-ray data from Chandra with radio observations of galaxy clusters, the team determined the distances to 38 galaxy clusters ranging from 1.4 billion to 9.3 billion

HUBBLE PINPOINTS WHITE DWARFS IN GLOBULAR CLUSTER

Science.gov (United States)

2002-01-01

Peering deep inside a cluster of several hundred thousand stars, NASA's Hubble Space Telescope uncovered the oldest burned-out stars in our Milky Way Galaxy. Located in the globular cluster M4, these small, dying stars - called white dwarfs - are giving astronomers a fresh reading on one of the biggest questions in astronomy: How old is the universe? The ancient white dwarfs in M4 are about 12 to 13 billion years old. After accounting for the time it took the cluster to form after the big bang, astronomers found that the age of the white dwarfs agrees with previous estimates for the universe's age. In the top panel, a ground-based observatory snapped a panoramic view of the entire cluster, which contains several hundred thousand stars within a volume of 10 to 30 light-years across. The Kitt Peak National Observatory's 0.9-meter telescope took this picture in March 1995. The box at left indicates the region observed by the Hubble telescope. The Hubble telescope studied a small region of the cluster. A section of that region is seen in the picture at bottom left. A sampling of an even smaller region is shown at bottom right. This region is only about one light-year across. In this smaller region, Hubble pinpointed a number of faint white dwarfs. The blue circles pinpoint the dwarfs. It took nearly eight days of exposure time over a 67-day period to find these extremely faint stars. Globular clusters are among the oldest clusters of stars in the universe. The faintest and coolest white dwarfs within globular clusters can yield a globular cluster's age. Earlier Hubble observations showed that the first stars formed less than 1 billion years after the universe's birth in the big bang. So, finding the oldest stars puts astronomers within arm's reach of the universe's age. M4 is 7,000 light-years away in the constellation Scorpius. Hubble's Wide Field and Planetary Camera 2 made the observations from January through April 2001. These optical observations were combined to

Hubble and the Language of Images

Science.gov (United States)

Levay, Z. G.

2005-12-01

Images released from the Hubble Space Telescope have been very highly regarded by the astronomy-attentive public for at least a decade. Due in large part to these images, Hubble has become an iconic figure, even among the general public. This iconic status is both a boon and a burden for those who produce the stream of images fl owing from this telescope. While the benefits of attention are fairly obvious, the negative aspects are less visible. One of the most persistent challenges is the need to continue to deliver images that "top" those released before. In part this can be accomplished because of Hubble's upgraded instrumentation. But it can also be a source of pressure that could, if left unchecked, erode ethical boundaries in our communication with the public. These pressures are magnified in an atmosphere of uncertainty with regard to the future of the mission.

Relación entre locus de control, ira y rendimiento deportivo en jugadores de tenis de mesa

Directory of Open Access Journals (Sweden)

Higinio González-García

2017-01-01

Full Text Available Los objetivos de este estudio fueron comprobar la relación entre el locus de control y el rendimiento de- portivo, y conocer la relación entre el locus de control y las variables de ira. La muestra de la investigación se compuso de 58 jugadores federados de tenis de mesa de toda la geografía española. Los participantes completa- ron un cuestionario sociodemográfico ad hoc , la Escala de Locus de Control (ELC y el Inventario de Expresión de la Ira Estado-Rasgo (STAXI-2. Los resultados revela- ron que no había diferencias de medias en los niveles de locus de control externo en función de la división de juego y del tipo de práctica deportiva (profesionales vs amateurs. Por otro lado, se confirmó la relación entre el locus de control externo y la expresión externa de la ira, encontrándose diferencias estadísticamente signifi- cativas entre la expresión externa de la ira y los grupos de locus de control externo alto y bajo. Finalmente, se concluyó que el nivel de rendimiento deportivo no in- terfería en los niveles de locus de control y, por otro lado, se confirma la relación del locus de control exter- no en la expresión externa de la ira de los jugadores de tenis de mesa. Por lo tanto, el locus de control interno se muestra como una variable protectora importante para intervenir con jugadores y entrenadores.

Hubble Legacy Archive And The Public

Science.gov (United States)

Harris, Jessica; Whitmore, B.; Eisenhamer, B.; Bishop, M.; Knisely, L.

2012-01-01

The Hubble Legacy Archive (HLA) at the Space Telescope Science Institute (STScI) hosts the Image of the Month (IOTM) Series. The HLA is a joint project of STScI, the Space Telescope European Coordinating Facility (ST-ECF), and the Canadian Astronomy Data Centre (CADC). The HLA is designed optimize science from the Hubble Space Telescope by providing online enhanced Hubble products and advanced browsing capabilities. The IOTM's are created for astronomers and the public to highlight various features within HLA, such as the "Interactive Display", "Footprint” and "Inventory” features to name a few. We have been working with the Office of Public Outreach (OPO) to create a standards based educational module for middle school to high school students of the IOTM: Rings and the Moons of Uranus. The set of Uranus activities are highlighted by a movie that displays the orbit of five of Uranus’ largest satellites. We made the movie based on eight visits of Uranus from 2000-06-16 to 2000-06-18, using the PC chip on the Wide Field Planetary Camera 2 (WFPC2) and filter F850LP (proposal ID: 8680). Students will be engaged in activities that will allow them to "discover” the rings and satellites around Uranus, calculate the orbit of the satellites, and introduces students to analyze real data from Hubble.

Influence of water-filtered infrared-A (wIRA on reduction of local fat and body weight by physical exercise

Directory of Open Access Journals (Sweden)

Schmitz, Gerd

2006-07-01

Full Text Available Aim of the study: Investigation, whether water-filtered infrared-A (wIRA irradiation during moderate bicycle ergometer endurance exercise has effects especially on local fat reduction and on weight reduction beyond the effects of ergometer exercise alone. Methods: Randomised controlled study with 40 obese females (BMI 30-40 (median: 34.5, body weight 76-125 (median: 94.9 kg, age 20-40 (median: 35.5 years, isocaloric nutrition, 20 in the wIRA group and 20 in the control group. In both groups each participant performed 3 times per week over 4 weeks for 45 minutes bicycle ergometer endurance exercise with a constant load according to a lactate level of 2 mmol/l (aerobic endurance load, as determined before the intervention period. In the wIRA group in addition large parts of the body (including waist, hip, and thighs were irradiated during all ergometries of the intervention period with visible light and a predominant part of water-filtered infrared-A (wIRA, using the irradiation unit “Hydrosun® 6000” with 10 wIRA radiators (Hydrosun® Medizintechnik, Müllheim, Germany, radiator type 500, 4 mm water cuvette, yellow filter, water-filtered spectrum 500-1400 nm around a speed independent bicycle ergometer. Main variable of interest: change of “the sum of circumferences of waist, hip, and both thighs of each patient” over the intervention period (4 weeks. Additional variables of interest: body weight, body mass index BMI, body fat percentage, fat mass, fat-free mass, water mass (analysis of body composition by tetrapolar bioimpedance analysis, assessment of an arteriosclerotic risk profile by blood investigation of variables of lipid metabolism (cholesterol, triglycerides, high density lipoproteins HDL, low density lipoproteins LDL, apolipoprotein A1, apolipoprotein B, clinical chemistry (fasting glucose, alanin-aminotransferase ALT (= glutamyl pyruvic transaminase GPT, gamma-glutamyl-transferase GGT, creatinine, albumin, endocrinology

Chemistry of Carbon Rich Star IRAS 15194–5115 A. Ali

Indian Academy of Sciences (India)

We have constructed two gas-phase models to study the chem- ... 1. Introduction. IRAS 15194–5115 is the third brightest carbon star at 12 µm and the brightest one ..... The main formation routes of CN, HCN and HNC in the inner part are.

Percolation Analysis of a Wiener Reconstruction of the IRAS 1.2 Jy Redshift Catalog

Science.gov (United States)

Yess, Capp; Shandarin, Sergei F.; Fisher, Karl B.

1997-01-01

We present percolation analyses of Wiener reconstructions of the IRAS 1.2 Jy redshift survey. There are 10 reconstructions of galaxy density fields in real space spanning the range β = 0.1-1.0, where β = Ω0.6/b, Ω is the present dimensionless density, and b is the bias factor. Our method uses the growth of the largest cluster statistic to characterize the topology of a density field, where Gaussian randomized versions of the reconstructions are used as standards for analysis. For the reconstruction volume of radius R ~ 100 h-1 Mpc, percolation analysis reveals a slight ``meatball'' topology for the real space, galaxy distribution of the IRAS survey.

Hubble again views Saturn's Rings Edge-on

Science.gov (United States)

1995-01-01

Saturn's magnificent ring system is seen tilted edge-on -- for the second time this year -- in this NASA Hubble Space Telescope picture taken on August 10, 1995, when the planet was 895 million miles (1,440 million kilometers) away. Hubble snapped the image as Earth sped back across Saturn's ring plane to the sunlit side of the rings. Last May 22, Earth dipped below the ring plane, giving observers a brief look at the backlit side of the rings. Ring-plane crossing events occur approximately every 15 years. Earthbound observers won't have as good a view until the year 2038. Several of Saturn's icy moons are visible as tiny starlike objects in or near the ring plane. They are from left to right, Enceladus, Tethys, Dione and Mimas. 'The Hubble data shows numerous faint satellites close to the bright rings, but it will take a couple of months to precisely identify them,' according to Steve Larson (University of Arizona). During the May ring plane crossing, Hubble detected two, and possibly four, new moons orbiting Saturn. These new observations also provide a better view of the faint E ring, 'to help determine the size of particles and whether they will pose a collision hazard to the Cassini spacecraft,' said Larson. The picture was taken with Hubble's Wide Field Planetary Camera 2 in wide field mode. This image is a composite view, where a long exposure of the faint rings has been combined with a shorter exposure of Saturn's disk to bring out more detail. When viewed edge-on, the rings are so dim they almost disappear because they are very thin -- probably less than a mile thick.The Wide Field/Planetary Camera 2 was developed by the Jet Propulsion Laboratory and managed by the Goddard Spaced Flight Center for NASA's Office of Space Science.This image and other images and data received from the Hubble Space Telescope are posted on the World Wide Web on the Space Telescope Science Institute home page at URL http://oposite.stsci.edu/pubinfo/

Observations of 40-70 micron bands of ice in IRAS 09371 + 1212 and other stars

Science.gov (United States)

Omont, A.; Forveille, T.; Moseley, S. H.; Glaccum, W. J.; Harvey, P. M.; Likkel, L.; Loewenstein, R. F.; Lisse, C. M.

1990-01-01

IRAS 09371 + 1212 is still an absolutely unique object. This M giant star, with circumstellar CO and a spectacular bipolar nebula, displays unique IRAS FIR colors which had been attributed to strong emission in the 40-70-micron bands of ice, as subsequently supported by the observation of a strong 3.1-micron absorption band. The results of the KAO observations have confirmed its unusual nature: the far-infrared bands of ice are by far the strongest known. Its dust temperature, 50 K or less, is by far the lowest known for a late-type circumstellar envelope.

Far-infrared investigation of the Taurus star-forming region using the IRAS database

International Nuclear Information System (INIS)

Hughes, J.D.

1986-01-01

The Taurus-Auriga complex was selected as the first molecular cloud to be investigated in this study. The Taurus clouds were defined as lying between 04h and 05h in R.A. and +16 to +31 degrees in Dec., then the IRAS point-source catalogue was searched for sources with good or moderate quality fluxes in all three of the shortest IRAS bands. The sources selected were then classified into subgroups according to their IRAS colors. Taurus is generally believed to be an area of low-mass star formation, having no luminous O-B associations within or near to the cloud complex. Once field stars, galaxies and planetary nebulae had been removed from the sample only the molecular cloud cores, T Tauri stars and a few emission-line A and B stars remained. The great majority of these objects are pre-main sequence in nature and, as stated by Chester (1985), main sequence stars without excess far-infrared emission would only be seen in Taurus if their spectral types were earlier than about A5 and then not 25 microns. By choosing our sample in this way we are naturally selecting the hotter and thus more evolved sources. To counteract this, the molecular cloud core-criterion was applied to soruces with good or moderate quality flux at 25, 60 and 100 microns, increasing the core sample by about one third. The candidate protostar B335 is only detected by IRAS at 60 and 100 microns while Taurus is heavily contaminated by cirrus at 100 microns. This means that detection at 25 microns is also required with those at 60 and 100 microns to avoid confusing a ridge of cirrus with a genuine protostar. The far-infrared luminosity function of these sources is then calculated and converted to the visual band by a standard method to compare with the field star luminosity function of Miller and Scalo

Version 1 of the Hubble Source Catalog

Science.gov (United States)

Whitmore, Bradley C.; Allam, Sahar S.; Budavári, Tamás; Casertano, Stefano; Downes, Ronald A.; Donaldson, Thomas; Fall, S. Michael; Lubow, Stephen H.; Quick, Lee; Strolger, Louis-Gregory; Wallace, Geoff; White, Richard L.

2016-06-01

The Hubble Source Catalog is designed to help optimize science from the Hubble Space Telescope (HST) by combining the tens of thousands of visit-based source lists in the Hubble Legacy Archive (HLA) into a single master catalog. Version 1 of the Hubble Source Catalog includes WFPC2, ACS/WFC, WFC3/UVIS, and WFC3/IR photometric data generated using SExtractor software to produce the individual source lists. The catalog includes roughly 80 million detections of 30 million objects involving 112 different detector/filter combinations, and about 160,000 HST exposures. Source lists from Data Release 8 of the HLA are matched using an algorithm developed by Budavári & Lubow. The mean photometric accuracy for the catalog as a whole is better than 0.10 mag, with relative accuracy as good as 0.02 mag in certain circumstances (e.g., bright isolated stars). The relative astrometric residuals are typically within 10 mas, with a value for the mode (I.e., most common value) of 2.3 mas. The absolute astrometric accuracy is better than 0''\\hspace{-0.5em}. 1 for most sources, but can be much larger for a fraction of fields that could not be matched to the PanSTARRS, SDSS, or 2MASS reference systems. In this paper we describe the database design with emphasis on those aspects that enable the users to fully exploit the catalog while avoiding common misunderstandings and potential pitfalls. We provide usage examples to illustrate some of the science capabilities and data quality characteristics, and briefly discuss plans for future improvements to the Hubble Source Catalog.

A study of the stellar population in the Lynds 1641 dark cloud. I. The IRAS catalog sources

International Nuclear Information System (INIS)

Strom, K.M.; Newton, G.; Strom, S.E.; Seaman, R.L.; Carrasco, L.

1989-01-01

The character of the sources identified in the IRAS Point Source Catalog and located within the boundaries of the nearest giant molecular cloud, Lynds 1641 is discussed. New optical and near-infrared photometry are combined to provide spectral energy distributions (SEDs) for these objects divided into three classes: class I objects with flat or rising spectra, class II objects with spectra intermediate in slope between a flat and blackbody spectrum, and class III objects with spectra similar to those of blackbodies. It is found that L1641 contains a much larger percentage of class I sources than does the nearby Taurus-Auriga star-forming complex. Spectral energy distributions for the IRAS-selected sample are examined and compared with SEDs for young stellar objects (YSOs) located in Taurus-Auriga. The IRAS-selected sources having optical counterparts in the H-R diagram are identified and discussed along with the distribution of masses and ages for these YSOs. 86 refs

Brief description of the programmes of the Institut fuer Reaktordynamik und Anlagensicherheit (IRA)

International Nuclear Information System (INIS)

1977-01-01

All programmes used by the IRA are presented, giving name and abbreviation, field of application, purpose and solution method, requirements made on the computer, necessary auxiliary programmes, and machine time for typical examples. (RW) [de

IRAS observations of starburst galaxies

International Nuclear Information System (INIS)

Sekiguchi, K.

1987-01-01

Far infrared properties of Starburst galaxies were analyzed using IRAS observations at 25, 60, and 100 micrometers. Seventy-nine of 102 Starburst galaxies from the list of Balzano were detected. These galaxies have high IR luminosities of up to a few 10 to the 12th power L sub 0 and concentrate in a small area of the IR color - color diagram. The IR power law spectral indices, alpha, lie within the ranges -2.5 < alpha(60,25)< -1.5 and -1.5 < alpha(100,60)< 0. These observed indices can be interpreted in terms of a cold disk component and a warm component. More than 80% of the 60 micrometer emission comes from the warm component. The fraction of the 60 micrometer emission attributable to the warm component can be used as an activity indicator

BEAUTY IN THE EYE OF HUBBLE

Science.gov (United States)

2002-01-01

A dying star, IC 4406, dubbed the 'Retina Nebula' is revealed in this month's Hubble Heritage image. Like many other so-called planetary nebulae, IC 4406 exhibits a high degree of symmetry; the left and right halves of the Hubble image are nearly mirror images of the other. If we could fly around IC4406 in a starship, we would see that the gas and dust form a vast donut of material streaming outward from the dying star. From Earth, we are viewing the donut from the side. This side view allows us to see the intricate tendrils of dust that have been compared to the eye's retina. In other planetary nebulae, like the Ring Nebula (NGC 6720), we view the donut from the top. The donut of material confines the intense radiation coming from the remnant of the dying star. Gas on the inside of the donut is ionized by light from the central star and glows. Light from oxygen atoms is rendered blue in this image; hydrogen is shown as green, and nitrogen as red. The range of color in the final image shows the differences in concentration of these three gases in the nebula. Unseen in the Hubble image is a larger zone of neutral gas that is not emitting visible light, but which can be seen by radio telescopes. One of the most interesting features of IC 4406 is the irregular lattice of dark lanes that criss-cross the center of the nebula. These lanes are about 160 astronomical units wide (1 astronomical unit is the distance between the Earth and Sun). They are located right at the boundary between the hot glowing gas that produces the visual light imaged here and the neutral gas seen with radio telescopes. We see the lanes in silhouette because they have a density of dust and gas that is a thousand times higher than the rest of the nebula. The dust lanes are like a rather open mesh veil that has been wrapped around the bright donut. The fate of these dense knots of material is unknown. Will they survive the nebula's expansion and become dark denizens of the space between the stars

ALMA 690 GHz OBSERVATIONS OF IRAS 16293–2422B: INFALL IN A HIGHLY OPTICALLY THICK DISK

International Nuclear Information System (INIS)

Zapata, Luis A.; Loinard, Laurent; Rodríguez, Luis F.; Hernández-Hernández, Vicente; Takahashi, Satoko; Trejo, Alfonso; Parise, Bérengère

2013-01-01

We present sensitive, high angular resolution (∼0.''2) submillimeter continuum and line observations of IRAS 16293–2422B made with the Atacama Large Millimeter/Submillimeter Array. The 0.45 mm continuum observations reveal a single and very compact source associated with IRAS 16293–2422B. This submillimeter source has a deconvolved angular size of about 400 mas (50 AU) and does not show any inner structure inside of this diameter. The H 13 CN, HC 15 N, and CH 3 OH line emission regions are about twice as large as the continuum emission and reveal a pronounced inner depression or ''hole'' with a size comparable to that estimated for the submillimeter continuum. We suggest that the presence of this inner depression and the fact that we do not see an inner structure (or a flat structure) in the continuum are produced by very optically thick dust located in the innermost parts of IRAS 16293–2422B. All three lines also show pronounced inverse P-Cygni profiles with infall and dispersion velocities larger than those recently reported from observations at lower frequencies, suggesting that we are detecting faster and more turbulent gas located closer to the central object. Finally, we report a small east-west velocity gradient in IRAS 16293–2422B that suggests that its disk plane is likely located very close to the plane of the sky.

Infrared galaxies in the IRAS minisurvey

Science.gov (United States)

Soifer, B. T.; Neugebauer, G.; Rowan-Robinson, M.; Clegg, P. E.; Emerson, J. P.; Houck, J. R.; De Jong, T.; Aumann, H. H.; Beichman, C. A.; Boggess, N.

1984-01-01

A total of 86 galaxies have been detected at 60 microns in the high galactic latitude portion of the IRAS minisurvey. The surface density of detected galaxies with flux densities greater than 0.5 Jy is 0.25 sq deg. Virtually all the galaxies detected are spiral galaxies and have an infrared to blue luminosity ratio ranging from 50 to 0.5. For the infrared-selected sample, no obvious correlation exists between infrared excess and color temperature. The infrared flux from 10 to 100 microns contributes approximately 5 percent of the blue luminosity for galaxies in the magnitude range 14 less than m(pg) less than 18 mag. The fraction of interacting galaxies is between one-eighth and one-fourth of the sample.

Hubble induced mass after inflation in spectator field models

Energy Technology Data Exchange (ETDEWEB)

Fujita, Tomohiro [Stanford Institute for Theoretical Physics and Department of Physics, Stanford University, Stanford, CA 94306 (United States); Harigaya, Keisuke, E-mail: tomofuji@stanford.edu, E-mail: keisukeh@icrr.u-tokyo.ac.jp [Department of Physics, University of California, Berkeley, CA 94720 (United States)

2016-12-01

Spectator field models such as the curvaton scenario and the modulated reheating are attractive scenarios for the generation of the cosmic curvature perturbation, as the constraints on inflation models are relaxed. In this paper, we discuss the effect of Hubble induced masses on the dynamics of spectator fields after inflation. We pay particular attention to the Hubble induced mass by the kinetic energy of an oscillating inflaton, which is generically unsuppressed but often overlooked. In the curvaton scenario, the Hubble induced mass relaxes the constraint on the property of the inflaton and the curvaton, such as the reheating temperature and the inflation scale. We comment on the implication of our discussion for baryogenesis in the curvaton scenario. In the modulated reheating, the predictions of models e.g. the non-gaussianity can be considerably altered. Furthermore, we propose a new model of the modulated reheating utilizing the Hubble induced mass which realizes a wide range of the local non-gaussianity parameter.

Testing the isotropy of the Hubble expansion

OpenAIRE

Migkas, K.; Plionis, M.

2016-01-01

Abstract: We have used the Union2.1 SNIa compilation to search for possible Hubble expansion anisotropies, dividing the sky in 9 solid angles containing roughly the same number of SNIa, as well as in two Galactic hemispheres. We identified only one sky region, containing 82 SNIa (~15% of total sample with z > 0.02), that indeed appears to share a Hubble expansion significantly different from the rest of the sample. However, this behaviour can be attributed to the joint "erratic" behaviour of ...

CRYSTALLINE SILICATES IN EVOLVED STARS. I. SPITZER/INFRARED SPECTROGRAPH SPECTROSCOPY OF IRAS 16456-3542, 18354-0638, AND 23239+5754

Energy Technology Data Exchange (ETDEWEB)

Jiang, B. W.; Zhang, Ke [Department of Astronomy, Beijing Normal University, Beijing 100875 (China); Li, Aigen [Department of Physics and Astronomy, University of Missouri, Columbia, MO 65211 (United States); Lisse, C. M., E-mail: bjiang@bnu.edu.cn, E-mail: kzhang@caltech.edu, E-mail: lia@missouri.edu, E-mail: carey.lisse@jhuapl.edu [Johns Hopkins University, Applied Physics Laboratory, Laurel, MD 20723 (United States)

2013-03-01

We report the Spitzer Infrared Spectrograph (IRS) observations of three evolved stars: IRAS 16456-3542, 18354-0638, and 23239+5754. The 9.9-37.2 {mu}m Spitzer/IRS high-resolution spectra of these three sources exhibit rich sets of enstatite-dominated crystalline silicate emission features. IRAS 16456-3542 is extremely rich in crystalline silicates, with >90% of its silicate mass in crystalline form, the highest to date ever reported for crystalline silicate sources.

The ALMA-PILS survey: the sulphur connection between protostars and comets: IRAS 16293-2422 B and 67P/Churyumov-Gerasimenko

Science.gov (United States)

Drozdovskaya, Maria N.; van Dishoeck, Ewine F.; Jørgensen, Jes K.; Calmonte, Ursina; van der Wiel, Matthijs H. D.; Coutens, Audrey; Calcutt, Hannah; Müller, Holger S. P.; Bjerkeli, Per; Persson, Magnus V.; Wampfler, Susanne F.; Altwegg, Kathrin

2018-06-01

The evolutionary past of our Solar system can be pieced together by comparing analogous low-mass protostars with remnants of our Protosolar Nebula - comets. Sulphur-bearing molecules may be unique tracers of the joint evolution of the volatile and refractory components. ALMA Band 7 data from the large unbiased Protostellar Interferometric Line Survey are used to search for S-bearing molecules in the outer disc-like structure, ˜60 au from IRAS 16293-2422 B, and are compared with data on 67P/Churyumov-Gerasimenko (67P/C-G) stemming from the ROSINA (Rosetta Orbiter Spectrometer for Ion and Neutral Analysis) instrument aboard Rosetta. Species such as SO2, SO, OCS, CS, H2CS, H2S, and CH3SH are detected via at least one of their isotopologues towards IRAS 16293-2422 B. The search reveals a first-time detection of OC33S towards this source and a tentative first-time detection of C36S towards a low-mass protostar. The data show that IRAS 16293-2422 B contains much more OCS than H2S in comparison to 67P/C-G; meanwhile, the SO/SO2 ratio is in close agreement between the two targets. IRAS 16293-2422 B has a CH3SH/H2CS ratio in range of that of our Solar system (differences by a factor of 0.7-5.3). It is suggested that the levels of UV radiation during the initial collapse of the systems may have varied and have potentially been higher for IRAS 16293-2422 B due to its binary nature; thereby, converting more H2S into OCS. It remains to be conclusively tested if this also promotes the formation of S-bearing complex organics. Elevated UV levels of IRAS 16293-2422 B and a warmer birth cloud of our Solar system may jointly explain the variations between the two low-mass systems.

Hubble 2020: Outer Planet Atmospheres Legacy (OPAL) Program

Science.gov (United States)

Simon, Amy

2017-08-01

Long time base observations of the outer planets are critical in understanding the atmospheric dynamics and evolution of the gas giants. We propose yearly monitoring of each giant planet for the remainder of Hubble's lifetime to provide a lasting legacy of increasingly valuable data for time-domain studies. The Hubble Space Telescope is a unique asset to planetary science, allowing high spatial resolution data with absolute photometric knowledge. For the outer planets, gas/ice giant planets Jupiter, Saturn, Uranus and Neptune, many phenomena happen on timescales of years to decades, and the data we propose are beyond the scope of a typical GO program. Hubble is the only platform that can provide high spatial resolution global studies of cloud coloration, activity, and motion on a consistent time basis to help constrain the underlying mechanics.

MILLIMETRIC AND SUBMILLIMETRIC OBSERVATIONS OF IRAS 05327+3404 ''HOLOEA'' IN M36

International Nuclear Information System (INIS)

Morata, O.; Ho, P. T. P.; Kuan, Y.-J.; Huang, H.-C.; Zhao-Geisler, R.; Magnier, E. A.

2013-01-01

The transition between the protostar, Class I, and the pre-main-sequence star, Class II, phases is still one of the most uncertain, and important, stages in the knowledge of the process of formation of an individual star because it is the stage that determines the final mass of the star. We observed the young stellar object ''Holoea'', associated with IRAS 05327+3404, which was classified as an object in the transition between the Class I and Class II phases with several unusual properties, and appears to be surrounded by large amounts of circumstellar material. We used the SMA and BIMA telescopes at millimeter and submillimeter (submm) wavelengths to observe the dust continuum emission and the CO (1-0) and (2-1), HCO + (1-0) and (3-2), and HCN (1-0) transitions in the region around IRAS 05327+3404. We detected two continuum emission peaks at 1.1 mm: SMM 1, the submm counterpart of IRAS 05327+3404, and SMM 2, ∼6 arcsec to the west. The emissions of the three molecules show marked differences. The CO emission near the systemic velocity is filtered out by the telescopes, and CO mostly traces the high-velocity gas. The HCO + and HCN emissions are more concentrated around the central parts of the region, and show several intensity peaks coincident with the submm continuum peaks. We identify two main molecular outflows: a bipolar outflow in an E-W direction that would be powered by SMM 1 and the other in a NE direction, which we associate with SMM 2. We propose that the SMM sources are probably Class I objects, with SMM 1 in an earlier evolutionary stage

Descoberta de um aglomerado estelar massivo associado a fonte IRAS 16177-5018

Science.gov (United States)

Roman Lopes, A.; Abraham, Z.; Lépine, J. R. D.

2003-08-01

Neste trabalho apresentamos a descoberta de um aglomerado de estrelas jovens e massivas embebido em uma região HII extensa associado com a fonte IRAS 16177-5018, que se apresenta invisível na faixa óptica do espectro eletromagnético, onde a extinção é da ordem de AV = 26 magnitudes. As observações foram feitas com a camera infravermelha (CamIV) do Laboratório Nacional de Astrofísica, Brasil, equipada com um detector Hawaii de HgCdTe de 1024´1024 pixel acoplada ao telescópio de 60 cm Boller & Chivens do IAG. A fotometria obtida a partir das imagens nas bandas J, H e K (filtro estreito) mostrou a presença de fontes com excesso de emissão no infravermelho em 2.2 mm, concentradas em uma área de aproximadamente um minuto de arco quadrado em torno da nebulosa na qual esta embebido o objeto identificado como a fonte IRAS. A fonte IRAS apresenta um índice espectral (entre 2.2 21.3 mm) a = d log(l Fl) / d log l = 4.78, característico de um objeto extremamente jovem com luminosidade bolométrica (obtida da integral da densidade de fluxo entre o infravermelho próximo (1.25mm) e o infravermelho distante (100mm)) de 2.8´105L¤, o qual corresponde a uma estrela da sequência principal de idade zero de cerca de 42 M¤. A partir do diagrama cor-magnitude foi possível classificar a maioria dos membros do aglomerado como estrelas massivas mais luminosas que tipo espectral B5.

Ira as a pioneer in audiology: His contributions to the clinical measurement of hearing and hearing impairment

Science.gov (United States)

Formby, C.; Gagne, J. P.

2002-05-01

Ira Hirsh's contributions to clinical science and research are diverse and significant. In fact, approximately one-third of the 100+ publications that Ira lists in his curriculum vitae (CV) are clinical in nature, dealing with various aspects of audiology, deafness, hearing aids, aural rehabilitation, and speech and language pathology. The majority of these citations, fully one-quarter of his publication list, addresses problems specific to the clinical measurement of hearing and hearing impairment. Undoubtedly, the most influential of these published works appears in his CV under the citation ``The Measurement of Hearing.'' The forward for this publication, his only textbook, was penned in June, 1952 (now precisely half a century past at the time of this session). The aims of this presentation are to (1) provide perspective on the fundamental importance of his virtually timeless text in shaping the fledgling discipline of audiology, and (2) celebrate Ira's many contributions to the profession and practice of audiology. [Preparation for this presentation was supported, in part, by a K24 career development award from NIDCD.

Carnegie Hubble Program: A Mid-Infrared Calibration of the Hubble Constant

Science.gov (United States)

Freedman, Wendy L.; Madore, Barry F.; Scowcroft, Victoria; Burns, Chris; Monson, Andy; Persson, S. Eric; Seibert, Mark; Rigby, Jane

2012-01-01

Using a mid-infrared calibration of the Cepheid distance scale based on recent observations at 3.6 micrometers with the Spitzer Space Telescope, we have obtained a new, high-accuracy calibration of the Hubble constant. We have established the mid-IR zero point of the Leavitt law (the Cepheid period-luminosity relation) using time-averaged 3.6 micrometers data for 10 high-metallicity, MilkyWay Cepheids having independently measured trigonometric parallaxes. We have adopted the slope of the PL relation using time-averaged 3.6micrometers data for 80 long-period Large Magellanic Cloud (LMC) Cepheids falling in the period range 0.8 < log(P) < 1.8.We find a new reddening-corrected distance to the LMC of 18.477 +/- 0.033 (systematic) mag. We re-examine the systematic uncertainties in H(sub 0), also taking into account new data over the past decade. In combination with the new Spitzer calibration, the systematic uncertainty in H(sub 0) over that obtained by the Hubble Space Telescope Key Project has decreased by over a factor of three. Applying the Spitzer calibration to the Key Project sample, we find a value of H(sub 0) = 74.3 with a systematic uncertainty of +/-2.1 (systematic) kilometers per second Mpc(sup -1), corresponding to a 2.8% systematic uncertainty in the Hubble constant. This result, in combination with WMAP7measurements of the cosmic microwave background anisotropies and assuming a flat universe, yields a value of the equation of state for dark energy, w(sub 0) = -1.09 +/- 0.10. Alternatively, relaxing the constraints on flatness and the numbers of relativistic species, and combining our results with those of WMAP7, Type Ia supernovae and baryon acoustic oscillations yield w(sub 0) = -1.08 +/- 0.10 and a value of N(sub eff) = 4.13 +/- 0.67, mildly consistent with the existence of a fourth neutrino species.

HUBBLE SPIES MOST DISTANT SUPERNOVA EVER SEEN

Science.gov (United States)

2002-01-01

Using NASA's Hubble Space Telescope, astronomers pinpointed a blaze of light from the farthest supernova ever seen, a dying star that exploded 10 billion years ago. The detection and analysis of this supernova, called 1997ff, is greatly bolstering the case for the existence of a mysterious form of dark energy pervading the cosmos, making galaxies hurl ever faster away from each other. The supernova also offers the first glimpse of the universe slowing down soon after the Big Bang, before it began speeding up. This panel of images, taken with the Wide Field and Planetary Camera 2, shows the supernova's cosmic neighborhood; its home galaxy; and the dying star itself. Astronomers found this supernova in 1997 during a second look at the northern Hubble Deep Field [top panel], a tiny region of sky first explored by the Hubble telescope in 1995. The image shows the myriad of galaxies Hubble spied when it peered across more than 10 billion years of time and space. The white box marks the area where the supernova dwells. The photo at bottom left is a close-up view of that region. The white arrow points to the exploding star's home galaxy, a faint elliptical. Its redness is due to the billions of old stars residing there. The picture at bottom right shows the supernova itself, distinguished by the white dot in the center. Although this stellar explosion is among the brightest beacons in the universe, it could not be seen directly in the Hubble images. The stellar blast is so distant from Earth that its light is buried in the glow of its host galaxy. To find the supernova, astronomers compared two pictures of the 'deep field' taken two years apart. One image was of the original Hubble Deep Field; the other, the follow-up deep-field picture taken in 1997. Using special computer software, astronomers then measured the light from the galaxies in both images. Noting any changes in light output between the two pictures, the computer identified a blob of light in the 1997 picture

Dismantling Hubble's Legacy?

OpenAIRE

Way, Michael J.

2013-01-01

Edwin Hubble is famous for a number of discoveries that are well known to amateur and professional astronomers, students and the general public. The origins of these discoveries are examined and it is demonstrated that, in each case, a great deal of supporting evidence was already in place. In some cases the discoveries had either already been made, or competing versions were not adopted for complex scientific and sociological reasons.

26 CFR 1.408(q)-1 - Deemed IRAs in qualified employer plans.

Science.gov (United States)

2010-04-01

... (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Pension, Profit-Sharing, Stock Bonus Plans, Etc. § 1.408(q)-1... restrictions that a trustee, custodian, or insurance company is permitted to impose on distributions from... accounts of any of the deemed IRAs is invested in life insurance contracts, regardless of whether the...

New Hubble Servicing Mission to upgrade instruments

Science.gov (United States)

2006-10-01

The history of the NASA/ESA Hubble Space Telescope is dominated by the familiar sharp images and amazing discoveries that have had an unprecedented scientific impact on our view of the world and our understanding of the universe. Nevertheless, such important contributions to science and humankind have only been possible as result of regular upgrades and enhancements to Hubble’s instrumentation. Using the Space Shuttle for this fifth Servicing Mission underlines the important role that astronauts have played and continue to play in increasing the Space Telescope’s lifespan and scientific power. Since the loss of Columbia in 2003, the Shuttle has been successfully launched on three missions, confirming that improvements made to it have established the required high level of safety for the spacecraft and its crew. “There is never going to be an end to the science that we can do with a machine like Hubble”, says David Southwood, ESA’s Director of Science. “Hubble is our way of exploring our origins. Everyone should be proud that there is a European element to it and that we all are part of its success at some level.” This Servicing Mission will not just ensure that Hubble can function for perhaps as much as another ten years; it will also increase its capabilities significantly in key areas. This highly visible mission is expected to take place in 2008 and will feature several space walks. As part of the upgrade, two new scientific instruments will be installed: the Cosmic Origins Spectrograph and Wide Field Camera 3. Each has advanced technology sensors that will dramatically improve Hubble’s potential for discovery and enable it to observe faint light from the youngest stars and galaxies in the universe. With such an astounding increase in its science capabilities, this orbital observatory will continue to penetrate the most distant regions of outer space and reveal breathtaking phenomena. “Today, Hubble is producing more science than ever before in

EL CADÁVER DE LA IRA COMO EFECTO MARIPOSA: LA REALIZACIÓN DE UN RELATO DE FICCIÓN

OpenAIRE

VALERO MARCO, DANIEL

2016-01-01

[ES] El presente proyecto trata sobre la realización de un cortometraje de ficción con el tema de la ira y el efecto mariposa. En primer lugar se realiza un proceso de documentación teórica en el que se estudia el comportamiento de la ira y se relaciona con el efecto mariposa de la teoría del caos. Tras esto, se plantea la creación de un cortometraje de ficción que refleje las principales conclusiones de la investigación realizada. ...

Finding our Origins with the Hubble and James Webb Space Telescopes

Science.gov (United States)

Gardner, Jonathan P.

2009-01-01

NASA is planning a successor to the Hubble Space Telescope designed to study the origins of galaxies, stars, planets and life in the universe. In this talk, Dr. Gardner will discuss the origin and evolution of galaxies, beginning with the Big Bang and tracing what we have learned with Hubble through to the present day. He will show that results from studies with Hubble have led to plans for its successor, the James Webb Space Telescope. Webb is scheduled to launch in 2014, and is designed to find the first galaxies that formed in the distant past and to penetrate the dusty clouds of gas where stars are still forming today. He will compare Webb to Hubble, and discuss recent progress in the construction of the observatory.

ANOMALOUSLY STEEP REDDENING LAW IN QUASARS: AN EXCEPTIONAL EXAMPLE OBSERVED IN IRAS 14026+4341

International Nuclear Information System (INIS)

Jiang Peng; Zhou Hongyan; Ji Tuo; Shu Xinwen; Liu Wenjuan; Dong Xiaobo; Wang Huiyuan; Wang Tinggui; Wang Jianguo; Bai Jinming

2013-01-01

A fraction of the heavily reddened quasars require a reddening curve that is even steeper than that of the Small Magellanic Cloud. In this paper, we thoroughly characterize the anomalously steep reddening law in quasars via an exceptional example observed in IRAS 14026+4341. By comparing the observed spectrum to the quasar composite spectrum, we derive a reddening curve in the rest-frame wavelength range of 1200-10000 Å. It has a steep rise at wavelengths shorter than 3000 Å, but no significant reddening at longer wavelengths. The absence of dust reddening in the optical continuum is confirmed by the normal broad-line Balmer decrement (the Hα/Hβ ratio) in IRAS 14026+4341. The anomalous reddening curve can be satisfactorily reproduced with a dust model containing silicate grains in a power-law size distribution, dn(a)/da∝a –1.4 , truncated at a maximum size of a max = 70 nm. The unusual size distribution may be caused by the destruction of large 'stardust' grains by quasar activities or a different dust formation mechanism (i.e., the in situ formation of dust grains in quasar outflows). It is also possible that the analogies of the dust grains observed near the Galactic center are responsible for the steep reddening curve. In addition, we find that IRAS 14026+4341 is a weak emission-line quasar (i.e., PHL 1811 analogies) with heavy dust reddening and blueshifted broad absorption lines.

Chemistry of the High-mass Protostellar Molecular Clump IRAS 16562–3959

Science.gov (United States)

Guzmán, Andrés E.; Guzmán, Viviana V.; Garay, Guido; Bronfman, Leonardo; Hechenleitner, Federico

2018-06-01

We present molecular line observations of the high-mass molecular clump IRAS 16562‑3959 taken at 3 mm using the Atacama Large Millimeter/submillimeter Array at 1.″7 angular resolution (0.014 pc spatial resolution). This clump hosts the actively accreting high-mass young stellar object (HMYSO) G345.4938+01.4677, which is associated with a hypercompact H II region. We identify and analyze emission lines from 22 molecular species (encompassing 34 isomers) and classify them into two groups, depending on their spatial distribution within the clump. One of these groups gathers shock tracers (e.g., SiO, SO, HNCO) and species formed in dust grains like methanol (CH3OH), ethenone or ketene (H2CCO), and acetaldehyde (CH3CHO). The second group collects species closely resembling the dust continuum emission morphology and are formed mainly in the gas phase, like hydrocarbons (CCH, c-C3H2, CH3CCH), cyanopolyynes (HC3N and HC5N), and cyanides (HCN and CH3C3N). Emission from complex organic molecules (COMs) like CH3OH, propanenitrile (CH3CH2CN), and methoxymethane (CH3OCH3) arise from gas in the vicinity of a hot molecular core (T ≳ 100 K) associated with the HMYSO. Other COMs such as propyne (CH3CCH), acrylonitrile (CH2CHCN), and acetaldehyde seem to better trace warm (T ≲ 80 K) dense gas. In addition, deuterated ammonia (NH2D) is detected mostly in the outskirts of IRAS 16562‑3959 and associated with near-infrared dark globules, probably gaseous remnants of the clump’s prestellar phase. The spatial distribution of molecules in IRAS 16562‑3959 supports the view that in protostellar clumps, chemical tracers associated with different evolutionary stages—starless to hot cores/H II regions—exist coevally.

Replacement vs. Renovation: The Reincarnation of Hubble Middle School

Science.gov (United States)

Ogurek, Douglas J.

2010-01-01

At the original Hubble Middle School, neither the views (a congested Roosevelt Road and glimpses of downtown Wheaton) nor the century-old facility that offered them was very inspiring. Built at the start of the 20th century, the 250,000-square-foot building was converted from Wheaton Central High School to Hubble Middle School in the early 1980s.…

A Hubble Diagram for Quasars

Directory of Open Access Journals (Sweden)

Susanna Bisogni

2018-01-01

Full Text Available The cosmological model is at present not tested between the redshift of the farthest observed supernovae (z ~ 1.4 and that of the Cosmic Microwave Background (z ~ 1,100. Here we introduce a new method to measure the cosmological parameters: we show that quasars can be used as “standard candles” by employing the non-linear relation between their intrinsic UV and X-ray emission as an absolute distance indicator. We built a sample of ~1,900 quasars with available UV and X-ray observations, and produced a Hubble Diagram up to z ~ 5. The analysis of the quasar Hubble Diagram, when used in combination with supernovae, provides robust constraints on the matter and energy content in the cosmos. The application of this method to forthcoming, larger quasar samples, will also provide tight constraints on the dark energy equation of state and its possible evolution with time.

Delivering Hubble Discoveries to the Classroom

Science.gov (United States)

Eisenhamer, B.; Villard, R.; Weaver, D.; Cordes, K.; Knisely, L.

2013-04-01

Today's classrooms are significantly influenced by current news events, delivered instantly into the classroom via the Internet. Educators are challenged daily to transform these events into student learning opportunities. In the case of space science, current news events may be the only chance for educators and students to explore the marvels of the Universe. Inspired by these circumstances, the education and news teams developed the Star Witness News science content reading series. These online news stories (also available in downloadable PDF format) mirror the content of Hubble press releases and are designed for upper elementary and middle school level readers to enjoy. Educators can use Star Witness News stories to reinforce students' reading skills while exposing students to the latest Hubble discoveries.

Warm absorber and truncated accretion disc in IRAS 05078+1626

Czech Academy of Sciences Publication Activity Database

Svoboda, Jiří; Guainazzi, M.; Karas, Vladimír

2010-01-01

Roč. 512, Mar-Apr (2010), A62/1-A62/8 ISSN 0004-6361 R&D Projects: GA ČR GD205/09/H033; GA ČR GA205/07/0052 Grant - others:ESA(XE) ESA- PECS project No. 98040; Univerzita Karlova(CZ) GAUK 33308 Institutional research plan: CEZ:AV0Z10030501 Keywords : galaxies: active * galaxies: Seyfert * galaxies: individual: IRAS 05078+1626 Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.410, year: 2010

La ira en la primera tradición cidiana

Directory of Open Access Journals (Sweden)

Oscar Martín

2007-11-01

Full Text Available The expressions of the wrath in the Cantar de Mio Cid include a group of traditions of different nature, which constitute a point of departure for the proper interpretation of the text. On the one hand, the ira regia ('regal wrath' is related to the emotional medieval theory on wrath, and, on the other hand, the analysis of the political dimension of wrath in the Cantar and in the preceding Cidian tradition, contributes with new aspects on cultural practices and legal systems in the Middle Ages.

La ira de Dios: sobre ‘Relatos salvajes’ de Damián Szifrón

Directory of Open Access Journals (Sweden)

Gonzalo Aguilar

2017-12-01

Full Text Available “La ira de Dios (sobre ‘Relatos salvajes’ de Damián Szifrón” propone un debate sobre una de las películas argentinas más exitosas de todos los tiempos. En polémica con las lecturas que señalaban y cuestionaban el carácter prepolítico del film y su uso de las pasiones más bajas del público, este ensayo busca otro camino: por un lado, analizar la ira como uno de los capitales políticos más importantes y decisivos de la sociedad contemporánea. Por otro, investigar los vínculos entre la película Relatos salvajes y la pospolítica en la sociedad del espectáculo.

Cataclysmic variables, Hubble-Sandage variables and eta Carinae

International Nuclear Information System (INIS)

Bath, G.T.

1980-01-01

The Hubble-Sandage variables are the most luminous stars in external galaxies. They were first investigated by Hubble and Sandage (1953) for use as distance indicators. Their main characteristics are high luminosity, blue colour indices, and irregular variability. Spectroscopically they show hydrogen and helium in emission with occasionally weaker FeII and [FeII], and no Balmer jump (Humphreys 1975, 1978). In this respect they closely resemble cataclysmic variables, particularly dwarf novae. In the quiescent state dwarf novae show broad H and HeI, together with a strong UV continuum. In contrast to the spectroscopic similarities, the luminosities could hardly differ more. Rather than being the brightest stars known, quiescent dwarf novae are as faint or fainter than the sun. It is suggested that the close correspondence between the spectral appearance of the two classes combined with the difference in luminosity is well accounted for by a model of Hubble-Sandage variables in which the same physical processes are occurring, but on a larger scale. (Auth.)

Cosmic Collisions The Hubble Atlas of Merging Galaxies

CERN Document Server

Christensen, Lars Lindberg; Martin, Davide

2009-01-01

Lars Lindberg Christensen, Raquel Yumi Shida & Davide De Martin Cosmic Collisions: The Hubble Atlas of Merging Galaxies Like majestic ships in the grandest night, galaxies can slip ever closer until their mutual gravitational interaction begins to mold them into intricate figures that are finally, and irreversibly, woven together. It is an immense cosmic dance, choreographed by gravity. Cosmic Collisions contains a hundred new, many thus far unpublished, images of colliding galaxies from the NASA/ESA Hubble Space Telescope. It is believed that many present-day galaxies, including the Milky Way, were assembled from such a coalescence of smaller galaxies, occurring over billions of years. Triggered by the colossal and violent interaction between the galaxies, stars form from large clouds of gas in firework bursts, creating brilliant blue star clusters. The importance of these cosmic encounters reaches far beyond the stunning Hubble images. They may, in fact, be among the most important processes that shape ...

A young bipolar outflow from IRAS 15398-3359

DEFF Research Database (Denmark)

Bjerkeli, Per; Jørgensen, Jes Kristian; Brinch, Christian

2016-01-01

emission towards IRAS 15398-3359. The lineradiative transfer code LIME is used to construct a full 3D model of thesystem taking all relevant components and scales into account. Results: CO, HCO+, and N2H+ aredetected and shown to trace the motions of the outflow. For CO, thecircumstellar envelope...... and the surrounding cloud also have a profoundimpact on the observed line profiles. N2H+ isdetected in the outflow, but is suppressed towards the central region,perhaps because of the competing reaction between CO andH3+ in the densest regions as well as thedestruction of N2H+ by CO.N2D+ is detected in a ridge south...

Nucleus of Comet IRAS-Araki-Alcock (1983 VII)

International Nuclear Information System (INIS)

Sekanina, Z.

1988-01-01

Optical, radar, infrared, UV, and microwave-continuum observations of Comet IRAS-Araki-Alcok were obtained in May 1983, the week of the comet's close approach to earth. The comet has a nucleus dimension and a rotation period which are similar to those of Comet Halley, but a different morphological signature (a persisting sunward fan-shaped coma). Time variations are noted in the projected nucleus cross section. Results suggest significant limb-darkening effects in the relevant domains of radio waves, and that the comet's interior must be extremely cold. It is found that the thermal-infrared fluxes from the inner coma of the comet are dominated by the nucleus. 63 references

Detection of glycolaldehyde toward the solar-type protostar NGC 1333 IRAS2A

DEFF Research Database (Denmark)

Coutens, Audrey; Persson, M. V.; Jørgensen, J. K.

2015-01-01

Glycolaldehyde is a key molecule in the formation of biologically relevant molecules such as ribose. We report its detection with the Plateau de Bure interferometer toward the Class 0 young stellar object NGC 1333 IRAS2A, which is only the second solar-type protostar for which this prebiotic mole...

Hubble expansion in static spacetime

International Nuclear Information System (INIS)

Rossler, Otto E.; Froehlich, Dieter; Movassagh, Ramis; Moore, Anthony

2007-01-01

A recently proposed mechanism for light-path expansion in a static spacetime is based on the moving-lenses paradigm. Since the latter is valid independently of whether space expands or not, a static universe can be used to better see the implications. The moving-lenses paradigm is related to the paradigm of dynamical friction. If this is correct, a Hubble-like law is implicit. It is described quantitatively. A bent in the Hubble-like line is predictably implied. The main underlying assumption is Price's Principle (PI 3 ). If the theory is sound, the greatest remaining problem in cosmology becomes the origin of hydrogen. Since Blandford's jet production mechanism for quasars is too weak, a generalized Hawking radiation hidden in the walls of cosmic voids is invoked. A second prediction is empirical: slow pattern changes in the cosmic microwave background. A third is ultra-high redshifts for Giacconi quasars. Bruno's eternal universe in the spirit of Augustine becomes a bit less outlandish

The Carnegie Hubble Program

Science.gov (United States)

Freedman, Wendy L.; Madore, Barry F.; Scowcroft, Vicky; Mnso, Andy; Persson, S. E.; Rigby, Jane; Sturch, Laura; Stetson, Peter

2011-01-01

We present an overview of and preliminary results from an ongoing comprehensive program that has a goal of determining the Hubble constant to a systematic accuracy of 2%. As part of this program, we are currently obtaining 3.6 micron data using the Infrared Array Camera (IRAC) on Spitzer, and the program is designed to include JWST in the future. We demonstrate that the mid-infrared period-luminosity relation for Cepheids at 3.6 microns is the most accurate means of measuring Cepheid distances to date. At 3.6 microns, it is possible to minimize the known remaining systematic uncertainties in the Cepheid extragalactic distance scale. We discuss the advantages of 3.6 micron observations in minimizing systematic effects in the Cepheid calibration of the Hubble constant including the absolute zero point, extinction corrections, and the effects of metallicity on the colors and magnitudes of Cepheids. We are undertaking three independent tests of the sensitivity of the mid-IR Cepheid Leavitt Law to metallicity, which when combined will allow a robust constraint on the effect. Finally, we are providing a new mid-IR Tully-Fisher relation for spiral galaxies.

ON THE NATURE OF THE ENIGMATIC OBJECT IRAS 19312+1950: A RARE PHASE OF MASSIVE STAR FORMATION?

Energy Technology Data Exchange (ETDEWEB)

Cordiner, M. A.; Charnley, S. B.; Milam, S. N. [Astrochemistry Laboratory, NASA Goddard Space Flight Center, Code 691, 8800 Greenbelt Road, Greenbelt, MD 20771 (United States); Boogert, A. C. A. [Universities Space Research Association, Stratospheric Observatory for Infrared Astronomy, NASA Ames Research Center, MS 232-11, Moffett Field, CA 94035 (United States); Justtanont, K.; Wirström, E. S. [Department of Earth and Space Sciences, Chalmers University of Technology, Onsala Space Observatory, SE-439 92, Onsala (Sweden); Cox, N. L. J. [Instituut voor Sterrenkunde, KU Leuven, Celestijnenlaan 200D, bus 2401, B-3001, Leuven (Belgium); Smith, R. G. [School of Physical, Environmental and Mathematical Sciences, The University of New South Wales, Australian Defence Force Academy, Canberra ACT 2600 (Australia); Tielens, A. G. G. M. [Leiden Observatory, University of Leiden, P.O. Box 9513, NL-2300 RA Leiden (Netherlands); Keane, J. V., E-mail: martin.cordiner@nasa.gov [Institute for Astronomy, University of Hawaii, Honolulu, HI 96822 (United States)

2016-09-01

IRAS 19312+1950 is a peculiar object that has eluded firm characterization since its discovery, with combined maser properties similar to an evolved star and a young stellar object (YSO). To help determine its true nature, we obtained infrared spectra of IRAS 19312+1950 in the range 5–550 μ m using the Herschel and Spitzer space observatories. The Herschel PACS maps exhibit a compact, slightly asymmetric continuum source at 170 μ m, indicative of a large, dusty circumstellar envelope. The far-IR CO emission line spectrum reveals two gas temperature components: ≈0.22 M {sub ⊙} of material at 280 ± 18 K, and ≈1.6 M {sub ⊙} of material at 157 ± 3 K. The O i 63 μ m line is detected on-source but no significant emission from atomic ions was found. The HIFI observations display shocked, high-velocity gas with outflow speeds up to 90 km s{sup −1} along the line of sight. From Spitzer spectroscopy, we identify ice absorption bands due to H{sub 2}O at 5.8 μ m and CO{sub 2} at 15 μ m. The spectral energy distribution is consistent with a massive, luminous (∼2 × 10{sup 4} L {sub ⊙}) central source surrounded by a dense, warm circumstellar disk and envelope of total mass ∼500–700 M {sub ⊙}, with large bipolar outflow cavities. The combination of distinctive far-IR spectral features suggest that IRAS 19312+1950 should be classified as an accreting, high-mass YSO rather than an evolved star. In light of this reclassification, IRAS 19312+1950 becomes only the fifth high-mass protostar known to exhibit SiO maser activity, and demonstrates that 18 cm OH maser line ratios may not be reliable observational discriminators between evolved stars and YSOs.

On the Nature of the Enigmatic Object IRAS 19312+1950: A Rare Phase of Massive Star Formation?

Science.gov (United States)

Cordiner, M. A.; Boogert, A. C. A.; Charnley, S. B.; Justtanont, K.; Cox, N. L. J.; Smith, R. G.; Tielens, A. G. G. M.; Wirstrom, E. S.; Milam, S. N.; Keane, J. V.

2016-01-01

IRAS?19312+1950 is a peculiar object that has eluded firm characterization since its discovery, with combined maser properties similar to an evolved star and a young stellar object (YSO). To help determine its true nature, we obtained infrared spectra of IRAS?19312+1950 in the range 5-550 microns using the Herschel and Spitzer space observatories. The Herschel PACS maps exhibit a compact, slightly asymmetric continuum source at 170 microns, indicative of a large, dusty circumstellar envelope. The far-IR CO emission line spectrum reveals two gas temperature components: approx. = 0.22 Stellar Mass of material at 280+/-18 K, and ˜1.6 Me of material at 157+/-3 K. The OI 63 micron line is detected on-source but no significant emission from atomic ions was found. The HIFI observations display shocked, high-velocity gas with outflow speeds up to 90 km/s along the line of sight. From Spitzer spectroscopy, we identify ice absorption bands due to H2O at 5.8 microns and CO2 at 15 microns. The spectral energy distribution is consistent with a massive, luminous (approx. 2 × 10(exp 4) Stellar Luminosity) central source surrounded by a dense, warm circumstellar disk and envelope of total mass approx. 500-700 Stellar Mass with large bipolar outflow cavities. The combination of distinctive far-IR spectral features suggest that IRAS19312+1950 should be classified as an accreting, high-mass YSO rather than an evolved star. In light of this reclassification, IRAS19312+1950 becomes only the fifth high-mass protostar known to exhibit SiO maser activity, and demonstrates that 18 cm OH maser line ratios may not be reliable observational discriminators between evolved stars and YSOs.

Symbiotic stars according to IRAS observations

International Nuclear Information System (INIS)

Luud, L.; Tuvikene, T.

1987-01-01

Symbiotic stars contained in Allen's catalog are examined with a view to establishing their coincidence with sources of far infrared radiation in the catalog of point sources observed with the IRAS satellite. Altogether, 72 symbiotic or suspected symbiotic objects have been identified. A list of the identified stars has been compiled, and the energy distributions in the infrared spectra of selected stars are given. It has been found that the presence of dust in symbiotic systems is a more widespread phenomenon than hitherto believed. Almost 40% of them are dust systems. Among them, objects with dust temperature of several tens of degrees kelvin have been found. It is shown that the only useful two-color diagram is the (K - m 12 )-(m 12 - m 25 ) diagram. Finally, attention is drawn to a type of symbiotic stars having cold components of the spectral class G; these require a special investigation

Niveles de ira en deportistas: diferencias en función del grado de contacto y el género. [Anger intensity in sportspeople: differences based on contact and gender].

Directory of Open Access Journals (Sweden)

José Ignacio Menéndez-Santurio

2017-10-01

Full Text Available Los objetivos de este estudio fueron tres: (1 analizar los niveles de ira de las personas en función del grado de contacto en el deporte practicado, (2 examinar los niveles de ira en función del género, y (3 determinar posibles correlaciones entre la ira y la edad, los años, los días y las horas semanales de práctica. 398 personas (188 hombres y 210 mujeres entre 16 y 35 años accedieron a participar: 148 competidores de deportes de contacto, 138 de deportes sin contacto y 112 no practicantes. Se llevó a cabo una investigación cuantitativa de tipo comparativa transversal. Se utilizó el Inventario de la Expresión de la Ira Estado-Rasgo. Los resultados mostraron diferencias significativas (p < 0,05 en el sentimiento de ira entre no practicantes y practicantes de deportes sin contacto, en la expresión verbal de la ira entre practicantes de deportes de contacto y sin contacto y en la reacción a la ira entre no-practicantes y practicantes de deportes de contacto. Asimismo, se hallaron diferencias significativas (p < 0,05 en las variables rasgo de ira, control interno de ira y expresión física de la ira en función del género. También se encontraron correlaciones negativas significativas (p < 0,05 entre la edad, días y años de práctica y la ira. Estos hallazgos señalan que los niveles de ira se ven afectados por la cantidad, intensidad y grado de contacto de su práctica deportiva, así como por el género. Abstract The aims of this study were three: (1 to assess individuals’ anger levels based on the contact in the sport, (2 to examine anger levels based on gender, and (3 to determine possible correlations between anger and age, years, days, and hours of practice. 398 individuals (188 males and 210 females between 16 and 35 years agreed to participate: 148 contact-sport competitors, 138 contactless sport and 112 individuals who did not practice any sport. A comparative, transversal quantitative research design was carried out

Hubble Space Telescope: a Vision to 2020 and Beyond: The Hubble Source Catalog

Science.gov (United States)

Strolger, Louis-Gregory

2016-01-01

The Hubble Source Catalog (HSC) is an initiative centered on what science would be enabled by a master catalog of all the sources HST has imaged over its lifetime. The first version of this catalog was released in early 2015, and included approximately 30 million sources from archived direct imaging with WFPC2, ACS (through 2011), and WFC3 (to 2014). Version 2, scheduled for release in early 2016, will feed off the Hubble Legacy Archive DR9 release, updating the ACS sources with more detections, and more direct imaging, through to mid-2015. This talk will overview the properties and goals of the HSC in terms of its source detection, object resolution, confusion limits, and overall astrometric and photometric precision. I will also discuss the connections to other MAST activities (e.g., the Discovery Portal interface), to STScI and user products (e.g., the Spectroscopic Catalog and High-Level Science Products), and to community resources (e.g., Pan-STARRS, SDSS, and eventually GAIA). The HSC successfully amalgamates the diverse observations with HST, and despite the limitations in uniformity on the sky, will be an important reference for JWST, LSST, and other future telescopes.

IRAS 14348-1447, an Ultraluminous Pair of Colliding, Gas-Rich Galaxies: The Birth of a Quasar?

Science.gov (United States)

Sanders, D B; Scoville, N Z; Soifer, B T

1988-02-05

Ground-based observations of the object IRAS 14348-1447, which was discovered with the Infrared Astronomical Satellite, show that it is an extremely luminous colliding galaxy system that emits more than 95 percent of its energy at far-infrared wavelengths. IRAS 14348-1447, which is receeding from the sun at 8 percent of the speed of light, has a bolometric luminosity more than 100 times larger than that of our galaxy, and is therefore as luminous as optical quasars. New optical, infrared, and spectroscopic measurements suggest that the dominant luminosity source is a dustenshrouded quasar. The fuel for the intense activity is an enormous supply of molecular gas. Carbon monoxide emission has been detected at a wavelength of 2.6 millimeters by means of a new, more sensitive receiver recently installed on the 12-meter telescope of the National Radio Astronomy Observatory. IRAS 14348-1447 is the most distant and luminous source of carbon monoxide line emission yet detected. The derived mass of interstellar molecular hydrogen is 6 x 10(10) solar masses. This value is approximately 20 times that of the molecular gas content of the Milky Way and is similar to the largest masses of atomic hydrogen found in galaxies. A large mass of molecular gas may be a prerequisite for the formation of quasars during strong galactic collisions.

Development and validation of a questionnaire (the IRA-AGHN to assess teachers' knowledge of Attention Deficit Hyperactivity Disorder

Directory of Open Access Journals (Sweden)

Marian Soroa

2014-10-01

Full Text Available The purpose of this study was to develop a questionnaire, called IRA-AGHN, to assess infant and primary school teachers' knowledge of Attention Deficit Hyperactivity Disorder. The psychometric properties of this questionnaire were examined in a sample of 752 teachers aged between 20 and 64 years (M = 41.57; SD = 9.69. These teachers were employed at 84 randomly selected schools in the Autonomous Community of the Basque Country and Navarre. The factor validity, internal consistency, temporal stability, convergent validity and external validity of the instrument were all analysed. The results suggest that the IRA-AGHN is a valid and reliable measure for assessing teachers' knowledge of ADHD.

The infrared emission bands. III. Southern IRAS sources.

Science.gov (United States)

Cohen, M; Tielens, A G; Bregman, J; Witteborn, F C; Rank, D M; Allamandola, L J; Wooden, D H; de Muizon, M

1989-06-01

We present airborne 5-8 micrometers spectra of southern IRAS sources which reveal strong polycyclic aromatic hydrocarbon (PAH) emission features. The good correlation between the bands, in particular the dominant 6.2 and "7.7" micrometers features, strongly imply a common carrier, reinforcing the PAH hypothesis. However, small but detectable spectral variations exist. Planetaries have a distinctly different ratio of I(6.2)/I(7.7) than other nebulae, accompanied by a redward shift in the actual wavelength of the "7.7" micrometers peak. Further, we have detected a new feature, previously predicted from laboratory spectra of PAH molecules, at 5.2 micrometers in many of these sources. Spectra of two rare [WC 10] planetary nebular nuclei indicate a very prominent plateau of emission, linking the 6.2 and 7.7 micrometers bands. Several of our sources show definite evidence for emission structure between 14 and 23 micrometers in their IRAS Low-Resolution Spectral Atlas spectra: we attribute this structure to PAH bands. too. We have defined the "generic" spectrum of emission bands relating the mean intensities of each band to that of the strongest, near 7.7 micrometers. We have added three more planetary or protoplanetary nebulae to our correlation between 7.7 micrometers band intensity and nebular gas phase C/O ratio, namely NGC 6302, HR 4049, and the highly carbon-rich [WC 10] nucleus, CPD--56 degrees 8032. For the latter we have determined a ratio for C/O of approximately 4.8 from IUE observations. The good correlation between the intensity ratio of the "7.7" micrometers feature relative to the far-infrared dust continuum and nebular C/O also supports a carbonaceous carrier for these emission features.

Dante, i diavoli e l'ira di Virgilio

Directory of Open Access Journals (Sweden)

Federico Saviotti

2014-07-01

Full Text Available Riassunto: Numerosi interventi critici hanno analizzato ad ogni livello la diablerie che Dante mette in scena in If. XXI-XXIII; tuttavia, la sua eccentricità formale e contenutistica rispetto al resto del poema sembra ancora imbarazzare gli esegeti. In questo articolo si cerca di giustificarne la coerenza nel quadro della poetica della comedìa dantesca, concentrandosi su alcuni aspetti di particolare interesse: tra questi, l’opportunità di una lettura carnevalesca – in senso bachtiniano – della diablerie e il senso del “riso” di cui questa è portatrice; la presenza di un rovesciamento intra-testuale definibile come “auto-parodico” rispetto alla scena di If. VIII-IX e apprezzabile a partire dalla rappresentazione dei diversi personaggi; la “sconfitta” due volte patita da Virgilio nei confronti dei diavoli e la definizione, in entrambi ed altri casi, della sua ira. Abstract: Many scholars have analyzed at any level the diablerie Dante puts on stage in If. XXI-XXIII; nevertheless, its formal and substantial eccentricity compared with the rest of the poem still seems to puzzle the commentators. In this paper I will try to demonstrate its coherence with the poetics of Dante’s comedìa, by focusing on some very interesting elements: the opportunity of a bachtinian interpretation of the diablerie as a carnival expression and the meaning of the “laughter” it conveys; the presence of an intra-textual reversal which may be defined as “auto-parodic” in respect to the scene in If. VIII-IX and appreciated through the poetic representation of the different characters; the “defeat” which Virgilio undergoes twice against the devils and the definition, in both and other cases, of its ira.  

Radar observations of Comet IRAS-Araki-Alcock 1983d

International Nuclear Information System (INIS)

Harmon, J.K.; Hine, A.A.; Campbell, D.B.; Shapiro, I.I.; Marsden, B.G.

1989-01-01

A detailed analysis and interpretation of the Arecibo S-band radar observations of Comet IRAS-Araki-Alcock 1983d are presented. The very high signal strengths are used to make an accurate determination of the shape of the echo spectrum in the two orthogonal senses of circular polarization. The narrow-band component is used to place constraints on the size, rotation, period, reflectivity, and roughness of the nucleus. Detailed analysis of the broadband component yields estimates of, or bounds on, the spatial extent, position, and mass of the particle cloud, as well as the effective size of the constituent particles. 41 references

Stray radiation and the Infrared Astronomical Satellite /IRAS/ telescope

Science.gov (United States)

Noll, R. J.; Harned, R.; Breault, R. P.; Malugin, R.

1981-01-01

Stray light control is a major consideration in the design of infrared cryogenically cooled telescopes such as the Infrared Astronomical Satellite (IRAS). The basic design of the baffle system, and the placement, shape, and coating of the secondary support struts for the telescope subsystem are described. The intent of this paper is to highlight the stray light problems encountered while designing the system, and to illustrate how computer analysis can be a useful design aid. Scattering measurements of the primary mirror, and a full system level scatter measurement are presented. Comparisons of predicted performance with the measured results are also presented.

Near-infrared observations of IRAS minisurvey galaxies

International Nuclear Information System (INIS)

Carico, D.P.; Soifer, B.T.; Elias, J.H.; Matthews, K.; Neugebauer, G.; Beichman, C.; Persson, C.J.; Persson, S.E.

1987-01-01

Near infrared photometry at J, H, and K was obtained for 82 galaxies from the IRAS minisurvey. The near infrared colors of these galaxies cover a larger range in J-H and H-K than do normal field spiral galaxies, and evidence is presented of a tighter correlation between the near and far infrared emission in far infrared bright galaxies than exists between the far infrared and the visible emission. These results suggest the presence of dust in the far infrared bright galaxies, with hot dust emission contributing to the 2.2 micron emission, and extinction by dust affecting both the near infrared colors and the visible luminosities. In addition, there is some indication that the infrared emission in many of the minisurvey galaxies is coming from a strong nuclear component

Poblacion estelar joven embebida en la nube molecular galactica asociada a la fuente IRAS 18236-1205

Science.gov (United States)

Romero, Ricardo Retes

2008-06-01

En esta tesis presento una metodología de seleccion y estudio de la población estelar embebida en la nube molecular galactica asociada a la fuente IRAS 18236-1205. La fuente IRAS posee colores de region Ultra Compacta HII (UCHII) y tiene deteccióon en monosulfuro de carbono (CS), trazador molecular de alta densidad, lo cual da la posibilidad de definir la nube molecular asociada hacia esta region. Lo anterior muestra que esta es buena candidata a región de formación estelar masiva. La metodología de seleccion de la población embebida, est à basada por una parte, en la distribución del gas molecular monoxido de carbono (13CO) asociado a la fuente IRAS, nube molecular seleccionada del mapeo Galactic Ring Survey (GRS) realizado en 13CO. Otros pasos de la seleccion, se basan en los diagramas color-color y color-magnitud con datos del cercano infrarrrojo de 2MASS. Para el estudio de la componente estelar se usaron los catalogos de fuentes puntuales en el cercano, medio y lejano infrarrojo de 2MASS, SPITZER e IRAS, respectivamente. De los diagramas color-color y color-magnitud, usando datos de 2MASS, se construyo un criterio fotométrico para identificar los objetos estelares j ovenes embebidos en la region molecular. Aplicando modelos a la distribución espectral de energía (SED) de algunos ellos, se encontraron parametros estelares de objetos estelares j ovenes embebidos de masa intermedia y alta. Adicionalmente, se encontro un objeto de masa ´ intermedia no identifiado por el catalogo de 2MASS y su efecto sobre el medio interestelar, emision en la banda de [4.5] μm de IRAC-Spitzer asociado a un outflow. Dos de los objetos seleccionados por el criterio fotometrico resultaron ser objetos estelares jovenes de alta e intermedia masa (B1V/B2V y B8V/A0V respectivamente), los cuales deben estar asociados a la emision radiativa responsable de los colores de región UC HII. Otro objeto estelar joven de baja masa (F0V/F5V) fue encontrado en la region de estudio

The Infrared Astronomical Satellite (IRAS) mission

Science.gov (United States)

Neugebauer, G.; Habing, H. J.; Van Duinen, R.; Aumann, H. H.; Beichman, C. A.; Baud, B.; Beintema, D. A.; Boggess, N.; Clegg, P. E.; De Jong, T.

1984-01-01

The Infrared Astronomical Satellite (IRAS) consists of a spacecraft and a liquid helium cryostat that contains a cooled IR telescope. The telescope's focal plane assembly is cooled to less than 3 K, and contains 62 IR detectors in the survey array which are arranged so that every source crossing the field of view can be seen by at least two detectors in each of four wavelength bands. The satellite was launched into a 900 km-altitude near-polar orbit, and its cryogenic helium supply was exhausted on November 22, 1983. By mission's end, 72 percent of the sky had been observed with three or more hours-confirming scans, and 95 percent with two or more hours-confirming scans. About 2000 stars detected at 12 and 25 microns early in the mission, and identified in the SAO (1966) catalog, have a positional uncertainty ellipse whose axes are 45 x 9 arcsec for an hours-confirmed source.

Antimicrobial Photoinactivation Using Visible Light Plus Water-Filtered Infrared-A (VIS + wIRA Alters In Situ Oral Biofilms.

Directory of Open Access Journals (Sweden)

A Al-Ahmad

Full Text Available Recently, growing attention has been paid to antimicrobial photodynamic therapy (aPDT in dentistry. Changing the microbial composition of initial and mature oral biofilm by aPDT using visible light plus water-filtered infrared-A wavelengths (VIS + wIRA has not yet been investigated. Moreover, most aPDT studies have been conducted on planktonic bacterial cultures. Therefore, in the present clinical study we cultivated initial and mature oral biofilms in six healthy volunteers for 2 hours or 3 days, respectively. The biofilms were treated with aPDT using VIS+wIRA (200 mW cm(-2, toluidine blue (TB and chlorine e6 (Ce6 for 5 minutes. Chlorhexidine treated biofilm samples served as positive controls, while untreated biofilms served as negative controls. After aPDT treatment the colony forming units (CFU of the biofilm samples were quantified, and the surviving bacteria were isolated in pure cultures and identified using MALDI-TOF, biochemical tests and 16S rDNA-sequencing. aPDT killed more than 99.9% of the initial viable bacterial count and 95% of the mature oral biofilm in situ, independent of the photosensitizer. The number of surviving bacterial species was highly reduced to 6 (TB and 4 (Ce6 in the treated initial oral biofilm compared to the 20 different species of the untreated biofilm. The proportions of surviving bacterial species were also changed after TB- and Ce6-mediated aPDT of the mature oral biofilm, resulting in a shift in the microbial composition of the treated biofilm compared to that of the control biofilm. In conclusion, aPDT using VIS + wIRA showed a remarkable potential to eradicate both initial and mature oral biofilms, and also to markedly alter the remaining biofilm. This encourages the clinical use of aPDT with VIS + wIRA for the treatment of periimplantitis and periodontitis.

Observational constraint on spherical inhomogeneity with CMB and local Hubble parameter

Science.gov (United States)

Tokutake, Masato; Ichiki, Kiyotomo; Yoo, Chul-Moon

2018-03-01

We derive an observational constraint on a spherical inhomogeneity of the void centered at our position from the angular power spectrum of the cosmic microwave background (CMB) and local measurements of the Hubble parameter. The late time behaviour of the void is assumed to be well described by the so-called Λ-Lemaȋtre-Tolman-Bondi (ΛLTB) solution. Then, we restrict the models to the asymptotically homogeneous models each of which is approximated by a flat Friedmann-Lemaȋtre-Robertson-Walker model. The late time ΛLTB models are parametrized by four parameters including the value of the cosmological constant and the local Hubble parameter. The other two parameters are used to parametrize the observed distance-redshift relation. Then, the ΛLTB models are constructed so that they are compatible with the given distance-redshift relation. Including conventional parameters for the CMB analysis, we characterize our models by seven parameters in total. The local Hubble measurements are reflected in the prior distribution of the local Hubble parameter. As a result of a Markov-Chains-Monte-Carlo analysis for the CMB temperature and polarization anisotropies, we found that the inhomogeneous universe models with vanishing cosmological constant are ruled out as is expected. However, a significant under-density around us is still compatible with the angular power spectrum of CMB and the local Hubble parameter.

A Toy Cosmology Using a Hubble-Scale Casimir Effect

Directory of Open Access Journals (Sweden)

Michael E. McCulloch

2014-02-01

Full Text Available The visible mass of the observable universe agrees with that needed for a flat cosmos, and the reason for this is not known. It is shown that this can be explained by modelling the Hubble volume as a black hole that emits Hawking radiation inwards, disallowing wavelengths that do not fit exactly into the Hubble diameter, since partial waves would allow an inference of what lies outside the horizon. This model of “horizon wave censorship” is equivalent to a Hubble-scale Casimir effect. This incomplete toy model is presented to stimulate discussion. It predicts a minimum mass and acceleration for the observable universe which are in agreement with the observed mass and acceleration, and predicts that the observable universe gains mass as it expands and was hotter in the past. It also predicts a suppression of variation on the largest cosmic scales that agrees with the low-l cosmic microwave background anomaly seen by the Planck satellite.

Building the Hubble Space Telescope

International Nuclear Information System (INIS)

O'dell, C.R.

1989-01-01

The development of the design for the Hubble Space Telescope (HST) is discussed. The HST optical system is described and illustrated. The financial and policy issues related to the development of the HST are considered. The actual construction of the HST optical telescope is examined. Also, consideration is given to the plans for the HST launch

Current Diagnosis and Management of Immune Related Adverse Events (irAEs Induced by Immune Checkpoint Inhibitor Therapy

Directory of Open Access Journals (Sweden)

Vivek Kumar

2017-02-01

Full Text Available The indications of immune checkpoint inhibitors (ICIs are set to rise further with the approval of newer agent like atezolimumab for use in patients with advanced stage urothelial carcinoma. More frequent use of ICIs has improved our understanding of their unique side effects, which are known as immune-related adverse events (irAEs. The spectrum of irAEs has expanded beyond more common manifestations such as dermatological, gastrointestinal and endocrine effects to rarer presentations involving nervous, hematopoietic and urinary systems. There are new safety data accumulating on ICIs in patients with previously diagnosed autoimmune conditions. It is challenging for clinicians to continuously update their working knowledge to diagnose and manage these events successfully. If diagnosed timely, the majority of events are completely reversible, and temporary immunosuppression with glucocorticoids, infliximab or other agents is warranted only in the most severe grade illnesses. The same principles of management will possibly apply as newer anti- cytotoxic T lymphocytes-associated antigen 4 (CTLA-4 and programmed cell death protein 1 (PD-1/PD-L1 antibodies are introduced. The current focus of research is for prophylaxis and for biomarkers to predict the onset of these toxicities. In this review we summarize the irAEs of ICIs and emphasize their growing spectrum and their management algorithms, to update oncology practitioners.

Adsorption of uranium(VI) from sulphate solutions using Amberlite IRA-402 resin: Equilibrium, kinetics and thermodynamics study

International Nuclear Information System (INIS)

Solgy, Mostafa; Taghizadeh, Majid; Ghoddocynejad, Davood

2015-01-01

Highlights: • Adsorption of uranium from sulphate solutions by an anion exchange resin. • The effects of pH, contact time and adsorbent dosage were investigated. • The adsorption equilibrium is well described by the Freundlich isotherm model. • The adsorption kinetics can be predicted by the pseudo second-order model. • The adsorption is a physical, spontaneous and endothermic process. - Abstract: In the present study, adsorption of uranium from sulphate solutions was evaluated using Amberlite IRA-402 resin. The variation of adsorption process was investigated in batch sorption mode. The parameters studied were pH, contact time and adsorbent dosage. Langmuir and Freundlich isotherm models were used in order to present a mathematical description of the equilibrium data at three different temperatures (25 °C, 35 °C and 45 °C). The final results confirmed that the equilibrium data tend to follow Freundlich isotherm model. The maximum adsorption capacity of Amberlite IRA-402 for uranium(VI) was evaluated to be 213 mg/g for the Langmuir model at 25 °C. The adsorption of uranium on the mentioned anion exchange resin was found to follow the pseudo-second order kinetic model, indicating that chemical adsorption was the rate limiting-step. The values of thermodynamic parameters proved that adsorption process of uranium onto Amberlite IRA-402 resin could be considered endothermic (ΔH > 0) and spontaneous (ΔG < 0)

Newly discovered IRAS QSO close to the Galactic plane

International Nuclear Information System (INIS)

Strauss, M.A.; Kirhakos, S.D.; Yahil, A.

1988-01-01

CCD observations of the IRAS QSO candidate I09149-6206 performed at CTIO during December 1987 are reported, including 564-806-nm spectroscopy obtained with the 1.5-m telescope and direct UVBRI imaging obtained with the 0.91-m telescope. The data are presented in tables and graphs and characterized in detail. It is found that the source is surrounded by a faint fuzz with low surface brightness and strong forbidden O III lines. Parameters determined include redshift z = 0.0571, Galactic latitude -9.2 deg, V magnitude 13.55, Galactic reddening E(B-V) = about 0.23, and absolute V magnitude about -24.87. 33 references

Hubble peers inside a celestial geode

Science.gov (United States)

2004-08-01

celestial geode hi-res Size hi-res: 148 Kb Credits: ESA/NASA, Yäel Nazé (University of Liège, Belgium) and You-Hua Chu (University of Illinois, Urbana, USA) Hubble peers inside a celestial geode In this unusual image, the NASA/ESA Hubble Space Telescope captures a rare view of the celestial equivalent of a geode - a gas cavity carved by the stellar wind and intense ultraviolet radiation from a young hot star. Real geodes are handball-sized, hollow rocks that start out as bubbles in volcanic or sedimentary rock. Only when these inconspicuous round rocks are split in half by a geologist, do we get a chance to appreciate the inside of the rock cavity that is lined with crystals. In the case of Hubble's 35 light-year diameter ‘celestial geode’ the transparency of its bubble-like cavity of interstellar gas and dust reveals the treasures of its interior. Low resolution version (JPG format) 148 Kb High resolution version (TIFF format) 1929 Kb Acknowledgment: This image was created with the help of the ESA/ESO/NASA Photoshop FITS Liberator. Real geodes are handball-sized, hollow rocks that start out as bubbles in volcanic or sedimentary rock. Only when these inconspicuous round rocks are split in half by a geologist, do we get a chance to appreciate the inside of the rock cavity that is lined with crystals. In the case of Hubble's 35 light-year diameter ‘celestial geode’ the transparency of its bubble-like cavity of interstellar gas and dust reveals the treasures of its interior. The object, called N44F, is being inflated by a torrent of fast-moving particles (what astronomers call a 'stellar wind') from an exceptionally hot star (the bright star just below the centre of the bubble) once buried inside a cold dense cloud. Compared with our Sun (which is losing mass through the so-called 'solar wind'), the central star in N44F is ejecting more than a 100 million times more mass per second and the hurricane of particles moves much faster at 7 million km per hour

The Dense Molecular Gas and Nuclear Activity in the ULIRG IRAS 13120–5453

Energy Technology Data Exchange (ETDEWEB)

Privon, G. C.; Treister, E. [Instituto de Astrofśica, Facultad de Física, Pontificia Universidad Católica de Chile, Casilla 306, Santiago 22 (Chile); Aalto, S.; Falstad, N.; Muller, S.; Costagliola, F. [Department of Earth and Space Sciences, Chalmers University of Technology, Onsala Space Observatory, SE-439 94 Onsala (Sweden); González-Alfonso, E. [Universidad de Alcalá, Departamento de Física y Matemáticas, Campus Universitario, E-28871 Alcalá de Henares, Madrid (Spain); Sliwa, K. [Max Planck Institute for Astronomy, Königstuhl 17, D-69117 Heidelberg (Germany); Armus, L. [Spitzer Science Center, California Institute of Technology, MS 220-6, Pasadena, CA, 91125 (United States); Evans, A. S. [Department of Astronomy, University of Virginia, Charlottesville, VA 22903 (United States); Garcia-Burillo, S. [Observatorio de Madrid, OAN-IGN, Alfonso XII, 3, E-28014-Madrid (Spain); Izumi, T. [Institute of Astronomy, School of Science, The University of Tokyo, 2-21-1 Osawa, Mitaka, Tokyo 181-0015 (Japan); Sakamoto, K. [Institute of Astronomy and Astrophysics, Academia Sinica, P.O. Box 23-141, 10617, Taipei, Taiwan (China); Werf, P. van der [Leiden Observatory, Leiden University, P.O. Box 9513, 2300 RA Leiden (Netherlands); Chu, J. K. [Institute for Astronomy, University of Hawaii, 2680 Woodlawn Drive, Honolulu, HI 96822 (United States)

2017-02-01

We present new Atacama Large Millimeter/submillimeter Array Band 7 (∼340 GHz) observations of the dense gas tracers HCN, HCO{sup +}, and CS in the local, single-nucleus, ultraluminous infrared galaxy IRAS 13120–5453. We find centrally enhanced HCN (4–3) emission, relative to HCO{sup +} (4–3), but do not find evidence for radiative pumping of HCN. Considering the size of the starburst (0.5 kpc) and the estimated supernovae rate of ∼1.2 yr{sup −1}, the high HCN/HCO{sup +} ratio can be explained by an enhanced HCN abundance as a result of mechanical heating by the supernovae, though the active galactic nucleus and winds may also contribute additional mechanical heating. The starburst size implies a high Σ{sub IR} of 4.7 × 10{sup 12} L {sub ⊙} kpc{sup −2}, slightly below predictions of radiation-pressure limited starbursts. The HCN line profile has low-level wings, which we tentatively interpret as evidence for outflowing dense molecular gas. However, the dense molecular outflow seen in the HCN line wings is unlikely to escape the Galaxy and is destined to return to the nucleus and fuel future star formation. We also present modeling of Herschel observations of the H{sub 2}O lines and find a nuclear dust temperature of ∼40 K. IRAS 13120–5453 has a lower dust temperature and Σ{sub IR} than is inferred for the systems termed “compact obscured nuclei (CONs)” (such as Arp 220 and Mrk 231). If IRAS 13120–5453 has undergone a CON phase, we are likely witnessing it at a time when the feedback has already inflated the nuclear ISM and diluted star formation in the starburst/active galactic nucleus core.

European astronaut selected for the third Hubble Space Telescope

Science.gov (United States)

1998-08-01

The STS-104 crew will rendezvous with the orbiting Hubble Space Telescope, which is the size of a city bus, capture it using the Shuttle's Canadian robot arm and secure it in Columbia's payload bay. Then, working in teams of two, the four astronauts will leave the Shuttle's pressurised cabin and venture into the payload bay, performing a variety of tasks that will improve the productivity and reliability of the telescope. The four astronauts will perform a series of six "extravehicular" activities in the open space environment. Such activities are commonly called spacewalks, but this term does little justice to the considerable physical and mental efforts that astronauts need to make in doing the very demanding work involved. The Shuttle commander and pilot for this flight have not yet been appointed, but the four designated mission specialists begin training for the STS-104 mission immediately. "The ambitious nature of this mission, with its six spacewalks, made it important for the payload crew to begin training as early as possible," said David C. Leestma, NASA Director of Flight Crew Operations at the Johnson Space Center in Houston, to which Claude Nicollier is on resident assignment from ESA's European Astronaut Centre in Cologne, Germany, the home base of the European astronaut corps. The Hubble Space Telescope was launched into orbit in April 1990. It is one of the most capable optical telescopes available to astronomers today, producing images and spectral observations at the forefront of astronomy. The European Space Agency contributed a 15 share to the development of Hubble. One of the five scientific instruments on board, the Faint Object Camera, was built by a European industrial consortium made up of British Aerospace, Dornier and Matra under a contract with the European Space Agency. The solar arrays which provide Hubble with electrical power were manufactured by British Aerospace and Dornier. In its eight years of operation, the telescope has not

Manejo de las infecciones respiratorias agudas (IRA en una comunidad kaqchiquel de Guatemala

Directory of Open Access Journals (Sweden)

Sáenz de Tejada Sandra

1997-01-01

Full Text Available Las infecciones respiratorias agudas (IRA figuran entre las principales causas de morbilidad y mortalidad infantiles en América Latina. En Guatemala, la neumonía es la primera causa de muerte en niños pequeños y ocasiona aproximadamente una tercera parte de las consultas ambulatorias a servicios pediátricos. Una buena proporción de estas muertes se deben a un manejo deficiente, atribuible a la falta de reconocimiento de los primeros signos de neumonía, a la presencia de barreras que impiden una búsqueda inmediata de atención, a la consulta a proveedores inapropiados o a recomendaciones terapéuticas inadecuadas. El propósito de esta breve investigación cualitativa fue estudiar las percepciones y los comportamientos de los habitantes de San Juan Comalapa, comunidad kaqchiquel en el altiplano central de Guatemala, en lo que respecta a las IRA. Se entrevistó a 32 madres en su domicilio con el fin de determinar cómo clasificaban las IRA y qué signos y síntomas las hacían buscar atención inmediata. Los resultados revelaron que las madres sabían reconocer la presencia de respiración rápida, pero no de tiraje respiratorio (dos signos importantes de neumonía. Cuando buscaban atención, solían acudir a médicos u otros proveedores en centros de salud y ocasionalmente en consultorios privados, pero la búsqueda raras veces era oportuna debido a la poca accesibilidad de los servicios y a la subestimación de la gravedad de los síntomas. Esta conducta podría modificarse por medio de una intervención educativa. Al final se hacen recomendaciones orientadas a mejorar la comunicación verbal entre los proveedores de atención de salud y las madres.

Manejo de las infecciones respiratorias agudas (IRA en una comunidad kaqchiquel de Guatemala

Directory of Open Access Journals (Sweden)

Sandra Sáenz de Tejada

1997-04-01

Full Text Available Las infecciones respiratorias agudas (IRA figuran entre las principales causas de morbilidad y mortalidad infantiles en América Latina. En Guatemala, la neumonía es la primera causa de muerte en niños pequeños y ocasiona aproximadamente una tercera parte de las consultas ambulatorias a servicios pediátricos. Una buena proporción de estas muertes se deben a un manejo deficiente, atribuible a la falta de reconocimiento de los primeros signos de neumonía, a la presencia de barreras que impiden una búsqueda inmediata de atención, a la consulta a proveedores inapropiados o a recomendaciones terapéuticas inadecuadas. El propósito de esta breve investigación cualitativa fue estudiar las percepciones y los comportamientos de los habitantes de San Juan Comalapa, comunidad kaqchiquel en el altiplano central de Guatemala, en lo que respecta a las IRA. Se entrevistó a 32 madres en su domicilio con el fin de determinar cómo clasificaban las IRA y qué signos y síntomas las hacían buscar atención inmediata. Los resultados revelaron que las madres sabían reconocer la presencia de respiración rápida, pero no de tiraje respiratorio (dos signos importantes de neumonía. Cuando buscaban atención, solían acudir a médicos u otros proveedores en centros de salud y ocasionalmente en consultorios privados, pero la búsqueda raras veces era oportuna debido a la poca accesibilidad de los servicios y a la subestimación de la gravedad de los síntomas. Esta conducta podría modificarse por medio de una intervención educativa. Al final se hacen recomendaciones orientadas a mejorar la comunicación verbal entre los proveedores de atención de salud y las madres.

Dynamical structure of the inner 100 AU of the deeply embedded protostar IRAS 16293–2422

Energy Technology Data Exchange (ETDEWEB)

Favre, Cécile; Field, David [Department of Physics and Astronomy, University of Aarhus, Ny Munkegade 120, DK-8000 Aarhus C (Denmark); Jørgensen, Jes K.; Brinch, Christian; Bisschop, Suzanne E. [Centre for Star and Planet Formation, Niels Bohr Institute, University of Copenhagen, Juliane Maries Vej 30, DK-2100 Copenhagen Ø (Denmark); Bourke, Tyler L. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street MS42, Cambridge, MA 02138 (United States); Hogerheijde, Michiel R. [Leiden Observatory, Leiden University, P.O. Box 9513, 2300-RA Leiden (Netherlands); Frieswijk, Wilfred W. F., E-mail: cfavre@umich.edu [Netherlands Institute for Radio Astronomy, Postbus 2, 7990-AA Dwingeloo (Netherlands)

2014-07-20

A fundamental question about the early evolution of low-mass protostars is when circumstellar disks may form. High angular resolution observations of molecular transitions in the (sub)millimeter wavelength windows make it possible to investigate the kinematics of the gas around newly formed stars, for example, to identify the presence of rotation and infall. IRAS 16293–2422 was observed with the extended Submillimeter Array (eSMA) resulting in subarcsecond resolution (0.''46 × 0.''29, i.e., ∼55 × 35 AU) images of compact emission from the C{sup 17}O (3-2) and C{sup 34}S (7-6) transitions at 337 GHz (0.89 mm). To recover the more extended emission we have combined the eSMA data with SMA observations of the same molecules. The emission of C{sup 17}O (3-2) and C{sup 34}S (7-6) both show a velocity gradient oriented along a northeast-southwest direction with respect to the continuum marking the location of one of the components of the binary, IRAS 16293A. Our combined eSMA and SMA observations show that the velocity field on the 50-400 AU scales is consistent with a rotating structure. It cannot be explained by simple Keplerian rotation around a single point mass but rather needs to take into account the enclosed envelope mass at the radii where the observed lines are excited. We suggest that IRAS 16293–2422 could be among the best candidates to observe a pseudo-disk with future high angular resolution observations.

Hubble Source Catalog

Science.gov (United States)

Lubow, S.; Budavári, T.

2013-10-01

We have created an initial catalog of objects observed by the WFPC2 and ACS instruments on the Hubble Space Telescope (HST). The catalog is based on observations taken on more than 6000 visits (telescope pointings) of ACS/WFC and more than 25000 visits of WFPC2. The catalog is obtained by cross matching by position in the sky all Hubble Legacy Archive (HLA) Source Extractor source lists for these instruments. The source lists describe properties of source detections within a visit. The calculations are performed on a SQL Server database system. First we collect overlapping images into groups, e.g., Eta Car, and determine nearby (approximately matching) pairs of sources from different images within each group. We then apply a novel algorithm for improving the cross matching of pairs of sources by adjusting the astrometry of the images. Next, we combine pairwise matches into maximal sets of possible multi-source matches. We apply a greedy Bayesian method to split the maximal matches into more reliable matches. We test the accuracy of the matches by comparing the fluxes of the matched sources. The result is a set of information that ties together multiple observations of the same object. A byproduct of the catalog is greatly improved relative astrometry for many of the HST images. We also provide information on nondetections that can be used to determine dropouts. With the catalog, for the first time, one can carry out time domain, multi-wavelength studies across a large set of HST data. The catalog is publicly available. Much more can be done to expand the catalog capabilities.

MIDCOURSE SPACE EXPERIMENT VERSUS IRAS TWO-COLOR DIAGRAMS AND THE CIRCUMSTELLAR ENVELOPE-SEQUENCE OF OXYGEN-RICH LATE-TYPE STARS

International Nuclear Information System (INIS)

Sjouwerman, Lorant O.; Capen, Stephanie M.; Claussen, Mark J.

2009-01-01

We present Midcourse Space Experiment (MSX) two-color diagrams that can be used to characterize circumstellar environments of sources with good quality MSX colors in terms of IRAS color regions for oxygen-rich stars. With these diagrams, we aim to provide a new tool that can be used to study circumstellar environments and to improve detection rates for targeted surveys for circumstellar maser emission similar to the IRAS two-color diagram. This new tool is especially useful for regions in the sky where IRAS was confused, in particular in the Galactic plane and bulge region. Unfortunately, using MSX colors alone does not allow one to distinguish between carbon-rich and oxygen-rich objects. An application of this tool on 86 GHz SiO masers shows that for this type of masers an instantaneous detection rate of 60% to 80% can be achieved if target sources are selected according to MSX color (region). Our investigations may have revealed an error in the MSX point source catalog version 2.3. That is, the photometry of the 21.3 μm (MSX E filter) band for most weak 8.28 μm (or MSX A filter) band sources seems off by about a factor 2 (0.5-1 mag too bright).

A guide to hubble space telescope objects their selection, location, and significance

CERN Document Server

Chen, James L

2015-01-01

From the authors of "How to Find the Apollo Landing Sites," this is a guide to connecting the view above with the history of recent scientific discoveries from the Hubble Space Telescope. Each selected HST photo is shown with a sky map and a photograph or drawing to illustrate where to find it and how it should appear from a backyard telescope. Here is the casual observer's chance to locate the deep space objects visually, and appreciate the historic Hubble photos in comparison to what is visible from a backyard telescope. HST objects of all types are addressed, from Messier objects, Caldwell objects, and NGC objects, and are arranged in terms of what can be seen during the seasons. Additionally, the reader is given an historical perspective on the work of Edwin Hubble, while locating and viewing the deep space objects that changed astronomy forever.  Countless people have seen the amazing photographs taken by the Hubble Space Telescope. But how many people can actually point out where in the sky ...

IRAS 03063+5735: A BOWSHOCK NEBULA POWERED BY AN EARLY B STAR

Energy Technology Data Exchange (ETDEWEB)

Kobulnicky, Henry A.; Lundquist, Michael J.; Bhattacharjee, Anirban [Department of Physics and Astronomy, 1000 E. University Avenue, University of Wyoming Laramie, WY 82071 (United States); Kerton, C. R., E-mail: chipk@uwyo.edu, E-mail: mlundqui@uwyo.edu, E-mail: abhattac@uwyo.edu, E-mail: kerton@iastate.edu [Department of Physics and Astronomy, Iowa State University Ames, IA 50011 (United States)

2012-03-15

Mid-infrared images from the Spitzer Space Telescope Galactic Legacy Infrared MidPlane Survey Extraordinaire program reveal that the infrared source IRAS 03063+5735 is a bowshock nebula produced by an early B star, 2MASS 03101044+5747035. We present new optical spectra of this star, classify it as a B1.5 V, and determine a probable association with a molecular cloud complex at V{sub LSR} = -38 to -42 km s{sup -1} in the outer Galaxy near l = 140.{sup 0}59, b = -0.{sup 0}250. On the basis of spectroscopic parallax, we estimate a distance of 4.0 {+-} 1 kpc to both the bowshock nebula and the molecular complex. One plausible scenario is that this is a high-velocity runaway star impinging upon a molecular cloud. We identify the H II region and stellar cluster associated with IRAS 03064+5638 at a projected distance of 64 pc as one plausible birth site. The spectrophotometric distance and linkage to a molecular feature provides another piece of data helping to secure the ill-determined rotation curve in the outer Galaxy. As a by-product of spectral typing this star, we present empirical spectral diagnostic diagrams suitable for approximate spectral classification of O and B stars using He lines in the little-used yellow-red portion of the optical spectrum.

Observations of the Hubble Deep Field with the Infrared Space Observatory .4. Association of sources with Hubble Deep Field galaxies

DEFF Research Database (Denmark)

Mann, R.G.; Oliver, S.J.; Serjeant, S.B.G.

1997-01-01

We discuss the identification of sources detected by the Infrared Space Observatory (ISO) at 6.7 and 15 mu m in the Hubble Deep Field (HDF) region. We conservatively associate ISO sources with objects in existing optical and near-infrared HDF catalogues using the likelihood ratio method, confirming...... these results (and, in one case, clarifying them) with independent visual searches, We find 15 ISO sources to be reliably associated with bright [I-814(AB) HDF, and one with an I-814(AB)=19.9 star, while a further 11 are associated with objects in the Hubble Flanking Fields (10 galaxies...... and one star), Amongst optically bright HDF galaxies, ISO tends to detect luminous, star-forming galaxies at fairly high redshift and with disturbed morphologies, in preference to nearby ellipticals....

IRaPPA: information retrieval based integration of biophysical models for protein assembly selection.

Science.gov (United States)

Moal, Iain H; Barradas-Bautista, Didier; Jiménez-García, Brian; Torchala, Mieczyslaw; van der Velde, Arjan; Vreven, Thom; Weng, Zhiping; Bates, Paul A; Fernández-Recio, Juan

2017-06-15

In order to function, proteins frequently bind to one another and form 3D assemblies. Knowledge of the atomic details of these structures helps our understanding of how proteins work together, how mutations can lead to disease, and facilitates the designing of drugs which prevent or mimic the interaction. Atomic modeling of protein-protein interactions requires the selection of near-native structures from a set of docked poses based on their calculable properties. By considering this as an information retrieval problem, we have adapted methods developed for Internet search ranking and electoral voting into IRaPPA, a pipeline integrating biophysical properties. The approach enhances the identification of near-native structures when applied to four docking methods, resulting in a near-native appearing in the top 10 solutions for up to 50% of complexes benchmarked, and up to 70% in the top 100. IRaPPA has been implemented in the SwarmDock server ( http://bmm.crick.ac.uk/∼SwarmDock/ ), pyDock server ( http://life.bsc.es/pid/pydockrescoring/ ) and ZDOCK server ( http://zdock.umassmed.edu/ ), with code available on request. moal@ebi.ac.uk. Supplementary data are available at Bioinformatics online. © The Author 2017. Published by Oxford University Press. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com

Respuesta emocional de ira y alteraciones del lenguaje en pacientes con esquizofrenia

OpenAIRE

Herrero Sebastián, Neus

2015-01-01

Los pacientes con esquizofrenia presentan alteraciones en el procesamiento emocional especialmente en la expresión, y en el reconocimiento de emociones. Sin embargo, se ha investigado poco cómo experimentan las emociones los pacientes con esquizofrenia y en concreto existe una literatura muy escasa sobre la respuesta cardiovascular, hormonal o de la activación asimétrica cerebral. Por otro lado, la ira es clave en la conducta agresiva, y en el caso de la esquizofrenia parece estar mediada por...

Type Ia supernova Hubble residuals and host-galaxy properties

International Nuclear Information System (INIS)

Kim, A. G.; Aldering, G.; Aragon, C.; Bailey, S.; Fakhouri, H. K.; Antilogus, P.; Bongard, S.; Canto, A.; Cellier-Holzem, F.; Fleury, M.; Guy, J.; Baltay, C.; Buton, C.; Feindt, U.; Greskovic, P.; Kowalski, M.; Childress, M.; Chotard, N.; Copin, Y.; Gangler, E.

2014-01-01

Kim et al. introduced a new methodology for determining peak-brightness absolute magnitudes of type Ia supernovae from multi-band light curves. We examine the relation between their parameterization of light curves and Hubble residuals, based on photometry synthesized from the Nearby Supernova Factory spectrophotometric time series, with global host-galaxy properties. The K13 Hubble residual step with host mass is 0.013 ± 0.031 mag for a supernova subsample with data coverage corresponding to the K13 training; at <<1σ, the step is not significant and lower than previous measurements. Relaxing the data coverage requirement of the Hubble residual step with the host mass is 0.045 ± 0.026 mag for the larger sample; a calculation using the modes of the distributions, less sensitive to outliers, yields a step of 0.019 mag. The analysis of this article uses K13 inferred luminosities, as distinguished from previous works that use magnitude corrections as a function of SALT2 color and stretch parameters: steps at >2σ significance are found in SALT2 Hubble residuals in samples split by the values of their K13 x(1) and x(2) light-curve parameters. x(1) affects the light-curve width and color around peak (similar to the Δm 15 and stretch parameters), and x(2) affects colors, the near-UV light-curve width, and the light-curve decline 20-30 days after peak brightness. The novel light-curve analysis, increased parameter set, and magnitude corrections of K13 may be capturing features of SN Ia diversity arising from progenitor stellar evolution.

8- to 13-micron spectrophotometry of Comet IRAS-Araki-Alcock

Science.gov (United States)

Feierberg, M. A.; Witteborn, F. C.; Johnson, J. R.; Campins, H.

1984-01-01

Spectrophotometry between 8.0 and 13.0 microns at 2 percent spectral resolution is presented for areas in and near the nuclear condensation of Comet IRAS-Araki-Alcock (1983d) on May 11 and 12, 1983. All the spectra can be fit very well by blackbody curves, and no 10-micron silicate emissions are seen. The temperature structure of the coma suggests the presence of small (radii less than 5 microns) dust particles within 150 km of the nucleus and larger ones further out. The change in the spatial distribution of the infrared flux between the two nights suggests that an outburst may have occurred sometime on May 11.

Luminosity function of the brightest galaxies in the IRAS survey

International Nuclear Information System (INIS)

Soifer, B.T.; Sanders, D.B.; Madore, B.F.; Neugebauer, G.; Persson, C.J.; Persson, S.E.; Rice, W.L.

1987-01-01

Results from a study of the far infrared properties of the brightest galaxies in the IRAS survey are described. There is a correlation between the infrared luminosity and the infrared to optical luminosity ratio and between the infrared luminosity and the far infrared color temperature in these galaxies. The infrared bright galaxies represent a significant component of extragalactic objects in the local universe, being comparable in space density to the Seyferts, optically identified starburst galaxies, and more numerous than quasars at the same bolometric luminosity. The far infrared luminosity in the local universe is approximately 25% of the starlight output in the same volume

Search for near-infrared counterparts of IRAS embedded sources in the M17 SW giant molecular cloud

International Nuclear Information System (INIS)

Elmegreen, D.M.; Phillips, J.; Beck, K.; Thomas, H.; Howard, J.

1988-01-01

Wide-field near-infrared and blue band plates of the region containing the M17 giant molecular cloud complex have been blinked to locate bright near-infrared stars that may be embedded in the M17 SW giant molecular cloud. Twenty such stars coincided with the positions of IRAS point sources that appeared embedded based on color-color diagrams. Some of these stars may be the sources of the infrared luminosities. Of the 20 stars, seven were too faint to appear on the B band plate. The optical magnitudes and colors determined from the plate image diameters were measured for the other 13 coincident stars; they are most likely upper main-sequence or pre-main-sequence stars with extinctions of 7 mag. The IRAS luminosity-temperature diagram indicates that the embedded sources in M17 are more massive than those in the Orion cloud. 35 references

IRAS 18153-1651: an H II region with a possible wind bubble blown by a young main-sequence B star

Science.gov (United States)

Gvaramadze, V. V.; Mackey, J.; Kniazev, A. Y.; Langer, N.; Chené, A.-N.; Castro, N.; Haworth, T. J.; Grebel, E. K.

2017-04-01

We report the results of spectroscopic observations and numerical modelling of the H II region IRAS 18153-1651. Our study was motivated by the discovery of an optical arc and two main-sequence stars of spectral type B1 and B3 near the centre of IRAS 18153-1651. We interpret the arc as the edge of the wind bubble (blown by the B1 star), whose brightness is enhanced by the interaction with a photoevaporation flow from a nearby molecular cloud. This interpretation implies that we deal with a unique case of a young massive star (the most massive member of a recently formed low-mass star cluster) caught just tens of thousands of years after its stellar wind has begun to blow a bubble into the surrounding dense medium. Our 2D, radiation-hydrodynamics simulations of the wind bubble and the H II region around the B1 star provide a reasonable match to observations, both in terms of morphology and absolute brightness of the optical and mid-infrared emission, and verify the young age of IRAS 18153-1651. Taken together our results strongly suggest that we have revealed the first example of a wind bubble blown by a main-sequence B star.

The Hubble Legacy Archive: Data Processing in the Era of AstroDrizzle

Science.gov (United States)

Strolger, Louis-Gregory; Hubble Legacy Archive Team, The Hubble Source Catalog Team

2015-01-01

The Hubble Legacy Archive (HLA) expands the utility of Hubble Space Telescope wide-field imaging data by providing high-level composite images and source lists, perusable and immediately available online. The latest HLA data release (DR8.0) marks a fundamental change in how these image combinations are produced, using DrizzlePac tools and Astrodrizzle to reduce geometric distortion and provide improved source catalogs for all publicly available data. We detail the HLA data processing and source list schemas, what products are newly updated and available for WFC3 and ACS, and how these data products are further utilized in the production of the Hubble Source Catalog. We also discuss plans for future development, including updates to WFPC2 products and field mosaics.

CO and IRAS detection of an intermediate-velocity cloud

International Nuclear Information System (INIS)

Desert, F.X.; Bazell, D.; Blitz, L.

1990-01-01

In the course of a radio survey of high-Galactic-latitude clouds, CO emission was detected at the position l = 210.8 deg and b = 63.1 deg with an LSR velocity of -39 km/sec. This molecular cloud constitutes the third one with an unusually large absolute velocity at these latitudes, as compared with the 5.4-km/sec cloud-to-cloud velocity dispersion of the high-latitude molecular clouds. The position is coincident with an H I intermediate-velocity cloud (GHL 11, Verschuur H, OLM 268) and the IR-excess cloud 306 in the list by Desert et al. (1988). This cloud is clearly detected at all four IRAS wavelengths and has warmer colors than the local ISM. 27 refs

The Small Magellanic Cloud in the far infrared. I. ISO's 170 mu m map and revisit of the IRAS 12-100 mu m data

Science.gov (United States)

Wilke, K.; Stickel, M.; Haas, M.; Herbstmeier, U.; Klaas, U.; Lemke, D.

2003-04-01

The ISOPHOT experiment onboard the ISO satellite generated a complete view of the Small Magellanic Cloud (SMC) at 170 mu m with 1.5 arcmin resolution. The map is analysed using an automated photometry program enabling accurate photometric characterization of the far infrared (FIR) emitting regions. An integrated FIR luminosity of 8.5x 107 Lsun is obtained, leading to a star formation rate of SFRFIR=0.015 Msun/yr. With an average dust temperature of TD, 170/100}=20.5 K>, the total dust mass follows to MD=3.7x105 Msun. In this paper, the sources detected at 170 mu m are compared with those obtainable from the IRAS satellite data. For this purpose, the 12 mu m, 25 mu m, 60 mu m, and 100 mu m IRAS high resolution (HiRes) maps of the SMC are re-examined using the same method. In contrast to former studies, this provides an all-band ISO/IRAS source catalog which is no longer based on eyeball classification, but relies on an algorithm which is capable of automated, repeatable photometry, even for irregular sources. In the mid infrared IRAS bands numerous bright FIR emitting regions in the SMC are detected and classified: 73 sources are found at 12 mu m, 135 at 25 mu m (most of them with Fnu =2.0 Jy. Comparable numbers are found for the two FIR IRAS maps at 60 mu m (384) and 100 mu m (338) with fluxes up to 450 Jy. 70 of the 243 170 mu m sources are assigned a general SED type (``cold'', ``warm'', i.e., 30 K) for the first time. A comparison with earlier IRAS results suggests that many source flux densities in those studies have been under- or overestimated because of non-standardized fitting methods. Many sources with flux densities up to 40 Jy listed in former catalogs cannot be identified in our data. Based on observations with ISO, an ESA project with instruments funded by ESA Member States (especially the PI countries: France, Germany, The Netherlands and the UK) and with the participation of ISAS and NASA. The tables in Appendices A to E are only available in

A nuclear data approach for the Hubble constant measurements

Directory of Open Access Journals (Sweden)

Pritychenko Boris

2017-01-01

Full Text Available An extraordinary number of Hubble constant measurements challenges physicists with selection of the best numerical value. The standard U.S. Nuclear Data Program (USNDP codes and procedures have been applied to resolve this issue. The nuclear data approach has produced the most probable or recommended Hubble constant value of 67.2(69 (km/sec/Mpc. This recommended value is based on the last 20 years of experimental research and includes contributions from different types of measurements. The present result implies (14.55 ± 1.51 × 109 years as a rough estimate for the age of the Universe. The complete list of recommended results is given and possible implications are discussed.

IRAS observations of the exciting stars of Herbig-Haro objects. II. The Reipurth and Graham sample and low-resolution spectra

International Nuclear Information System (INIS)

Cohen, M.

1990-01-01

Using IRAS COADDed images, candidates are suggested for the exciting stars of Herbig-Haro objects from the Reipurth and Graham sample. The IRAS low-resolution spectrometer provides spectra for 20 of the 46 candidate stars so far identified as exciting young, unevolved H-H systems. These reveal 10-micron silicate absorption features, or are too red to show detectable flux near 10 microns. The histogram of bolometric luminosities for 46 young Herbig-Haro exciting stars has a median of 13 solar luminosities and a mode between 16 and 32 solar luminosities. Although the enlarged sample of known exciting stars has more of the higher luminosity objects than an earlier sample, the histogram still represents a generally low-luminosity distribution. 27 refs

IRAS Colors of the Pleiades

Science.gov (United States)

Carey, Sean J.; Shipman, R. F.; Clark, F. O.

1996-01-01

We present large scale images of the infrared emission of the region around the Pleiades using the ISSA data product from the IRAS mission. Residual Zodiacal background and a discontinuity in the image due to the scanning strategy of the satellite necessitated special background subtraction methods. The 60/100 color image clearly shows the heating of the ambient interstellar medium by the cluster. The 12/100 and 25/100 images peak on the cluster as expected for exposure of small dust grains to an enhanced UV radiation field; however, the 25/100 color declines to below the average interstellar value at the periphery of the cluster. Potential causes of the color deficit are discussed. A new method of identifying dense molecular material through infrared emission properties is presented. The difference between the 100 micron flux density and the 60 micron flux density scaled by the average interstellar 60/100 color ratio (Delta I(sub 100) is a sensitive diagnostic of material with embedded heating sources (Delta I(sub 100) less than 0) and cold, dense cores (Delta I(sub 100) greater than 0). The dense cores of the Taurus cloud complex as well as Lynds 1457 are clearly identified by this method, while the IR bright but diffuse Pleiades molecular cloud is virtually indistinguishable from the nearby infrared cirrus.

MILLIMETRIC AND SUBMILLIMETRIC OBSERVATIONS OF IRAS 05327+3404 ''HOLOEA'' IN M36

Energy Technology Data Exchange (ETDEWEB)

Morata, O.; Ho, P. T. P. [Institute of Astronomy and Astrophysics, Academia Sinica, P.O. Box 23-141, Taipei 106, Taiwan (China); Kuan, Y.-J.; Huang, H.-C.; Zhao-Geisler, R. [Department of Earth Sciences, National Taiwan Normal University, 88 Section 4, Ting Chou Road, Taipei 116, Taiwan (China); Magnier, E. A., E-mail: omorata@asiaa.sinica.edu.tw [Institute for Astronomy, University of Hawaii, 2680 Woodlawn Drive, Honolulu, HI 96822 (United States)

2013-09-15

The transition between the protostar, Class I, and the pre-main-sequence star, Class II, phases is still one of the most uncertain, and important, stages in the knowledge of the process of formation of an individual star because it is the stage that determines the final mass of the star. We observed the young stellar object ''Holoea'', associated with IRAS 05327+3404, which was classified as an object in the transition between the Class I and Class II phases with several unusual properties, and appears to be surrounded by large amounts of circumstellar material. We used the SMA and BIMA telescopes at millimeter and submillimeter (submm) wavelengths to observe the dust continuum emission and the CO (1-0) and (2-1), HCO{sup +} (1-0) and (3-2), and HCN (1-0) transitions in the region around IRAS 05327+3404. We detected two continuum emission peaks at 1.1 mm: SMM 1, the submm counterpart of IRAS 05327+3404, and SMM 2, {approx}6 arcsec to the west. The emissions of the three molecules show marked differences. The CO emission near the systemic velocity is filtered out by the telescopes, and CO mostly traces the high-velocity gas. The HCO{sup +} and HCN emissions are more concentrated around the central parts of the region, and show several intensity peaks coincident with the submm continuum peaks. We identify two main molecular outflows: a bipolar outflow in an E-W direction that would be powered by SMM 1 and the other in a NE direction, which we associate with SMM 2. We propose that the SMM sources are probably Class I objects, with SMM 1 in an earlier evolutionary stage.

Observações espectroscópicas da candidata a pós-AGB IRAS 19386+0155

Science.gov (United States)

Lorenz-Martins, S.; Pereira, C. B.

2003-08-01

Nesse trabalho apresentamos a análise fotosférica da estrela candidata a pós-AGB IRAS 19386+0155. Com os dados obtidos no espectrógrafo FEROS foram determinados os parâmetros atmosféricos e abundâncias fotosféricas utilizando o código MOOG. A análise do espectro mostrou que IRAS 19386+0155 possui os seguintes parâmetros atmosféricos : Teff = 6800K, log g = 1.4, [M/H] = -1.5 e Vt = 8.4 km/s. O padrão de abundância obtido para os elementos mais leves (Carbono, Nitrogênio e Oxigênio) e elementos a (Magnésio, Silício e Cálcio) foi inferior ao solar (log C = 7.74, log N = 7.28, Log O = 8.43, log Mg = 7.14, log Si = 7.54 e log Ca = 5.91). Uma inspeção visual do espectro ISO deste objeto revela a presença de poeira fria na forma de silicatos cristalinos. Embora as bandas mais marcantes de silicatos amorfos (em 10 mm e 18mm) não sejam observadas, a emissão em 21 mm, presente em algumas pós-AGBs também não está presente. O espectro ISO parece revelar um meio rico em oxigênio, mas a forma da distribuição de energia no infravermelho não obedece ao padrão apresentado por outras pós-AGBs. Nossos resultados nos levam a sugerir que IRAS 19386+0155 talvez faça parte de um sistema binário, uma vez que outras pós-AGBs que são membros de sistemas binários apresentam padrão de abundância semelhante.

Measurement of Hubble constant: non-Gaussian errors in HST Key Project data

Energy Technology Data Exchange (ETDEWEB)

Singh, Meghendra [Dr. A.P.J. Abdul Kalam Technical University, Uttar Pradesh, Lucknow, 226021 India (India); Gupta, Shashikant; Pandey, Ashwini [Amity University Haryana, Gurgaon, Haryana, 122413 India (India); Sharma, Satendra, E-mail: meghendrasingh_db@yahoo.co.in, E-mail: shashikantgupta.astro@gmail.com, E-mail: satyamkashwini@gmail.com, E-mail: ssharma_phy@yahoo.co.uk [Yobe State University, Damaturu, Yobe State (Nigeria)

2016-08-01

Assuming the Central Limit Theorem, experimental uncertainties in any data set are expected to follow the Gaussian distribution with zero mean. We propose an elegant method based on Kolmogorov-Smirnov statistic to test the above; and apply it on the measurement of Hubble constant which determines the expansion rate of the Universe. The measurements were made using Hubble Space Telescope. Our analysis shows that the uncertainties in the above measurement are non-Gaussian.

A Biomarker to Differentiate between Primary and Cocaine-Induced Major Depression in Cocaine Use Disorder: The Role of Platelet IRAS/Nischarin (I1-Imidazoline Receptor

Directory of Open Access Journals (Sweden)

Benjamin Keller

2017-12-01

Full Text Available The association of cocaine use disorder (CUD and comorbid major depressive disorder (MDD; CUD/MDD is characterized by high prevalence and poor treatment outcomes. CUD/MDD may be primary (primary MDD or cocaine-induced (CUD-induced MDD. Specific biomarkers are needed to improve diagnoses and therapeutic approaches in this dual pathology. Platelet biomarkers [5-HT2A receptor and imidazoline receptor antisera selected (IRAS/nischarin] were assessed by Western blot in subjects with CUD and primary MDD (n = 16 or CUD-induced MDD (n = 9; antidepressant free, AD−; antidepressant treated, AD+ and controls (n = 10 at basal level and/or after acute tryptophan depletion (ATD. Basal platelet 5-HT2A receptor (monomer was reduced in comorbid CUD/MDD subjects (all patients: 43% compared to healthy controls, and this down-regulation was independent of AD medication (decreases in AD−: 47%, and in AD+: 40%. No basal differences were found for IRAS/nischarin contents in AD+ and AD− comorbid CUD/MDD subjects. The comparison of IRAS/nischarin in the different subject groups during/after ATD showed opposite modulations (i.e., increases and decreases in response to low plasma tryptophan levels with significant differences discriminating between the subgroups of CUD with primary MDD and CUD-induced MDD. These specific alterations suggested that platelet IRAS/nischarin might be useful as a biomarker to discriminate between primary and CUD-induced MDD in this dual pathology.

Influencia de las Emociones Negativas (Ansiedad, Depresión e Ira sobre la Eficacia de un Programa de Tratamiento Cognitivo Conductual de Deshabituación al Tabaco

Directory of Open Access Journals (Sweden)

Francisco Javier Pérez-Pareja

2010-01-01

Full Text Available El objetivo de esta investigación es analizar la influencia de la ansiedad, la ira y la depresión, como emociones negativas, sobre el éxito en la aplicación de un tratamiento psicológico de carácter cognitivo-conductual para dejar de fumar. Estas tres respuestas emocionales fueron evaluadas en una muestra final de 180 personas antes de iniciar el tratamiento. Los resultados muestran que la depresión y la ira ejercen una importante influencia sobre el éxito terapéutico; es decir, habiendo dejado de fumar, mientras que la ansiedad no muestra efectos significativos. Sujetos con elevadas puntuaciones en depresión presentan importantes dificultades para finalizar el programa de manera exitosa, mientras que sujetos con puntuaciones elevadas en ira muestran una buena adherencia y un importante porcentaje de éxito en el tratamiento.

Studies of IRAS sources at high galactic latitudes

International Nuclear Information System (INIS)

Rowan-Robinson, M.; Helou, G.; Walker, D.

1987-01-01

A detailed study has been carried out of a complete sample of IRAS 25-, 60- and 100-μm sources identified with galaxies brighter than 14.5 mag at b > 60 0 . Redshifts are available for virtually all these galaxies. The 60- and 100-μm luminosities are well correlated with the corrected absolute magnitude Msub(B), the 25-μm luminosity less well so. There is a clear correlation of the ratio of far-infrared luminosity to optical luminosity, Lsub(FIR)/Lsub(B), with 100 μm/60 μm colour, in the sense that the more luminous infrared galaxies are warmer. This behaviour can be modelled as a mixture of a normal 'disc' component and a starburst component. There is no significant difference in the distribution of Lsub(FIR)/Lsub(B) versus 100 μm/60 μm colour for edge-on and face-on spirals, showing that the adopted internal extinction correction is a good approximation. (author)

On the determination of the Hubble constant

International Nuclear Information System (INIS)

Gurzadyan, V.G.; Harutyunyan, V.V.; Kocharyan, A.A.

1990-10-01

The possibility of an alternative determination of the distance scale of the Universe and the Hubble constant based on the numerical analysis of the hierarchical nature of the large scale Universe (galaxies, clusters and superclusters) is proposed. The results of computer experiments performed by means of special numerical algorithms are represented. (author). 9 refs, 7 figs

The identification of IRAS 15194-5115 with a bright extreme carbon star

International Nuclear Information System (INIS)

Meadows, P.J.

1987-01-01

The authors identify IRAS 15194-5115 with a previously unknown extreme carbon star which is the third brightest carbon star in the sky at 12 μm (1148 Jy). Results of optical and infrared photometry and spectroscopy are presented. The 3.03 μm absorption feature associated with C 2 H 2 and HCN is seen as well as SiC emission at 11.2 μm. A comparison with recent model calculations of other workers indicates that this star is very similar to IRC+10216 and that it lies at a distance of about 1.7 kpc. (author)

Hubble Captures Volcanic Eruption Plume From Io

Science.gov (United States)

1997-01-01

The Hubble Space Telescope has snapped a picture of a 400-km-high (250-mile-high) plume of gas and dust from a volcanic eruption on Io, Jupiter's large innermost moon.Io was passing in front of Jupiter when this image was taken by the Wide Field and Planetary Camera 2 in July 1996. The plume appears as an orange patch just off the edge of Io in the eight o'clock position, against the blue background of Jupiter's clouds. Io's volcanic eruptions blasts material hundreds of kilometers into space in giant plumes of gas and dust. In this image, material must have been blown out of the volcano at more than 2,000 mph to form a plume of this size, which is the largest yet seen on Io.Until now, these plumes have only been seen by spacecraft near Jupiter, and their detection from the Earth-orbiting Hubble Space Telescope opens up new opportunities for long-term studies of these remarkable phenomena.The plume seen here is from Pele, one of Io's most powerful volcanos. Pele's eruptions have been seen before. In March 1979, the Voyager 1 spacecraft recorded a 300-km-high eruption cloud from Pele. But the volcano was inactive when the Voyager 2 spacecraft flew by Jupiter in July 1979. This Hubble observation is the first glimpse of a Pele eruption plume since the Voyager expeditions.Io's volcanic plumes are much taller than those produced by terrestrial volcanos because of a combination of factors. The moon's thin atmosphere offers no resistance to the expanding volcanic gases; its weak gravity (one-sixth that of Earth) allows material to climb higher before falling; and its biggest volcanos are more powerful than most of Earth's volcanos.This image is a contrast-enhanced composite of an ultraviolet image (2600 Angstrom wavelength), shown in blue, and a violet image (4100 Angstrom wavelength), shown in orange. The orange color probably occurs because of the absorption and/or scattering of ultraviolet light in the plume. This light from Jupiter passes through the plume and is

The Herschel/HIFI unbiased spectral survey of the solar-mass protostar IRAS16293

Science.gov (United States)

Bottinelli, S.; Caux, E.; Cecarelli, C.; Kahane, C.

2012-03-01

Unbiased spectral surveys are powerful tools to study the chemistry and the physics of star forming regions, because they can provide a complete census of the molecular content and the observed lines probe the physical structure of the source. While unbiased surveys at the millimeter and sub-millimeter wavelengths observable from ground-based telescopes have previously been performed towards several high-mass protostars, very little data exist on low-mass protostars, with only one such ground-based survey carried out towards this kind of object. However, since low-mass protostars are believed to resemble our own Sun's progenitor, the information provided by spectral surveys is crucial in order to uncover the birth mechanisms of low-mass stars and hence of our Sun. To help fill up this gap in our understanding, we carried out an almost complete spectral survey towards the solar-type protostar IRAS16293-2422 with the HIFI instrument onboard Herschel. The observations covered a range of about 700 GHz, in which a few hundreds lines were detected with more than 3σ confidence interval certainty and identified. All the detected lines which were free from obvious blending effects were fitted with Gaussians to estimate their basic kinematic properties. Contrarily to what is observed in the millimeter range, no lines from complex organic molecules have been observed. In this work, we characterize the different components of IRAS16293-2422 (a known binary at least) by analyzing the numerous emission and absorption lines identified.

Enhancing Hubble's vision service missions that expanded our view of the universe

CERN Document Server

Shayler, David J

2016-01-01

After a 20-year struggle to place a large, sophisticated optical telescope in orbit the Hubble Space Telescope was finally launched in 1990, though its primary mirror was soon found to be flawed. A dramatic mission in 1993 installed corrective optics so that the intended science program could finally begin. Those events are related in a companion to this book, The Hubble Space Telescope: From Concept to Success.   Enhancing Hubble’s Vision: Service Missions That Expanded Our View of the Universe tells the story of the four missions between 1997 and 2009 that repaired, serviced and upgraded the instruments on the telescope to maintain its state-of-the-art capabilities. It draws on first hand interviews with those closely involved in the project. The spacewalking skills and experiences gained from maintaining and upgrading Hubble had direct application to the construction of the International Space Station and help with its maintenance. These skills can be applied to future human and robotic satellite servic...

Recovery of carboxylic acids produced during dark fermentation of food waste by adsorption on Amberlite IRA-67 and activated carbon.

Science.gov (United States)

Yousuf, Ahasa; Bonk, Fabian; Bastidas-Oyanedel, Juan-Rodrigo; Schmidt, Jens Ejbye

2016-10-01

Amberlite IRA-67 and activated carbon were tested as promising candidates for carboxylic acid recovery by adsorption. Dark fermentation was performed without pH control and without addition of external inoculum at 37°C in batch mode. Lactic, acetic and butyric acids, were obtained, after 7days of fermentation. The maximum acid removal, 74%, from the Amberlite IRA-67 and 63% from activated carbon was obtained from clarified fermentation broth using 200gadsorbent/Lbroth at pH 3.3. The pH has significant effect and pH below the carboxylic acids pKa showed to be beneficial for both the adsorbents. The un-controlled pH fermentation creates acidic environment, aiding in adsorption by eliminating use of chemicals for efficient removal. This study proposes simple and easy valorization of waste to valuable chemicals. Copyright © 2016 Elsevier Ltd. All rights reserved.

Discriminación en el trabajo y el vecindario hacia las mujeres que viven con VIH y su relación con la depresión y la ira

Directory of Open Access Journals (Sweden)

José Moral de la Rubia

2015-01-01

Full Text Available Se describe el nivel de discriminación percibida en el trabajo y el vecindario, y se estudia la relación que tiene con la depresión y la ira. La escala de Discriminación Temida y Percibida, el Inventario de Depresión de Beck y el Inventario de Rasgo- Estado-Expresión de Ira se aplicaron a una muestra no probabilística de 200 mujeres con VIH. Se percibe discriminación en el trabajo y el vecindario con mayor frecuencia que en la familia. La discriminación se relacionó más con depresión, no teniendo la ira un papel mediador. Se concluye que prevenir la discriminación podría ser un factor protector de depresión en mujeres que viven con VIH.

Construcción de un diagrama de Hubble: Una herramienta para la Enseñanza de la Astronomía

Directory of Open Access Journals (Sweden)

Giovanni Cardona Rodriguez

2016-06-01

Full Text Available Se presenta una actividad que puede apoyar el trabajo de los docentes que dirigen  clubes de Astronomía y quieren abordar el tema de evolución del Universo, ya que   se  reconstruye  la ley de Hubble  a partir de la construcción de un Diagrama de Hubble con  datos  tomados del Sloan Digital Sky Survey   (SDSS ,  del  cual se obtiene el valor del parámetro de Hubble y se infiere la expansión del Universo. Esta actividad  didáctica permite a los profesores orientar a sus estudiantes por el camino que siguió Hubble  para determinar su ley, en este sentido se exponen algunas implicaciones de aplicación de la misma en el contexto de la formación de profesores de física y de los clubes de Astronomía.  Construction of a Hubble Diagram: A tool for teaching astronomy This article presents the construction and analysis of an activity that can support the work of teachers who run Astronomy clubs and want to address the issue of evolution of the Universe. Here Hubble's law is reconstructed by reproducing a Hubble diagram with Sloan Digital Sky Survey's (SDSS data, from which the Hubble parameter value is obtained and the expansion of the Universe is inferred. This educational activity allows teachers to guide their students along the path followed by Hubble to determine his law. In this sense some implications of applying the latter are discussed in the context of teacher's training in Physics and Astronomy clubs. Construção de um diagrama de Hubble: Uma ferramenta para ensino de astronomía Se apresenta uma actividade que pode apoiar o trabalho dos professores que dirigem clubes de Astronomia e querem abordar a questão da evolução do Universo, como a lei de Hubble é reconstruída a partir da reprodução de um diagrama de Hubble com os dados tomados do Sloan digital Sky Survey (SDSS, é achado o parâmetro de Hubble e inferida a expansão do universo. Esta actividade educativa permite aos professores orientar seus alunos ao

Very deep IRAS survey - constraints on the evolution of starburst galaxies

International Nuclear Information System (INIS)

Hacking, P.; Houck, J.R.; Condon, J.J.; National Radio Astronomy Observatory, Charlottesville, VA)

1987-01-01

Counts of sources (primarily starburst galaxies) from a deep 60 microns IRAS survey published by Hacking and Houck (1987) are compared with four evolutionary models. The counts below 100 mJy are higher than expected if no evolution has taken place out to a redshift of approximately 0.2. Redshift measurements of the survey sources should be able to distinguish between luminosity-evolution and density-evolution models and detect as little as a 20 percent brightening or increase in density of infrared sources per billion years ago (H/0/ = 100 km/s per Mpc). Starburst galaxies cannot account for the reported 100 microns background without extreme evolution at high redshifts. 21 references

MEDICIÓN DE LA IRA EN EL DEPORTE DE COMBATE: VALIDACIÓN DEL STAXI-2 EN DEPORTISTAS MEXICANOS/ MEASUREMENT OF ANGER IN COMBAT SPORT:VALIDATION OF STAXI-2 IN MEXICAN SPORTSMEN

Directory of Open Access Journals (Sweden)

Nazira Calleja Bello**

2010-05-01

Full Text Available RESUMENLa ira es una emoción que juega un papel fundamental en la ejecución de los deportes de combate. El propósito delpresente estudio fue desarrollar una versión para deportistas de combate del Inventario de Expresión de la Ira Estado-Rasgo, STAXI-2, versión española. La muestra estuvo conformada por 303 deportistas que formaban parte de las seleccionesnacionales mexicanas de cinco deportes de combate. Los resultados mostraron una estructura factorial similar a la versiónespañola, que reporta tres escalas: Ira-Estado, Ira-Rasgo y Expresión de Ira; sin embargo, de los 49 reactivos iniciales sólose conservaron 28, que se agruparon en siete factores y no en las nueve subescalas que conformaban el instrumento original.Los índices de consistencia interna fueron aceptables y se obtuvieron correlaciones significativas entre los factores, exceptocon el Control de la ira. El inventario obtenido es un instrumento válido y confiable para su utilización en la medición de laira en el deporte de combate.ABSTRACTThe anger is an emotion that plays a fundamental role in combat sports execution. The purpose of the present study wasto develop a version for combat sportsmen of the State-Trait Anger Expression Inventory, STAXI-2, Spanish version. Thesample was conformed by 303 sportsmen that were part of the selections national Mexicans of five combat sports. Theresults showed a similar factorial structure to the Spanish version which reports three scales: Anger-State, Anger-Trait andAnger-Expression; however, of the 49 initial items only 28 were conserved that grouped in seven factors and not in the ninesubscales that consisted the original instrument. The indexes of internal consistency were acceptable and significantcorrelations were obtained among the factors, except with the Anger-Control. The obtained inventory is a reliable and validfor its use in anger mensuration in combat sports.

HUBBLE CAPTURES MERGER BETWEEN QUASAR AND GALAXY

Science.gov (United States)

2002-01-01

This NASA Hubble Space Telescope image shows evidence fo r a merger between a quasar and a companion galaxy. This surprising result might require theorists to rethink their explanations for the nature of quasars, the most energetic objects in the universe. The bright central object is the quasar itself, located several billion light-years away. The two wisps on the (left) of the bright central object are remnants of a bright galaxy that have been disrupted by the mutual gravitational attraction between the quasar and the companion galaxy. This provides clear evidence for a merger between the two objects. Since their discovery in 1963, quasars (quasi-stellar objects) have been enigmatic because they emit prodigious amounts of energy from a very compact source. The most widely accepted model is that a quasar is powered by a supermassive black hole in the core of a galaxy. These new observations proved a challenge for theorists as no current models predict the complex quasar interactions unveiled by Hubble. The image was taken with the Wide Field Planetary Camera-2. Credit: John Bahcall, Institute for Advanced Study, NASA.

Hubble Space Telescope: Should NASA Proceed with a Servicing Mission?

National Research Council Canada - National Science Library

Morgan, Daniel

2006-01-01

The National Aeronautics and Space Administration (NASA) estimates that without a servicing mission to replace key components, the Hubble Space Telescope will cease scientific operations in 2008 instead of 2010...

Influencia de las Emociones Negativas (Ansiedad, Depresión e Ira) sobre la Eficacia de un Programa de Tratamiento Cognitivo Conductual de Deshabituación al Tabaco

OpenAIRE

Francisco Javier Pérez-Pareja; Albert Sesé; Ana Filomena Romo; Alfonso Palmer; Manuel Tomás

2010-01-01

El objetivo de esta investigación es analizar la influencia de la ansiedad, la ira y la depresión, como emociones negativas, sobre el éxito en la aplicación de un tratamiento psicológico de carácter cognitivo-conductual para dejar de fumar. Estas tres respuestas emocionales fueron evaluadas en una muestra final de 180 personas antes de iniciar el tratamiento. Los resultados muestran que la depresión y la ira ejercen una importante influencia sobre el éxito terapéutico; es decir, habiendo deja...

The Prevalence of Tobacco, Hubble-Bubble, Alcoholic Drinks, Drugs, and Stimulants among High-School Students

Directory of Open Access Journals (Sweden)

Roghayeh Alaee

2011-08-01

Full Text Available Introduction: The purpose of the present study was to investigate the prevalence of tobacco, hubble-bubble, alcoholic drinks, and other drugs among Karaj high-school students in 2011. Methods: The research method was a descriptive-sectional study. Participants of this study were 447 girl and boy high-school students of Karaj that were selected by clustering random sampling. For data gathering, drug abuse questionnaire, and risk and protective factors inventory were administered among selected sample. Results: According to the results, 57% of students in this study said that they have had experiences with a kind of drug including tobacco, hubble-bubble, alcoholic drinks, and other drugs at least once in their lives. The study showed the prevalence for soft drugs: hubble-bubble, tobacco, and alcoholic drinks, and for hard drugs ecstasy, opium, hashish, meth, crack, and heroin respectively. Conclusion: Soft drugs including hubble-bubble, tobacco, and alcoholic drinks, are the most common among Karaj high-school students. The prevalence of hard drugs among them is rather low.

Hubble Space Telescope nickel hydrogen battery system briefing

Science.gov (United States)

Nawrocki, David; Saldana, David; Rao, Gopal

1993-01-01

The topics covered are presented in viewgraph form and include the following: the Hubble Space Telescope (HST) Mission; system constraints; battery specification; battery module; simplified block diagram; cell design summary; present status; voltage decay; system depth of discharge; pressure since launch; system capacity; eclipse time vs. trickle charge; capacity test objectives; and capacity during tests.

Irrationality, barbarism and violence in the Seneca’s De Ira: a political reading

Directory of Open Access Journals (Sweden)

Ignacio Pajón Leyra

2018-03-01

Full Text Available Seneca’s philosophy dedicates a special attention to passions, regarded as the main obstacle to attaining wisdom, and in particular to anger, considered the most dreadful of them all. Scholars have usually interpreted his treaty On anger (De ira as a private handbook of ethics containing advice about how to become wise. However, this article explores a different approach to the text, placing it in the context of Seneca’s discussion about the virtue of courage. Thus, in Seneca’s thought anger appears as a social issue that affects both political communities and isolated individuals.

European astronomers' successes with the Hubble Space Telescope*

Science.gov (United States)

1997-02-01

[Figure: Laguna Nebula] Their work spans all aspects of astronomy, from the planets to the most distant galaxies and quasars, and the following examples are just a few European highlights from Hubble's second phase, 1994-96. A scarcity of midget stars Stars less massive and fainter than the Sun are much numerous in the Milky Way Galaxy than the big bright stars that catch the eye. Guido De Marchi and Francesco Paresce of the European Southern Observatory as Garching, Germany, have counted them. With the wide-field WFPC2 camera, they have taken sample censuses within six globular clusters, which are large gatherings of stars orbiting independently in the Galaxy. In every case they find that the commonest stars have an output of light that is only one-hundredth of the Sun's. They are ten times more numerous than stars like the Sun. More significant for theories of the Universe is a scarcity of very faint stars. Some astronomers have suggested that vast numbers of such stars could account for the mysterious dark matter, which makes stars and galaxies move about more rapidly than expected from the mass of visible matter. But that would require an ever-growing count of objects at low brightnesses, and De Marchi and Paresce find the opposite to be the case -- the numbers diminish. There may be a minimum size below which Nature finds starmaking difficult. The few examples of very small stars seen so far by astronomers may be, not the heralds of a multitude of dark-matter stars, but rareties. Unchanging habits in starmaking Confirmation that very small stars are scarce comes from Gerry Gilmore of the Institute of Astronomy in Cambridge (UK). He leads a European team that analyses long-exposure images in the WFPC2 camera, obtained as a by-product when another instrument is examining a selected object. The result is an almost random sample of well-observed stars and galaxies. The most remarkable general conclusion is that the make-up of stellar populations never seems to

NASA Astrophysics E/PO: A Quarter Century of Discovery and Inspiration with the Hubble Space Telescope

Science.gov (United States)

Jirdeh, Hussein; Straughn, Amber; Smith, Denise Anne; Eisenhamer, Bonnie

2015-08-01

April 24, 2015 marked the 25th anniversary of the launch of the Hubble Space Telescope. In its quarter-century in orbit, the Hubble Space Telescope has transformed the way we understand the Universe, helped us find our place among the stars, and paved the way to incredible advancements in science and technology.In this presentation, we explain how NASA and ESA, including the Space Telescope Science Institute (STScI) and partners, is using the 25th anniversary of Hubble’s launch as a unique opportunity to communicate to students, educators, and the public the significance of the past quarter-century of discovery with the Hubble Space Telescope. We describe the various programs, resources, and experiences we are utilizing to enhancethe public understanding of Hubble’s many contributions to the scientific world. These include educator professional development opportunities, exhibits, events, traditional and social media, and resources for educators (formal k-12, informal, and higher education). We also highlight how we are capitalizing on Hubble’s cultural popularity to make the scientific connection to NASA’s next Great Observatory, the James Webb Space Telescope.This presentation highlights many of the opportunities by which students, educators, and the public are joining in the anniversary activities, both in-person and online. Find out more at hubble25th.org and follow #Hubble25 on social media.

A Molecular-line Study of the Interstellar Bullet Engine IRAS05506+2414

Science.gov (United States)

Sahai, Raghvendra; Lee, Chin-Fei; Sánchez Contreras, Carmen; Patel, Nimesh; Morris, Mark R.; Claussen, Mark

2017-12-01

We present interferometric and single-dish molecular line observations of the interstellar bullet-outflow source IRAS 05506+2414, whose wide-angle bullet spray is similar to the Orion BN/KL explosive outflow and likely arises from an entirely different mechanism than the classical accretion-disk-driven bipolar flows in young stellar objects. The bullet-outflow source is associated with a large pseudo-disk and three molecular outflows—a high-velocity outflow (HVO), a medium-velocity outflow (MVO), and a slow, extended outflow (SEO). The size (mass) of the pseudo-disk is 10,350 au × 6400 au (0.64-0.17 M ⊙) from a model-fit assuming infall and rotation, we derive a central stellar mass of 8-19 M ⊙. The HVO (MVO) has an angular size ˜5180 (˜3330) au and a projected outflow velocity of ˜140 km s-1 (˜30 km s-1). The SEO size (outflow speed) is ˜0.9 pc (˜6 km s-1). The HVO’s axis is aligned with (orthogonal to) that of the SEO (pseudo-disk). The velocity structure of the MVO is unresolved. The scalar momenta in the HVO and SEO are very similar, suggesting that the SEO has resulted from the HVO interacting with ambient-cloud material. The bullet spray shares a common axis with the pseudo-disk and has an age comparable to that of MVO (few hundred years), suggesting that these three structures are intimately linked. We discuss several models for the outflows in IRAS 05506+2414 (including dynamical decay of a stellar cluster, chance encounter of a runaway star with a dense cloud, and close passage of two protostars), and conclude that second-epoch imaging to derive proper motions of the bullets and nearby stars can help to discriminate between them.

HUBBLE'S PANORAMIC PORTRAIT OF A VAST STAR-FORMING REGION

Science.gov (United States)

2002-01-01

NASA's Hubble Space Telescope has snapped a panoramic portrait of a vast, sculpted landscape of gas and dust where thousands of stars are being born. This fertile star-forming region, called the 30 Doradus Nebula, has a sparkling stellar centerpiece: the most spectacular cluster of massive stars in our cosmic neighborhood of about 25 galaxies. The mosaic picture shows that ultraviolet radiation and high-speed material unleashed by the stars in the cluster, called R136 [the large blue blob left of center], are weaving a tapestry of creation and destruction, triggering the collapse of looming gas and dust clouds and forming pillar-like structures that are incubators for nascent stars. The photo offers an unprecedented, detailed view of the entire inner region of 30 Doradus, measuring 200 light-years wide by 150 light-years high. The nebula resides in the Large Magellanic Cloud (a satellite galaxy of the Milky Way), 170,000 light-years from Earth. Nebulas like 30 Doradus are the 'signposts' of recent star birth. High-energy ultraviolet radiation from the young, hot, massive stars in R136 causes the surrounding gaseous material to glow. Previous Hubble telescope observations showed that R136 contains several dozen of the most massive stars known, each about 100 times the mass of the Sun and about 10 times as hot. These stellar behemoths all formed at the same time about 2 million years ago. The stars in R136 are producing intense 'stellar winds' (streams of material traveling at several million miles an hour), which are wreaking havoc on the gas and dust in the surrounding neighborhood. The winds are pushing the gas away from the cluster and compressing the inner regions of the surrounding gas and dust clouds [the pinkish material]. The intense pressure is triggering the collapse of parts of the clouds, producing a new generation of star formation around the central cluster. The new stellar nursery is about 30 to 50 light-years from R136. Most of the stars in the

First results from the Hubble OPAL Program: Jupiter in 2015

Science.gov (United States)

Simon, Amy A.; Wong, Michael H.; Orton, Glenn S.

2015-11-01

The Hubble 2020: Outer Planet Atmospheres Legacy (OPAL) program is a Director's Discretionary program designed to generate two yearly global maps for each of the outer planets to enable long term studies of atmospheric color, structure and two-dimensional wind fields. This presentation focuses on Jupiter results from the first year of the campaign. Data were acqured January 19, 2015 with the WFC3/UVIS camera and the F275W, F343N, F395N, F467M, F502N, F547M, F631N, F658N, and F889N filters. Global maps were generated and are publicly available through the High Level Science Products archive: https://archive.stsci.edu/prepds/opal/Using cross-correlation on the global maps, the zonal wind profile was measured between +/- 50 degrees latitude and is in family with Voyager and Cassini era profiles. There are some variations in mid to high latitude wind jet magnitudes, particularly at +40°and -35° planetographic latitude. The Great Red Spot continues to maintain an intense orange coloration, as it did in 2014. However, the interior shows changed structure, including a reduced core and new filamentary features. Finally, a wave not previously seen in Hubble images was also observed and is interpreted as a baroclinic instability with associated cyclone formation near 16° N latitude. A similar feature was observed faintly in Voyager 2 images, and is consistent with the Hubble feature in location and scale.

SPECTROSCOPIC VARIABILITY OF IRAS 22272+5435

International Nuclear Information System (INIS)

Začs, Laimons; Grankina, Aija; Musaev, Faig; Kaminsky, Bogdan; Pavlenko, Yakiv; Sperauskas, Julius; Hrivnak, Bruce J.

2016-01-01

A time series of high-resolution spectra was observed in the optical wavelength region for the bright proto-planetary nebula IRAS 22272+5435 (HD 235858), along with a simultaneous monitoring of its radial velocity and BV R C magnitudes. The object is known to vary in light, color, and velocity owing to pulsation with a period of 132 days. The light and color variations are accompanied by significant changes in spectral features, most of which are identified as lines of carbon-bearing molecules. According to the observations, the C 2 Swan system and CN Red system lines are stronger near the light minimum. A photospheric spectrum of the central star was calculated using new self-consistent atmospheric models. The observed intensity variations in the C 2 Swan system and CN Red system lines were found to be much larger than expected if due solely to the temperature variation in the atmosphere of the pulsating star. In addition, the molecular lines are blueshifted relative to the photospheric velocity. The site of formation of the strong molecular features appears to be a cool outflow triggered by the pulsation. The variability in atomic lines seems to be mostly due variations of the effective temperature during the pulsation cycle. The profiles of strong atomic lines are split, and some of them are variable in a timescale of a week or so, probably because of shock waves in the outer atmosphere

Hubble's Law Implies Benford's Law for Distances to Galaxies ...

Indian Academy of Sciences (India)

in both time and space, predicts that conformity to Benford's law will improve as more data on distances to galaxies becomes available. Con- versely, with the logical derivation of this law presented here, the recent empirical observations may beviewed as independent evidence of the validity of Hubble's law. Key words.

Remarks on the low value obtained for the Hubble constant

International Nuclear Information System (INIS)

Jaakkola, Toivo

1975-01-01

Some remarks are made on the basis of the data given by Sandage and Tamman, suggesting that these authors have over-estimated the distances to the most luminous galaxies and obtained a value too low for the Hubble constant [fr

Observation of the HH 1 and 2 region with IRAS

International Nuclear Information System (INIS)

Pravdo, S.H.; Chester, T.J.

1987-01-01

Infrared Astronomical Satellite (IRAS) observations of the region in Orion containing HH 1 and 2 reveal for the first time the large-scale distribution of newly formed stars. New infrared sources discovered in these observations are discussed, and attempts are made to untangle the complex infrared morphology of this field. A major finding of this study is that HH 1 is near the peak of an intense and broad plateau of 60 and 100 micron emission that spatially corresponds well with the boundaries of a previously detected molecular cloud. Other findings include the detection of an emitting circum-HH object dust complex around HH 2, 25 micron emission associated with the putative HH 1 and 2 exciting source discovered with the VLA, a new luminous far-infrared source, and numerous infrared source complexes, some in blank optical fields and others in fields containing optical emission-line stars. 37 references

IRAS bright galaxy sample. II. The sample and luminosity function

International Nuclear Information System (INIS)

Soifer, B.T.; Sanders, D.B.; Neugebauer, G.; Madore, B.F.; Danielson, G.E.; David Dunlap Observatory, Richmond Hill, Canada; Palomar Observatory; California Institute of Technology, Pasadena)

1987-01-01

A statistically complete sample of 324 of the brightest infrared galaxies discovered at 60 microns in the IRAS all-sky survey is described. The results show that far-infrared emission is a significant luminosity component in the local universe, representing 25 percent of the luminosity emitted by stars in the same volume. Above 10 to the 11th solar luminosities, the infrared luminous galaxies are the dominant population of objects in the universe, being as numerous as the Seyfert galaxies and more numerous than quasars at higher luminosities. The infrared luminosity appears to be independent of the optical luminosity of galaxies. Most infrared bright galaxies appear to require much of the interstellar matter to be contributing to the observed infrared luminosity. Approximately 60-80 percent of the far-infrared luminosity of the local universe can be attributed, directly or indirectly, to recent or ongoing star formation. 67 references

An independent determination of the local Hubble constant

Science.gov (United States)

Fernández Arenas, David; Terlevich, Elena; Terlevich, Roberto; Melnick, Jorge; Chávez, Ricardo; Bresolin, Fabio; Telles, Eduardo; Plionis, Manolis; Basilakos, Spyros

2018-02-01

The relationship between the integrated H β line luminosity and the velocity dispersion of the ionized gas of H II galaxies and giant H II regions represents an exciting standard candle that presently can be used up to redshifts z ˜ 4. Locally it is used to obtain precise measurements of the Hubble constant by combining the slope of the relation obtained from nearby (z ≤ 0.2) H II galaxies with the zero-point determined from giant H II regions belonging to an `anchor sample' of galaxies for which accurate redshift-independent distance moduli are available. We present new data for 36 giant H II regions in 13 galaxies of the anchor sample that includes the megamaser galaxy NGC 4258. Our data are the result of the first 4 yr of observation of our primary sample of 130 giant H II regions in 73 galaxies with Cepheid determined distances. Our best estimate of the Hubble parameter is 71.0 ± 2.8(random) ± 2.1(systematic) km s- 1Mpc- 1. This result is the product of an independent approach and, although at present less precise than the latest SNIa results, it is amenable to substantial improvement.

Rotation-Infall Motion around the Protostar IRAS 16293-2422 Traced by Water Maser Emission

Science.gov (United States)

Imai, Hiroshi; Iwata, Takahiro; Miyoshi, Makoto

1999-08-01

We made VLBI observations of the water maser emission associated with a protostar, IRAS 16293-2422, using the Kashima-Nobeyama Interferometer (KNIFE) and the Japanese domestic VLBI network (J-Net).\\footnote[2]. These distributions of water maser features showed the blue-shifted and red-shifted components separated in the north-south direction among three epochs spanning three years. The direction of the separation was perpendicular to the molecular outflow and parallel to the elongation of the molecular disk. These steady distributions were successfully modeled by a rotating-infalling disk with an outer radius of 100 AU around a central object with a mass of 0.3 MO . The local specific angular momentum of the disk was calculated to be 0.2-1.0times 10-3 km s-1 pc at a radius of 20-100 AU. This value is roughly equal to that of the disk of IRAS 00338+6312 in L1287 and those of the molecular disks around the protostars in the Taurus molecular cloud. The relatively large disk radius of about 100 AU traced by water maser emission suggests that impinging clumps onto the disk should be hotter than 200 K to excite the water maser emission. Mizusawa, Nobeyama, and Kagoshima stations are operated by staff members of National Astronomical Observatory of the Ministry of Education, Science, Sports and Culture. Kashima station is operated by staff members of Communications Research Laboratory of the Ministry of Posts and Telecomunications. The recent status of J-Net is seen in the WWW home page: http://www.nro.nao.ac.jp/\\ \\ miyaji/Jnet.

On the Luminosity Distance and the Hubble Constant

OpenAIRE

Yuri Heymann

2013-01-01

By differentiating luminosity distance with respect to time using its standard formula we find that the peculiar velocity is a time varying velocity of light. Therefore, a new definition of the luminosity distance is provided such that the peculiar velocity is equal to c. Using this definition a Hubble constant H0 = 67.3 km s−1 Mpc−1 is obtained from supernovae data.

The ESA Hubble 15th Anniversary Campaign: A Trans-European collaboration project

Science.gov (United States)

Zoulias, Manolis; Christensen, Lars Lindberg; Kornmesser, Martin

2006-08-01

On April 24th 2005, NASA/ESA Hubble Space Telescope had been in orbit for 15 years. The anniversary was celebrated by ESA with the production of an 83 min. scientific movie and a 120 pages book, both titled ``Hubble, 15 years of discovery''. In order to cross language and distribution barriers a network of 16 translators and 22 partners from more than 10 countries was established. The DVD was distributed in approximately 700,000 copies throughout Europe. The project was amongst the largest of its kind with respect to collaboration, distribution and audience impact. It clearly demonstrated how international collaboration can produce effective cross-cultural educational and outreach products for astronomy.

Dynamical friction: The Hubble diagram as a cosmological test

International Nuclear Information System (INIS)

Gunn, J.E.; Tinsley, B.M.

1976-01-01

Effects on the Hubble diagram of the frictional accretion of small cluster galaxies by large ones, to which Ostriker and Tremaine have recently drawn attention, must be accurately determined if the magnitude-redshift relation is to become a viable cosmological test. We find that the process might be detectable through the concomitant change in galaxy colors, but that its effect on the dispersion of magnitudes of first-ranked cluster galaxies would be negligible even if the change in average magnitude is very important. The sign of the effect of accretion on the luminosity observed within a given aperture depends on the structures of the galaxies involved. The size of the effect not only depends sensitively on the galaxy structures, but is also amplified when the relatively recent collapse times of the clusters are taken into account. It is vital to answer the complicated observational and theoretical questions raised by these preliminary calculations, because the Hubble diagram remains the most promising approach to the deceleration parameter q 0 . Local tests of the density of the universe do not give equivalent information

HUBBLE provides multiple views of how to feed a black hole

Science.gov (United States)

1998-05-01

Although the cause-and-effect relationships are not yet clear, the views provided by complementary images from two instruments aboard the Hubble Space Telescope are giving astronomers new insights into the powerful forces being exerted in this complex maelstrom. Researchers believe these forces may even have shifted the axis of the massive black hole from its expected orientation. The Hubble wide-field camera visible image of the merged Centaurus A galaxy, also called NGC 5128, shows in sharp clarity a dramatic dark lane of dust girdling the galaxy. Blue clusters of newborn stars are clearly resolved, and silhouettes of dust filaments are interspersed with blazing orange-glowing gas. Located only 10 million light-years away, this peculiar-looking galaxy contains the closest active galactic nucleus to Earth and has long been considered an example of an elliptical galaxy disrupted by a recent collision with a smaller companion spiral galaxy. Using the infrared vision of Hubble, astronomers have penetrated this wall of dust for the first time to see a twisted disk of hot gas swept up in the black hole's gravitational whirlpool. The suspected black hole is so dense it contains the mass of perhaps a billion stars, compacted into a small region of space not much larger than our Solar System. Resolving features as small as seven light-years across, Hubble has shown astronomers that the hot gas disk is tilted in a different direction from the black hole's axis -- like a wobbly wheel around an axle. The black hole's axis is identified by the orientation of a high-speed jet of material, glowing in X-rays and radio frequencies, blasted from the black hole at 1/100th the speed of light. This gas disk presumably fueling the black hole may have formed so recently it is not yet aligned to the black hole's spin axis, or it may simply be influenced more by the galaxy's gravitational tug than by the black hole's. "This black hole is doing its own thing. Aside from receiving fresh

The IRAS minisurvey. [Infra Red Astronomy Satellite study of selected sources

Science.gov (United States)

Rowan-Robinson, M.; Clegg, P. E.; Emerson, J. P.; Beichman, C. A.; Aumann, H. H.; Gautier, T. N.; Neugebauer, G.; Soifer, B. T.; Beintema, D. A.; Boggess, N.

1984-01-01

Before the main Infrared Astronomical Satellite (IRAS) all-sky survey was started, a preliminary survey of 900 sq deg was carried out. Some results from this 'minisurvey' are given here. The completeness of the minisurvey at galactic latitudes from 20 to 40 deg drops sharply at flux densities below 0.4, 0.4, 0.5, and 2.5 Jy at 12, 25, 60, and 100 microns, respectively. The corresponding surface densities of point sources brighter than these flux levels are 1.1, 0.4, 0.65, and 1.25/sq deg, respectively. Outside the galactic plane, the majority of the sources at 12 and 25 microns are stars, while galaxies make up a significant proportion of 60 micron sources. The 100 micron band is dominated by emission from interstellar dust over much of the minisurvey area.

IRAS surface brightness maps of reflection nebulae in the Pleiades

Science.gov (United States)

Castelaz, Michael W.; Werner, M. W.; Sellgren, K.

1987-01-01

Surface brightness maps at 12, 25, 60, and 100 microns were made of a 2.5 deg x 2.5 deg area of the reflection nebulae in the Pleiades by coadding IRAS scans of this region. Emission is seen surrounding 17 Tau, 20 Tau, 23 Tau, and 25 Tau in all four bands, coextensive with the visible reflection nebulosity, and extending as far as 30 arcminutes from the illuminating stars. The infrared energy distributions of the nebulae peak in the 100 micron band, but up to 40 percent of the total infrared power lies in the 12 and 25 micron bands. The brightness of the 12 and 25 micron emission and the absence of temperature gradients at these wavelengths are inconsistent with the predictions of equilibrium thermal emission models. The emission at these wavelengths appears to be the result of micron nonequilibrium emission from very small grains, or from molecules consisting of 10-100 carbon atoms, which have been excited by ultraviolet radiation from the illuminating stars.

Hubble Space Telescope - Scientific, Technological and Social Contributions to the Public Discourse on Science

Science.gov (United States)

Wiseman, Jennifer

2012-01-01

The Hubble Space Telescope has unified the world with a sense of awe and wonder for 2 I years and is currently more scientifically powerful than ever. I will present highlights of discoveries made with the Hubble Space Telescope, including details of planetary weather, star formation, extra-solar planets, colliding galaxies, and a universe expanding with the acceleration of dark energy. I will also present the unique technical challenges and triumphs of this phenomenal observatory, and discuss how our discoveries in the cosmos affect our sense of human unity, significance, and wonder.

The Hubble Space Telescope: UV, Visible, and Near-Infrared Pursuits

Science.gov (United States)

Wiseman, Jennifer

2010-01-01

The Hubble Space Telescope continues to push the limits on world-class astrophysics. Cameras including the Advanced Camera for Surveys and the new panchromatic Wide Field Camera 3 which was installed nu last year's successful servicing mission S2N4,o{fer imaging from near-infrared through ultraviolet wavelengths. Spectroscopic studies of sources from black holes to exoplanet atmospheres are making great advances through the versatile use of STIS, the Space Telescope Imaging Spectrograph. The new Cosmic Origins Spectrograph, also installed last year, is the most sensitive UV spectrograph to fly io space and is uniquely suited to address particular scientific questions on galaxy halos, the intergalactic medium, and the cosmic web. With these outstanding capabilities on HST come complex needs for laboratory astrophysics support including atomic and line identification data. I will provide an overview of Hubble's current capabilities and the scientific programs and goals that particularly benefit from the studies of laboratory astrophysics.

A Scientific Revolution: The Hubble and James Webb Space Telescopes

Science.gov (United States)

Gardner, Jonathan P.

2010-01-01

Astronomy is going through a scientific revolution, responding to a flood of data from the Hubble Space Telescope, other space missions, and large telescopes on the ground. In this talk, I will discuss some of the important discoveries of the last decade, from dwarf planets in the outer Solar System to the mysterious dark energy that overcomes gravity to accelerate the expansion of the Universe. The next decade will be equally bright with the newly refurbished Hubble and the promise of its successor, the James Webb Space Telescope. An infrared-optimized 6.5m space telescope, Webb is designed to find the first galaxies that formed in the early universe and to peer into the dusty gas clouds where stars and planets are born. With MEMS technology, a deployed primary mirror and a tennis-court sized sunshield, the mission presents many technical challenges. I will describe Webb's scientific goals, its design and recent progress in constructing the observatory. Webb is scheduled for launch in 2014.

Distance to M33 determined from magnitude corrections to Hubble's original cepheid photometry

International Nuclear Information System (INIS)

Sandage, A.

1983-01-01

New photoelectric photometry in Selected Area 45, and transfers from a faint photoelectric sequence adjacent to the south-preceding arm in M33 have been made to the comparison stars for Hubble's Cepheids in M33. Progressive magnitude corrections are required to Hubble's M33 scales, reaching 2.8 mag at the limit of the Mount Wilson 2.5-m Hooker reflector. Hubble's Cepheid light curves have been corrected to the B photoelectric system, and new photometric parameters are given for 35 of his variables. The P-L relation agrees in zero point to within 0.2 mag of the P-L relation from independent data by Sandage and Carlson for 12 new Cepheids in an outlying region of M33. Application of an adopted absolute P-L relation, calibrated by Martin, Warren, and Feast, to these data gives an apparent blue modulus of (m-M)/sup AB//sub M33/ = 25.35, which is 0.67 mag fainter than a previously adopted value, and represents a factor of 4.2 increase of Hubble's earliest distance. Three consequences of this larger apparent distance modulus are (1) the mean absolute magnitude of the first three brightest red supergiants is M/sup max//sub left-angle-bracketV/(3)> = -8.7 rather than approx.-8.0 in M33, complicating but not destroying use of red supergiants as distance indicators, (2) the mean absolute magnitude of the two brightest blue irregular supergiant variables is M/sub left-angle-bracketB/(2)> = -9.95, which is close to the value for the brightest known supergiants in the galaxy, and (3) the absolute magnitude of M33 itself is brighter than heretofore assumed

Galaxy distances and deviations from universal expansion; Proceedings of the NATO Advanced Research Workshop, Kona, HI, Jan. 13-17, 1986

Science.gov (United States)

Madore, Barry F.; Tully, R. Brent

A collection of papers on galaxy distances and deviations from universal expansion is presented. Individual topics addressed include: new results on the distance scale and the Hubble constant, Magellanic Clouds and the distance scale, CCD observations of Cepheids in nearby galaxies, distances using A supergiant stars, infrared calibration of the Cepheid distance scale, two stepping stones to the Hubble constant, physical models of supernovae and the distance scale, 21 cm line widths and distances of spiral galaxies, infrared color-luminosity relations for field galaxies, minimizing the scatter in the Tully-Fisher relation, photometry of galaxies and the local peculiar motion, elliptical galaxies and nonuniformities in the Hubble flow, and large-scale anisotropy in the Hubble flow. Also discussed are: improved distance indicator for elliptical galaxies, anisotropy of galaxies detected by IRAS, the local gravitational field, measurements of the CBR, measure of cosmological times, ages from nuclear cosmochronology, extragalactic gas at high redshift, supercluster infall models, Virgo infall and the mass density of the universe, dynamics of superclusters and Omega(0), distribution of galaxies versus dark matter, peculiar velocities and galaxy formation, cosmological shells and blast waves.

Making Data Mobile: The Hubble Deep Field Academy iPad app

Science.gov (United States)

Eisenhamer, Bonnie; Cordes, K.; Davis, S.; Eisenhamer, J.

2013-01-01

Many school districts are purchasing iPads for educators and students to use as learning tools in the classroom. Educators often prefer these devices to desktop and laptop computers because they offer portability and an intuitive design, while having a larger screen size when compared to smart phones. As a result, we began investigating the potential of adapting online activities for use on Apple’s iPad to enhance the dissemination and usage of these activities in instructional settings while continuing to meet educators’ needs. As a pilot effort, we are developing an iPad app for the “Hubble Deep Field Academy” - an activity that is currently available online and commonly used by middle school educators. The Hubble Deep Field Academy app features the HDF-North image while centering on the theme of how scientists use light to explore and study the universe. It also includes features such as embedded links to vocabulary, images and videos, teacher background materials, and readings about Hubble’s other deep field surveys. It is our goal is to impact students’ engagement in STEM-related activities, while enhancing educators’ usage of NASA data via new and innovative mediums. We also hope to develop and share lessons learned with the E/PO community that can be used to support similar projects. We plan to test the Hubble Deep Field Academy app during the school year to determine if this new activity format is beneficial to the education community.

Quasar Host Galaxies/Neptune Rotation/Galaxy Building Blocks/Hubble Deep Field/Saturn Storm

Science.gov (United States)

2001-01-01

Computerized animations simulate a quasar erupting in the core of a normal spiral galaxy, the collision of two interacting galaxies, and the evolution of the universe. Hubble Space Telescope (HST) images show six quasars' host galaxies (including spirals, ellipticals, and colliding galaxies) and six clumps of galaxies approximately 11 billion light years away. A false color time lapse movie of Neptune displays the planet's 16-hour rotation, and the evolution of a storm on Saturn is seen though a video of the planet's rotation. A zoom sequence starts with a ground-based image of the constellation Ursa major and ends with the Hubble Deep Field through progressively narrower and deeper views.

MOVING OBJECTS IN THE HUBBLE ULTRA DEEP FIELD

Energy Technology Data Exchange (ETDEWEB)

Kilic, Mukremin; Gianninas, Alexandros [Homer L. Dodge Department of Physics and Astronomy, University of Oklahoma, 440 W. Brooks St., Norman, OK 73019 (United States); Von Hippel, Ted, E-mail: kilic@ou.edu, E-mail: alexg@nhn.ou.edu, E-mail: ted.vonhippel@erau.edu [Embry-Riddle Aeronautical University, 600 S. Clyde Morris Blvd., Daytona Beach, FL 32114 (United States)

2013-09-01

We identify proper motion objects in the Hubble Ultra Deep Field (UDF) using the optical data from the original UDF program in 2004 and the near-infrared data from the 128 orbit UDF 2012 campaign. There are 12 sources brighter than I = 27 mag that display >3{sigma} significant proper motions. We do not find any proper motion objects fainter than this magnitude limit. Combining optical and near-infrared photometry, we model the spectral energy distribution of each point-source using stellar templates and state-of-the-art white dwarf models. For I {<=} 27 mag, we identify 23 stars with K0-M6 spectral types and two faint blue objects that are clearly old, thick disk white dwarfs. We measure a thick disk white dwarf space density of 0.1-1.7 Multiplication-Sign 10{sup -3} pc{sup -3} from these two objects. There are no halo white dwarfs in the UDF down to I = 27 mag. Combining the Hubble Deep Field North, South, and the UDF data, we do not see any evidence for dark matter in the form of faint halo white dwarfs, and the observed population of white dwarfs can be explained with the standard Galactic models.

The census of complex organic molecules in the solar-type protostar IRAS16293-2422

Energy Technology Data Exchange (ETDEWEB)

Jaber, Ali A.; Ceccarelli, C.; Kahane, C. [Université Grenoble Alpes, IPAG, F-38000 Grenoble (France); Caux, E. [Université de Toulouse, UPS-OMP, IRAP, F-31400 Toulouse (France)

2014-08-10

Complex organic molecules (COMs) are considered to be crucial molecules, since they are connected with organic chemistry, at the basis of terrestrial life. More pragmatically, they are molecules which in principle are difficult to synthesize in harsh interstellar environments and, therefore, are a crucial test for astrochemical models. Current models assume that several COMs are synthesized on lukewarm grain surfaces (≳30-40 K) and released in the gas phase at dust temperatures of ≳100 K. However, recent detections of COMs in ≲20 K gas demonstrate that we still need important pieces to complete the puzzle of COMs formation. Here, we present a complete census of the oxygen- and nitrogen-bearing COMs, previously detected in different Interstellar Medium (ISM) regions, toward the solar-type protostar IRAS16293-2422. The census was obtained from the millimeter-submillimeter unbiased spectral survey TIMASSS. Of the 29 COMs searched for, 6 were detected: methyl cyanide, ketene, acetaldehyde, formamide, dimethyl ether, and methyl formate. Multifrequency analysis of the last five COMs provides clear evidence that they are present in the cold (≲30 K) envelope of IRAS16293-2422, with abundances of 0.03-2 × 10{sup –10}. Our data do not allow us to support the hypothesis that the COMs abundance increases with increasing dust temperature in the cold envelope, as expected if COMs were predominately formed on lukewarm grain surfaces. Finally, when also considering other ISM sources, we find a strong correlation over five orders of magnitude between methyl formate and dimethyl ether, and methyl formate and formamide abundances, which may point to a link between these two couples of species in cold and warm gas.

Type I supernovae and angular anisotropy of the Hubble constant

International Nuclear Information System (INIS)

Le Denmat, Gerard; Vigier, J.-P.

1975-01-01

The observation of type I supernovae in distant galaxies yields an homogeneous sample of sources to evaluate their true distance. An examination of their distribution in the sky provides a significant confirmation of the angular anisotropy of the Hubble constant already observed by Rubin, Rubin and Ford [fr

UVUDF: Ultraviolet Imaging of the Hubble Ultra Deep Field with Wide-Field Camera 3

Science.gov (United States)

Teplitz, Harry I.; Rafelski, Marc; Kurczynski, Peter; Bond, Nicholas A.; Grogin, Norman; Koekemoer, Anton M.; Atek, Hakim; Brown, Thomas M.; Coe, Dan; Colbert, James W.; Ferguson, Henry C.; Finkelstein, Steven L.; Gardner, Jonathan P.; Gawiser, Eric; Giavalisco, Mauro; Gronwall, Caryl; Hanish, Daniel J.; Lee, Kyoung-Soo; de Mello, Duilia F.; Ravindranath, Swara; Ryan, Russell E.; Siana, Brian D.; Scarlata, Claudia; Soto, Emmaris; Voyer, Elysse N.; Wolfe, Arthur M.

2013-12-01

We present an overview of a 90 orbit Hubble Space Telescope treasury program to obtain near-ultraviolet imaging of the Hubble Ultra Deep Field using the Wide Field Camera 3 UVIS detector with the F225W, F275W, and F336W filters. This survey is designed to: (1) investigate the episode of peak star formation activity in galaxies at 1 dropouts at redshifts 1.7, 2.1, and 2.7 is largely consistent with the number predicted by published luminosity functions. We also confirm that the image mosaics have sufficient sensitivity and resolution to support the analysis of the evolution of star-forming clumps, reaching 28-29th magnitude depth at 5σ in a 0.''2 radius aperture depending on filter and observing epoch. Based on observations made with the NASA/ESA Hubble Space Telescope, obtained at the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS 5-26555. These observations are #12534.

Characterization of the volatile components in green tea by IRAE-HS-SPME/GC-MS combined with multivariate analysis.

Science.gov (United States)

Yang, Yan-Qin; Yin, Hong-Xu; Yuan, Hai-Bo; Jiang, Yong-Wen; Dong, Chun-Wang; Deng, Yu-Liang

2018-01-01

In the present work, a novel infrared-assisted extraction coupled to headspace solid-phase microextraction (IRAE-HS-SPME) followed by gas chromatography-mass spectrometry (GC-MS) was developed for rapid determination of the volatile components in green tea. The extraction parameters such as fiber type, sample amount, infrared power, extraction time, and infrared lamp distance were optimized by orthogonal experimental design. Under optimum conditions, a total of 82 volatile compounds in 21 green tea samples from different geographical origins were identified. Compared with classical water-bath heating, the proposed technique has remarkable advantages of considerably reducing the analytical time and high efficiency. In addition, an effective classification of green teas based on their volatile profiles was achieved by partial least square-discriminant analysis (PLS-DA) and hierarchical clustering analysis (HCA). Furthermore, the application of a dual criterion based on the variable importance in the projection (VIP) values of the PLS-DA models and on the category from one-way univariate analysis (ANOVA) allowed the identification of 12 potential volatile markers, which were considered to make the most important contribution to the discrimination of the samples. The results suggest that IRAE-HS-SPME/GC-MS technique combined with multivariate analysis offers a valuable tool to assess geographical traceability of different tea varieties.

Characterization of the volatile components in green tea by IRAE-HS-SPME/GC-MS combined with multivariate analysis.

Directory of Open Access Journals (Sweden)

Yan-Qin Yang

Full Text Available In the present work, a novel infrared-assisted extraction coupled to headspace solid-phase microextraction (IRAE-HS-SPME followed by gas chromatography-mass spectrometry (GC-MS was developed for rapid determination of the volatile components in green tea. The extraction parameters such as fiber type, sample amount, infrared power, extraction time, and infrared lamp distance were optimized by orthogonal experimental design. Under optimum conditions, a total of 82 volatile compounds in 21 green tea samples from different geographical origins were identified. Compared with classical water-bath heating, the proposed technique has remarkable advantages of considerably reducing the analytical time and high efficiency. In addition, an effective classification of green teas based on their volatile profiles was achieved by partial least square-discriminant analysis (PLS-DA and hierarchical clustering analysis (HCA. Furthermore, the application of a dual criterion based on the variable importance in the projection (VIP values of the PLS-DA models and on the category from one-way univariate analysis (ANOVA allowed the identification of 12 potential volatile markers, which were considered to make the most important contribution to the discrimination of the samples. The results suggest that IRAE-HS-SPME/GC-MS technique combined with multivariate analysis offers a valuable tool to assess geographical traceability of different tea varieties.

Monte Carlo calculations and experimental measurements of dosimetric parameters of the IRA-103Pd brachytherapy source

International Nuclear Information System (INIS)

Sadeghi, Mahdi; Raisali, Gholamreza; Hosseini, S. Hamed; Shavar, Arzhang

2008-01-01

This article presents a brachytherapy source having 103 Pd adsorbed onto a cylindrical silver rod that has been developed by the Agricultural, Medical, and Industrial Research School for permanent implant applications. Dosimetric characteristics (radial dose function, anisotropy function, and anisotropy factor) of this source were experimentally and theoretically determined in terms of the updated AAPM Task group 43 (TG-43U1) recommendations. Monte Carlo simulations were used to calculate the dose rate constant. Measurements were performed using TLD-GR200A circular chip dosimeters using standard methods employing thermoluminescent dosimeters in a Perspex phantom. Precision machined bores in the phantom located the dosimeters and the source in a reproducible fixed geometry, providing for transverse-axis and angular dose profiles over a range of distances from 0.5 to 5 cm. The Monte Carlo N-particle (MCNP) code, version 4C simulation techniques have been used to evaluate the dose-rate distributions around this model 103 Pd source in water and Perspex phantoms. The Monte Carlo calculated dose rate constant of the IRA- 103 Pd source in water was found to be 0.678 cGy h -1 U -1 with an approximate uncertainty of ±0.1%. The anisotropy function, F(r,θ), and the radial dose function, g(r), of the IRA- 103 Pd source were also measured in a Perspex phantom and calculated in both Perspex and liquid water phantoms

Hubble's View of Little Blue Dots

Science.gov (United States)

Kohler, Susanna

2018-02-01

The recent discovery of a new type of tiny, star-forming galaxy is the latest in a zoo of detections shedding light on our early universe. What can we learn from the unique little blue dots found in archival Hubble data?Peas, Berries, and DotsGreen pea galaxies identified by citizen scientists with Galaxy Zoo. [Richard Nowell Carolin Cardamone]As telescope capabilities improve and we develop increasingly deeper large-scale surveys of our universe, we continue to learn more about small, faraway galaxies. In recent years, increasing sensitivity first enabled the detection of green peas luminous, compact, low-mass (10 billion solar masses; compare this to the Milky Ways 1 trillion solar masses!) galaxies with high rates of star formation.Not long thereafter, we discovered galaxies that form stars similarly rapidly, but are even smaller only 330 million solar masses, spanning less than 3,000 light-years in size. These tiny powerhouses were termed blueberries for their distinctive color.Now, scientists Debra and Bruce Elmegreen (of Vassar College and IBM Research Division, respectively) report the discovery of galaxies that have even higher star formation rates and even lower masses: little blue dots.Exploring Tiny Star FactoriesThe Elmegreens discovered these unique galaxies by exploring archival Hubble data. The Hubble Frontier Fields data consist of deep images of six distant galaxy clusters and the parallel fields next to them. It was in the archival data for two Frontier Field Parallels, those for clusters Abell 2744 and MAS J0416.1-2403, that the authors noticed several galaxies that stand out as tiny, bright, blue objects that are nearly point sources.Top: a few examples of the little blue dots recently identified in two Hubble Frontier Field Parallels. Bottom: stacked images for three different groups of little blue dots. [Elmegreen Elmegreen 2017]The authors performed a search through the two Frontier Field Parallels, discovering a total of 55 little blue dots

Application of radioactive tracers in upgradation of industrial grade ion exchange resin (Amberlite IRA-400)

International Nuclear Information System (INIS)

Lokhande, R.S.; Singare, P.U.

1998-01-01

The exchange rates of ion exchange are determined by application of 131 I as a tracer isotope. The exchange study carried out in this investigation deals with understanding the effectiveness of ion exchange resin (in iodide form) Amberlite IRA-400 at different concentrations of potassium iodide solution (electrolyte) with temperature of solution varying from 27-48 degC by keeping amount of ion exchange resin constant (1.0 g). The exchange study is also carried out by varying amount of ion exchange resins, for fixed temperature (27.0 degC) and for fixed concentration of potassium iodide solution (0.005 M). (author)

Performance Comparisons of Improved Regular Repeat Accumulate (RA and Irregular Repeat Accumulate (IRA Turbo Decoding

Directory of Open Access Journals (Sweden)

Ahmed Abdulkadhim Hamad

2017-08-01

Full Text Available In this paper, different techniques are used to improve the turbo decoding of regular repeat accumulate (RA and irregular repeat accumulate (IRA codes. The adaptive scaling of a-posteriori information produced by Soft-output Viterbi decoder (SOVA is proposed. The encoded pilots are another scheme that applied for short length RA codes. This work also suggests a simple and a fast method to generate a random interleaver having a free 4 cycle Tanner graph. Progressive edge growth algorithm (PEG is also studied and simulated to create the Tanner graphs which have a great girth.

Organic Chemistry of Southern Sources: Microwave Spectroscopy of Cha-MMS1 and IRAS 15194-5115

Science.gov (United States)

Cordiner, Martin; Charnley, Steven

2011-01-01

We report new spectra of molecule-rich sources in the southern hemisphere obtained using the 22-meter Mopra telescope. Spectra and maps are presented of organic molecules detected between 30 and 50 GHz in the young Class 0 protostar Chamaeleon MMS-1. The large abundances of polyynes, cyanopolyynes and methanol may be indicative of a warm carbon chemistry in the dense gas surrounding this protostar. Spectra are also presented from a 78-96 GHz scan of the carbon-rich AGB star IRAS 15194-5115, including new detections of HC5N, CCS and C13CH.

Studying Galaxy Formation with the Hubble, Spitzer and James Webb Space Telescopes

Science.gov (United States)

Gardner, Jonathan P.

2009-01-01

The deepest optical to infrared observations of the universe include the Hubble Deep Fields, the Great Observatories Origins Deep Survey and the recent Hubble Ultra-Deep Field. Galaxies are seen in these surveys at redshifts z greater than 6, less than 1 Gyr after the Big Bang, at the end of a period when light from the galaxies has reionized Hydrogen in the inter-galactic medium. These observations, combined with theoretical understanding, indicate that the first stars and galaxies formed at z greater than 10, beyond the reach of the Hubble and Spitzer Space Telescopes. To observe the first galaxies, NASA is planning the James Webb Space Telescope (JWST), a large (6.5m), cold (less than 50K), infrared-optimized observatory to be launched early in the next decade into orbit around the second Earth-Sun Lagrange point. JWST will have four instruments: The Near-Infrared Camera, the Near-Infrared multi-object Spectrograph, and the Tunable Filter Imager will cover the wavelength range 0.6 to 5 microns, while the Mid-Infrared Instrument will do both imaging and spectroscopy from 5 to 28.5 microns. In addition to JWST's ability to study the formation and evolution of galaxies, I will also briefly review its expected contributions to studies of the formation of stars and planetary systems, and discuss recent progress in constructing the observatory.

WITNESSING THE KEY EARLY PHASE OF QUASAR EVOLUTION: AN OBSCURED ACTIVE GALACTIC NUCLEUS PAIR IN THE INTERACTING GALAXY IRAS 20210+1121

International Nuclear Information System (INIS)

Piconcelli, Enrico; Fiore, Fabrizio; Maiolino, Roberto; Nicastro, Fabrizio; Vignali, Cristian; Bianchi, Stefano; Mathur, Smita; Guainazzi, Matteo; Lanzuisi, Giorgio

2010-01-01

We report the discovery of an active galactic nucleus (AGN) pair in the interacting galaxy system IRAS 20210+1121 at z = 0.056. An XMM-Newton observation reveals the presence of an obscured (N H ∼ 5 x 10 23 cm -2 ), Seyfert-like (L 2-10keV = 4.7 x 10 42 erg s -1 ) nucleus in the northern galaxy, which lacks unambiguous optical AGN signatures. Our spectral analysis also provides strong evidence that the IR-luminous southern galaxy hosts a Type 2 quasar embedded in a bright starburst emission. In particular, the X-ray primary continuum from the nucleus appears totally depressed in the XMM-Newton band as expected in the case of a Compton-thick absorber, and only the emission produced by Compton scattering ('reflection') of the continuum from circumnuclear matter is seen. As such, IRAS 20210+1121 seems to provide an excellent opportunity to witness a key, early phase in the quasar evolution predicted by the theoretical models of quasar activation by galaxy collisions.

Revealing the ultrafast outflow in IRAS 13224-3809 through spectral variability

Science.gov (United States)

Parker, M. L.; Alston, W. N.; Buisson, D. J. K.; Fabian, A. C.; Jiang, J.; Kara, E.; Lohfink, A.; Pinto, C.; Reynolds, C. S.

2017-08-01

We present an analysis of the long-term X-ray variability of the extreme narrow-line Seyfert 1 galaxy IRAS 13224-3809 using principal component analysis (PCA) and fractional excess variability (Fvar) spectra to identify model-independent spectral components. We identify a series of variability peaks in both the first PCA component and Fvar spectrum which correspond to the strongest predicted absorption lines from the ultrafast outflow (UFO) discovered by Parker et al. (2017). We also find higher order PCA components, which correspond to variability of the soft excess and reflection features. The subtle differences between RMS and PCA results argue that the observed flux-dependence of the absorption is due to increased ionization of the gas, rather than changes in column density or covering fraction. This result demonstrates that we can detect outflows from variability alone and that variability studies of UFOs are an extremely promising avenue for future research.

A Guided Inquiry on Hubble Plots and the Big Bang

Science.gov (United States)

Forringer, Ted

2014-01-01

In our science for non-science majors course "21st Century Physics," we investigate modern "Hubble plots" (plots of velocity versus distance for deep space objects) in order to discuss the Big Bang, dark matter, and dark energy. There are two potential challenges that our students face when encountering these topics for the…

Nickel-hydrogen battery testing for Hubble Space Telescope

Science.gov (United States)

Baggett, Randy M.; Whitt, Thomas H.

1989-01-01

The authors identify objectives and provide data from several nickel-hydrogen battery tests designed to evaluate the possibility of launching Ni-H2 batteries on the Hubble Space Telescope (HST). Test results from a 14-cell battery, a 12-cell battery, and a 4-cell pack are presented. Results of a thermal vacuum test to verify the battery-module/bay heat rejection capacity are reported. A 6-battery system simulation breadboard is described, and test results are presented.

The Hubble Space Telescope nickel-hydrogen battery design

Science.gov (United States)

Nawrocki, D. E.; Armantrout, J. D.; Standlee, D. J.; Baker, R. C.; Lanier, J. R.

1990-01-01

Details are presented of the HST (Hubble Space Telescope) battery cell, battery package, and module mechanical and electrical designs. Also included are a summary of acceptance, qualification, and vibration tests and thermal vacuum testing. Unique details of battery cell charge retention performance characteristics associated with prelaunch hold conditions are discussed. Special charge control methods to minimize thermal dissipation during pad charging operations are summarized. This module design meets all NASA fracture control requirements for manned missions.

Provocaciones del alumnado y emoción de ira en el profesorado de Educación Física: El caso de los centros de atención educativa preferente de la ciudad de Barcelona

Directory of Open Access Journals (Sweden)

Sylvain Ayme

2010-09-01

Full Text Available Los objetivos de este artículo son: a identificar los diferentes tipos de provocaciones del alumnado en las clases de Educación Física y b relacionarlos con las reacciones de ira (y sus grados de intensidad de cinco profesores de esta materia que ejercen en centros de atención educativa preferente (CAEP en Barcelona. Los resultados del análisis de cincuenta sesiones muestran que: a cuatro de los cinco profesores sintieron intensidades “bajas” de ira en la mayoría de ocasiones; b lo que les produce una mayor intensidad de ira es la no participación del alumnado, aunque las intensidades emocionales varían según el tipo de provocación, y c la percepción del “nivel de perjuicio” y “carácter voluntario” de las provocaciones explican hasta un 51 % de la variación del nivel de intensidad de las respuestas emocionales de estos profesores.

The effect of interacting dark energy on local measurements of the Hubble constant

International Nuclear Information System (INIS)

Odderskov, Io; Baldi, Marco; Amendola, Luca

2016-01-01

In the current state of cosmology, where cosmological parameters are being measured to percent accuracy, it is essential to understand all sources of error to high precision. In this paper we present the results of a study of the local variations in the Hubble constant measured at the distance scale of the Coma Cluster, and test the validity of correcting for the peculiar velocities predicted by gravitational instability theory. The study is based on N-body simulations, and includes models featuring a coupling between dark energy and dark matter, as well as two ΛCDM simulations with different values of σ 8 . It is found that the variance in the local flows is significantly larger in the coupled models, which increases the uncertainty in the local measurements of the Hubble constant in these scenarios. By comparing the results from the different simulations, it is found that most of the effect is caused by the higher value of σ 8 in the coupled cosmologies, though this cannot account for all of the additional variance. Given the discrepancy between different estimates of the Hubble constant in the universe today, cosmological models causing a greater cosmic variance is something that we should be aware of.

The effect of interacting dark energy on local measurements of the Hubble constant

Energy Technology Data Exchange (ETDEWEB)

Odderskov, Io [Department of Physics and Astronomy, University of Aarhus, Ny Munkegade 120, Aarhus C (Denmark); Baldi, Marco [Dipartimento di Fisica e Astronomia, Alma Mater Studiorum Università di Bologna, viale Berti Pichat 6/2, I-40127, Bologna (Italy); Amendola, Luca, E-mail: isho07@phys.au.dk, E-mail: marco.baldi5@unibo.it, E-mail: l.amendola@thphys.uni-heidelberg.de [Institut für Theoretische Physik, Ruprecht-Karls-Universität Heidelberg, Philosophenweg 16, 69120 Heidelberg (Germany)

2016-05-01

In the current state of cosmology, where cosmological parameters are being measured to percent accuracy, it is essential to understand all sources of error to high precision. In this paper we present the results of a study of the local variations in the Hubble constant measured at the distance scale of the Coma Cluster, and test the validity of correcting for the peculiar velocities predicted by gravitational instability theory. The study is based on N-body simulations, and includes models featuring a coupling between dark energy and dark matter, as well as two ΛCDM simulations with different values of σ{sub 8}. It is found that the variance in the local flows is significantly larger in the coupled models, which increases the uncertainty in the local measurements of the Hubble constant in these scenarios. By comparing the results from the different simulations, it is found that most of the effect is caused by the higher value of σ{sub 8} in the coupled cosmologies, though this cannot account for all of the additional variance. Given the discrepancy between different estimates of the Hubble constant in the universe today, cosmological models causing a greater cosmic variance is something that we should be aware of.

Astronomers celebrate a year of new Hubble results

Science.gov (United States)

1995-02-01

"We are beginning to understand that because of these observations we are going to have to change the way we look at the Universe," said ESA's Dr Duccio Macchetto, Associate Director for Science Programs at the Space Telescope Science Institute (STScI), Baltimore, Maryland, USA. The European Space Agency plays a major role in the Hubble Space Telescope programme. The Agency provided one of the telescope's four major instruments, called the Faint Object Camera, and two sets of electricity-generating solar arrays. In addition, 15 ESA scientific and technical staff work at the STScI. In return for this contribution, European astronomers are entitled to 15 percent of the telescope's observing time, although currently they account for 20 percent of all observations. "This is a testimony to the quality of the European science community", said Dr Roger Bonnet, Director of Science at ESA. "We are only guaranteed 15 percent of the telescope's use, but consistently receive much more than that." Astronomers from universities, observatories and research institutes across Europe lead more than 60 investigations planned for the telescope's fifth observing cycle, which begins this summer. Many more Europeans contribute to teams led by other astronomers. Looking back to the very start of time European astronomer Dr Peter Jakobsen used ESA's Faint Object Camera to confirm that helium was present in the early Universe. Astronomers had long predicted that 90 percent of the newly born Universe consisted of hydrogen, with helium making up the remainder. Before the refurbished Hubble came along, it was easy to detect the hydrogen, but the primordial helium remained elusive. The ultraviolet capabilities of the telescope, combined with the improvement in spatial resolution following the repair, made it possible for Dr Jakobsen to obtain an image of a quasar close to the edge of the known Universe. A spectral analysis of this picture revealed the quasar's light, which took 13 billion years

THE PHYSICAL ENVIRONMENT AROUND IRAS 17599–2148: INFRARED DARK CLOUD AND BIPOLAR NEBULA

Energy Technology Data Exchange (ETDEWEB)

Dewangan, L. K.; Janardhan, P. [Physical Research Laboratory, Navrangpura, Ahmedabad 380 009 (India); Ojha, D. K. [Department of Astronomy and Astrophysics, Tata Institute of Fundamental Research, Homi Bhabha Road, Mumbai 400 005 (India); Zinchenko, I. [Institute of Applied Physics of the Russian Academy of Sciences, 46 Ulyanov st., Nizhny Novgorod 603950 (Russian Federation); Ghosh, S. K. [National Centre for Radio Astrophysics, Ganeshkhind, Pune 411 007 (India); Luna, A., E-mail: lokeshd@prl.res.in [Instituto Nacional de Astrofísica, Óptica y Electrónica, Luis Enrique Erro # 1, Tonantzintla, Puebla, C.P. 72840 (Mexico)

2016-12-20

We present a multiscale and multiwavelength study to investigate the star formation process around IRAS 17599–2148, which is part of an elongated filamentary structure (EFS) (extension ∼21 pc) seen in the Herschel maps. Using the Herschel data analysis, at least six massive clumps (M {sub clump} ∼ 777–7024 M {sub ⊙}) are found in the EFS with a range of temperature and column density of ∼16–39 K and ∼(0.6–11) × 10{sup 22} cm{sup −2} (A {sub V}  ∼ 7–117 mag), respectively. The EFS hosts cold gas regions (i.e., infrared dark cloud) without any radio detection and a bipolar nebula (BN) linked with the H ii region IRAS 17599–2148, tracing two distinct environments inferred through the temperature distribution and ionized emission. Based on virial analysis and higher values of self-gravitating pressure, the clumps are found unstable against gravitational collapse. We find 474 young stellar objects (YSOs) in the selected region, and ∼72% of these YSOs are found in the clusters distributed mainly toward the clumps in the EFS. These YSOs might have spontaneously formed due to processes not related to the expanding H ii region. At the edges of BN, four additional clumps are also associated with YSO clusters, which appear to be influenced by the expanding H ii region. The most massive clump in the EFS contains two compact radio sources traced in the Giant Metre-wave Radio Telescope 1.28 GHz map and a massive protostar candidate, IRS 1, prior to an ultracompact H ii phase. Using the Very Large Telescope/NACO near-infrared images, IRS 1 is resolved with a jet-like feature within a 4200 au scale.

Observational constraints on Hubble parameter in viscous generalized Chaplygin gas

Science.gov (United States)

Thakur, P.

2018-04-01

Cosmological model with viscous generalized Chaplygin gas (in short, VGCG) is considered here to determine observational constraints on its equation of state parameters (in short, EoS) from background data. These data consists of H(z)-z (OHD) data, Baryonic Acoustic Oscillations peak parameter, CMB shift parameter and SN Ia data (Union 2.1). Best-fit values of the EoS parameters including present Hubble parameter (H0) and their acceptable range at different confidence limits are determined. In this model the permitted range for the present Hubble parameter and the transition redshift (zt) at 1σ confidence limits are H0= 70.24^{+0.34}_{-0.36} and zt=0.76^{+0.07}_{-0.07} respectively. These EoS parameters are then compared with those of other models. Present age of the Universe (t0) have also been determined here. Akaike information criterion and Bayesian information criterion for the model selection have been adopted for comparison with other models. It is noted that VGCG model satisfactorily accommodates the present accelerating phase of the Universe.

Hubble Space Telescope electrical power system

Science.gov (United States)

Whitt, Thomas H.; Bush, John R., Jr.

1990-01-01

The Hubble Space Telescope (HST) electrical power system (EPS) is supplying between 2000 and 2400 W of continuous power to the electrical loads. The major components of the EPS are the 5000-W back surface field reflector solar array, the six nickel-hydrogen (NiH2) 22-cell 88-Ah batteries, and the charge current controllers, which, in conjunction with the flight computer, control battery charging. The operation of the HST EPS and the results of the HST NiH2 six-battery test are discussed, and preliminary flight data are reviewed. The HST NiH2 six-battery test is a breadboard of the HST EPS on test at Marshall Space Flight Center.

Constraining the evolution of the Hubble Parameter using cosmic chronometers

Science.gov (United States)

Dickinson, Hugh

2017-08-01

Substantial investment is being made in space- and ground-based missions with the goal of revealing the nature of the observed cosmic acceleration. This is one of the most important unsolved problems in cosmology today.We propose here to constrain the evolution of the Hubble parameter [H(z)] between 1.3 fundamental nature of dark energy.

Diatomáceas perifíticas em um sistema eutrófico brasileiro (Reservatório do Iraí, estado do Paraná Periphytic diatoms in a Brazilian eutrophic system (Iraí reservoir, Paraná state

Directory of Open Access Journals (Sweden)

Angela Maria da Silva

2010-12-01

Full Text Available O estudo sobre a diversidade das diatomáceas do reservatório do Iraí ampliou o conhecimento da flora diatomológica perifítica de ambientes eutróficos do estado do Paraná e contribuiu para subsidiar futuros trabalhos que utilizem diatomáceas como bioindicadoras das condições tróficas da água. Coletas trimestrais foram realizadas no reservatório durante um ano. As amostras perifíticas foram obtidas pela remoção do biofilme aderido a caules da macrófita Polygonum sp. e a lâminas de vidro. Estas foram colocadas em complexos de madeira e deixadas submersas durante 30 dias para colonização. O estudo taxonômico resultou na identificação de 11 citações pioneiras para o estado do Paraná entre as 96 espécies de diatomáceas determinadas. Maior diversidade de espécies foi registrada para o substrato macrófita. Achnanthidium minutissimum foi dominante na maior parte das amostras analisadas, sendo considerada tolerante às condições eutróficas do reservatório do Iraí. Fragilaria rumpens, Fragilaria vaucheriae var. capitellata e Gomphonema gracile foram abundantes. Informações ecológicas sobre as espécies foram obtidas em literatura, sendo 35% características de sistemas aquáticos em processo avançado de eutrofização, 18% de ambientes mesotróficos e 19% classificadas como tolerantes e indiferentes ao estado trófico dos ambientes.This floristic survey contributed to our knowledge of periphytic diatoms in a eutrophic reservoir in Paraná state, and provided a basis for future works using diatoms as bioindicators of trophic water conditions. Samples were collected quarterly, over a year, by removing the biofilm attached to Polygonum sp. stems and to glass slides. The slides were placed in wooden frames and remained submersed for 30 days to colonize. The taxonomic study resulted in 11 new taxonomic records for Paraná state among the 96 identified diatoms. The highest species diversity was found in the macrophyte

EXTINCTION AND POLYCYCLIC AROMATIC HYDROCARBON INTENSITY VARIATIONS ACROSS THE H II REGION IRAS 12063-6259

Energy Technology Data Exchange (ETDEWEB)

Stock, D. J.; Peeters, E.; Otaguro, J. N. [Department of Physics and Astronomy, University of Western Ontario, London, ON N6A 3K7 (Canada); Tielens, A. G. G. M. [Leiden Observatory, Leiden University, P.O. Box 9513, NL-2300 RA Leiden (Netherlands); Bik, A. [Max-Planck-Institut fuer Astronomie, Koenigstuhl 17, D-69117 Heidelberg (Germany)

2013-07-01

The spatial variations in polycyclic aromatic hydrocarbon (PAH) band intensities are normally attributed to the physical conditions of the emitting PAHs, however in recent years it has been suggested that such variations are caused mainly by extinction. To resolve this question, we have obtained near-infrared (NIR), mid-infrared (MIR), and radio observations of the compact H II region IRAS 12063-6259. We use these data to construct multiple independent extinction maps and also to measure the main PAH features (6.2, 7.7, 8.6, and 11.2 {mu}m) in the MIR. Three extinction maps are derived: the first using the NIR hydrogen lines and case B recombination theory; the second combining the NIR data with radio data; and the third making use of the Spitzer/IRS MIR observations to measure the 9.8 {mu}m silicate absorption feature using the Spoon method and PAHFIT (as the depth of this feature can be related to overall extinction). The silicate absorption over the bright, southern component of IRAS 12063-6259 is almost absent while the other methods find significant extinction. While such breakdowns of the relationship between the NIR extinction and the 9.8 {mu}m absorption have been observed in molecular clouds, they have never been observed for H II regions. We then compare the PAH intensity variations in the Spitzer/IRS data after dereddening to those found in the original data. It was found that in most cases, the PAH band intensity variations persist even after dereddening, implying that extinction is not the main cause of the PAH band intensity variations.

"HUBBLE, the astronomer, the telescope, the results"

CERN Multimedia

CERN. Geneva

2011-01-01

The fundamental discoveries made by Edwin Hubble in the first quarter of the last century will be presented. The space telescope bearing his name will be introduced, as well as the strategy put in place by NASA and the European Space Agency for its operation and its maintenance on-orbit. The personal experience of the speaker having participated in two of five servicing mission will be exposed and illustrated by pictures taken on-orbit. Finally, the main results obtained by the orbital observatory will be presented, in particular the ones related to the large scale structure of the Universe and its early history

A RECENT ACCRETION BURST IN THE LOW-MASS PROTOSTAR IRAS 15398-3359: ALMA IMAGING OF ITS RELATED CHEMISTRY

International Nuclear Information System (INIS)

Jørgensen, Jes K.; Brinch, Christian; Lindberg, Johan E.; Bisschop, Suzanne E.; Visser, Ruud; Bergin, Edwin A.; Sakai, Nami; Yamamoto, Satoshi; Harsono, Daniel; Van Dishoeck, Ewine F.; Persson, Magnus V.

2013-01-01

Low-mass protostars have been suggested to show highly variable accretion rates throughout their evolution. Such changes in accretion, and related heating of their ambient envelopes, may trigger significant chemical variations on different spatial scales and from source-to-source. We present images of emission from C 17 O, H 13 CO + , CH 3 OH, C 34 S and C 2 H toward the low-mass protostar IRAS 15398-3359 on 0.''5 (75 AU diameter) scales with the Atacama Large Millimeter/submillimeter Array at 340 GHz. The resolved images show that the emission from H 13 CO + is only present in a ring-like structure with a radius of about 1-1.''5 (150-200 AU) whereas the CO and other high dipole moment molecules are centrally condensed toward the location of the central protostar. We propose that HCO + is destroyed by water vapor present on small scales. The origin of this water vapor is likely an accretion burst during the last 100-1000 yr increasing the luminosity of IRAS 15398-3359 by a factor of 100 above its current luminosity. Such a burst in luminosity can also explain the centrally condensed CH 3 OH and extended warm carbon-chain chemistry observed in this source and furthermore be reflected in the relative faintness of its compact continuum emission compared to other protostars

Planetary transit candidates in Corot-IRa01 field

Science.gov (United States)

Carpano, S.; Cabrera, J.; Alonso, R.; Barge, P.; Aigrain, S.; Almenara, J.-M.; Bordé, P.; Bouchy, F.; Carone, L.; Deeg, H. J.; de La Reza, R.; Deleuil, M.; Dvorak, R.; Erikson, A.; Fressin, F.; Fridlund, M.; Gondoin, P.; Guillot, T.; Hatzes, A.; Jorda, L.; Lammer, H.; Léger, A.; Llebaria, A.; Magain, P.; Moutou, C.; Ofir, A.; Ollivier, M.; Janot-Pacheco, E.; Pätzold, M.; Pont, F.; Queloz, D.; Rauer, H.; Régulo, C.; Renner, S.; Rouan, D.; Samuel, B.; Schneider, J.; Wuchterl, G.

2009-10-01

Context: CoRoT is a pioneering space mission devoted to the analysis of stellar variability and the photometric detection of extrasolar planets. Aims: We present the list of planetary transit candidates detected in the first field observed by CoRoT, IRa01, the initial run toward the Galactic anticenter, which lasted for 60 days. Methods: We analysed 3898 sources in the coloured bands and 5974 in the monochromatic band. Instrumental noise and stellar variability were taken into account using detrending tools before applying various transit search algorithms. Results: Fifty sources were classified as planetary transit candidates and the most reliable 40 detections were declared targets for follow-up ground-based observations. Two of these targets have so far been confirmed as planets, CoRoT-1b and CoRoT-4b, for which a complete characterization and specific studies were performed. The CoRoT space mission, launched on December 27th 2006, has been developed and is operated by CNES, with contributions from Austria, Belgium, Brazil, ESA, Germany, and Spain. Four French laboratories associated with the CNRS (LESIA, LAM, IAS ,OMP) collaborate with CNES on the satellite development. First CoRoT data are available to the public from the CoRoT archive: http://idoc-corot.ias.u-psud.fr.

Molecular jet of IRAS 04166+2706

Energy Technology Data Exchange (ETDEWEB)

Wang, Liang-Yao [Graduate Institute of Astronomy and Astrophysics, National Taiwan University, No. 1, Sec. 4, Roosevelt Road, Taipei 10617, Taiwan (China); Shang, Hsien; Su, Yu-Nung; Hirano, Naomi; Lee, Chin-Fei [Academia Sinica, Institute of Astrophysics (ASIAA), P.O. Box 23141, Taipei 106, Taiwan (China); Santiago-García, Joaquín [Instituto de Radioastronomía Milimétrica (IRAM), Avenida Divina Pastora 7, Núcleo Central, E-18012 Granada (Spain); Tafalla, Mario [Observatorio Astronómico Nacional (IGN), Alfonso XII 3, E-28014 Madrid (Spain); Zhang, Qizhou, E-mail: lywang@asiaa.sinica.edu.tw [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States)

2014-01-01

The molecular outflow from IRAS 04166+2706 was mapped with the Submillimeter Array at a 350 GHz continuum and CO J = 3-2 at an angular resolution of ∼1''. The field of view covers the central arcminute, which contains the inner four pairs of knots of the molecular jet. On the channel map, conical structures are clearly present in the low-velocity range (|V – V {sub 0}| < 10 km s{sup –1}), and the highly collimated knots appear in the extremely high velocity range (50 >|V – V {sub 0}| > 30 km s{sup –1}). The higher angular resolution of ∼1'' reveals the first blue-shifted knot (B1) that was missing in previous Plateau de Bure Interferometer observation of Santiago-García et al. at an offset of ∼6'' to the northeast of the central source. This identification completes the symmetric sequence of knots in both the blue- and red-shifted lobes of the outflow. The innermost knots R1 and B1 have the highest velocities within the sequence. Although the general features appear to be similar to previous CO J = 2-1 images in Santiago-García et al., the emission in CO J = 3-2 almost always peaks further away from the central source than that of CO J = 2-1 in the red-shifted lobe of the channel maps. This gives rise to a gradient in the line-ratio map of CO J = 3-2/J = 2-1 from head to tail within a knot. A large velocity gradient analysis suggests that the differences may reflect a higher gas kinetic temperature at the head. We also explore possible constraints imposed by the nondetection of SiO J = 8-7.

Hubble Images Reveal Jupiter's Auroras

Science.gov (United States)

1996-01-01

These images, taken by the Hubble Space Telescope, reveal changes in Jupiter's auroral emissions and how small auroral spots just outside the emission rings are linked to the planet's volcanic moon, Io. The images represent the most sensitive and sharply-detailed views ever taken of Jovian auroras.The top panel pinpoints the effects of emissions from Io, which is about the size of Earth's moon. The black-and-white image on the left, taken in visible light, shows how Io and Jupiter are linked by an invisible electrical current of charged particles called a 'flux tube.' The particles - ejected from Io (the bright spot on Jupiter's right) by volcanic eruptions - flow along Jupiter's magnetic field lines, which thread through Io, to the planet's north and south magnetic poles. This image also shows the belts of clouds surrounding Jupiter as well as the Great Red Spot.The black-and-white image on the right, taken in ultraviolet light about 15 minutes later, shows Jupiter's auroral emissions at the north and south poles. Just outside these emissions are the auroral spots. Called 'footprints,' the spots are created when the particles in Io's 'flux tube' reach Jupiter's upper atmosphere and interact with hydrogen gas, making it fluoresce. In this image, Io is not observable because it is faint in the ultraviolet.The two ultraviolet images at the bottom of the picture show how the auroral emissions change in brightness and structure as Jupiter rotates. These false-color images also reveal how the magnetic field is offset from Jupiter's spin axis by 10 to 15 degrees. In the right image, the north auroral emission is rising over the left limb; the south auroral oval is beginning to set. The image on the left, obtained on a different date, shows a full view of the north aurora, with a strong emission inside the main auroral oval.The images were taken by the telescope's Wide Field and Planetary Camera 2 between May 1994 and September 1995.This image and other images and data

The Hubble series: convergence properties and redshift variables

International Nuclear Information System (INIS)

Cattoen, Celine; Visser, Matt

2007-01-01

In cosmography, cosmokinetics and cosmology, it is quite common to encounter physical quantities expanded as a Taylor series in the cosmological redshift z. Perhaps the most well-known exemplar of this phenomenon is the Hubble relation between distance and redshift. However, we now have considerable high-z data available; for instance, we have supernova data at least back to redshift z ∼ 1.75. This opens up the theoretical question as to whether or not the Hubble series (or more generally any series expansion based on the z-redshift) actually converges for large redshift. Based on a combination of mathematical and physical reasonings, we argue that the radius of convergence of any series expansion in z is less than or equal to 1, and that z-based expansions must break down for z > 1, corresponding to a universe less than half of its current size. Furthermore, we shall argue on theoretical grounds for the utility of an improved parametrization y = z/(1 + z). In terms of the y-redshift, we again argue that the radius of convergence of any series expansion in y is less than or equal to 1, so that y-based expansions are likely to be good all the way back to the big bang (y = 1), but that y-based expansions must break down for y < -1, now corresponding to a universe more than twice its current size

The variance of the locally measured Hubble parameter explained with different estimators

DEFF Research Database (Denmark)

Odderskov, Io Sandberg Hess; Hannestad, Steen; Brandbyge, Jacob

2017-01-01

We study the expected variance of measurements of the Hubble constant, H0, as calculated in either linear perturbation theory or using non-linear velocity power spectra derived from N-body simulations. We compare the variance with that obtained by carrying out mock observations in the N......-body simulations, and show that the estimator typically used for the local Hubble constant in studies based on perturbation theory is different from the one used in studies based on N-body simulations. The latter gives larger weight to distant sources, which explains why studies based on N-body simulations tend...... to obtain a smaller variance than that found from studies based on the power spectrum. Although both approaches result in a variance too small to explain the discrepancy between the value of H0 from CMB measurements and the value measured in the local universe, these considerations are important in light...

The Hubble Tarantula Treasury Project

Science.gov (United States)

Sabbi, Elena; Lennon, D. J.; Anderson, J.; Van Der Marel, R. P.; Aloisi, A.; Boyer, M. L.; Cignoni, M.; De Marchi, G.; de Mink, S. E.; Evans, C. J.; Gallagher, J. S.; Gordon, K. D.; Gouliermis, D.; Grebel, E.; Koekemoer, A. M.; Larsen, S. S.; Panagia, N.; Ryon, J. E.; Smith, L. J.; Tosi, M.; Zaritsky, D. F.

2014-01-01

The Tarantula Nebula (a.k.a. 30 Doradus) in the Large Magellanic Cloud is one of the most famous objects in astronomy, with first astronomical references being more than 150 years old. Today the Tarantula Nebula and its ionizing cluster R136 are considered one of the few known starburst regions in the Local Group and an ideal test bed to investigate the temporal and spatial evolution of a prototypical starburst on a sub-cluster scale. The Hubble Tarantula Treasury Project (HTTP) is a panchromatic imaging survey of the stellar populations and ionized gas in the Tarantula Nebula that reaches into the sub-solar mass regime (eBook that explains how stars form and evolve using images from HTTP. The eBook utilizes emerging technology that works in conjunction with the built-in accessibility features in the Apple iPad to allow totally blind users to interactively explore complex astronomical images.

Astronaut Anna Fisher in NBS Training For Hubble Space Telescope

Science.gov (United States)

1980-01-01

The Hubble Space Telescope (HST) is a cooperative program of the European Space Agency (ESA) and the National Aeronautical and Space Administration (NASA) to operate a long-lived space-based observatory. It was the flagship mission of NASA's Great Observatories program. The HST program began as an astronomical dream in the 1940s. During the 1970s and 1980s, the HST was finally designed and built becoming operational in the 1990s. The HST was deployed into a low-Earth orbit on April 25, 1990 from the cargo bay of the Space Shuttle Discovery (STS-31). The design of the HST took into consideration its length of service and the necessity of repairs and equipment replacement by making the body modular. In doing so, subsequent shuttle missions could recover the HST, replace faulty or obsolete parts and be re-released. Marshall Space Flight Center's (MSFC's) Neutral Buoyancy Simulator (NBS) served as the test center for shuttle astronauts training for Hubble related missions. Shown is astronaut Anna Fisher training on a mock-up of a modular section of the HST for an axial scientific instrument change out.

OBSERVATIONAL STUDY OF THE CONTINUUM AND WATER MASER EMISSION IN THE IRAS 19217+1651 REGION

Energy Technology Data Exchange (ETDEWEB)

Rodriguez-Esnard, T.; Trinidad, M. A. [Departamento de Astronomia, Universidad de Guanajuato, Apdo Postal 144, Guanajuato, GTO, Mexico CP 36000 (Mexico); Migenes, V., E-mail: tatiana@iga.cu, E-mail: trinidad@astro.ugto.mx, E-mail: vmigenes@byu.edu [Department of Physics and Astronomy, Brigham Young University, ESC-N145, Provo, UT 84602 (United States)

2012-12-20

We report interferometric observations of the high-mass star-forming region IRAS 19217+1651. We observed the radio continuum (1.3 cm and 3.6 cm) and water maser emission using the Very Large Array (VLA-EVLA) in transition mode (configuration A). Two radio continuum sources were detected at both wavelengths, I19217-A and I19217-B. In addition, 17 maser spots were observed distributed mainly in two groups, M1 and M2, and one isolated maser. This latter could be indicating the relative position of another continuum source which we did not detect. The results indicate that I19217-A appears to be consistent with an ultracompact H II region associated with a zero-age main-sequence B0-type star. Furthermore, the 1.3 cm continuum emission of this source suggests a cometary morphology. In addition, I19217-B appears to be an H II region consisting of at least two stars, which may be contributing to its complex structure. It was also found that the H{sub 2}O masers of the group M1 are apparently associated with the continuum source I19217-A. These are tracing motions which are not gravitationally bound according to their spatial distribution and kinematics. They also seem to be describing outflows in the direction of the elongated cometary region. On the other hand, the second maser group, M2, could be tracing the base of a jet. Finally, infrared data from Spitzer, Midcourse Space Experiment, and IRIS show that IRAS 19217+1651 is embedded inside a large open bubble, like a broken ring, which possibly has affected the morphology of the cometary H II region observed at 1.3 cm.

Planck early results. XIX. All-sky temperature and dust optical depth from Planck and IRAS. Constraints on the "dark gas" in our Galaxy

DEFF Research Database (Denmark)

Poutanen, T.; Natoli, P.; Polenta, G.

2011-01-01

An all sky map of the apparent temperature and optical depth of thermal dust emission is constructed using the Planck-HFI (350μm to 2 mm) andIRAS(100μm) data. The optical depth maps are correlated with tracers of the atomic (Hi) and molecular gas traced by CO. The correlation with the column dens...

EXTINCTION AND POLYCYCLIC AROMATIC HYDROCARBON INTENSITY VARIATIONS ACROSS THE H II REGION IRAS 12063–6259

International Nuclear Information System (INIS)

Stock, D. J.; Peeters, E.; Otaguro, J. N.; Tielens, A. G. G. M.; Bik, A.

2013-01-01

The spatial variations in polycyclic aromatic hydrocarbon (PAH) band intensities are normally attributed to the physical conditions of the emitting PAHs, however in recent years it has been suggested that such variations are caused mainly by extinction. To resolve this question, we have obtained near-infrared (NIR), mid-infrared (MIR), and radio observations of the compact H II region IRAS 12063–6259. We use these data to construct multiple independent extinction maps and also to measure the main PAH features (6.2, 7.7, 8.6, and 11.2 μm) in the MIR. Three extinction maps are derived: the first using the NIR hydrogen lines and case B recombination theory; the second combining the NIR data with radio data; and the third making use of the Spitzer/IRS MIR observations to measure the 9.8 μm silicate absorption feature using the Spoon method and PAHFIT (as the depth of this feature can be related to overall extinction). The silicate absorption over the bright, southern component of IRAS 12063–6259 is almost absent while the other methods find significant extinction. While such breakdowns of the relationship between the NIR extinction and the 9.8 μm absorption have been observed in molecular clouds, they have never been observed for H II regions. We then compare the PAH intensity variations in the Spitzer/IRS data after dereddening to those found in the original data. It was found that in most cases, the PAH band intensity variations persist even after dereddening, implying that extinction is not the main cause of the PAH band intensity variations.

Beyond the Hubble Constant

Science.gov (United States)

1995-08-01

about the distances to galaxies and thereby about the expansion rate of the Universe. A simple way to determine the distance to a remote galaxy is by measuring its redshift, calculate its velocity from the redshift and divide this by the Hubble constant, H0. For instance, the measured redshift of the parent galaxy of SN 1995K (0.478) yields a velocity of 116,000 km/sec, somewhat more than one-third of the speed of light (300,000 km/sec). From the universal expansion rate, described by the Hubble constant (H0 = 20 km/sec per million lightyears as found by some studies), this velocity would indicate a distance to the supernova and its parent galaxy of about 5,800 million lightyears. The explosion of the supernova would thus have taken place 5,800 million years ago, i.e. about 1,000 million years before the solar system was formed. However, such a simple calculation works only for relatively ``nearby'' objects, perhaps out to some hundred million lightyears. When we look much further into space, we also look far back in time and it is not excluded that the universal expansion rate, i.e. the Hubble constant, may have been different at earlier epochs. This means that unless we know the change of the Hubble constant with time, we cannot determine reliable distances of distant galaxies from their measured redshifts and velocities. At the same time, knowledge about such change or lack of the same will provide unique information about the time elapsed since the Universe began to expand (the ``Big Bang''), that is, the age of the Universe and also its ultimate fate. The Deceleration Parameter q0 Cosmologists are therefore eager to determine not only the current expansion rate (i.e., the Hubble constant, H0) but also its possible change with time (known as the deceleration parameter, q0). Although a highly accurate value of H0 has still not become available, increasing attention is now given to the observational determination of the second parameter, cf. also the Appendix at the

Solar system anomalies: Revisiting Hubble's law

Science.gov (United States)

Plamondon, R.

2017-12-01

This paper investigates the impact of a new metric recently published [R. Plamondon and C. Ouellet-Plamondon, in On Recent Developments in Theoretical and Experimental General Relativity, Astrophysics, and Relativistic Field Theories, edited by K. Rosquist, R. T. Jantzen, and R. Ruffini (World Scientific, Singapore, 2015), p. 1301] for studying the space-time geometry of a static symmetric massive object. This metric depends on a complementary error function (erfc) potential that characterizes the emergent gravitation field predicted by the model. This results in two types of deviations as compared to computations made on the basis of a Newtonian potential: a constant and a radial outcome. One key feature of the metric is that it postulates the existence of an intrinsic physical constant σ , the massive object-specific proper length that scales measurements in its surroundings. Although σ must be evaluated experimentally, we use a heuristic to estimate its value and point out some latent relationships between the Hubble constant, the secular increase in the astronomical unit, and the Pioneers delay. Indeed, highlighting the systematic errors that emerge when the effect of σ is neglected, one can link the Hubble constant H 0 to σ Sun and the secular increase V AU to σ Earth . The accuracy of the resulting numerical predictions, H 0 = 74 . 42 ( 0 . 02 ) ( km / s ) / Mpc and V AU ≅ 7.8 cm yr-1 , calls for more investigations of this new metric by specific experts. Moreover, we investigate the expected impacts of the new metric on the flyby anomalies, and we revisit the Pioneers delay. It is shown that both phenomena could be partly taken into account within the context of this unifying paradigm, with quite accurate numerical predictions. A correction for the osculating asymptotic velocity at the perigee of the order of 10 mm/s and an inward radial acceleration of 8 . 34 × 10 - 10 m / s 2 affecting the Pioneer ! space crafts could be explained by this new model.

Implications of the IRAS data for galactic gamma-ray astronomy and EGRET

International Nuclear Information System (INIS)

Stecker, F.W.

1990-01-01

Using the results of gamma-ray, millimeter wave and far infrared surveys of the galaxy, one can derive a logically consistent picture of the large scale distribution of galactic gas and cosmic rays, one tied to the overall processes of stellar birth and destruction on a galactic scale. Using the results of the IRAS far-infrared survey of the galaxy, the large scale radial distributions of galactic far-infrared emission were obtained independently for both the northern and southern hemisphere sides of the Galaxy. It was found that the dominant feature in these distributions to be a broad peak coincident with the 5 kpc molecular gas cloud ring. Also found was evidence of spiral arm features. Strong correlations are evident between the large scale galactic distributions of far infrared emission, gamma-ray emission and total CO emission. There is a particularly tight correlation between the distribution of warm molecular clouds and far-infrared emission on a galactic scale

RECTIFIED ASTEROID ALBEDOS AND DIAMETERS FROM IRAS AND MSX PHOTOMETRY CATALOGS

International Nuclear Information System (INIS)

Ryan, Erin Lee; Woodward, Charles E.

2010-01-01

Rectified diameters and albedo estimates of 1517 main-belt asteroids selected from IRAS and the Mid-Course Space Experiment asteroid photometry catalogs are derived from updated infrared thermal models, the Standard Thermal Model and the Near-Earth Asteroid Thermal Model (NEATM), and Monte Carlo simulations, using new Minor Planet Center compilations of absolute magnitudes (H values) constrained by occultation- and radar-derived parameters. The NEATM approach produces a more robust estimate of albedos and diameters, yielding albedos of p v (NEATM mean) =0.081 ± 0.064. The asteroid beaming parameter (η) for the selected asteroids has a mean value of 1.07 ± 0.27, and the smooth distribution of η suggests that this parameter is independent of asteroid properties such as composition. No trends in η due to size-dependent rotation rates are evident. Comparison of derived values of η as a function of taxonomic type indicates that the beaming parameter values for S- and C-type asteroids are identical within the standard deviation of the population of beaming parameters.

Far-infrared data for symbiotic stars. II. The IRAS survey observations

International Nuclear Information System (INIS)

Kenyon, S.J.; Fernandez-Castro, T.; Stencel, R.E.

1988-01-01

IRAS survey data for all known symbiotic binaries are reported. S type systems have 25 micron excesses much larger than those of single red giant stars, suggesting that these objects lose mass more rapidly than do normal giants. D type objects have far-IR colors similar to those of Mira variables, implying mass-loss rate of about 10 to the -6th solar masses/yr. The near-IR extinctions of the D types indicate that their Mira components are enshrouded in optically thick dust shells, while their hot companions lie outside the shells. If this interpretation of the data is correct, then the very red near-IR colors of D type symbiotic stars are caused by extreme amounts of dust absorption rather than dust emission. The small group of D prime objects possesses far-IR colors resembling those of compact planetary nebulae or extreme OH/IR stars. It is speculated that these binaries are not symbiotic stars at all, but contain a hot compact star and an exasymptotic branch giant which is in the process of ejecting a planetary nebula shell. 42 references

Dynamical interpretation of the Hubble sequence of galaxies

Energy Technology Data Exchange (ETDEWEB)

Dallaporta, N; Secco, L [Padua Univ. (Italy). Istituto di Astronomia

1977-08-01

Brosche (1970) has proposed a theory in which the energy loss due to collisions among gas clouds contained in a galaxy constitutes the driving mechanism for its evolution, through virial equilibrium states, which, from an initial spherical shape, makes it to contract towards an elongated form; moreover, the value of the total angular momentum, assumed as given by uniform rotation, is assumed to determine the galaxy type on the Hubble sequence and to influence strongly the contraction time from the initial spherical to the final flat configuration. The authors modify Brosche's scheme by assuming as models the rotating polytropes of Chandrasekhar and Lebovitz with variable density from centre to border. As a consequence of this change, centrifugal shedding of matter is attained at the equator of the contracting ellipsoid for a configuration with an axial ratio different from zero, so that, hereafter, a flat disk is formed surrounding the internal bulge, with a decreasing overall eccentricity; the rotation curve assumes then an aspect qualitatively similar to the one observed for spiral galaxies. The feedback of star formation which, by exhausting the material of the gas clouds, is able to stop the driving mechanism of evolution before the final flat stage is attained has also been considered at several positions according to the value of the angular momentum. Numerical calculations seem to indicate that one can obtain in this way, by varying the angular momentum and the initial number of clouds, different galaxy types (elliptical, lenticular, spiral) resembling those of the Hubble sequence.

Constraining dark energy with Hubble parameter measurements: an analysis including future redshift-drift observations

International Nuclear Information System (INIS)

Guo, Rui-Yun; Zhang, Xin

2016-01-01

The nature of dark energy affects the Hubble expansion rate (namely, the expansion history) H(z) by an integral over w(z). However, the usual observables are the luminosity distances or the angular diameter distances, which measure the distance.redshift relation. Actually, the property of dark energy affects the distances (and the growth factor) by a further integration over functions of H(z). Thus, the direct measurements of the Hubble parameter H(z) at different redshifts are of great importance for constraining the properties of dark energy. In this paper, we show how the typical dark energy models, for example, the ΛCDM, wCDM, CPL, and holographic dark energy models, can be constrained by the current direct measurements of H(z) (31 data used in total in this paper, covering the redshift range of z @ element of [0.07, 2.34]). In fact, the future redshift-drift observations (also referred to as the Sandage-Loeb test) can also directly measure H(z) at higher redshifts, covering the range of z @ element of [2, 5]. We thus discuss what role the redshift-drift observations can play in constraining dark energy with the Hubble parameter measurements. We show that the constraints on dark energy can be improved greatly with the H(z) data from only a 10-year observation of redshift drift. (orig.)

NCBI nr-aa BLAST: CBRC-DSIM-02-0010 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DSIM-02-0010 ref|NP_610824.1| CG3814-PA, isoform A [Drosophila melanogaster] g...b|AAF58447.1| CG3814-PA, isoform A [Drosophila melanogaster] gb|AAT94437.1| RE58310p [Drosophila melanogaster] NP_610824.1 3e-35 34% ...

Asteroseismology of the Transiting Exoplanet Host HD 17156 with Hubble Space Telescope Fine Guidance Sensor

DEFF Research Database (Denmark)

Gilliland, Ronald L.; McCullough, Peter R.; Nelan, Edmund P.

2011-01-01

light curve. Using the density constraint from asteroseismology, and stellar evolution modeling results in M * = 1.285 ± 0.026 M sun, R * = 1.507 ± 0.012 R sun, and a stellar age of 3.2 ± 0.3 Gyr. Based on observations with the NASA/ESA Hubble Space Telescope, obtained at the Space Telescope Science......Observations conducted with the Fine Guidance Sensor on the Hubble Space Telescope (HST) providing high cadence and precision time-series photometry were obtained over 10 consecutive days in 2008 December on the host star of the transiting exoplanet HD 17156b. During this time, 1.0 × 1012 photons...... Institute, which is operated by AURA, Inc., under NASA contract NAS 5-26555....

THE PANCHROMATIC HUBBLE ANDROMEDA TREASURY

International Nuclear Information System (INIS)

Dalcanton, Julianne J.; Williams, Benjamin F.; Rosenfield, Philip; Weisz, Daniel R.; Gilbert, Karoline M.; Gogarten, Stephanie M.; Lang, Dustin; Lauer, Tod R.; Dong Hui; Kalirai, Jason S.; Boyer, Martha L.; Gordon, Karl D.; Seth, Anil C.; Dolphin, Andrew; Bell, Eric F.; Bianchi, Luciana C.; Caldwell, Nelson; Dorman, Claire E.; Guhathakurta, Puragra; Girardi, Léo

2012-01-01

The Panchromatic Hubble Andromeda Treasury is an ongoing Hubble Space Telescope Multi-Cycle Treasury program to image ∼1/3 of M31's star-forming disk in six filters, spanning from the ultraviolet (UV) to the near-infrared (NIR). We use the Wide Field Camera 3 (WFC3) and Advanced Camera for Surveys (ACS) to resolve the galaxy into millions of individual stars with projected radii from 0 to 20 kpc. The full survey will cover a contiguous 0.5 deg 2 area in 828 orbits. Imaging is being obtained in the F275W and F336W filters on the WFC3/UVIS camera, F475W and F814W on ACS/WFC, and F110W and F160W on WFC3/IR. The resulting wavelength coverage gives excellent constraints on stellar temperature, bolometric luminosity, and extinction for most spectral types. The data produce photometry with a signal-to-noise ratio of 4 at m F275W = 25.1, m F336W = 24.9, m F475W = 27.9, m F814W = 27.1, m F110W = 25.5, and m F160W = 24.6 for single pointings in the uncrowded outer disk; in the inner disk, however, the optical and NIR data are crowding limited, and the deepest reliable magnitudes are up to 5 mag brighter. Observations are carried out in two orbits per pointing, split between WFC3/UVIS and WFC3/IR cameras in primary mode, with ACS/WFC run in parallel. All pointings are dithered to produce Nyquist-sampled images in F475W, F814W, and F160W. We describe the observing strategy, photometry, astrometry, and data products available for the survey, along with extensive testing of photometric stability, crowding errors, spatially dependent photometric biases, and telescope pointing control. We also report on initial fits to the structure of M31's disk, derived from the density of red giant branch stars, in a way that is independent of assumed mass-to-light ratios and is robust to variations in dust extinction. These fits also show that the 10 kpc ring is not just a region of enhanced recent star formation, but is instead a dynamical structure containing a significant overdensity of

CONSTRAINING DUST AND COLOR VARIATIONS OF HIGH-z SNe USING NICMOS ON THE HUBBLE SPACE TELESCOPE

International Nuclear Information System (INIS)

Nobili, S.; Amanullah, R.; Goobar, A.

2009-01-01

We present data from the Supernova Cosmology Project for five high redshift Type Ia supernovae (SNe Ia) that were obtained using the NICMOS infrared camera on the Hubble Space Telescope. We add two SNe from this sample to a rest-frame I-band Hubble diagram, doubling the number of high redshift supernovae on this diagram. This I-band Hubble diagram is consistent with a flat universe (Ω M , Ω Λ ) = (0.29, 0.71). A homogeneous distribution of large grain dust in the intergalactic medium (replenishing dust) is incompatible with the data and is excluded at the 5σ confidence level, if the SN host galaxy reddening is corrected assuming R V = 1.75. We use both optical and infrared observations to compare photometric properties of distant SNe Ia with those of nearby objects. We find generally good agreement with the expected color evolution for all SNe except the highest redshift SN in our sample (SN 1997ek at z = 0.863) which shows a peculiar color behavior. We also present spectra obtained from ground-based telescopes for type identification and determination of redshift.

Hubble Space Telescope via the Web

Science.gov (United States)

O'Dea, Christopher P.

The Space Telescope Science Institute (STScI) makes available a wide variety of information concerning the Hubble Space Telescope (HST) via the Space Telescope Electronic Information Service (STEIS). STEIS is accessible via anonymous ftp, gopher, WAIS, and WWW. The information on STEIS includes how to propose for time on the HST, the current status of HST, reports on the scientific instruments, the observing schedule, data reduction software, calibration files, and a set of publicly available images in JPEG, GIF and TIFF format. STEIS serves both the astronomical community as well as the larger Internet community. WWW is currently the most widely used interface to STEIS. Future developments on STEIS are expected to include larger amounts of hypertext, especially HST images and educational material of interest to students, educators, and the general public, and the ability to query proposal status.

Eyes on the Universe: The Legacy of the Hubble Space Telescope and Looking to the Future with the James Webb Space Telescope

Science.gov (United States)

Straughn, Amber

2011-01-01

Over the past 20 years the Hubble Space Telescope has revolutionized our understanding of the Universe. Most recently, the complete refurbishment of Hubble in 2009 has given new life to the telescope and the new science instruments have already produced groundbreaking science results, revealing some of the most distant galaxy candidates ever discovered. Despite the remarkable advances in astrophysics that Hubble has provided, the new questions that have arisen demand a new space telescope with new technologies and capabilities. I will present the exciting new technology development and science goals of NASA's James Webb Space Telescope, which is currently being built and tested and will be launched this decade.

Metrical connection in space-time, Newton's and Hubble's laws

International Nuclear Information System (INIS)

Maeder, A.

1978-01-01

The theory of gravitation in general relativity is not scale invariant. Here, we follow Dirac's proposition of a scale invariant theory of gravitation (i.e. a theory in which the equations keep their form when a transformation of scale is made). We examine some concepts of Weyl's geometry, like the metrical connection, the scale transformations and invariance, and we discuss their consequences for the equation of the geodetic motion and for its Newtonian limit. Under general conditions, we show that the only non-vanishing component of the coefficient of metrical connection may be identified with Hubble's constant. In this framework, the equivalent to the Newtonian approximation for the equation of motion contains an additional acceleration term Hdr vector /dt, which produces an expansion of gravitational systems. The velocity of this expansion is shown to increase linearly with the distance between interacting objects. The relative importance of this new expansion term to the Newtonian one varies like (2rhosub(c)/rho)sup(1/2), where rhosub(c) is the critical density of the Einsteinde Sitter model and rho is the mean density of the considered gravitational configuration. Thus, this 'generalized expansion' is important essentially for systems of mean density not too much above the critical density. Finally, our main conclusion is that in the integrable Weyl geometry, Hubble's law - like Newton's law - would appear as an intrinsic property of gravitation, being only the most visible manifestation of a general effect characterizing the gravitational interaction. (orig.) [de

Estudio clínico-epidemiológico y molecular de Metapneumovirus Humano en pacientes con Infecciones Respiratorias Agudas (IRA) en Venezuela

OpenAIRE

Tovar H, Cerraf E; Moncho S, Alessandra; Fernandez S, David; Aguilar M, Marwan S; Morón, Dulce

2014-01-01

El Metapneumovirus Humano (MPVh) ha sido asociado con Infecciones Respiratorias Agudas (IRA) en pacientes de todas las edades. Estudios epidemiológicos indican la prevalencia del MPVh alrededor del mundo, sin embargo, en Venezuela poco se conoce sobre su comportamiento en la población. Este estudio pretende describir el comportamiento epidemiológico de la infección por MPVh en pacientes venezolanos. Se evaluaron por RT-PCR multiplex 1812 hisopados nasales (HN) provenientes de pacientes con di...

Hubble Space Telescope: The Telescope, the Observations & the Servicing Mission

Science.gov (United States)

1999-11-01

Today the HST Archives contain more than 260 000 astronomical observations. More than 13 000 astronomical objects have been observed by hundreds of different groups of scientists. Direct proof of the scientific significance of this project is the record-breaking number of papers published : over 2400 to date. Some of HST's most memorable achievements are: * the discovery of myriads of very faint galaxies in the early Universe, * unprecedented, accurate measurements of distances to the farthest galaxies, * significant improvement in the determination of the Hubble constant and thus the age of the Universe, * confirmation of the existence of blacks holes, * a far better understanding of the birth, life and death of stars, * a very detailed look at the secrets of the process by which planets are created. Europe and HST ESA's contribution to HST represents a nominal investment of 15%. ESA provided one of the two imaging instruments - the Faint Object Camera (FOC) - and the solar panels. It also has 15 scientists and computer staff working at the Space Telescope Science Institute in Baltimore (Maryland). In Europe the astronomical community receives observational assistance from the Space Telescope European Coordinating Facility (ST-ECF) located in Garching, Munich. In return for ESA's investment, European astronomers have access to approximately 15% of the observing time. In reality the actual observing time competitively allocated to European astronomers is closer to 20%. Looking back at almost ten years of operation, the head of ST-ECF, European HST Project Scientist Piero Benvenuti states: "Hubble has been of paramount importance to European astronomy, much more than the mere 20% of observing time. It has given the opportunity for European scientists to use a top class instrument that Europe alone would not be able to build and operate. In specific areas of research they have now, mainly due to HST, achieved international leadership." One of the major reasons for

Infrared spectrophotometry of Comet IRAS-Araki-Alcock (1983d) - A bare nucleus revealed?

Science.gov (United States)

Hanner, M. S.; Aitken, D. K.; Knacke, R.; Mccorkle, S.; Roche, P. F.; Tokunaga, A. T.

1985-01-01

Spectra of the central core and surrounding coma of Comet IRAS-Araki-Alcock (1983d) were obtained at 8-13 microns on May 11 and 2-4 microns on May 12, 1983. Spatially resolved measurements at 10 microns with a 4-arcsec beam showed that the central core was more than 100 times brighter than the inner coma only 8 arcsec away; for radially outflowing dust, the brightness ratio would be a factor of 8. The observations of the central core are consistent with direct detection of a nucleus having a radius of approximately 5 km. The temperature of the sunlit hemisphere was greater than 300 K. Spectra of the core are featureless, while spectra of the coma suggest weak silicate emission. The spectra show no evidence for icy grains. The dust production rate on May 11.4 was about 100,000 g/sec, assuming that the gas flux from the dust-producing areas on the nucleus was about 0.00001 g/sq cm per sec.

Multiple monopolar outflows driven by massive protostars in IRAS 18162-2048

Energy Technology Data Exchange (ETDEWEB)

Fernández-López, M. [Department of Astronomy, University of Illinois at Urbana-Champaign, 1002 West Green Street, Urbana, IL 61801 (United States); Girart, J. M. [Institut de Ciencies de l' Espai (CSIC-IEEC), Campus UAB, Facultat de Ciencies, Torre C5-parell 2, E-08193 Bellaterra, Catalunya (Spain); Curiel, S.; Fonfría, J. P. [Instituto de Astronomía, Universidad Nacional Autónoma de México (UNAM), Apartado Postal 70-264, 04510 México, DF (Mexico); Zapata, L. A. [Centro de Radioastronomía y Astrofísica, UNAM, Apartado Postal 3-72, Morelia, Michoacán 58089 (Mexico); Qiu, K., E-mail: manferna@illinois.edu, E-mail: girart@ieec.cat [School of Astronomy and Space Science, Nanjing University, Nanjing 210093 (China)

2013-11-20

In this article, we present Combined Array for Research in Millimeter-wave Astronomy (CARMA) 3.5 mm observations and SubMillimeter Array (SMA) 870 μm observations toward the high-mass star-forming region IRAS 18162-2048, which is the core of the HH 80/81/80N system. Molecular emission from HCN, HCO{sup +}, and SiO traces two molecular outflows (the so-called northeast and northwest outflows). These outflows have their origin in a region close to the position of MM2, a millimeter source known to harbor two protostars. For the first time we estimate the physical characteristics of these molecular outflows, which are similar to those of 10{sup 3}-5 × 10{sup 3} L {sub ☉} protostars, and suggest that MM2 harbors high-mass protostars. High-angular resolution CO observations show an additional outflow due southeast. Also for the first time, we identify its driving source, MM2(E), and see evidence of precession. All three outflows have a monopolar appearance, but we link the NW and SE lobes, and explain their asymmetric shape as being a consequence of possible deflection.

VLA Ammonia Observations of IRAS 16253-2429: A Very Young and Low Mass Protostellar System

Science.gov (United States)

Wiseman, Jennifer J.

2011-01-01

IRAS l6253-2429. the source of the Wasp-Waist Nebula seen in Spitzer IRAC images, is an isolated very low luminosity ("VeLLO") Class 0 protostar in the nearby rho Ophiuchi cloud. We present VLA ammonia mapping observations of the dense gas envelope feeding the central core accreting system. We find a flattened envelope perpendicular to the outflow axis, and gas cavities that appear to cradle the outflow lobes as though carved out by the flow and associated (apparently precessing) jet. Based on the NH3 (1,1) and (2,2) emission distribution, we derive the mass, velocity fields and temperature distribution for the envelope. We discuss the combined evidence for this source as possibly one of the youngest and lowest mass sources in formation yet known.

Hubble Diagram Test of Expanding and Static Cosmological Models: The Case for a Slowly Expanding Flat Universe

Directory of Open Access Journals (Sweden)

Laszlo A. Marosi

2013-01-01

Full Text Available We present a new redshift (RS versus photon travel time ( test including 171 supernovae RS data points. We extended the Hubble diagram to a range of z = 0,0141–8.1 in the hope that at high RSs, the fitting of the calculated RS/ diagrams to the observed RS data would, as predicted by different cosmological models, set constraints on alternative cosmological models. The Lambda cold dark matter (ΛCDM, the static universe model, and the case for a slowly expanding flat universe (SEU are considered. We show that on the basis of the Hubble diagram test, the static and the slowly expanding models are favored.

An updated Type II supernova Hubble diagram

Science.gov (United States)

Gall, E. E. E.; Kotak, R.; Leibundgut, B.; Taubenberger, S.; Hillebrandt, W.; Kromer, M.; Burgett, W. S.; Chambers, K.; Flewelling, H.; Huber, M. E.; Kaiser, N.; Kudritzki, R. P.; Magnier, E. A.; Metcalfe, N.; Smith, K.; Tonry, J. L.; Wainscoat, R. J.; Waters, C.

2018-03-01

We present photometry and spectroscopy of nine Type II-P/L supernovae (SNe) with redshifts in the 0.045 ≲ z ≲ 0.335 range, with a view to re-examining their utility as distance indicators. Specifically, we apply the expanding photosphere method (EPM) and the standardized candle method (SCM) to each target, and find that both methods yield distances that are in reasonable agreement with each other. The current record-holder for the highest-redshift spectroscopically confirmed supernova (SN) II-P is PS1-13bni (z = 0.335-0.012+0.009), and illustrates the promise of Type II SNe as cosmological tools. We updated existing EPM and SCM Hubble diagrams by adding our sample to those previously published. Within the context of Type II SN distance measuring techniques, we investigated two related questions. First, we explored the possibility of utilising spectral lines other than the traditionally used Fe IIλ5169 to infer the photospheric velocity of SN ejecta. Using local well-observed objects, we derive an epoch-dependent relation between the strong Balmer line and Fe IIλ5169 velocities that is applicable 30 to 40 days post-explosion. Motivated in part by the continuum of key observables such as rise time and decline rates exhibited from II-P to II-L SNe, we assessed the possibility of using Hubble-flow Type II-L SNe as distance indicators. These yield similar distances as the Type II-P SNe. Although these initial results are encouraging, a significantly larger sample of SNe II-L would be required to draw definitive conclusions. Tables A.1, A.3, A.5, A.7, A.9, A.11, A.13, A.15 and A.17 are also available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (http://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/611/A25

The Great Attractor: At the Limits of Hubble's Law of the Expanding Universe.

Science.gov (United States)

Murdin, Paul

1991-01-01

Presents the origin and mathematics of Hubble's Law of the expanding universe. Discusses limitations to this law and the related concepts of standard candles, elliptical galaxies, and streaming motions, which are conspicuous deviations from the law. The third of three models proposed as explanations for streaming motions is designated: The Great…

New solution to the problem of the tension between the high-redshift and low-redshift measurements of the Hubble constant

Science.gov (United States)

Bolejko, Krzysztof

2018-01-01

During my talk I will present results suggesting that the phenomenon of emerging spatial curvature could resolve the conflict between Planck's (high-redshift) and Riess et al. (low-redshift) measurements of the Hubble constant. The phenomenon of emerging spatial curvature is absent in the Standard Cosmological Model, which has a flat and fixed spatial curvature (small perturbations are considered in the Standard Cosmological Model but their global average vanishes, leading to spatial flatness at all times).In my talk I will show that with the nonlinear growth of cosmic structures the global average deviates from zero. As a result, the spatial curvature evolves from spatial flatness of the early universe to a negatively curved universe at the present day, with Omega_K ~ 0.1. Consequently, the present day expansion rate, as measured by the Hubble constant, is a few percent higher compared to the high-redshift constraints. This provides an explanation why there is a tension between high-redshift (Planck) and low-redshift (Riess et al.) measurements of the Hubble constant. In the presence of emerging spatial curvature these two measurements should in fact be different: high redshift measurements should be slightly lower than the Hubble constant inferred from the low-redshift data.The presentation will be based on the results described in arXiv:1707.01800 and arXiv:1708.09143 (which discuss the phenomenon of emerging spatial curvature) and on a paper that is still work in progress but is expected to be posted on arxiv by the AAS meeting (this paper uses mock low-redshift data to show that starting from the Planck's cosmological models (in the early universe) but with the emerging spatial curvature taken into account, the low-redshift Hubble constant should be 72.4 km/s/Mpc.

The Carnegie-Chicago Hubble Program. I. An Independent Approach to the Extragalactic Distance Scale Using Only Population II Distance Indicators

Science.gov (United States)

Beaton, Rachael L.; Freedman, Wendy L.; Madore, Barry F.; Bono, Giuseppe; Carlson, Erika K.; Clementini, Gisella; Durbin, Meredith J.; Garofalo, Alessia; Hatt, Dylan; Jang, In Sung; Kollmeier, Juna A.; Lee, Myung Gyoon; Monson, Andrew J.; Rich, Jeffrey A.; Scowcroft, Victoria; Seibert, Mark; Sturch, Laura; Yang, Soung-Chul

2016-12-01

We present an overview of the Carnegie-Chicago Hubble Program, an ongoing program to obtain a 3% measurement of the Hubble constant (H 0) using alternative methods to the traditional Cepheid distance scale. We aim to establish a completely independent route to H 0 using RR Lyrae variables, the tip of the red giant branch (TRGB), and Type Ia supernovae (SNe Ia). This alternative distance ladder can be applied to galaxies of any Hubble type, of any inclination, and, using old stars in low-density environments, is robust to the degenerate effects of metallicity and interstellar extinction. Given the relatively small number of SNe Ia host galaxies with independently measured distances, these properties provide a great systematic advantage in the measurement of H 0 via the distance ladder. Initially, the accuracy of our value of H 0 will be set by the five Galactic RR Lyrae calibrators with Hubble Space Telescope Fine-Guidance Sensor parallaxes. With Gaia, both the RR Lyrae zero-point and TRGB method will be independently calibrated, the former with at least an order of magnitude more calibrators and the latter directly through parallax measurement of tip red giants. As the first end-to-end “distance ladder” completely independent of both Cepheid variables and the Large Magellanic Cloud, this path to H 0 will allow for the high-precision comparison at each rung of the traditional distance ladder that is necessary to understand tensions between this and other routes to H 0. Based on observations made with the NASA/ESA Hubble Space Telescope, obtained at the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS 5-26555. These observations are associated with programs #13472 and #13691.

Selections from 2017: Hubble Survey Explores Distant Galaxies

Science.gov (United States)

Kohler, Susanna

2017-12-01

Editors note:In these last two weeks of 2017, well be looking at a few selections that we havent yet discussed on AAS Nova from among the most-downloaded paperspublished in AAS journals this year. The usual posting schedule will resume in January.CANDELS Multi-Wavelength Catalogs: Source Identification and Photometry in the CANDELS COSMOSSurvey FieldPublished January2017Main takeaway:A publication led byHooshang Nayyeri(UC Irvine and UC Riverside) early this year details acatalog of sources built using the Cosmic Assembly Near-infrared Deep Extragalactic Legacy Survey(CANDELS), a survey carried out by cameras on board the Hubble Space Telescope. The catalogliststhe properties of 38,000 distant galaxies visiblewithin the COSMOS field, a two-square-degree equatorial field explored in depthto answer cosmological questions.Why its interesting:Illustration showing the three-dimensional map of the dark matter distribution in theCOSMOS field. [Adapted from NASA/ESA/R. Massey(California Institute of Technology)]The depth and resolution of the CANDELS observations areuseful for addressingseveral major science goals, including the following:Studying the most distant objects in the universe at the epoch of reionization in the cosmic dawn.Understanding galaxy formation and evolution during the peak epoch of star formation in the cosmic high noon.Studying star formation from deep ultravioletobservations and studying cosmology from supernova observations.Why CANDELS is a major endeavor:CANDELS isthe largest multi-cycle treasury program ever approved on the Hubble Space Telescope using over 900 orbits between 2010 and 2013 withtwo cameras on board the spacecraftto study galaxy formation and evolution throughout cosmic time. The CANDELS images are all publicly available, and the new catalogrepresents an enormous source of information about distant objectsin our universe.CitationH. Nayyeri et al 2017 ApJS 228 7. doi:10.3847/1538-4365/228/1/7

The Hubble Constant from SN Refsdal

Science.gov (United States)

Vega-Ferrero, J.; Diego, J. M.; Miranda, V.; Bernstein, G. M.

2018-02-01

Hubble Space Telescope observations from 2015 December 11 detected the expected fifth counter-image of supernova (SN) Refsdal at z = 1.49. In this Letter, we compare the time-delay predictions from numerous models with the measured value derived by Kelly et al. from very early data in the light curve of the SN Refsdal and find a best value for {H}0={64}-11+9 {km} {{{s}}}-1 {{Mpc}}-1 (68% CL), in excellent agreement with predictions from cosmic microwave background and recent weak lensing data + baryon acoustic oscillations + Big Bang nucleosynthesis (from the DES Collaboration). This is the first constraint on H 0 derived from time delays between multiple-lensed SN images, and the first with a galaxy cluster lens, subject to systematic effects different from other time-delay H 0 estimates. Additional time-delay measurements from new multiply imaged SNe will allow derivation of competitive constraints on H 0.

Hubble diagram as a probe of minicharged particles

International Nuclear Information System (INIS)

Ahlers, Markus

2009-01-01

The luminosity-redshift relation of cosmological standard candles provides information about the relative energy composition of our Universe. In particular, the observation of type Ia supernovae up to a redshift of z∼2 indicates a universe which is dominated today by dark matter and dark energy. The propagation distance of light from these sources is of the order of the Hubble radius and serves as a very sensitive probe of feeble inelastic photon interactions with background matter, radiation, or magnetic fields. In this paper we discuss the limits on minicharged particle models arising from a dimming effect in supernova surveys. We briefly speculate about a strong dimming effect as an alternative to dark energy.

Planck intermediate results XXIX. All-sky dust modelling with Planck, IRAS, and WISE observations

DEFF Research Database (Denmark)

Ade, P. A. R.; Aghanim, N.; Alves, M. I. R.

2016-01-01

We present all-sky modelling of the high resolution Planck, IRAS, andWISE infrared (IR) observations using the physical dust model presented by Draine & Li in 2007 (DL, ApJ, 657, 810). We study the performance and results of this model, and discuss implications for future dust modelling....... The present work extends the DL dust modelling carried out on nearby galaxies using Herschel and Spitzer data to Galactic dust emission. We employ the DL dust model to generate maps of the dust mass surface density Sigma(Md), the dust optical extinction A(V), and the starlight intensity heating the bulk...... of the dust, parametrized by U-min. The DL model reproduces the observed spectral energy distribution (SED) satisfactorily over most of the sky, with small deviations in the inner Galactic disk and in low ecliptic latitude areas, presumably due to zodiacal light contamination. In the Andromeda galaxy (M31...

A laboratory analog for the carrier of the 3 micron emission of the protoplanetary nebula IRAS 05341+0852.

Science.gov (United States)

Beegle, L W; Wdowiak, T J; Arnoult, K M

1997-09-10

A mixture of the polycyclic aromatic hydrocarbons (PAHs), acenaphthylene and acenaphthene, when subjected to the energetic environment of a hydrogen plasma, is transformed into a material that exhibits an infrared absorption profile in the 3 micron region that is an excellent match of the protoplanetary nebula IRAS 05341+0852 emission profile in the same wavelength region. Acenaphthylene and acenaphthene were chosen as precursors in the experiment because these molecules have a structure that can be described as a keystone in a process in which carbon atoms in a stellar wind condense into PAH species. The spectral match between experiment and observations appears to validate that scenario.

HUBBLE'S ULTRAVIOLET VIEWS OF NEARBY GALAXIES YIELD CLUES TO EARLY UNIVERSE

Science.gov (United States)

2002-01-01

Astronomers are using these three NASA Hubble Space Telescope images to help tackle the question of why distant galaxies have such odd shapes, appearing markedly different from the typical elliptical and spiral galaxies seen in the nearby universe. Do faraway galaxies look weird because they are truly weird? Or, are they actually normal galaxies that look like oddballs, because astronomers are getting an incomplete picture of them, seeing only the brightest pieces? Light from these galaxies travels great distances (billions of light-years) to reach Earth. During its journey, the light is 'stretched' due to the expansion of space. As a result, the light is no longer visible, but has been shifted to the infrared where present instruments are less sensitive. About the only light astronomers can see comes from regions where hot, young stars reside. These stars emit mostly ultraviolet light. But this light is stretched, appearing as visible light by the time it reaches Earth. Studying these distant galaxies is like trying to put together a puzzle with some of the pieces missing. What, then, do distant galaxies really look like? Astronomers studied 37 nearby galaxies to find out. By viewing these galaxies in ultraviolet light, astronomers can compare their shapes with those of their distant relatives. These three Hubble telescope pictures, taken with the Wide Field and Planetary Camera 2, represent a sampling from that survey. Astronomers observed the galaxies in ultraviolet and visible light to study all the stars that make up these 'cities of stars.' The results of their survey support the idea that astronomers are detecting the 'tip of the iceberg' of very distant galaxies. Based on these Hubble ultraviolet images, not all the faraway galaxies necessarily possess intrinsically odd shapes. The results are being presented today at the 197th meeting of the American Astronomical Society in San Diego, CA. The central region of the 'star-burst' spiral galaxy at far left

Hubble 3D: A Science and Hollywood Collaboration Made (Nearly) in Heaven

Science.gov (United States)

Showstack, Randy

2010-04-01

Just 2 days after the 2010 Academy Awards® ceremony in early March bestowed Oscars® for motion picture achievements, NASA deputy administrator Lori Garver touted a new film about the Hubble Space Telescope, Hubble 3D, for best drama, special effects, screenplay, actors and actress, and director and producer. The 43-minute IMAX and Warner Brothers Pictures production, which opened in theaters on 19 March, is an example of the ability of Hollywood and the science community to partner in providing a dynamic educational and entertaining product, according to a number of people associated with the film. Sharing the red carpet at the Smithsonian National Air and Space Museum in Washington, D. C., with astronauts and others to mark the world premiere, Garver said the film shows the drama of the astronauts’ efforts to repair the telescope while traveling 17,000 miles per hour and performing grueling space walks (see Figure 1). “We have literally opened our eyes on the universe through this telescope,” she said. “This is a taxpayer-funded agency, and we are giving back to the public the very story that they paid for.”

A utilização da solução natural de eucalipto nas nebulizações, como auxiliar nos tratamentos das infecções respiratórias agudas: (IRA

Directory of Open Access Journals (Sweden)

Ana Tania Lopes Sampaio Alves

1992-09-01

Full Text Available Em um total de 4.625 consultas médicas à criança menor de 5 anos, durante um período de 7 meses, foram diagnosticados 936 casos de infecções respiratórias agudas (20,2%. Estudou-se algumas características clínicas e fatores de risco mais comumente encontradas em cada tipo catalogado de IRA. O mais freqüente sintoma foi o desconforto respiratório moderado. O presente trabalho tem por objetivo relatar a experiência vivenciada em Macaíba/RN (F.SESP, relacionada à adaptação do uso da solução natural de eucalipto manipulada pela equipe de enfermagem em substituição às convenientemente utilizadas, ou seja, as soluções farmacológicas, em Inalações de crianças com IRA.

Testing the Interacting Dark Energy Model with Cosmic Microwave Background Anisotropy and Observational Hubble Data

Directory of Open Access Journals (Sweden)

Weiqiang Yang

2017-07-01

Full Text Available The coupling between dark energy and dark matter provides a possible approach to mitigate the coincidence problem of the cosmological standard model. In this paper, we assumed the interacting term was related to the Hubble parameter, energy density of dark energy, and equation of state of dark energy. The interaction rate between dark energy and dark matter was a constant parameter, which was, Q = 3 H ξ ( 1 + w x ρ x . Based on the Markov chain Monte Carlo method, we made a global fitting on the interacting dark energy model from Planck 2015 cosmic microwave background anisotropy and observational Hubble data. We found that the observational data sets slightly favored a small interaction rate between dark energy and dark matter; however, there was not obvious evidence of interaction at the 1 σ level.

The ALMA-PILS survey: 3D modeling of the envelope, disks and dust filament of IRAS 16293-2422

Science.gov (United States)

Jacobsen, S. K.; Jørgensen, J. K.; van der Wiel, M. H. D.; Calcutt, H.; Bourke, T. L.; Brinch, C.; Coutens, A.; Drozdovskaya, M. N.; Kristensen, L. E.; Müller, H. S. P.; Wampfler, S. F.

2018-04-01

Context. The Class 0 protostellar binary IRAS 16293-2422 is an interesting target for (sub)millimeter observations due to, both, the rich chemistry toward the two main components of the binary and its complex morphology. Its proximity to Earth allows the study of its physical and chemical structure on solar system scales using high angular resolution observations. Such data reveal a complex morphology that cannot be accounted for in traditional, spherical 1D models of the envelope. Aims: The purpose of this paper is to study the environment of the two components of the binary through 3D radiative transfer modeling and to compare with data from the Atacama Large Millimeter/submillimeter Array. Such comparisons can be used to constrain the protoplanetary disk structures, the luminosities of the two components of the binary and the chemistry of simple species. Methods: We present 13CO, C17O and C18O J = 3-2 observations from the ALMA Protostellar Interferometric Line Survey (PILS), together with a qualitative study of the dust and gas density distribution of IRAS 16293-2422. A 3D dust and gas model including disks and a dust filament between the two protostars is constructed which qualitatively reproduces the dust continuum and gas line emission. Results: Radiative transfer modeling in our sampled parameter space suggests that, while the disk around source A could not be constrained, the disk around source B has to be vertically extended. This puffed-up structure can be obtained with both a protoplanetary disk model with an unexpectedly high scale-height and with the density solution from an infalling, rotating collapse. Combined constraints on our 3D model, from observed dust continuum and CO isotopologue emission between the sources, corroborate that source A should be at least six times more luminous than source B. We also demonstrate that the volume of high-temperature regions where complex organic molecules arise is sensitive to whether or not the total

Discovery of Hubble's Law as a Series of Type III Errors

Science.gov (United States)

Belenkiy, Ari

2015-01-01

Recently much attention has been paid to the history of the discovery of Hubble's law--the linear relation between the rate of recession of the remote galaxies and distance to them from Earth. Though historians of cosmology now mention several names associated with this law instead of just one, the motivation of each actor of that remarkable…

Photoinactivation Using Visible Light Plus Water-Filtered Infrared-A (vis+wIRA and Chlorine e6 (Ce6 eradicates Planktonic Periodontal Pathogens and Subgingival Biofilms

Directory of Open Access Journals (Sweden)

Ali Al-Ahmad

2016-11-01

Full Text Available Alternative treatment methods for pathogens and microbial biofilms are required due to the widespread rise in antibiotic resistance. Antimicrobial photodynamic therapy (aPDT has recently gained attention as a novel method to eradicate pathogens. The aim of this study was to evaluate the antimicrobial effects of a novel aPDT method using visible light (vis and water infiltrated infrared A (wIRA in combination with chlorine e6 (Ce6 against different periodontal pathogens in planktonic form and within in situ subgingival oral biofilms. Eight different periodontal pathogens were exposed to aPDT using vis+wIRA and 100 µg/ml Ce6 in planktonic culture. Additionally, pooled subgingival dental biofilm was also treated by aPDT and the number of viable cells determined as colony forming units (CFU. Live/dead staining was used in combination with confocal laser scanning microscopy (CLSM to visualize and quantify antimicrobial effects within the biofilm samples. Untreated negative controls as well as 0.2 % chlorhexidine (CHX-treated positive controls were used. All eight tested periodontal pathogens including Aggregatibacter actinomycetemcomitans, Porphyromonas gingivalis, Eikenella corrodens, Actinomyces odontolyticus, Fusobacterium nucleatum, Parvimonas micra, Slackia exigua and Atopopium rimae and the aPDT-treated subgingival biofilm were eliminated over the ranges of 3.43 - 8.34 and 3.91 - 4.28 log10 CFU in the log10 scale, respectively. Thus, aPDT showed bactericidal effects on the representative pathogens as well as on the in situ subgingival biofilm. The live/dead staining also revealed a significant reduction (33.45 % of active cells within the aPDT-treated subgingival biofilm. Taking the favorable tissue healing effects of vis+wIRA into consideration, the significant antimicrobial effects revealed in this study highlight the potential of aPDT using this light source in combination with Ce6 as an adjunctive method to treat periodontitis as well as

The chemical structure of the Class 0 protostellar envelope NGC 1333 IRAS 4A⋆⋆

Science.gov (United States)

Koumpia, E.; Semenov, D. A.; van der Tak, F. F. S.; Boogert, A. C. A.; Caux, E.

2017-07-01

Context. It is not well known what drives the chemistry of a protostellar envelope, in particular the role of the stellar mass and the protostellar outflows on the chemical enrichment of such environments. Aims: We study the chemical structure of the Class 0 protostellar envelope NGC 1333 IRAS 4A in order to (I) investigate the influence of the outflows on the chemistry; (II) constrain the age of our studied object; (III) compare it with a typical high-mass protostellar envelope. Methods: In our analysis we use JCMT line mapping (360-373 GHz) and HIFI pointed spectra (626.01-721.48 GHz). To study the influence of the outflow on the degree of deuteration, we compare JCMT maps of HCO+ and DCO+ with non-LTE (RADEX) models in a region that spatially covers the outflow activity of IRAS 4A. To study the envelope chemistry, we derive empirical molecular abundance profiles for the observed species using the Monte Carlo radiative transfer code (RATRAN) and adopting a 1D dust density/temperature profile from the literature. We use a combination of constant abundance profiles and abundance profiles that include jumps at two radii (T 100 K or T 30 K) to fit our observations. We compare our best-fit observed abundance profiles with the predictions from the time dependent gas grain chemical code (ALCHEMIC). Results: We detect CO, 13CO, C18O, CS, HCN, HCO+, N2H+, H2CO, CH3OH, H2O, H2S, DCO+, HDCO, D2CO, SO, SO2, SiO, HNC, CN, C2H and OCS. We divide the detected lines in three groups based on their line profiles: a) broad emission (FWHM = 4-11 km s-1), b) narrow emission (FWHMtime-dependent gas-grain chemical model for the outer envelope, with the exceptions of HCN, HNC, CN. These species along with the CO abundance require an enhanced UV field which points towards an outflow cavity. The abundances with respect to H2 are 1 to 2 orders of magnitude lower than those observed in the high mass protostellar envelope (AFGL 2591), while they are found to be similar within factors of a

HUBBLE CAPTURES THE HEART OF STAR BIRTH

Science.gov (United States)

2002-01-01

NASA Hubble Space Telescope's Wide Field and Planetary Camera 2 (WFPC2) has captured a flurry of star birth near the heart of the barred spiral galaxy NGC 1808. On the left are two images, one superimposed over the other. The black-and-white picture is a ground-based view of the entire galaxy. The color inset image, taken with the Hubble telescope's Wide Field and Planetary Camera 2 (WFPC2), provides a close-up view of the galaxy's center, the hotbed of vigorous star formation. The ground-based image shows that the galaxy has an unusual, warped shape. Most spiral galaxies are flat disks, but this one has curls of dust and gas at its outer spiral arms (upper right-hand corner and lower left-hand corner). This peculiar shape is evidence that NGC 1808 may have had a close interaction with another nearby galaxy, NGC 1792, which is not in the picture Such an interaction could have hurled gas towards the nucleus of NGC 1808, triggering the exceptionally high rate of star birth seen in the WFPC2 inset image. The WFPC2 inset picture is a composite of images using colored filters that isolate red and infrared light as well as light from glowing hydrogen. The red and infrared light (seen as yellow) highlight older stars, while hydrogen (seen as blue) reveals areas of star birth. Colors were assigned to this false-color image to emphasize the vigorous star formation taking place around the galaxy's center. NGC 1808 is called a barred spiral galaxy because of the straight lines of star formation on both sides of the bright nucleus. This star formation may have been triggered by the rotation of the bar, or by matter which is streaming along the bar towards the central region (and feeding the star burst). Filaments of dust are being ejected from the core into a faint halo of stars surrounding the galaxy's disk (towards the upper left corner) by massive stars that have exploded as supernovae in the star burst region. The portion of the galaxy seen in this 'wide-field' image is

Super-Hubble de Sitter fluctuations and the dynamical RG

Energy Technology Data Exchange (ETDEWEB)

Burgess, C.P. [Department of Physics and Astronomy, McMaster University, Hamilton, Ontario (Canada); Leblond, L.; Shandera, S. [Perimeter Institute for Theoretical Physics, Waterloo, Ontario (Canada); Holman, R., E-mail: cburgess@perimeterinstitute.ca, E-mail: lleblond@perimeterinstitute.ca, E-mail: rha@andrew.cmu.edu, E-mail: sshandera@perimeterinstitute.ca [Department of Physics, Carnegie Mellon University, Pittsburgh, Pennsylvania 15213 (United States)

2010-03-01

Perturbative corrections to correlation functions for interacting theories in de Sitter spacetime often grow secularly with time, due to the properties of fluctuations on super-Hubble scales. This growth can lead to a breakdown of perturbation theory at late times. We argue that Dynamical Renormalization Group (DRG) techniques provide a convenient framework for interpreting and resumming these secularly growing terms. In the case of a massless scalar field in de Sitter with quartic self-interaction, the resummed result is also less singular in the infrared, in precisely the manner expected if a dynamical mass is generated. We compare this improved infrared behavior with large-N expansions when applicable.

Electrostatic Studies for the 2008 Hubble Service Repair Mission

Science.gov (United States)

Buhler, C. R.; Clements, J. S.; Calle, C. I.

2012-01-01

High vacuum triboelectric testing of space materials was required to identify possible Electrostatic Discharge (ESD) concerns for the astronauts in space during electronics board replacement on the Hubble Space Telescope. Testing under high vacuum conditions with common materials resulted in some interesting results. Many materials were able to charge to high levels which did not dissipate quickly even when grounded. Certain materials were able to charge up in contact with grounded metals while others were not. An interesting result was that like materials did not exchange electrostatic charge under high vacuum conditions. The most surprising experimental result is the lack of brush discharges from charged insulators under high vacuum conditions.

IRAS observations of dust heating and energy balance in the Rho Ophiuchi dark cloud

Science.gov (United States)

Greene, Thomas P.; Young, Erick T.

1989-01-01

The equilibrium process dust emission in the Rho Ophiuchi dark cloud is studied. The luminosity of the cloud is found to closely match the luminosity of the clouds's known embedded and external radiation sources. There is no evidence for a large population of undetected low-luminosity sources within the cloud and unknown external heating is also only a minor source of energy. Most of the cloud's luminosity is emitted in the mid-to-far-IR. Dust temperature maps indicate that the dust is not hot enough to heat the gas to observed temperatures. A simple cloud model with a radiation field composed of flux HD 147889, S1, and Sco OB2 associations predicts the observed IRAS 60 to 100 micron in-band flux ratios for a mean cloud density n(H2) = 1400. Flattened 12 and 25 micron observations show much extended emission in these bands, suggesting stochastic heating of very small grains or large molecules.

The Hubble Legacy Archive ACS grism data

Science.gov (United States)

Kümmel, M.; Rosati, P.; Fosbury, R.; Haase, J.; Hook, R. N.; Kuntschner, H.; Lombardi, M.; Micol, A.; Nilsson, K. K.; Stoehr, F.; Walsh, J. R.

2011-06-01

A public release of slitless spectra, obtained with ACS/WFC and the G800L grism, is presented. Spectra were automatically extracted in a uniform way from 153 archival fields (or "associations") distributed across the two Galactic caps, covering all observations to 2008. The ACS G800L grism provides a wavelength range of 0.55-1.00 μm, with a dispersion of 40 Å/pixel and a resolution of ~80 Å for point-like sources. The ACS G800L images and matched direct images were reduced with an automatic pipeline that handles all steps from archive retrieval, alignment and astrometric calibration, direct image combination, catalogue generation, spectral extraction and collection of metadata. The large number of extracted spectra (73,581) demanded automatic methods for quality control and an automated classification algorithm was trained on the visual inspection of several thousand spectra. The final sample of quality controlled spectra includes 47 919 datasets (65% of the total number of extracted spectra) for 32 149 unique objects, with a median iAB-band magnitude of 23.7, reaching 26.5 AB for the faintest objects. Each released dataset contains science-ready 1D and 2D spectra, as well as multi-band image cutouts of corresponding sources and a useful preview page summarising the direct and slitless data, astrometric and photometric parameters. This release is part of the continuing effort to enhance the content of the Hubble Legacy Archive (HLA) with highly processed data products which significantly facilitate the scientific exploitation of the Hubble data. In order to characterize the slitless spectra, emission-line flux and equivalent width sensitivity of the ACS data were compared with public ground-based spectra in the GOODS-South field. An example list of emission line galaxies with two or more identified lines is also included, covering the redshift range 0.2 - 4.6. Almost all redshift determinations outside of the GOODS fields are new. The scope of science projects

UV/Visible Telescope with Hubble Disposal

Science.gov (United States)

Benford, Dominic J.

2013-01-01

Submission Overview: Our primary objective is to convey a sense of the significant advances possible in astrophysics investigations for major Cosmic Origins COR program goals with a 2.4m telescope asset outfitted with one or more advanced UV visible instruments. Several compelling science objectives were identified based on community meetings these science objectives drove the conceptual design of instruments studied by the COR Program Office during July September 2012. This RFI submission encapsulates the results of that study, and suggests that a more detailed look into the instrument suite should be conducted to prove viability and affordability to support the demonstrated scientific value. This study was conducted in the context of a larger effort to consider the options available for a mission to dispose safely of Hubble hence, the overall architecture considered for the mission we studied for the 2.4m telescope asset included resource sharing. This mitigates combined cost and risk and provides naturally for a continued US leadership role in astrophysics with an advanced, general-purpose UV visible space telescope.

HUBBLE STAYS ON TRAIL OF FADING GAMMA-RAY BURST FIREBALL

Science.gov (United States)

2002-01-01

A Hubble Space Telescope image of the fading fireball from one of the universe's most mysterious phenomena, a gamma-ray burst. Though the visible component has faded to 1/500th its brightness (27.7 magnitude) from the time it was first discovered by ground- based telescopes last March (the actual gamma-ray burst took place on February 28), Hubble continues to clearly see the fireball and discriminated a surrounding nebulosity (at 25th magnitude) which is considered a host galaxy. The continued visibility of the burst, and the rate of its fading, support theories that the light from a gamma-ray burst is an expanding relativistic (moving near the speed of light) fireball, possibly produced by the collision of two dense objects, such as an orbiting pair of neutron stars. If the burst happened nearby, within our own galaxy, the resulting fireball should have had only enough energy to propel it into space for a month. The fact that this fireball is still visible after six months means the explosion was truly titanic and, to match the observed brightness, must have happened at the vast distances of galaxies. The energy released in a burst, which can last from a fraction of a second to a few hundred seconds, is equal to all of the Sun's energy generated over its 10 billion year lifetime. The false-color image was taken Sept. 5, 1997 with the Space Telescope Imaging Spectrograph. Credit: Andrew Fruchter (STScI), Elena Pian (ITSRE-CNR), and NASA

Charge retention test experiences on Hubble Space Telescope nickel-hydrogen battery cells

Science.gov (United States)

Nawrocki, Dave E.; Driscoll, J. R.; Armantrout, J. D.; Baker, R. C.; Wajsgras, H.

1993-01-01

The Hubble Space Telescope (HST) nickel-hydrogen battery module was designed by Lockheed Missile & Space Co (LMSC) and manufactured by Eagle-Picher Ind. (EPI) for the Marshall Space Flight Center (MSFC) as an Orbital Replacement Unit (ORU) for the nickel-cadmium batteries originally selected for this low earth orbit mission. The design features of the HST nickel hydrogen battery are described and the results of an extended charge retention test are summarized.

The Hubble Constant to 1%: Physics beyond LambdaCDM

Science.gov (United States)

Riess, Adam

2017-08-01

By steadily advancing the precision and accuracy of the Hubble constant, we now see 3.4-sigma evidence for a deviation from the standard LambdaCDM model and thus the exciting chance of discovering new fundamental physics such as exotic dark energy, a new relativistic particle, dark matter interactions, or a small curvature, to name a few possibilities. We propose a coordinated program to accomplish three goals with one set of observations: (1) improve the precision of the best route to H_0 with HST observations of Cepheids in the hosts of 11 SNe Ia, lowering the uncertainty to 1.3% to reach the discovery threshold of 5-sigma and begin resolving the underlying source of the deviation; (2) continue testing the quality of Cepheid distances, so far the most accurate and reliable indicators in the near Universe, using the tip of the red giant branch (TRGB); and (3) use oxygen-rich Miras to confirm the present tension with the CMB and establish a future route available to JWST. We can achieve all three goals with one dataset and take the penultimate step to reach 1% precision in H_0 after Gaia. With its long-pass filter and NIR capability, we can collect these data with WFC3 many times faster than previously possible while overcoming the extinction and metallicity effects that challenged the first generation of H_0 measurements. Our results will complement the leverage available at high redshift from other cosmological tools such as BAO, the CMB, and SNe Ia, and will provide a 40% improvement on the WFIRST measurements of dark energy. Reaching this precision will be a fitting legacy for the telescope charged to resolve decades of uncertainty regarding the Hubble constant.

Second generation spectrograph for the Hubble Space Telescope

Science.gov (United States)

Woodgate, B. E.; Boggess, A.; Gull, T. R.; Heap, S. R.; Krueger, V. L.; Maran, S. P.; Melcher, R. W.; Rebar, F. J.; Vitagliano, H. D.; Green, R. F.; Wolff, S. C.; Hutchings, J. B.; Jenkins, E. B.; Linsky, J. L.; Moos, H. W.; Roesler, F.; Shine, R. A.; Timothy, J. G.; Weistrop, D. E.; Bottema, M.; Meyer, W.

1986-01-01

The preliminary design for the Space Telescope Imaging Spectrograph (STIS), which has been selected by NASA for definition study for future flight as a second-generation instrument on the Hubble Space Telescope (HST), is presented. STIS is a two-dimensional spectrograph that will operate from 1050 A to 11,000 A at the limiting HST resolution of 0.05 arcsec FWHM, with spectral resolutions of 100, 1200, 20,000, and 100,000 and a maximum field-of-view of 50 x 50 arcsec. Its basic operating modes include echelle model, long slit mode, slitless spectrograph mode, coronographic spectroscopy, photon time-tagging, and direct imaging. Research objectives are active galactic nuclei, the intergalactic medium, global properties of galaxies, the origin of stellar systems, stelalr spectral variability, and spectrographic mapping of solar system processes.

Hubble Observes Surface of Titan

Science.gov (United States)

1994-01-01

Scientists for the first time have made images of the surface of Saturn's giant, haze-shrouded moon, Titan. They mapped light and dark features over the surface of the satellite during nearly a complete 16-day rotation. One prominent bright area they discovered is a surface feature 2,500 miles across, about the size of the continent of Australia.Titan, larger than Mercury and slightly smaller than Mars, is the only body in the solar system, other than Earth, that may have oceans and rainfall on its surface, albeit oceans and rain of ethane-methane rather than water. Scientists suspect that Titan's present environment -- although colder than minus 289 degrees Fahrenheit, so cold that water ice would be as hard as granite -- might be similar to that on Earth billions of years ago, before life began pumping oxygen into the atmosphere.Peter H. Smith of the University of Arizona Lunar and Planetary Laboratory and his team took the images with the Hubble Space Telescope during 14 observing runs between Oct. 4 - 18. Smith announced the team's first results last week at the 26th annual meeting of the American Astronomical Society Division for Planetary Sciences in Bethesda, Md. Co-investigators on the team are Mark Lemmon, a doctoral candidate with the UA Lunar and Planetary Laboratory; John Caldwell of York University, Canada; Larry Sromovsky of the University of Wisconsin; and Michael Allison of the Goddard Institute for Space Studies, New York City.Titan's atmosphere, about four times as dense as Earth's atmosphere, is primarily nitrogen laced with such poisonous substances as methane and ethane. This thick, orange, hydrocarbon haze was impenetrable to cameras aboard the Pioneer and Voyager spacecraft that flew by the Saturn system in the late 1970s and early 1980s. The haze is formed as methane in the atmosphere is destroyed by sunlight. The hydrocarbons produced by this methane destruction form a smog similar to that found over large cities, but is much thicker

On ambiente de binárias de pequena massa em formação: o caso do glóbulo cometário CG30 e IRAS08076-3556

Science.gov (United States)

Hickel, G. R.; Vilas-Boas, J. W. S.

2003-08-01

Neste trabalho, combinamos observações de polarização linear no óptico (banda R), dados no infravermelho distante (IRAS) e observações de transições moleculares em radiofreqüências (CO e espécies isotópicas, HCN e HCO+) para analisar o glóbulo cometário (GC) CG30 (na região da IRAS Vela Shell), que apresenta objetos Herbig-Haro e ejeções de matéria, além de uma fonte pontual IRAS em seu interior. Os objetivos deste estudo são: determinar a eficiência de formação estelar nos glóbulos cometários, através da relação entre a massa total do GC e da massa das estrelas em formação; determinar como o campo magnético influencia na formação de estrelas no interior destes objetos; e analisar as modificações que ejeções de matéria de estrelas em formação causam no gás e no campo magnético dos GCs. Combinando nossos dados com trabalhos já publicados, mostramos que CG30 tem uma eficiência de formação estelar em torno de 3%; que o campo magnético é importante na manutenção da estrutura global do GC e demonstra sinais de torção e compressão; e que a ejeção bipolar de matéria das estrelas do par formam uma ejeção quadripolar, a qual influencia na densidade e temperatura do gás e no grau de polarização dos grãos de poeira associados ao gás do GC.

Initial Hubble Diagram Results from the Nearby Supernova Factory

Energy Technology Data Exchange (ETDEWEB)

Bailey, S. [Lab. Nuclear and High-Energy Physics (LPNHE), Paris (France); Aldering, G. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Antilogus, P. [Lab. Nuclear and High-Energy Physics (LPNHE), Paris (France); Aragon, C. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Baltay, C. [Yale Univ., New Haven, CT (United States); Bongard, S. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Buton, C [Inst. of Nuclear Physics of Lyon (France); Childress, M. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Copin, Y. [Inst. of Nuclear Physics of Lyon (France); Gangler, E. [Inst. of Nuclear Physics of Lyon (France); Loken, S. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Nugent, P. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Pain, R. [Lab. Nuclear and High-Energy Physics (LPNHE), Paris (France); Pecontal, E. [Center of Research Astrophysics of Lyon (CRAL) (France); Pereira, R. [Lab. Nuclear and High-Energy Physics (LPNHE), Paris (France); Perlmutter, S. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Rabinowitz, D. [Yale Univ., New Haven, CT (United States); Rigaudier, G. [Center of Research Astrophysics of Lyon (CRAL) (France); Ripoche, P. [Lab. Nuclear and High-Energy Physics (LPNHE), Paris (France); Runge, K. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Scalzo, R. [Yale Univ., New Haven, CT (United States); Smadja, G. [Inst. of Nuclear Physics of Lyon (France); Tao, C. [Inst. of Nuclear Physics of Lyon (France); Thomas, R. C. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Wu, C. [Lab. Nuclear and High-Energy Physics (LPNHE), Paris (France)

2017-07-06

The use of Type Ia supernovae as distance indicators led to the discovery of the accelerating expansion of the universe a decade ago. Now that large second generation surveys have significantly increased the size and quality of the high-redshift sample, the cosmological constraints are limited by the currently available sample of ~50 cosmologically useful nearby supernovae. The Nearby Supernova Factory addresses this problem by discovering nearby supernovae and observing their spectrophotometric time development. Our data sample includes over 2400 spectra from spectral timeseries of 185 supernovae. This talk presents results from a portion of this sample including a Hubble diagram (relative distance vs. redshift) and a description of some analyses using this rich dataset.

La Evoluci?n de la percepci?n del rol del IRA Provisional a partir de est?mulos generados por el Sistema Internacional

OpenAIRE

Cort?s Rojas, Mar?a Alejandra

2017-01-01

Esta investigaci?n tiene como objetivo explicar los cambios en la forma de lucha, tanto armada como pol?tica, del IRA Provisional a partir del surgimiento de movimientos por los derechos civiles en Estados Unidos, el fin de la Guerra Fr?a y la deslegitimaci?n de los movimientos anti-imperialistas, el auge econ?mico irland?s y la expansi?n de los valores de la Uni?n Europea. Estos cambios pueden verse explicados por la forma en la que el grupo cambia su percepci?n del rol que desarrolla dentro...

45 CFR 1634.2 - Definitions.

Science.gov (United States)

2010-10-01

... Americans and migrant farm workers and may include other groups of eligible clients that, because they have... conflict; nor may the person have been a board member of or employed by that applicant in the past five...

Automation of Hubble Space Telescope Mission Operations

Science.gov (United States)

Burley, Richard; Goulet, Gregory; Slater, Mark; Huey, William; Bassford, Lynn; Dunham, Larry

2012-01-01

On June 13, 2011, after more than 21 years, 115 thousand orbits, and nearly 1 million exposures taken, the operation of the Hubble Space Telescope successfully transitioned from 24x7x365 staffing to 815 staffing. This required the automation of routine mission operations including telemetry and forward link acquisition, data dumping and solid-state recorder management, stored command loading, and health and safety monitoring of both the observatory and the HST Ground System. These changes were driven by budget reductions, and required ground system and onboard spacecraft enhancements across the entire operations spectrum, from planning and scheduling systems to payload flight software. Changes in personnel and staffing were required in order to adapt to the new roles and responsibilities required in the new automated operations era. This paper will provide a high level overview of the obstacles to automating nominal HST mission operations, both technical and cultural, and how those obstacles were overcome.

The Carnegie–Chicago Hubble Program. III. The Distance to NGC 1365 via the Tip of the Red Giant Branch

Science.gov (United States)

Jang, In Sung; Hatt, Dylan; Beaton, Rachael L.; Lee, Myung Gyoon; Freedman, Wendy L.; Madore, Barry F.; Hoyt, Taylor J.; Monson, Andrew J.; Rich, Jeffrey A.; Scowcroft, Victoria; Seibert, Mark

2018-01-01

The Carnegie–Chicago Hubble Program (CCHP) seeks to anchor the distance scale of Type Ia supernovae via the Tip of the Red Giant Branch (TRGB) method. Based on deep Hubble Space Telescope ACS/WFC imaging, we present an analysis of the TRGB for the metal-poor halo of NGC 1365, a giant spiral galaxy in the Fornax cluster that was host to the Type Ia supernova SN 2012fr. We have measured the extinction-corrected TRGB magnitude of NGC 1365 to be F814W = 27.34 ± 0.03stat ± 0.04sys mag. In advance of future direct calibration by Gaia, we adopt a provisional I-band TRGB luminosity set at the Large Magellanic Cloud and find a true distance modulus μ 0 = 31.29 ± 0.04stat ± 0.06sys mag or D = 18.1 ± 0.3stat ± 0.5sys Mpc. This measurement is in excellent agreement with recent Cepheid-based distances to NGC 1365 and reveals no significant difference in the distances derived from stars of Populations I and II for this galaxy. We revisit the error budget for the CCHP path to the Hubble constant based on the analysis presented here, i.e., that for one of the most distant Type Ia supernova hosts within our Program, and find that a 2.5% measurement is feasible with the current sample of galaxies and TRGB absolute calibration. Based in part on observations made with the NASA/ESA Hubble Space Telescope, obtained at the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS 5-26555. These observations are associated with program #13691.

SUBARCSECOND ANALYSIS OF THE INFALLING–ROTATING ENVELOPE AROUND THE CLASS I PROTOSTAR IRAS 04365+2535

Energy Technology Data Exchange (ETDEWEB)

Sakai, Nami [The Institute of Physical and Chemical Research (RIKEN), 2-1, Hirosawa, Wako-shi, Saitama 351-0198 (Japan); Oya, Yoko; López-Sepulcre, Ana; Watanabe, Yoshimasa; Yamamoto, Satoshi [Department of Physics, The University of Tokyo, Bunkyo-ku, Tokyo 113-0033 (Japan); Sakai, Takeshi [Department of Communication Engineering and Informatics, Graduate School of Informatics and Engineering, The University of Electro-Communications, Chofugaoka, Chofu, Tokyo 182-8585 (Japan); Hirota, Tomoya [National Astronomical Observatory of Japan, Osawa, Mitaka, Tokyo 181-8588 (Japan); Aikawa, Yuri [Center for Computational Science, University of Tsukuba, Tsukuba, Ibaraki 305-8577 (Japan); Ceccarelli, Cecilia; Lefloch, Bertrand; Kahane, Claudine [Universite de Grenoble Alpes, IPAG, F-38000 Grenoble (France); Caux, Emmanuel; Vastel, Charlotte [Universite de Toulouse, UPS-OMP, IRAP, Toulouse (France)

2016-04-01

Subarcsecond images of the rotational line emission of CS and SO have been obtained toward the Class I protostar IRAS 04365+2535 in TMC-1A with ALMA. A compact component around the protostar is clearly detected in the CS and SO emission. The velocity structure of the compact component of CS reveals infalling–rotating motion conserving the angular momentum. It is well explained by a ballistic model of an infalling–rotating envelope with the radius of the centrifugal barrier (one-half of the centrifugal radius) of 50 au, although the distribution of the infalling gas is asymmetric around the protostar. The distribution of SO is mostly concentrated around the radius of the centrifugal barrier of the simple model. Thus, a drastic change in chemical composition of the gas infalling onto the protostar is found to occur at a 50 au scale probably due to accretion shocks, demonstrating that the infalling material is significantly processed before being delivered into the disk.

A ROTATING MOLECULAR DISK TOWARD IRAS 18162-2048, THE EXCITING SOURCE OF HH 80-81

International Nuclear Information System (INIS)

Fernandez-Lopez, M.; Curiel, S.; Girart, J. M.; Gomez, Y.; Ho, P. T. P.; Patel, N.

2011-01-01

We present several molecular line emission arcsecond and subarcsecond observations obtained with the Submillimeter Array in the direction of the massive protostar IRAS 18162-2048, the exciting source of HH 80-81. The data clearly indicate the presence of a compact (radius ∼425-850 AU) SO 2 structure, enveloping the more compact (radius ∼ sun . The SO 2 spectral line data also allow us to constrain the structure temperature between 120 and 160 K and the volume density ∼> 2 x 10 9 cm -3 . We also find that such a rotating flattened system could be unstable due to gravitational disturbances. The data from C 17 O line emission show a dense core within this star-forming region. Additionally, the H 2 CO and SO emissions appear clumpy and trace the disk-like structure, a possible interaction between a molecular core and the outflows, and in part, the cavity walls excavated by the thermal radio jet.

Dark energy and the quietness of the local Hubble flow

International Nuclear Information System (INIS)

Axenides, M.; Perivolaropoulos, L.

2002-01-01

The linearity and quietness of the local ( X (t 0 ) of dark energy obeying the time independent equation of state p X =wρ X . We find that dark energy can indeed cool the LHF. However the dark energy parameter values required to make the predicted velocity dispersion consistent with the observed value v rms ≅40 km/s have been ruled out by other observational tests constraining the dark energy parameters w and Ω X . Therefore despite the claims of recent qualitative studies, dark energy with time independent equation of state cannot by itself explain the quietness and linearity of the local Hubble flow

Serendipitous discovery of warm absorbers in the Seyfert 2 galaxy IRAS 18325-5926

International Nuclear Information System (INIS)

Zhang Shuinai; Gu Qiusheng; Peng Zhixin; Ji Li

2011-01-01

Warm absorption is a common phenomenon in Seyfert 1s and quasars, but is rare in Seyfert 2s. We report the detection of warm absorbers with high energy resolution in the Seyfert 2 galaxy IRAS 18325-5926 for the first time with Chandra HETGS spectra. An intrinsic absorbing line system with an outflow velocity ∼ 400 km s -1 was found, which is contributed by two warm absorbers with FWHM of 570 km s -1 and 1360 km s -1 , respectively. The two absorbers were adjacent, and moving transversely across our line of sight. We constrained the distance between the center and the absorbers to be a small value, suggesting that the absorbers may originate from the highly ionized accretion disk wind ejected five years ago. The perspective of this type 2 Seyfert provides the best situation in which to investigate the vertical part of the funnel-like outflows. Another weak absorbing line system with zero redshift was also detected, which could be due to Galactic absorption with very high temperature or an intrinsic outflow with a very high velocity ∼ 6000 km s -1 . (research papers)

VizieR Online Data Catalog: Hubble Source Catalog (V1 and V2) (Whitmore+, 2016)

Science.gov (United States)

Whitmore, B. C.; Allam, S. S.; Budavari, T.; Casertano, S.; Downes, R. A.; Donaldson, T.; Fall, S. M.; Lubow, S. H.; Quick, L.; Strolger, L.-G.; Wallace, G.; White, R. L.

2016-10-01

The HSC v1 contains members of the WFPC2, ACS/WFC, WFC3/UVIS and WFC3/IR Source Extractor source lists from HLA version DR8 (data release 8). The crossmatching process involves adjusting the relative astrometry of overlapping images so as to minimize positional offsets between closely aligned sources in different images. After correction, the astrometric residuals of crossmatched sources are significantly reduced, to typically less than 10mas. The relative astrometry is supported by using Pan-STARRS, SDSS, and 2MASS as the astrometric backbone for initial corrections. In addition, the catalog includes source nondetections. The crossmatching algorithms and the properties of the initial (Beta 0.1) catalog are described in Budavari & Lubow (2012ApJ...761..188B). The HSC v2 contains members of the WFPC2, ACS/WFC, WFC3/UVIS and WFC3/IR Source Extractor source lists from HLA version DR9.1 (data release 9.1). The crossmatching process involves adjusting the relative astrometry of overlapping images so as to minimize positional offsets between closely aligned sources in different images. After correction, the astrometric residuals of crossmatched sources are significantly reduced, to typically less than 10mas. The relative astrometry is supported by using Pan-STARRS, SDSS, and 2MASS as the astrometric backbone for initial corrections. In addition, the catalog includes source nondetections. The crossmatching algorithms and the properties of the initial (Beta 0.1) catalog are described in Budavari & Lubow (2012ApJ...761..188B). Hubble Source Catalog Acknowledgement: Based on observations made with the NASA/ESA Hubble Space Telescope, and obtained from the Hubble Legacy Archive, which is a collaboration between the Space Telescope Science Institute (STScI/NASA), the Space Telescope European Coordinating Facility (ST-ECF/ESAC/ESA) and the Canadian Astronomy Data Centre (CADC/NRC/CSA). (2 data files).

Reexploration of interacting holographic dark energy model. Cases of interaction term excluding the Hubble parameter

Energy Technology Data Exchange (ETDEWEB)

Li, Hai-Li; Zhang, Jing-Fei; Feng, Lu [Northeastern University, Department of Physics, College of Sciences, Shenyang (China); Zhang, Xin [Northeastern University, Department of Physics, College of Sciences, Shenyang (China); Peking University, Center for High Energy Physics, Beijing (China)

2017-12-15

In this paper, we make a deep analysis for the five typical interacting holographic dark energy models with the interaction terms Q = 3βH{sub 0}ρ{sub de}, Q = 3βH{sub 0}ρ{sub c}, Q = 3βH{sub 0}(ρ{sub de} + ρ{sub c}), Q = 3βH{sub 0}√(ρ{sub de}ρ{sub c}), and Q = 3βH{sub 0}(ρ{sub de}ρ{sub c})/(ρ{sub de}+ρ{sub c}), respectively. We obtain observational constraints on these models by using the type Ia supernova data (the Joint Light-Curve Analysis sample), the cosmic microwave background data (Planck 2015 distance priors), the baryon acoustic oscillations data, and the direct measurement of the Hubble constant. We find that the values of χ{sub min}{sup 2} for all the five models are almost equal (around 699), indicating that the current observational data equally favor these IHDE models. In addition, a comparison with the cases of an interaction term involving the Hubble parameter H is also made. (orig.)

Monte Carlo calculations and experimental measurements of dosimetric parameters of the IRA-103Pd source

International Nuclear Information System (INIS)

Sadeghi, Mahdi; Hosseini, Hamed; Raisali, Gholamreza

2008-01-01

Full text: The use of 103 Pd seed sources for permanent prostate implantation has become a popular brachytherapy application. As recommended by AAPM the dosimetric characteristics of the new source must be determined using experimental and Monte Carlo simulations, before its use in clinical applications thus The goal of this report is the experimental and theoretical determination of the dosimetric characteristics of this source following the recommendations in the AAPM TG-43U1 protocol. Figure 1 shows the geometry of the IRA- 103 Pd source. The source consists of a cylindrical silver core, 0.3 cm long x 0.05 cm in diameter, onto which 0.5 nm layer of 103 Pd has been uniformly adsorbed. The effective active length of source is 0.3 cm and the silver core encapsulated inside a hollow titanium tube with 0.45 cm long, 0.07 cm and 0.08 inner and outer diameters and two caps. The Monte Carlo N-Particle (MCNP) code, version 4C, was used to determine the relevant dosimetric parameters of the source. The geometry of the Monte Carlo simulation performed in this study consisted of a sphere with 30 cm diameter. Dose distributions around this source were measured in two Perspex phantom using enough TLD chips. For these measurements, slabs of Perspex material were machined to accommodate the source and TLD chips. A value of 0.67± 1% cGy.h -1 .U -1 for, Λ, was calculated as the ratio of d(r 0 ,θ 0 ) and s K , that may be compared with Λ values obtained for 103 Pd sources. Result of calculations and measurements values of dosimetric parameters of the source including radial dose function, g(r), and anisotropy function, F(r,θ), has been shown in separate figures. The radial dose function, g(r), for the IRA- 103 Pd source and other 103 Pd sources is included in Fig. 2. Comparison between measured and Monte Carlo simulated dose function, g(r), and anisotropy function, F(r,θ), of this source demonstrated that they are in good agreement with each other and The value of Λ is

Revisiting the stellar velocity ellipsoid-Hubble-type relation: observations versus simulations

Science.gov (United States)

Pinna, F.; Falcón-Barroso, J.; Martig, M.; Martínez-Valpuesta, I.; Méndez-Abreu, J.; van de Ven, G.; Leaman, R.; Lyubenova, M.

2018-04-01

The stellar velocity ellipsoid (SVE) in galaxies can provide important information on the processes that participate in the dynamical heating of their disc components (e.g. giant molecular clouds, mergers, spiral density waves, and bars). Earlier findings suggested a strong relation between the shape of the disc SVE and Hubble type, with later-type galaxies displaying more anisotropic ellipsoids and early types being more isotropic. In this paper, we revisit the strength of this relation using an exhaustive compilation of observational results from the literature on this issue. We find no clear correlation between the shape of the disc SVE and morphological type, and show that galaxies with the same Hubble type display a wide range of vertical-to-radial velocity dispersion ratios. The points are distributed around a mean value and scatter of σz/σR = 0.7 ± 0.2. With the aid of numerical simulations, we argue that different mechanisms might influence the shape of the SVE in the same manner and that the same process (e.g. mergers) does not have the same impact in all the galaxies. The complexity of the observational picture is confirmed by these simulations, which suggest that the vertical-to-radial axis ratio of the SVE is not a good indicator of the main source of disc heating. Our analysis of those simulations also indicates that the observed shape of the disc SVE may be affected by several processes simultaneously and that the signatures of some of them (e.g. mergers) fade over time.

A young bipolar outflow from IRAS 15398-3359

Science.gov (United States)

Bjerkeli, P.; Jørgensen, J. K.; Brinch, C.

2016-03-01

Context. Changing physical conditions in the vicinity of protostars allow for a rich and interesting chemistry to occur. Heating and cooling of the gas allows molecules to be released from and frozen out on dust grains. These changes in physics, traced by chemistry as well as the kinematical information, allows us to distinguish between different scenarios describing the infall of matter and the launching of molecular outflows and jets. Aims: We aim to determine the spatial distribution of different species that are of different chemical origin. This is to examine the physical processes in play in the observed region. From the kinematical information of the emission lines we aim to determine the nature of the infalling and outflowing gas in the system. We also aim to determine the physical properties of the outflow. Methods: Maps from the Submillimeter Array (SMA) reveal the spatial distribution of the gaseous emission towards IRAS 15398-3359. The line radiative transfer code LIME is used to construct a full 3D model of the system taking all relevant components and scales into account. Results: CO, HCO+, and N2H+ are detected and shown to trace the motions of the outflow. For CO, the circumstellar envelope and the surrounding cloud also have a profound impact on the observed line profiles. N2H+ is detected in the outflow, but is suppressed towards the central region, perhaps because of the competing reaction between CO and H3+ in the densest regions as well as the destruction of N2H+ by CO. N2D+ is detected in a ridge south-west of the protostellar condensation and is not associated with the outflow. The morphology and kinematics of the CO emission suggests that the source is younger than ~1000 years. The mass, momentum, momentum rate, mechanical luminosity, kinetic energy, and mass-loss rate are also all estimated to be low. A full 3D radiative transfer model of the system can explain all the kinematical and morphological features in the system.

75 FR 28664 - Government-Owned Inventions, Available for Licensing

Science.gov (United States)

2010-05-21

...; telephone (650) 604-5104; fax (650) 604-2767. NASA Case No. ARC-14653-1: Air Traffic Management Evaluation Tool (FACET). NASA Case No. ARC-16320-1: Model-Based Prognostics for Batteries. NASA Case No. ARC-16342-1: Advanced Sensor Technology for Algai Biotechnology (ASTAB). NASA Case No. ARC-16370-1: A Truss...

Mach's Principle to Hubble's Law and Light Relativity

Science.gov (United States)

Zhang, Tianxi

2018-01-01

Discovery of the redshift-distance relation to be linear (i.e. Hubble's law) for galaxies in the end of 1920s instigated us to widely accept expansion of the universe, originated from a big bang around 14 billion years ago. Finding of the redshift-distance relation to be weaker than linear for distant type Ia supernovae nearly two decades ago further precipitated us to largely agree with recent acceleration of the universe, driven by the mysterious dark energy. The time dilation measured for supernovae has been claimed as a direct evidence for the expansion of the universe, but scientists could not explain why quasars and gamma-ray bursts had not similar time dilations. Recently, an anomaly was found in the standard template for the width of supernova light curves to be proportional to the wavelength, which exactly removed the time dilation of supernovae and hence was strongly inconsistent with the conventional redshift mechanism. In this study, we have derived a new redshift-distance relation from Mach's principle with light relativity that describes the effect of light on spacetime as well as the influence of disturbed spacetime on the light inertia or frequency. A moving object or photon, because of its continuously keeping on displacement, disturbs the rest of the entire universe or distorts/curves the spacetime. The distorted or curved spacetime then generates an effective gravitational force to act back on the moving object or photon, so that reduces the object inertia or photon frequency. Considering the disturbance of spacetime by a photon is extremely weak, we have modelled the effective gravitational force to be Newtonian and derived the new redshift-distance relation that can not only perfectly explain the redshift-distance measurement of distant type Ia supernovae but also inherently obtain Hubble's law as an approximate at small redshift. Therefore, the result obtained from this study does neither support the acceleration of the universe nor the

STS 31 PAYLOAD HUBBLE SPACE TELESCOPE ENCLOSED IN AN AIR-TIGHT PLASTIC BAG FOR PROTECTION IN VERTICA

Science.gov (United States)

1989-01-01

Preparations are made to enclose the Hubble Space Telescope [HST] inside an air-tight plastic bag in the VPF. Processing of the 94- inch primary mirror telescope for launch on the Discovery in March 1990, involves working within strict controls to prevent contamination.

IRAS 15099-5856: REMARKABLE MID-INFRARED SOURCE WITH PROMINENT CRYSTALLINE SILICATE EMISSION EMBEDDED IN THE SUPERNOVA REMNANT MSH15-52

International Nuclear Information System (INIS)

Koo, Bon-Chul; Kim, Hyun-Jeong; Im, Myungshin; McKee, Christopher F.; Suh, Kyung-Won; Moon, Dae-Sik; Lee, Ho-Gyu; Onaka, Takashi; Burton, Michael G.; Hiramatsu, Masaaki; Bessell, Michael S.; Gaensler, B. M.; Lee, Jae-Joon; Jeong, Woong-Seob; Tatematsu, Ken'ichi; Kawabe, Ryohei; Ezawa, Hajime; Kohno, Kotaro; Wilson, Grant; Yun, Min S.

2011-01-01

We report new mid-infrared (MIR) observations of the remarkable object IRAS 15099-5856 using the space telescopes AKARI and Spitzer, which demonstrate the presence of prominent crystalline silicate emission in this bright source. IRAS 15099-5856 has a complex morphology with a bright central compact source (IRS1) surrounded by knots, spurs, and several extended (∼4') arc-like filaments. The source is seen only at ≥10 μm. The Spitzer mid-infrared spectrum of IRS1 shows prominent emission features from Mg-rich crystalline silicates, strong [Ne II] 12.81 μm, and several other faint ionic lines. We model the MIR spectrum as thermal emission from dust and compare with the Herbig Be star HD 100546 and the luminous blue variable R71, which show very similar MIR spectra. Molecular line observations reveal two molecular clouds around the source, but no associated dense molecular cores. We suggest that IRS1 is heated by UV radiation from the adjacent O star Muzzio 10 and that its crystalline silicates most likely originated in a mass outflow from the progenitor of the supernova remnant (SNR) MSH 15-52. IRS1, which is embedded in the SNR, could have been shielded from the SN blast wave if the progenitor was in a close binary system with Muzzio 10. If MSH 15-52 is a remnant of Type Ib/c supernova (SN Ib/c), as has been previously proposed, this would confirm the binary model for SN Ib/c. IRS1 and the associated structures may be the relics of massive star death, as shaped by the supernova explosion, the pulsar wind, and the intense ionizing radiation of the embedded O star.

El efecto del rumor en el cambio del voto: la ira, el miedo y la incertidumbre generados por el rumor en procesos electorales y sus contribuciones en las decisiones del votante

Directory of Open Access Journals (Sweden)

Caroline Ávila

2016-01-01

Full Text Available El rumor es un componente reiterado en las campañas electorales, sin embargo, poco se ha estudiado sobre los efectos directos en las emociones y cómo estas inciden en el votante. Esta investigación presenta, con datos empíricos, evidencias de los efectos reales del rumor en emociones, como la ira, el miedo y la incertidumbre, a través de un estudio de las elecciones intermedias en Ecuador de febrero de 2014. La metodología es de tipo cuantitativo a través de encuestas aplicadas a los hogares objeto de este estudio. Los resultados fueron sometidos a análisis estadísticos de correlación de rho de Spearman y regresión logística que permiten explicar el cambio en el voto de acuerdo con las variables que evalúan la incidencia del rumor en emociones negativas, como la ira, la incertidumbre y el miedo. A efectos de este estudio, fue analizado el caso Tranvía Cuatro Ríos en la ciudad de Cuenca (500 000 habitantes.

The Development of a Virtual Company to Support the Reengineering of the NASA/Goddard Hubble Space Telescope Control Center System

Science.gov (United States)

Lehtonen, Ken

1999-01-01

This is a report to the Third Annual International Virtual Company Conference, on The Development of a Virtual Company to Support the Reengineering of the NASA/Goddard Hubble Space Telescope (HST) Control Center System. It begins with a HST Science "Commercial": Brief Tour of Our Universe showing various pictures taken from the Hubble Space Telescope. The presentation then reviews the project background and goals. Evolution of the Control Center System ("CCS Inc.") is then reviewed. Topics of Interest to "virtual companies" are reviewed: (1) "How To Choose A Team" (2) "Organizational Model" (3) "The Human Component" (4) "'Virtual Trust' Among Teaming Companies" (5) "Unique Challenges to Working Horizontally" (6) "The Cultural Impact" (7) "Lessons Learned".

PHYSICAL CONDITIONS IN THE ULTRAVIOLET ABSORBERS OF IRAS F22456-5125

International Nuclear Information System (INIS)

Dunn, Jay P.; Crenshaw, D. Michael; Trippe, M. L.; Kraemer, S. B.

2010-01-01

We present the ultraviolet (UV) and X-ray spectra observed with the Far Ultraviolet Spectroscopic Explorer (FUSE) and the XMM-Newton satellite, respectively, of the low-z Seyfert 1 galaxy IRAS F22456 - 5125. This object shows absorption from five distinct, narrow kinematic components that span a significant range in velocity (∼0 to -700 km s -1 ) and ionization (Lyman series, C III, N III, and O VI). We also show that three of the five kinematic components in these lines appear to be saturated in Lyβ λ1026 and that all five components show evidence of saturation in the O VI doublet lines λλ1032, 1038. Further, all five components show evidence for partial covering due to the absorption seen in the O VI doublet. This object is peculiar because it shows no evidence for corresponding X-ray absorption to the UV absorption in the X-ray spectrum, which violates the 1:1 correlation known for low-z active galactic nuclei (AGNs). We perform photoionization modeling of the UV absorption lines and predict that the O VII column density should be small, which would produce little to no absorption in agreement with the X-ray observation. We also examine the UV variability of the continuum flux for this object (an increase of a factor of 6). As the absorption components lack variability, we find a lower limit of ∼20 kpc for the distance for the absorbers from the central AGN.

Price of shifting the Hubble constant

Science.gov (United States)

Evslin, Jarah; Sen, Anjan A.; Ruchika

2018-05-01

An anisotropic measurement of the baryon acoustic oscillation (BAO) feature fixes the product of the Hubble constant and the acoustic scale H0rd. Therefore, regardless of the dark energy dynamics, to accommodate a higher value of H0 one needs a lower rd and so necessarily a modification of early time cosmology. One must either reduce the age of the Universe at the drag epoch or else the speed of sound in the primordial plasma. The first can be achieved, for example, with dark radiation or very early dark energy, automatically preserving the angular size of the acoustic scale in the cosmic microwave background (CMB) with no modifications to post-recombination dark energy. However, it is known that the simplest such modifications fall afoul of CMB constraints at higher multipoles. As an example, we combine anisotropic BAO with geometric measurements from strong lensing time delays from H0LiCOW and megamasers from the Megamaser Cosmology Project to measure rd, with and without the local distance ladder measurement of H0. We find that the best fit value of rd is indeed quite insensitive to the dark energy model and is also hardly affected by the inclusion of the local distance ladder data.

H0, q0 and the local velocity field. [Hubble and deceleration constants in Big Bang expansion

Science.gov (United States)

Sandage, A.; Tammann, G. A.

1982-01-01

An attempt is made to find a systematic deviation from linearity for distances that are under the control of the Virgo cluster, and to determine the value of the mean random motion about the systematic flow, in order to improve the measurement of the Hubble and the deceleration constants. The velocity-distance relation for large and intermediate distances is studied, and type I supernovae are calibrated relatively as distance indicators and absolutely to obtain a new value for the Hubble constant. Methods of determining the deceleration constant are assessed, including determination from direct measurement, mean luminosity density, virgocentric motion, and the time scale test. The very local velocity field is investigated, and a solution is preferred with a random peculiar radial velocity of very nearby field galaxies of 90-100 km/s, and a Virgocentric motion of the local group of 220 km/s, leading to an underlying expansion rate of 55, in satisfactory agreement with the global value.

The MUSE Hubble Ultra Deep Field Survey. IX. Evolution of galaxy merger fraction since z ≈ 6

Science.gov (United States)

Ventou, E.; Contini, T.; Bouché, N.; Epinat, B.; Brinchmann, J.; Bacon, R.; Inami, H.; Lam, D.; Drake, A.; Garel, T.; Michel-Dansac, L.; Pello, R.; Steinmetz, M.; Weilbacher, P. M.; Wisotzki, L.; Carollo, M.

2017-11-01

We provide, for the first time, robust observational constraints on the galaxy major merger fraction up to z ≈ 6 using spectroscopic close pair counts. Deep Multi Unit Spectroscopic Explorer (MUSE) observations in the Hubble Ultra Deep Field (HUDF) and Hubble Deep Field South (HDF-S) are used to identify 113 secure close pairs of galaxies among a parent sample of 1801 galaxies spread over a large redshift range (0.2 separation limit of 109.5 M⊙ or the median value of stellar mass computed in each redshift bin. Overall, the major close pair fraction for low-mass and massive galaxies follows the same trend. These new, homogeneous, and robust estimates of the major merger fraction since z ≈ 6 are in good agreement with recent predictions of cosmological numerical simulations. Based on observations made with ESO telescopes at the La Silla-Paranal Observatory under programmes 094.A-0289(B), 095.A-0010(A), 096.A-0045(A) and 096.A-0045(B).

Hubble evolution of fireball in relativistic nuclear collisions

International Nuclear Information System (INIS)

Zgura, Sorin; Besliu, Calin; Jipa, Alexandru

2004-01-01

The final state of Au + Au collisions at √s = 130 A GeV and 200 A GeV at RHIC has been reconstructed within the framework of the Buda-Lund hydro model, by performing a simultaneous fit to preliminary BRAHMS, PHENIX, PHOBOS and STAR data on two-particle Bose-Einstein correlations and identified single particle spectra. The Hubble constant is determined for cosmology. From this reconstructed final state and the knowledge of the equation of state of hot and dense hadronic matter (e.g. from lattice QCD calculations) one can, in principle, reconstruct the initial state of the reaction by running the (relativistic) hydrodynamical equations backwards in time and determine if this initial state had been in the QGP phase or not. Here we report on such a reconstruction within the framework of the Buda-Lund hydro model. This model fits are compared to RHIC's experiment data on identified particle spectra, two-particle Bose-Einstein or HBT correlations. (authors)

The Hubble Space Telescope from concept to success

CERN Document Server

Shayler, David J

2016-01-01

The highly successful Hubble Space Telescope was meant to change our view and understanding of the universe. Within weeks of its launch in 1990, however, the space community was shocked to find out that the primary mirror of the telescope was flawed. It was only the skills of scientists and engineers on the ground and the daring talents of astronauts sent to service the telescope in December 1993 that saved the mission. For over two decades NASA had developed the capabilities to service a payload in orbit. This involved numerous studies and the creation of a ground-based infrastructure to support the challenging missions. Unique tools and EVA hardware supported the skills developed in crew training that then enabled astronauts to complete a demanding series of spacewalks. Drawing upon first hand interviews with those closely involved in the project over thirty years ago this story explains the development of the servicing mission concept and the hurdles that had to be overcome to not only launch the telescope...

Theoretical colours and isochrones for some Hubble Space Telescope colour systems

Science.gov (United States)

Edvardsson, B.; Bell, R. A.

1989-01-01

Synthetic spectra for effective temperatures of 4000-7250 K, logarithmic surface gravities typical of dwarfs and subgiants, and metallicities from solar values to 0.001 of the solar metallicity were used to derive a grid of synthetic surface brightness magnitudes for 21 of the Hubble Space Telescope Wide Field Camera (WFC) band passes. The absolute magnitudes of these 21 band passes are also obtained for a set of globular cluster isochrones with different helium abundances, metallicities, oxygen abundances, and ages. The usefulness and efficiency of different sets of broad and intermediate bandwidth WFC colors for determining ages and metallicities for globular clusters are evaluated.

Estrés percibido, ansiedad, depresión e ira en el proceso de reproducción asistida : un estudio de caso

OpenAIRE

Pérez Ortega, Melania; Barraca Mairal, Jorge

2014-01-01

En el artículo se presenta un caso donde se analiza la presencia del estrés, la tristeza, la ansiedad, la ira y el desajuste emocional a lo largo de la aplicación de una técnica de reproducción asistida (Microinyección Espermática-ICSI). Se evaluó a una pareja, ambos de 34 años, antes de comenzar ICSI, durante las fases del proceso y posteriormente. Para la evaluación de sintomatología a lo largo de la intervención médica se utilizaron el BDI-II, el STAI, el STAXI-2...

Drug: D06600 [KEGG MEDICUS

Lifescience Database Archive (English)

Full Text Available D06600 Drug Giripladib (USAN) ... C41H36ClF3N2O4S D06600.gif ... Treatment of pain and symptomatic manageme...nt of arthritis PLA2G4A [HSA:5321] [KO:K16342] ... CAS: 865200-20-0 PubChem: 47208251 ChEMBL: CHEMBL2104969 LigandBox: D06600 ...

Drug: D03938 [KEGG MEDICUS

Lifescience Database Archive (English)

Full Text Available D03938 Drug Ecopladib (USAN/INN) ... C39H33Cl3N2O5S D03938.gif ... Treatment of pain and symptomatic manage...ment of arthritis PLA2G4A [HSA:5321] [KO:K16342] ... CAS: 381683-92-7 PubChem: 47205926 ChEMBL: CHEMBL269787 LigandBox: D03938 ...

Observations of the Hubble Deep Field with the Infrared Space Observatory .2. Source detection and photometry

DEFF Research Database (Denmark)

Goldschmidt, P.; Oliver, S.J.; Serjeant, S.B.G.

1997-01-01

We present positions and fluxes of point sources found in the Infrared Space Observatory (ISO) images of the Hubble Deep Field (HDF) at 6.7 and 15 mu m. We have constructed algorithmically selected 'complete' flux-limited samples of 19 sources in the 15-mu m image, and seven sources in the 6.7-mu m...

A MULTIWAVELENGTH STUDY OF TADPOLE GALAXIES IN THE HUBBLE ULTRA DEEP FIELD

International Nuclear Information System (INIS)

Straughn, Amber N.; Eufrasio, Rafael T.; Gardner, Jonathan P.; Voyer, Elysse N.; Mello, Duilia de; Soto, Emmaris; Petty, Sara; Kassin, Susan; Ravindranath, Swara

2015-01-01

Multiwavelength data are essential in order to provide a complete picture of galaxy evolution and to inform studies of galaxies’ morphological properties across cosmic time. Here we present the results of a multiwavelength investigation of the morphologies of “tadpole” galaxies at intermediate redshift (0.314 < z < 3.175) in the Hubble Ultra Deep Field. These galaxies were previously selected from deep Hubble Space Telescope (HST) F775W data based on their distinct asymmetric knot-plus-tail morphologies. Here we use deep Wide Field Camera 3 near-infrared imaging in addition to the HST optical data in order to study the rest-frame UV/optical morphologies of these galaxies across the redshift range 0.3 < z < 3.2. This study reveals that the majority of these galaxies do retain their general asymmetric morphology in the rest-frame optical over this redshift range, if not the distinct “tadpole” shape. The average stellar mass of tadpole galaxies is lower than that of field galaxies, with the effect being slightly greater at higher redshift within the errors. Estimated from spectral energy distribution fits, the average age of tadpole galaxies is younger than that of field galaxies in the lower-redshift bin, and the average metallicity is lower (whereas the specific star formation rate for tadpoles is roughly the same as field galaxies across the redshift range probed here). These average effects combined support the conclusion that this subset of galaxies is in an active phase of assembly, either late-stage merging or cold gas accretion causing localized clumpy star formation

A MULTIWAVELENGTH STUDY OF TADPOLE GALAXIES IN THE HUBBLE ULTRA DEEP FIELD

Energy Technology Data Exchange (ETDEWEB)

Straughn, Amber N.; Eufrasio, Rafael T.; Gardner, Jonathan P. [Astrophysics Science Division, Goddard Space Flight Center, Code 665, Greenbelt, MD 20771 (United States); Voyer, Elysse N. [Randstad at Google, 1129 San Antonio Road, Palo Alto, CA (United States); Mello, Duilia de; Soto, Emmaris [Department of Physics, The Catholic University of America, Washington, DC 20064 (United States); Petty, Sara [Department of Physics, Virginia Tech, Blacksburg, VA 24061 (United States); Kassin, Susan; Ravindranath, Swara [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States)

2015-12-01

Multiwavelength data are essential in order to provide a complete picture of galaxy evolution and to inform studies of galaxies’ morphological properties across cosmic time. Here we present the results of a multiwavelength investigation of the morphologies of “tadpole” galaxies at intermediate redshift (0.314 < z < 3.175) in the Hubble Ultra Deep Field. These galaxies were previously selected from deep Hubble Space Telescope (HST) F775W data based on their distinct asymmetric knot-plus-tail morphologies. Here we use deep Wide Field Camera 3 near-infrared imaging in addition to the HST optical data in order to study the rest-frame UV/optical morphologies of these galaxies across the redshift range 0.3 < z < 3.2. This study reveals that the majority of these galaxies do retain their general asymmetric morphology in the rest-frame optical over this redshift range, if not the distinct “tadpole” shape. The average stellar mass of tadpole galaxies is lower than that of field galaxies, with the effect being slightly greater at higher redshift within the errors. Estimated from spectral energy distribution fits, the average age of tadpole galaxies is younger than that of field galaxies in the lower-redshift bin, and the average metallicity is lower (whereas the specific star formation rate for tadpoles is roughly the same as field galaxies across the redshift range probed here). These average effects combined support the conclusion that this subset of galaxies is in an active phase of assembly, either late-stage merging or cold gas accretion causing localized clumpy star formation.

Planetary nebulae: 20 years of Hubble inquiry

Science.gov (United States)

Balick, Bruce

2012-08-01

The Hubble Space Telescope has served the critical roles of microscope and movie camera in the past 20 years of research on planetary nebulae (``PNe''). We have glimpsed the details of the evolving structures of neutral and ionized post-AGB objects, built ingenious heuristic models that mimic these structures, and constrained most of the relevant physical processes with careful observations and interpretation. We have searched for close physical binary stars with spatial resolution ~50 AU at 1 AU, located jets emerging from the nucleus at speeds up to 2000 km s-1 and matched newly discovered molecular and X-ray emission regions to physical substructures in order to better understand how stellar winds and ionizing radiation interact to form the lovely symmetries that are observed. Ultraviolet spectra of CNO in PNe help to uncover how stars process deep inside AGB stars with unstable nuclear burning zones. HST broadband imaging has been at the forefront of uncovering surprisingly complex wind morphologies produced at the tip of the AGB, and has led to an increasing realization of the potentially vital roles of close binary stars and emerging magnetic fields in shaping stellar winds.

THE 2012 HUBBLE ULTRA DEEP FIELD (UDF12): OBSERVATIONAL OVERVIEW

Energy Technology Data Exchange (ETDEWEB)

Koekemoer, Anton M. [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Ellis, Richard S.; Schenker, Matthew A. [Department of Astrophysics, California Institute of Technology, MS 249-17, Pasadena, CA 91125 (United States); McLure, Ross J.; Dunlop, James S.; Bowler, Rebecca A. A.; Rogers, Alexander B.; Curtis-Lake, Emma; Cirasuolo, Michele; Wild, V.; Targett, T. [Institute for Astronomy, University of Edinburgh, Royal Observatory, Edinburgh EH9 3HJ (United Kingdom); Robertson, Brant E.; Schneider, Evan; Stark, Daniel P. [Department of Astronomy and Steward Observatory, University of Arizona, Tucson, AZ 85721 (United States); Ono, Yoshiaki; Ouchi, Masami [Institute for Cosmic Ray Research, University of Tokyo, Kashiwa City, Chiba 277-8582 (Japan); Charlot, Stephane [UPMC-CNRS, UMR7095, Institut d' Astrophysique de Paris, F-75014, Paris (France); Furlanetto, Steven R. [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States)

2013-11-01

We present the 2012 Hubble Ultra Deep Field campaign (UDF12), a large 128 orbit Cycle 19 Hubble Space Telescope program aimed at extending previous Wide Field Camera 3 (WFC3)/IR observations of the UDF by quadrupling the exposure time in the F105W filter, imaging in an additional F140W filter, and extending the F160W exposure time by 50%, as well as adding an extremely deep parallel field with the Advanced Camera for Surveys (ACS) in the F814W filter with a total exposure time of 128 orbits. The principal scientific goal of this project is to determine whether galaxies reionized the universe; our observations are designed to provide a robust determination of the star formation density at z ∼> 8, improve measurements of the ultraviolet continuum slope at z ∼ 7-8, facilitate the construction of new samples of z ∼ 9-10 candidates, and enable the detection of sources up to z ∼ 12. For this project we committed to combining these and other WFC3/IR imaging observations of the UDF area into a single homogeneous dataset to provide the deepest near-infrared observations of the sky. In this paper we present the observational overview of the project and describe the procedures used in reducing the data as well as the final products that were produced. We present the details of several special procedures that we implemented to correct calibration issues in the data for both the WFC3/IR observations of the main UDF field and our deep 128 orbit ACS/WFC F814W parallel field image, including treatment for persistence, correction for time-variable sky backgrounds, and astrometric alignment to an accuracy of a few milliarcseconds. We release the full, combined mosaics comprising a single, unified set of mosaics of the UDF, providing the deepest near-infrared blank-field view of the universe currently achievable, reaching magnitudes as deep as AB ∼ 30 mag in the near-infrared, and yielding a legacy dataset on this field.

THE 2012 HUBBLE ULTRA DEEP FIELD (UDF12): OBSERVATIONAL OVERVIEW

International Nuclear Information System (INIS)

Koekemoer, Anton M.; Ellis, Richard S.; Schenker, Matthew A.; McLure, Ross J.; Dunlop, James S.; Bowler, Rebecca A. A.; Rogers, Alexander B.; Curtis-Lake, Emma; Cirasuolo, Michele; Wild, V.; Targett, T.; Robertson, Brant E.; Schneider, Evan; Stark, Daniel P.; Ono, Yoshiaki; Ouchi, Masami; Charlot, Stephane; Furlanetto, Steven R.

2013-01-01

We present the 2012 Hubble Ultra Deep Field campaign (UDF12), a large 128 orbit Cycle 19 Hubble Space Telescope program aimed at extending previous Wide Field Camera 3 (WFC3)/IR observations of the UDF by quadrupling the exposure time in the F105W filter, imaging in an additional F140W filter, and extending the F160W exposure time by 50%, as well as adding an extremely deep parallel field with the Advanced Camera for Surveys (ACS) in the F814W filter with a total exposure time of 128 orbits. The principal scientific goal of this project is to determine whether galaxies reionized the universe; our observations are designed to provide a robust determination of the star formation density at z ∼> 8, improve measurements of the ultraviolet continuum slope at z ∼ 7-8, facilitate the construction of new samples of z ∼ 9-10 candidates, and enable the detection of sources up to z ∼ 12. For this project we committed to combining these and other WFC3/IR imaging observations of the UDF area into a single homogeneous dataset to provide the deepest near-infrared observations of the sky. In this paper we present the observational overview of the project and describe the procedures used in reducing the data as well as the final products that were produced. We present the details of several special procedures that we implemented to correct calibration issues in the data for both the WFC3/IR observations of the main UDF field and our deep 128 orbit ACS/WFC F814W parallel field image, including treatment for persistence, correction for time-variable sky backgrounds, and astrometric alignment to an accuracy of a few milliarcseconds. We release the full, combined mosaics comprising a single, unified set of mosaics of the UDF, providing the deepest near-infrared blank-field view of the universe currently achievable, reaching magnitudes as deep as AB ∼ 30 mag in the near-infrared, and yielding a legacy dataset on this field

A natural language query system for Hubble Space Telescope proposal selection

Science.gov (United States)

Hornick, Thomas; Cohen, William; Miller, Glenn

1987-01-01

The proposal selection process for the Hubble Space Telescope is assisted by a robust and easy to use query program (TACOS). The system parses an English subset language sentence regardless of the order of the keyword phases, allowing the user a greater flexibility than a standard command query language. Capabilities for macro and procedure definition are also integrated. The system was designed for flexibility in both use and maintenance. In addition, TACOS can be applied to any knowledge domain that can be expressed in terms of a single reaction. The system was implemented mostly in Common LISP. The TACOS design is described in detail, with particular attention given to the implementation methods of sentence processing.

Statistics of the Hubble diagram. I. Determination of q2 and luminosity evolution with application to quasars

International Nuclear Information System (INIS)

Turner, E.L.

1979-01-01

A rank statistic version of the magnitude-redshift q 0 test is developed. It may be applied to the Hubble diagram of objects with an arbitrary and unknown luminosity function; in particular, the objects need not be ''standard candles.'' Only the single restriction that the objects' luminosity function does not vary in functional form is placed on the sources' intrinsic properties. Density and/or luminosity evolution are taken into account. Corrections for sample selection biases are incorporated into the analysis. Tests for the presence of luminosity evolution are given. Methods for determining either q 0 or the luminosity evolution when the other is a priori known are described.Application of these techniques to a sample of 119 3CR and 4C quasars leads to the following results: The radio Hubble diagram is consistent with all values of q 0 , suggesting that the quasar radio luminosity function is a featureless power law. The optical Hubble diagram indicates one of these possibilities: (1) the value of q 0 is in the range 2--32, probably near 5; (2) the value of q 0 is more reasonable and there is strong optical luminosity evolution [e.g., if q/sub o/ approx. = 0.05, then the characteristic optical luminosity scales like approx. (1 + Z)/sup 7/3/]; or (3) the data are a low-probability (< or =0.05) statistical fluctuation. The second interpretation is probably the most sensible one.Generalizations of the rank statistic magnitude-redshift test are suggested for application to a variety of extragalactic and stellar problems. Specific examples of applications to unorthodox cosmologies are given. Even for the unfavorable (very broad luminosity function) case of the optical quasar data, the rank statistic analysis is sensitive to relative variations in the distance-modulus-redshift relation as small as approx.0.4 mag for 1/2 < or = Z < or = 2

Multi-Epoch Hubble Space Telescope Observations of IZw18 : Characterization of Variable Stars at Ultra-Low Metallicities

NARCIS (Netherlands)

Fiorentino, G.; Ramos, R. Contreras; Clementini, G.; Marconi, M.; Musella, I.; Aloisi, A.; Annibali, F.; Saha, A.; Tosi, M.; van der Marel, R. P.

2010-01-01

Variable stars have been identified for the first time in the very metal-poor blue compact dwarf galaxy IZw18, using deep multi-band (F606W, F814W) time-series photometry obtained with the Advanced Camera for Surveys on board the Hubble Space Telescope. We detected 34 candidate variable stars in the

Tianma 65-m telescope detection of new OH maser features towards the water fountain source IRAS 18286-0959

Science.gov (United States)

Chen, Xi; Shen, Zhi-Qiang; Li, Xiao-Qiong; Yang, Kai; Nakashima, Jun-ichi; Wu, Ya-Jun; Zhao, Rong-Bin; Li, Juan; Wang, Jun-Zhi; Jiang, Dong-Rong; Wang, Jin-Qing; Li, Bin; Zhong, Wei-Ye; Yung, Bosco H. K.

2017-07-01

We report the results of the OH maser observation towards the water fountain source IRAS 18286-0959 using the newly built Shanghai Tianma 65-m Radio Telescope. We observed the three OH ground state transition lines at frequencies of 1612, 1665 and 1667 MHz. Comparing with the spectra of previous observations, we find new maser spectral components at velocity channels largely shifted from the systemic velocity: the velocity offsets of the newly found components lie in the range 20-40 km s-1 with respect to the systemic velocity. Besides maser variability, another possible interpretation for the newly detected maser features is that part of the molecular gas in the circumstellar envelope is accelerated. The acceleration is probably caused by the passage of a high-velocity molecular jet, which has been detected in previous Very Long Baseline Interferometry observations in the H2O maser line.

Study of deuterated water in the low-mass protostar IRAS16293-2422

Science.gov (United States)

Coutens, A.; Vastel, C.; Caux, E.; Ceccarelli, C.; Herschel Chess Team

2011-05-01

Observations of deuterated water are an important complement for studies of H2O, since they give strong constraints on the formation processes: grain surfaces versus gas-phase chemistry through energetic process as shocks. The CHESS (Chemical HErschel Surveys of Star forming regions) Key Program has allowed to detect a lot of transitions of HDO (8) and H2O (16) as well as its isotopes H_218O and H_217O towards the low-mass protostar IRAS16293-2422 thanks to the unbiaised spectral survey carried out with the HIFI instrument on board the Herschel Space Observatory. Complementary data of HDO from the ground-based telescopes IRAM and JCMT are also available, allowing a precise determination of the abundance of deuterated water through the protostar envelope. In order to reproduce the observed line profiles, we have performed a modeling of HDO from the hot corino through the envelope using the physical structure of the protostar (Crimier et al. 2010) and the spherical Monte Carlo radiative transfer code RATRAN, which takes also into account radiative pumping by continuum emission from dust. We have used new HDO collision rates with H_2, recently computed by Wiesenfeld, Scribano and Faure (2011, PCCP). The same method has been applied to model H_2O and its isotopes H_218O and H_217O. We will present the results of this analysis and discuss the determined abundances.

Panchromatic Hubble Andromeda Treasury. IX. A photometric survey of planetary nebulae in M31

Energy Technology Data Exchange (ETDEWEB)

Veyette, Mark J.; Williams, Benjamin F.; Dalcanton, Julianne J.; Balick, Bruce; Fouesneau, Morgan [Department of Astronomy, University of Washington, P.O. Box 351580, Seattle, WA 98195 (United States); Caldwell, Nelson [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Girardi, Léo [Osservatorio Astronomico di Padova—INAF, Vicolo dell' Osservatorio 5, I-35122 Padova (Italy); Gordon, Karl D.; Kalirai, Jason [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Rosenfield, Philip [Department of Physics and Astronomy G. Galilei, University of Padova, Vicolo dell' Osservatorio 3, I-35122 Padova (Italy); Seth, Anil C., E-mail: mveyette@uw.edu [Department of Physics and Astronomy, University of Utah, Salt Lake City, UT 84112 (United States)

2014-09-10

We search the Hubble Space Telescope (HST) Advanced Camera for Surveys and Wide Field Camera 3 broadband imaging data from the Panchromatic Hubble Andromeda Treasury (PHAT) survey to identify detections of cataloged planetary nebulae (PNs). Of the 711 PNs currently in the literature within the PHAT footprint, we find 467 detected in the broadband. For these 467, we are able to refine their astrometric accuracy from ∼0.''3 to 0.''05. Using the resolution of the HST, we are able to show that 152 objects currently in the catalogs are definitively not PNs, and we show that 32 objects thought to be extended in ground-based images are actually point-like and therefore good PN candidates. We also find one PN candidate that is marginally resolved. If this is a PN, it is up to 0.7 pc in diameter. With our new photometric data, we develop a method of measuring the level of excitation in individual PNs by comparing broadband and narrowband imaging and describe the effects of excitation on a PN's photometric signature. Using the photometric properties of the known PNs in the PHAT catalogs, we search for more PNs, but do not find any new candidates, suggesting that ground-based emission-line surveys are complete in the PHAT footprint to F475W ≅ 24.

Spatially resolved chemistry in nearby galaxies. III. Dense molecular gas in the inner disk of the LIRG IRAS 04296+2923

Energy Technology Data Exchange (ETDEWEB)

Meier, David S. [Department of Physics, New Mexico Institute of Mining and Technology, 801 Leroy Place, Socorro, NM 87801 (United States); Turner, Jean L. [Department of Physics and Astronomy, UCLA, Los Angeles, CA 90095-1547 (United States); Beck, Sara C., E-mail: dmeier@nmt.edu, E-mail: turner@astro.ucla.edu, E-mail: sara@wise.tau.ac.il [Department of Physics and Astronomy, Tel Aviv University, 69978 Ramat Aviv (Israel)

2014-11-10

We present a survey of 3 mm molecular lines in IRAS 04296+2923, one of the brightest known molecular-line emitting galaxies, and one of the closest luminous infrared galaxies (LIRGs). Data are from the Owens Valley and CARMA millimeter interferometers. Species detected at ≲ 4'' resolution include C{sup 18}O, HCN, HCO{sup +}, HNC, CN, CH{sub 3}OH, and, tentatively, HNCO. Along with existing CO, {sup 13}CO, and radio continuum data, these lines constrain the chemical properties of the inner disk. Dense molecular gas in the nucleus fuels a star formation rate ≳10 M {sub ☉} yr{sup –1} and is traced by lines of HCN, HCO{sup +}, HNC, and CN. A correlation between HCN and star formation rate is observed on sub-kiloparsec scales, consistent with global relations. Toward the nucleus, CN abundances are similar to those of HCN, indicating emission comes from a collection (∼40-50) of moderate visual extinction, photon-dominated-region clouds. The CO isotopic line ratios are unusual: CO(1-0)/{sup 13}CO(1-0) and CO(1-0)/C{sup 18}O(1-0) line ratios are large toward the starburst, as is commonly observed in LIRGs, but farther out in the disk these ratios are remarkably low (≲ 3). {sup 13}CO/C{sup 18}O abundance ratios are lower than in Galactic clouds, possibly because the C{sup 18}O is enriched by massive star ejecta from the starburst. {sup 13}CO is underabundant relative to CO. Extended emission from CH{sub 3}OH indicates that dynamical shocks pervade both the nucleus and the inner disk. The unusual CO isotopologue ratios, the CO/HCN intensity ratio versus L {sub IR}, the HCN/CN abundance ratio, and the gas consumption time versus inflow rate all indicate that the starburst in IRAS 04296+2923 is in an early stage of development.

TOWARD UNDERSTANDING THE B[e] PHENOMENON. III. PROPERTIES OF THE OPTICAL COUNTERPART OF IRAS 00470+6429

International Nuclear Information System (INIS)

Miroshnichenko, A. S.; Chentsov, E. L.; Klochkova, V. G.; Zharikov, S. V.; Grankin, K. N.; Kusakin, A. V.; Gandet, T. L.; Klingenberg, G.; Kildahl, S.; Rudy, R. J.; Lynch, D. K.; Venturini, C. C.; Mazuk, S.; Puetter, R. C.; Perry, R. B.; Carciofi, A. C.; Bjorkman, K. S.; Gray, R. O.; Bernabei, S.; Polcaro, V. F.

2009-01-01

FS CMa type stars are a group of Galactic objects with the B[e] phenomenon. They exhibit strong emission-line spectra and infrared excesses, which are most likely due to recently formed circumstellar dust. The group content and identification criteria were described in the first two papers of the series. In this paper we report our spectroscopic and photometric observations of the optical counterpart of IRAS 00470+6429 obtained in 2003-2008. The optical spectrum is dominated by emission lines, most of which have P Cyg type profiles. We detected significant brightness variations, which may include a regular component, and variable spectral line profiles in both shape and position. The presence of a weak Li I 6708 A line in the spectrum suggests that the object is most likely a binary system with a B2-B3 spectral-type primary companion of a luminosity log L/L sun = 3.9 ± 0.3 and a late-type secondary companion. We estimate a distance toward the object to be 2.0 ± 0.3 kpc from the Sun.

Galaxy evolution and large-scale structure in the far-infrared. II. The IRAS faint source survey

International Nuclear Information System (INIS)

Lonsdale, C.J.; Hacking, P.B.; Conrow, T.P.; Rowan-Robinson, M.

1990-01-01

The new IRAS Faint Source Survey data base is used to confirm the conclusion of Hacking et al. (1987) that the 60 micron source counts fainter than about 0.5 Jy lie in excess of predictions based on nonevolving model populations. The existence of an anisotropy between the northern and southern Galactic caps discovered by Rowan-Robinson et al. (1986) and Needham and Rowan-Robinson (1988) is confirmed, and it is found to extend below their sensitivity limit to about 0.3 Jy in 60 micron flux density. The count anisotropy at f(60) greater than 0.3 can be interpreted reasonably as due to the Local Supercluster; however, no one structure accounting for the fainter anisotropy can be easily identified in either optical or far-IR two-dimensional sky distributions. The far-IR galaxy sky distributions are considerably smoother than distributions from the published optical galaxy catalogs. It is likely that structure of the large size discussed here have been discriminated against in earlier studies due to insufficient volume sampling. 105 refs

A HUBBLE DIAGRAM FROM TYPE II SUPERNOVAE BASED SOLELY ON PHOTOMETRY: THE PHOTOMETRIC COLOR METHOD

International Nuclear Information System (INIS)

De Jaeger, T.; González-Gaitán, S.; Galbany, L.; Hamuy, M.; Gutiérrez, C. P.; Kuncarayakti, H.; Anderson, J. P.; Phillips, M. M.; Campillay, A.; Castellón, S.; Hsiao, E. Y.; Morrell, N.; Stritzinger, M. D.; Contreras, C.; Bolt, L.; Burns, C. R.; Folatelli, G.; Freedman, W. L.; Krisciunas, K.; Krzeminski, W.

2015-01-01

We present a Hubble diagram of SNe II using corrected magnitudes derived only from photometry, with no input of spectral information. We use a data set from the Carnegie Supernovae Project I for which optical and near-infrared light curves were obtained. The apparent magnitude is corrected by two observables, one corresponding to the slope of the plateau in the V band and the second a color term. We obtain a dispersion of 0.44 mag using a combination of the (V − i) color and the r band and we are able to reduce the dispersion to 0.39 mag using our golden sample. A comparison of our photometric color method (PCM) with the standardized candle method (SCM) is also performed. The dispersion obtained for the SCM (which uses both photometric and spectroscopic information) is 0.29 mag, which compares with 0.43 mag from the PCM for the same SN sample. The construction of a photometric Hubble diagram is of high importance in the coming era of large photometric wide-field surveys, which will increase the detection rate of supernovae by orders of magnitude. Such numbers will prohibit spectroscopic follow up in the vast majority of cases, and hence methods must be deployed which can proceed using solely photometric data

A HUBBLE DIAGRAM FROM TYPE II SUPERNOVAE BASED SOLELY ON PHOTOMETRY: THE PHOTOMETRIC COLOR METHOD

Energy Technology Data Exchange (ETDEWEB)

De Jaeger, T.; González-Gaitán, S.; Galbany, L.; Hamuy, M.; Gutiérrez, C. P.; Kuncarayakti, H. [Millennium Institute of Astrophysics, Santiago (Chile); Anderson, J. P. [European Southern Observatory, Alonso de Córdova 3107, Casilla 19, Santiago (Chile); Phillips, M. M.; Campillay, A.; Castellón, S.; Hsiao, E. Y.; Morrell, N. [Las Campanas Observatory, Carnegie Observatories, Casilla 601, La Serena (Chile); Stritzinger, M. D.; Contreras, C. [Department of Physics and Astronomy, Aarhus University, Ny Munkegade 120, DK-8000 Aarhus C (Denmark); Bolt, L. [Argelander Institut für Astronomie, Universität Bonn, Auf dem Hgel 71, D-53111 Bonn (Germany); Burns, C. R. [Observatories of the Carnegie Institution for Science, Pasadena, CA 91101 (United States); Folatelli, G. [Instituto de Astrofísica de La Plata, CONICET, Paseo del Bosque S/N, B1900FWA, La Plata (Argentina); Freedman, W. L. [Department of Astronomy and Astrophysics, University of Chicago, Chicago, IL 60637 (United States); Krisciunas, K. [George P. and Cynthia Woods Mitchell Institute for Fundamental Physics and Astronomy, Department of Physics and Astronomy, Texas A and M University, College Station, TX 77843 (United States); Krzeminski, W., E-mail: dthomas@das.uchile.cl [N. Copernicus Astronomical Center, ul. Bartycka 18, 00-716 Warszawa (Poland); and others

2015-12-20

We present a Hubble diagram of SNe II using corrected magnitudes derived only from photometry, with no input of spectral information. We use a data set from the Carnegie Supernovae Project I for which optical and near-infrared light curves were obtained. The apparent magnitude is corrected by two observables, one corresponding to the slope of the plateau in the V band and the second a color term. We obtain a dispersion of 0.44 mag using a combination of the (V − i) color and the r band and we are able to reduce the dispersion to 0.39 mag using our golden sample. A comparison of our photometric color method (PCM) with the standardized candle method (SCM) is also performed. The dispersion obtained for the SCM (which uses both photometric and spectroscopic information) is 0.29 mag, which compares with 0.43 mag from the PCM for the same SN sample. The construction of a photometric Hubble diagram is of high importance in the coming era of large photometric wide-field surveys, which will increase the detection rate of supernovae by orders of magnitude. Such numbers will prohibit spectroscopic follow up in the vast majority of cases, and hence methods must be deployed which can proceed using solely photometric data.

HUBBLE TARANTULA TREASURY PROJECT. V. THE STAR CLUSTER HODGE 301: THE OLD FACE OF 30 DORADUS

Energy Technology Data Exchange (ETDEWEB)

Cignoni, M. [Department of Physics—University of Pisa, Largo Pontecorvo, 3 Pisa, I-56127 (Italy); Sabbi, E.; Marel, R. P. van der; Aloisi, A.; Panagia, N. [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD, 21218 (United States); Lennon, D. J. [European Space Astronomy Centre, Apdo. de Correo 78, E-28691 Villanueva de la Canada, Madrid (Spain); Tosi, M. [INAF-Osservatorio Astronomico di Bologna, Via Ranzani 1, I-40127 Bologna (Italy); Grebel, E. K. [Astronomisches Rechen-Institut, Zentrum für Astronomie der Universität Heidelberg, Mönchhofstr. 12-14, D-69120 Heidelberg (Germany); Gallagher, J. S. III [Department of Astronomy, University of Wisconsin-Madison, WI 53706 (United States); Marchi, G. de [European Space Research and Technology Centre, Keplerlaan 1, NL-2200 AG Noordwijk (Netherlands); Gouliermis, D. A. [Zentrum für Astronomie der Universität Heidelberg, Institut für Theoretische Astrophysik, Albert-Ueberle-Str. 2, D-69120 Heidelberg (Germany); Larsen, S. [Department of Astrophysics, Radboud University, P.O. Box 9010, NL-6500 GL Nijmegen (Netherlands); Smith, L. J., E-mail: michele.cignoni@unipi.it [European Space Agency and Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States)

2016-12-20

Based on color–magnitude diagrams (CMDs) from the Hubble Space Telescope  Hubble Tarantula Treasury Project (HTTP) survey, we present the star formation history of Hodge 301, the oldest star cluster in the Tarantula Nebula. The HTTP photometry extends faint enough to reach, for the first time, the cluster pre-main sequence (PMS) turn-on, where the PMS joins the main sequence. Using the location of this feature, along with synthetic CMDs generated with the latest PARSEC models, we find that Hodge 301 is older than previously thought, with an age between 26.5 and 31.5 Myr. From this age, we also estimate that between 38 and 61 Type II supernovae exploded in the region. The same age is derived from the main sequence turn-off, whereas the age derived from the post-main sequence stars is younger and between 20 and 25 Myr. Other relevant parameters are a total stellar mass of ≈8800 ± 800  M {sub ⊙} and average reddening E ( B − V ) ≈ 0.22–0.24 mag, with a differential reddening δE ( B − V ) ≈ 0.04 mag.

Probing Very Bright End of Galaxy Luminosity Function at z >~ 7 Using Hubble Space Telescope Pure Parallel Observations

Science.gov (United States)

Yan, Haojing; Yan, Lin; Zamojski, Michel A.; Windhorst, Rogier A.; McCarthy, Patrick J.; Fan, Xiaohui; Röttgering, Huub J. A.; Koekemoer, Anton M.; Robertson, Brant E.; Davé, Romeel; Cai, Zheng

2011-02-01

We report the first results from the Hubble Infrared Pure Parallel Imaging Extragalactic Survey, which utilizes the pure parallel orbits of the Hubble Space Telescope to do deep imaging along a large number of random sightlines. To date, our analysis includes 26 widely separated fields observed by the Wide Field Camera 3, which amounts to 122.8 arcmin2 in total area. We have found three bright Y 098-dropouts, which are candidate galaxies at z >~ 7.4. One of these objects shows an indication of peculiar variability and its nature is uncertain. The other two objects are among the brightest candidate galaxies at these redshifts known to date (L>2L*). Such very luminous objects could be the progenitors of the high-mass Lyman break galaxies observed at lower redshifts (up to z ~ 5). While our sample is still limited in size, it is much less subject to the uncertainty caused by "cosmic variance" than other samples because it is derived using fields along many random sightlines. We find that the existence of the brightest candidate at z ≈ 7.4 is not well explained by the current luminosity function (LF) estimates at z ≈ 8. However, its inferred surface density could be explained by the prediction from the LFs at z ≈ 7 if it belongs to the high-redshift tail of the galaxy population at z ≈ 7. Based on observations made with the NASA/ESA Hubble Space Telescope, obtained at the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS 5-26555. These observations are associated with programs 11700 and 11702.

Galaxy Size Evolution at High Redshift and Surface Brightness Selection Effects: Constraints from the Hubble Ultra Deep Field

Science.gov (United States)

Bouwens, R. J.; Illingworth, G. D.; Blakeslee, J. P.; Broadhurst, T. J.; Franx, M.

2004-08-01

We use the exceptional depth of the Ultra Deep Field (UDF) and UDF-parallel Advanced Camera for Surveys fields to study the sizes of high-redshift (z~2-6) galaxies and address long-standing questions about possible biases in the cosmic star formation rate due to surface brightness dimming. Contrasting B-, V-, and i-dropout samples culled from the deeper data with those obtained from the shallower Great Observatories Origins Deep Survey fields, we demonstrate that the shallower data are essentially complete at bright magnitudes to z~0.4", >~3 kpc) low surface brightness galaxies are rare. A simple comparison of the half-light radii of the Hubble Deep Field-North + Hubble Deep Field-South U-dropouts with B-, V-, and i-dropouts from the UDF shows that the sizes follow a (1+z)-1.05+/-0.21 scaling toward high redshift. A more rigorous measurement compares different scalings of our U-dropout sample with the mean profiles for a set of intermediate-magnitude (26.0dropouts from the UDF. The best fit is found with a (1+z)-0.94+0.19-0.25 size scaling (for fixed luminosity). This result is then verified by repeating this experiment with different size measures, low-redshift samples, and magnitude ranges. Very similar scalings are found for all comparisons. A robust measurement of size evolution is thereby demonstrated for galaxies from z~6 to 2.5 using data from the UDF. Based on observations made with the NASA/ESA Hubble Space Telescope, which is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS5-26555.

Infrared observations of giant elliptical galaxies: (V-K) colors and the infrared Hubble diagram

International Nuclear Information System (INIS)

Grasdalen, G.L.

1980-01-01

The (V-K) colors of giant elliptical galaxies as a function of redshift are discussed. Present data are consistent with mild color evolution at z approximately 0.45. An infrared Hubble (redshift-magnitude) diagram is given. Cosmological models with q 0 =0 and no luminosity evolution are clearly excluded by the present data. A wide variety of models including those with q 0 =0 are permissible if luminosity evolution is included. Instrumental and programmatic implications of these results are summarized. (Auth.)

The Hubble IR cutoff in holographic ellipsoidal cosmologies

Energy Technology Data Exchange (ETDEWEB)

Cataldo, Mauricio [Universidad del Bio-Bio, Departamento de Fisica, Facultad de Ciencias, Concepcion (Chile); Cruz, Norman [Grupo de Cosmologia y Gravitacion-UBB, Concepcion (Chile)

2018-01-15

It is well known that for spatially flat FRW cosmologies, the holographic dark energy disfavors the Hubble parameter as a candidate for the IR cutoff. For overcoming this problem, we explore the use of this cutoff in holographic ellipsoidal cosmological models, and derive the general ellipsoidal metric induced by a such holographic energy density. Despite the drawbacks that this cutoff presents in homogeneous and isotropic universes, based on this general metric, we developed a suitable ellipsoidal holographic cosmological model, filled with a dark matter and a dark energy components. At late time stages, the cosmic evolution is dominated by a holographic anisotropic dark energy with barotropic equations of state. The cosmologies expand in all directions in accelerated manner. Since the ellipsoidal cosmologies given here are not asymptotically FRW, the deviation from homogeneity and isotropy of the universe on large cosmological scales remains constant during all cosmic evolution. This feature allows the studied holographic ellipsoidal cosmologies to be ruled by an equation of state ω = p/ρ, whose range belongs to quintessence or even phantom matter. (orig.)

A high-significance measurement of correlation between unresolved IRAS sources and optically-selected galaxy clusters

Energy Technology Data Exchange (ETDEWEB)

Hincks, Adam D.; Hajian, Amir [Canadian Institute for Theoretical Astrophysics, University of Toronto, Toronto, ON M5S 3H8 (Canada); Addison, Graeme E., E-mail: hincks@cita.utoronto.ca, E-mail: ahajian@cita.utoronto.ca, E-mail: gaddison@phas.ubc.ca [Department of Physics and Astronomy, University of British Columbia, Vancouver, BC V6T 1Z4 (Canada)

2013-05-01

We cross-correlate the 100 μm Improved Reprocessing of the IRAS Survey (IRIS) map and galaxy clusters at 0.1 < z < 0.3 in the maxBCG catalogue taken from the Sloan Digital Sky Survey, measuring an angular cross-power spectrum over multipole moments 150 < l < 3000 at a total significance of over 40σ. The cross-spectrum, which arises from the spatial correlation between unresolved dusty galaxies that make up the cosmic infrared background (CIB) in the IRIS map and the galaxy clusters, is well-fit by a single power law with an index of −1.28±0.12, similar to the clustering of unresolved galaxies from cross-correlating far-infrared and submillimetre maps at longer wavelengths. Using a recent, phenomenological model for the spectral and clustering properties of the IRIS galaxies, we constrain the large-scale bias of the maxBCG clusters to be 2.6±1.4, consistent with existing analyses of the real-space cluster correlation function. The success of our method suggests that future CIB-optical cross-correlations using Planck and Herschel data will significantly improve our understanding of the clustering and redshift distribution of the faint CIB sources.

X-RAY AND RADIO OBSERVATIONS OF THE MASSIVE STAR-FORMING REGION IRAS 20126+4104

Energy Technology Data Exchange (ETDEWEB)

Montes, V. A.; Hofner, P.; Anderson, C.; Rosero, V. [Physics Department, New Mexico Tech, 801 Leroy Place, Socorro, NM 87801 (United States)

2015-08-15

We present results from Chandra ACIS-I and Karl G. Jansky Very Large Array 6 cm continuum observations of the IRAS 20126+4104 massive star-forming region. We detect 150 X-ray sources within the 17′ × 17′ ACIS-I field, and a total of 13 radio sources within the 9.′2 primary beam at 4.9 GHz. Among these observtions are the first 6 cm detections of the central sources reported by Hofner et al., namely, I20N1, I20S, and I20var. A new variable radio source is also reported. Searching the 2MASS archive, we identified 88 near-infrared (NIR) counterparts to the X-ray sources. Only four of the X-ray sources had 6 cm counterparts. Based on an NIR color–color analysis and on the Besançon simulation of Galactic stellar populations, we estimate that approximately 80 X-ray sources are associated with this massive star-forming region. We detect an increasing surface density of X-ray sources toward the massive protostar and infer the presence of a cluster of at least 43 young stellar objects within a distance of 1.2 pc from the massive protostar.

Large-q correlations from a Hubble-type pion source

International Nuclear Information System (INIS)

Barghouty, A.F.; Miller, J.; Frankel, K.A.

1993-01-01

In two-pion correlation measurements from relativistic nuclear collisions, the correlation function, C 2 (q), appears to exhibit an oscillatory structure at large (q ≥100 MeV/c) relative momentum. If real, this structure may have consequences for the determination of the space-time extent of the pion source. A qualitatively similar feature is seen in cellular automaton simulations of a Lorentz gas. It has been argued phenomenologically that the q-dependent oscillations can arise from an interplay between successive scattering probabilities and density variations of an exploding pion source. To further illustrate this interplay we consider a Hubble-type free expansion model for the source in which the density is time-folded from an initial Gaussian. This allows the source expansion to enter as a dynamical variable in the source density p[r(t); t] and thus C 2 , along with any signature of the interplay between scattering and source density

Hartmann wavefront sensing of the corrective optics for the Hubble Space Telescope

Science.gov (United States)

Davila, Pam S.; Eichhorn, William L.; Wilson, Mark E.

1994-06-01

There is no doubt that astronomy with the `new, improved' Hubble Space Telescope will significantly advance our knowledge and understanding of the universe for years to come. The Corrective Optics Space Telescope Axial Replacement (COSTAR) was designed to restore the image quality to nearly diffraction limited performance for three of the first generation instruments; the faint object camera, the faint object spectrograph, and the Goddard high resolution spectrograph. Spectacular images have been obtained from the faint object camera after the installation of the corrective optics during the first servicing mission in December of 1993. About 85% of the light in the central core of the corrected image is contained within a circle with a diameter of 0.2 arcsec. This is a vast improvement over the previous 15 to 17% encircled energies obtained before COSTAR. Clearly COSTAR is a success. One reason for the overwhelming success of COSTAR was the ambitious and comprehensive test program conducted by various groups throughout the program. For optical testing of COSTAR on the ground, engineers at Ball Aerospace designed and built the refractive Hubble simulator to produce known amounts of spherical aberration and astigmatism at specific points in the field of view. The design goal for this refractive aberrated simulator (RAS) was to match the aberrations of the Hubble Space Telescope to within (lambda) /20 rms over the field at a wavelength of 632.8 nm. When the COSTAR optics were combined with the RAS optics, the corrected COSTAR output images were produced. These COSTAR images were recorded with a high resolution 1024 by 1024 array CCD camera, the Ball image analyzer (BIA). The image quality criteria used for assessment of COSTAR performance was encircled energy in the COSTAR focal plane. This test with the BIA was very important because it was a direct measurement of the point spread function. But it was difficult with this test to say anything quantitative about the

Masses of the Planetary Nebula Central Stars in the Galactic Globular Cluster System from HST Imaging and Spectroscopy

Energy Technology Data Exchange (ETDEWEB)

Jacoby, George H. [Lowell Observatory, Flagstaff, AZ 86001 (United States); Marco, Orsola De [Department of Physics and Astronomy, Macquarie University, Sydney, NSW 2109 (Australia); Davies, James [Space Telescope Science Institute, Baltimore MD 21218 (United States); Lotarevich, I. [American Museum of Natural History, New York, NY (United States); Bond, Howard E. [Department of Astronomy and Astrophysics, Pennsylvania State University, University Park, PA 16802 (United States); Harrington, J. Patrick [University of Maryland, College Park, MD (United States); Lanz, Thierry, E-mail: gjacoby@lowell.edu, E-mail: orsola.demarco@mq.edu.au, E-mail: jdavies@stsci.edu, E-mail: heb11@psu.edu, E-mail: jph@astro.umd.edu, E-mail: thierry.lanz@oca.eu [Laboratoire Lagrange, Université Côte d’Azur, Observatoire de la Côte d’Azur, CNRS, F-06304 Nice (France)

2017-02-10

The globular cluster (GC) system of our Galaxy contains four planetary nebulae (PNe): K 648 (or Ps 1) in M15, IRAS 18333-2357 in M22, JaFu 1 in Pal 6, and JaFu 2 in NGC 6441. Because single-star evolution at the low stellar mass of present-epoch GCs was considered incapable of producing visible PNe, their origin presented a puzzle. We imaged the PN JaFu 1 with the Hubble Space Telescope (HST) to obtain photometry of its central star (CS) and high-resolution morphological information. We imaged IRAS 18333-2357 with better depth and resolution, and we analyzed its archival HST spectra to constrain its CS temperature and luminosity. All PNe in Galactic GCs now have quality HST data, allowing us to improve CS mass estimates. We find reasonably consistent masses between 0.53 and 0.58 M {sub ⊙} for all four objects, though estimates vary when adopting different stellar evolutionary calculations. The CS mass of IRAS 18333-2357, though, depends strongly on its temperature, which remains elusive due to reddening uncertainties. For all four objects, we consider their CS and nebula masses, their morphologies, and other incongruities to assess the likelihood that these objects formed from binary stars. Although generally limited by uncertainties (∼0.02 M {sub ⊙}) in post-AGB tracks and core mass versus luminosity relations, the high-mass CS in K 648 indicates a binary origin. The CS of JaFu 1 exhibits compact, bright [O iii] and H α emission, like EGB 6, suggesting a binary companion or disk. Evidence is weaker for a binary origin of JaFu 2.

Surface Brightness Profiles of Composite Images of Compact Galaxies at Z approximately equal 4-6 in the Hubble Ultra Deep Field

National Research Council Canada - National Science Library

Hathi, N. P; Jansen, R. A; Windhorst, R. A; Cohen, S. H; Keel, W. C; Corbin, M. R; Ryan, Jr, R. E

2007-01-01

The Hubble Ultra Deep Field (HUDF) contains a significant number of B-, V-, and iota'-band dropout objects, many of which were recently confirmed to be young star-forming galaxies at Z approximately equal 4-6...

A Type II Supernova Hubble diagram from the CSP-I, SDSS-II, and SNLS surveys

OpenAIRE

de Jaeger, T.; González-Gaitán, S.; Hamuy, M.; Galbany, L.; Anderson, J. P.; Phillips, M. M.; Stritzinger, M. D.; Carlberg, R. G.; Sullivan, M.; Gutiérrez, C. P.; Hook, I. M.; Howell, D. Andrew; Hsiao, E. Y.; Kuncarayakti, H.; Ruhlmann-Kleider, V.

2016-01-01

The coming era of large photometric wide-field surveys will increase the detection rate of supernovae by orders of magnitude. Such numbers will restrict spectroscopic follow-up in the vast majority of cases, and hence new methods based solely on photometric data must be developed. Here, we construct a complete Hubble diagram of Type II supernovae (SNe II) combining data from three different samples: the Carnegie Supernova Project-I, the Sloan Digital Sky Survey II SN, and th...

Probing the z > 6 Universe with the First Hubble Frontier Fields Cluster A2744

Science.gov (United States)

Atek, Hakim; Richard, Johan; Kneib, Jean-Paul; Clement, Benjamin; Egami, Eiichi; Ebeling, Harald; Jauzac, Mathilde; Jullo, Eric; Laporte, Nicolas; Limousin, Marceau; Natarajan, Priyamvada

2014-05-01

The Hubble Frontier Fields program combines the capabilities of the Hubble Space Telescope (HST) with the gravitational lensing of massive galaxy clusters to probe the distant universe to an unprecedented depth. Here, we present the results of the first combined HST and Spitzer observations of the cluster A-2744. We combine the full near-infrared data with ancillary optical images to search for gravitationally lensed high-redshift (z >~ 6) galaxies. We report the detection of 15 I 814 dropout candidates at z ~ 6-7 and one Y 105 dropout at z ~ 8 in a total survey area of 1.43 arcmin2 in the source plane. The predictions of our lens model also allow us to identify five multiply imaged systems lying at redshifts between z ~ 6 and z ~ 8. Thanks to constraints from the mass distribution in the cluster, we were able to estimate the effective survey volume corrected for completeness and magnification effects. This was in turn used to estimate the rest-frame ultraviolet luminosity function (LF) at z ~ 6-8. Our LF results are generally in agreement with the most recent blank field estimates, confirming the feasibility of surveys through lensing clusters. Although based on a shallower observations than what will be achieved in the final data set including the full Advanced Camera for Survey observations, the LF presented here goes down to M UV ~-18.5, corresponding to 0.2L sstarf at z ~ 7 with one identified object at M UV ~-15 thanks to the highly magnified survey areas. This early study forecasts the power of using massive galaxy clusters as cosmic telescopes and its complementarity to blank fields. Based on observations made with the NASA/ESA Hubble Space Telescope (HST), which is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS 5-26555. These observations are associated with programs 13495 and 11689. Based in part on observations made with the Spitzer Space Telescope, which is operated by the Jet Propulsion Laboratory

The Carnegie-Chicago Hubble Program: Discovery of the Most Distant Ultra-faint Dwarf Galaxy in the Local Universe

Science.gov (United States)

Lee, Myung Gyoon; Jang, In Sung; Beaton, Rachael; Seibert, Mark; Bono, Giuseppe; Madore, Barry

2017-02-01

Ultra-faint dwarf galaxies (UFDs) are the faintest known galaxies, and due to their incredibly low surface brightness, it is difficult to find them beyond the Local Group. We report a serendipitous discovery of a UFD, Fornax UFD1, in the outskirts of NGC 1316, a giant galaxy in the Fornax cluster. The new galaxy is located at a projected radius of 55 kpc in the south-east of NGC 1316. This UFD is found as a small group of resolved stars in the Hubble Space Telescope images of a halo field of NGC 1316, obtained as part of the Carnegie-Chicago Hubble Program. Resolved stars in this galaxy are consistent with being mostly metal-poor red giant branch (RGB) stars. Applying the tip of the RGB method to the mean magnitude of the two brightest RGB stars, we estimate the distance to this galaxy, 19.0 ± 1.3 Mpc. Fornax UFD1 is probably a member of the Fornax cluster. The color-magnitude diagram of these stars is matched by a 12 Gyr isochrone with low metallicity ([Fe/H] ≈ -2.4). Total magnitude and effective radius of Fornax UFD1 are MV ≈ -7.6 ± 0.2 mag and reff = 146 ± 9 pc, which are similar to those of Virgo UFD1 that was discovered recently in the intracluster field of Virgo by Jang & Lee. Fornax UFD1 is the most distant known UFD that is confirmed by resolved stars. This indicates that UFDs are ubiquitous and that more UFDs remain to be discovered in the Fornax cluster. Based on observations made with the NASA/ESA Hubble Space Telescope, obtained at the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS 5-26555. These observations are associated with programs #10505 and #13691.

Discovery of z ~ 8 Galaxies in the Hubble Ultra Deep Field from Ultra-Deep WFC3/IR Observations

Science.gov (United States)

Bouwens, R. J.; Illingworth, G. D.; Oesch, P. A.; Stiavelli, M.; van Dokkum, P.; Trenti, M.; Magee, D.; Labbé, I.; Franx, M.; Carollo, C. M.; Gonzalez, V.

2010-02-01

We utilize the newly acquired, ultra-deep WFC3/IR observations over the Hubble Ultra Deep Field (HUDF) to search for star-forming galaxies at z ~ 8-8.5, only 600 million years from recombination, using a Y 105-dropout selection. The new 4.7 arcmin2 WFC3/IR observations reach to ~28.8 AB mag (5σ) in the Y 105 J 125 H 160 bands. These remarkable data reach ~1.5 AB mag deeper than the previous data over the HUDF, and now are an excellent match to the HUDF optical ACS data. For our search criteria, we use a two-color Lyman break selection technique to identify z ~ 8-8.5Y 105-dropouts. We find five likely z ~ 8-8.5 candidates. The sources have H 160-band magnitudes of ~28.3 AB mag and very blue UV-continuum slopes, with a median estimated β of lsim-2.5 (where f λ vprop λβ). This suggests that z ~ 8 galaxies are not only essentially dust free but also may have very young ages or low metallicities. The observed number of Y 105-dropout candidates is smaller than the 20 ± 6 sources expected assuming no evolution from z ~ 6, but is consistent with the five expected extrapolating the Bouwens et al. luminosity function (LF) results to z ~ 8. These results provide evidence that the evolution in the LF seen from z ~ 7 to z ~ 3 continues to z ~ 8. The remarkable improvement in the sensitivity of WFC3/IR has enabled Hubble Space Telescope to cross a threshold, revealing star-forming galaxies at z~ 8-9. Based on observations made with the NASA/ESA Hubble Space Telescope, which is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS 5-26555. These observations are associated with programs 11563, 9797.

Stellar bars and the spatial distribution of infrared luminosity

International Nuclear Information System (INIS)

Devereux, N.

1987-01-01

Ground-based 10 micron observations of the central region of over 100 infrared luminous galaxies are presented. A first order estimate of the spatial distribution of infrared emission in galaxies is obtained through a combination of ground-based and Infrared Astronomy Satellite (IRAS) data. The galaxies are nearby and primarily noninteracting, permitting an unbiased investigation of correlations with Hubble type. Approximately 40% of the early-type barred galaxies in this sample are associated with enhanced luminosity in the central (approximately 1 kpc diameter) region. The underlying luminosity source is attributed to both Seyfert and star formation activity. Late-type spirals are different in that the spatial distribution of infrared emission and the infrared luminoisty are not strongly dependent on barred morphology

The Speed of Light and the Hubble parameter: The Mass-Boom Effect

International Nuclear Information System (INIS)

Alfonso-Faus, Antonio

2008-01-01

We prove here that Newton's universal gravitation and momentum conservation laws together reproduce Weinberg's relation. It is shown that the Hubble parameter H must be built in this relation, or equivalently the age of the Universe t. Using a wave-to-particle interaction technique we then prove that the speed of light c decreases with cosmological time, and that c is proportional to the Hubble parameter H. We see the expansion of the Universe as a local effect due to the LAB value of the speed of light co taken as constant. We present a generalized red shift law and find a predicted acceleration for photons that agrees well with the result from Pioneer 10/11 anomalous acceleration. We finally present a cosmological model coherent with the above results that we call the Mass-Boom. It has a linear increase of mass m with time as a result of the speed of light c linear decrease with time, and the conservation of momentum mc. We obtain the baryonic mass parameter equal to the curvature parameter, Ω m Ω k , so that the model is of the type of the Einstein static, closed, finite, spherical, unlimited, with zero cosmological constant. This model is the cosmological view as seen by photons, neutrinos, tachyons etc. in contrast with the local view, the LAB reference. Neither dark matter nor dark energy is required by this model. With an initial constant speed of light during a short time we get inflation (an exponential expansion). This converts, during the inflation time, the Planck's fluctuation length of 10 -33 cm to the present size of the Universe (about 10 28 cm, constant from then on). Thereafter the Mass-Boom takes care to bring the initial values of the Universe (about 10 15 gr) to the value at the present time of about 10 55 gr

Constraints on inflation revisited. An analysis including the latest local measurement of the Hubble constant

Energy Technology Data Exchange (ETDEWEB)

Guo, Rui-Yun [Northeastern University, Department of Physics, College of Sciences, Shenyang (China); Zhang, Xin [Northeastern University, Department of Physics, College of Sciences, Shenyang (China); Peking University, Center for High Energy Physics, Beijing (China)

2017-12-15

We revisit the constraints on inflation models by using the current cosmological observations involving the latest local measurement of the Hubble constant (H{sub 0} = 73.00 ± 1.75 km s{sup -1} Mpc{sup -1}). We constrain the primordial power spectra of both scalar and tensor perturbations with the observational data including the Planck 2015 CMB full data, the BICEP2 and Keck Array CMB B-mode data, the BAO data, and the direct measurement of H{sub 0}. In order to relieve the tension between the local determination of the Hubble constant and the other astrophysical observations, we consider the additional parameter N{sub eff} in the cosmological model. We find that, for the ΛCDM+r+N{sub eff} model, the scale invariance is only excluded at the 3.3σ level, and ΔN{sub eff} > 0 is favored at the 1.6σ level. Comparing the obtained 1σ and 2σ contours of (n{sub s},r) with the theoretical predictions of selected inflation models, we find that both the convex and the concave potentials are favored at 2σ level, the natural inflation model is excluded at more than 2σ level, the Starobinsky R{sup 2} inflation model is only favored at around 2σ level, and the spontaneously broken SUSY inflation model is now the most favored model. (orig.)

Low-redshift effects of local structure on the Hubble parameter in presence of a cosmological constant

Energy Technology Data Exchange (ETDEWEB)

Romano, Antonio Enea [University of Crete, Department of Physics and CCTP, Heraklion (Greece); Kyoto University, Yukawa Institute for Theoretical Physics, Kyoto (Japan); Universidad de Antioquia, Instituto de Fisica, Medellin (Colombia); Vallejo, Sergio Andres [Kyoto University, Yukawa Institute for Theoretical Physics, Kyoto (Japan); Universidad de Antioquia, Instituto de Fisica, Medellin (Colombia)

2016-04-15

In order to estimate the effects of a local structure on the Hubble parameter we calculate the low-redshift expansion for H(z) and (δH)/(H) for an observer at the center of a spherically symmetric matter distribution in the presence of a cosmological constant. We then test the accuracy of the formulas comparing them with fully relativistic non-perturbative numerical calculations for different cases for the density profile. The low-redshift expansion we obtain gives results more precise than perturbation theory since it is based on the use of an exact solution of Einstein's field equations. For larger density contrasts the low-redshift formulas accuracy improves respect to the perturbation theory accuracy because the latter is based on the assumption of a small density contrast, while the former does not rely on such an assumption. The formulas can be used to take into account the effects on the Hubble expansion parameter due to the monopole component of the local structure. If the H(z) observations will show deviations from the ΛCDM prediction compatible with the formulas we have derived, this could be considered an independent evidence of the existence of a local inhomogeneity, and the formulas could be used to determine the characteristics of this local structure. (orig.)

SPECTROSCOPIC CONFIRMATION OF FAINT LYMAN BREAK GALAXIES NEAR REDSHIFT FIVE IN THE HUBBLE ULTRA DEEP FIELD

International Nuclear Information System (INIS)

Rhoads, James E.; Malhotra, Sangeeta; Cohen, Seth; Grogin, Norman; Hathi, Nimish; Ryan, Russell; Straughn, Amber; Windhorst, Rogier A.; Pirzkal, Norbert; Xu Chun; Koekemoer, Anton; Panagia, Nino; Dickinson, Mark; Ferreras, Ignacio; Gronwall, Caryl; Kuemmel, Martin; Walsh, Jeremy; Meurer, Gerhardt; Pasquali, Anna; Yan, H.-J.

2009-01-01

We present the faintest spectroscopically confirmed sample of z ∼ 5 Lyman break galaxies (LBGs) to date. The sample is based on slitless grism spectra of the Hubble Ultra Deep Field region from the Grism ACS Program for Extragalactic Science (GRAPES) and Probing Evolution and Reionization Spectroscopically (PEARS) projects, using the G800L grism on the Hubble Space Telescope Advanced Camera for Surveys. We report here confirmations of 39 galaxies, preselected as candidate LBGs using photometric selection criteria. We compare a 'traditional' V-dropout selection, based on the work of Giavalisco et al., to a more liberal one (with V - i > 0.9), and find that the traditional criteria are about 64% complete and 81% reliable. We also study the Lyα emission properties of our sample. We find that Lyα emission is detected in ∼1/4 of the sample, and that the liberal V-dropout color selection includes ∼55% of previously published line-selected Lyα sources. Finally, we examine our stacked two-dimensional spectra. We demonstrate that strong, spatially extended (∼1'') Lyα emission is not a generic property of these LBGs, but that a modest extension of the Lyα photosphere (compared to the starlight) may be present in those galaxies with prominent Lyα emission.

Hot water in the Inner 100 AU of the Class 0 protostar NGC 1333 IRAS2A

DEFF Research Database (Denmark)

Visser, Ruud; Jørgensen, Jes Kristian; Kristensen, Lars E.

2013-01-01

-303 lines of H_2^{16}O and H_2^{18}O (1097 GHz, E u/k = 249 K) in the low-mass Class 0 protostar NGC 1333 IRAS2A. A spherical radiative transfer model with a power-law density profile is unable to reproduce both the HIFI data and existing interferometric data on the H_2^{18}O 313-220 line (203 GHz, E u....../k = 204 K). Instead, the HIFI spectra likely show optically thick emission from a hot core with a radius of about 100 AU. The mass of the hot core is estimated from the C18O J = 9-8 and 10-9 lines. We derive a lower limit to the hot water abundance of 2 × 10-5, consistent with the theoretical predictions...... of ~10-4. The revised HDO/H2O abundance ratio is 1 × 10-3, an order of magnitude lower than previously estimated. Herschel is an ESA space observatory with science instruments provided by European-led Principal Investigator consortia and with important participation from NASA....

Light dark photon and fermionic dark radiation for the Hubble constant and the structure formation

OpenAIRE

Ko, P.; Tang, Yong

2018-01-01

Motivated by the tensions in the Hubble constant $H_0$ and the structure growth $\\sigma_8$ between $Planck$ results and other low redshift measurements, we discuss some cosmological effects of a dark sector model in which dark matter (DM) interacts with fermionic dark radiation (DR) through a light gauge boson (dark photon). Such kind of models are very generic in particle physics with a dark sector with dark gauge symmetries. The effective number of neutrinos is increased by $\\delta N_{eff} ...

A knowledge-based system for monitoring the electrical power system of the Hubble Space Telescope

Science.gov (United States)

Eddy, Pat

1987-01-01

The design and the prototype for the expert system for the Hubble Space Telescope's electrical power system are discussed. This prototype demonstrated the capability to use real time data from a 32k telemetry stream and to perform operational health and safety status monitoring, detect trends such as battery degradation, and detect anomalies such as solar array failures. This prototype, along with the pointing control system and data management system expert systems, forms the initial Telemetry Analysis for Lockheed Operated Spacecraft (TALOS) capability.

Hubble Space Telescope Snapshot Survey for Resolved Companions of Galactic Cepheids

Science.gov (United States)

Evans, Nancy Remage; Bond, Howard E.; Schaefer, Gail H.; Mason, Brian D.; Tingle, Evan; Karovska, Margarita; Pillitteri, Ignazio

2016-05-01

We have conducted an imaging survey with the Hubble Space Telescope Wide Field Camera 3 (WFC3) of 70 Galactic Cepheids, typically within 1 kpc, with the aim of finding resolved physical companions. The WFC3 field typically covers the 0.1 pc area where companions are expected. In this paper, we identify 39 Cepheids having candidate companions, based on their positions in color-magnitude diagrams, and having separations ⩾ 5'' from the Cepheids. We use follow-up observations of 14 of these candidates with XMM-Newton, and of one of them with ROSAT, to separate X-ray-active young stars (probable physical companions) from field stars (chance alignments). Our preliminary estimate, based on the optical and X-ray observations, is that only 3% of the Cepheids in the sample have wide companions. Our survey easily detects resolved main-sequence companions as faint as spectral type K. Thus the fact that the two most probable companions (those of FF Aql and RV Sco) are earlier than type K is not simply a function of the detection limit. We find no physical companions having separations larger than 4000 au in the X-ray survey. Two Cepheids are exceptions in that they do have young companions at significantly larger separations (δ Cep and S Nor), but both belong to a cluster or a loose association, so our working model is that they are not gravitationally bound binary members, but rather cluster/association members. All of these properties provide constraints on both star formation and subsequent dynamical evolution. The low frequency of true physical companions at separations > 5'' is confirmed by examination of the subset of the nearest Cepheids and also the density of the fields. Based on observations with the NASA/ESA Hubble Space Telescope obtained at the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS5-26555.

Hubble Space Telescope Observations of cD Galaxies and Their Globular Cluster Systems

Science.gov (United States)

Jordán, Andrés; Côté, Patrick; West, Michael J.; Marzke, Ronald O.; Minniti, Dante; Rejkuba, Marina

2004-01-01

We have used WFPC2 on the Hubble Space Telescope (HST) to obtain F450W and F814W images of four cD galaxies (NGC 541 in Abell 194, NGC 2832 in Abell 779, NGC 4839 in Abell 1656, and NGC 7768 in Abell 2666) in the range 5400 km s-1cluster (GC) systems reveals no anomalies in terms of specific frequencies, metallicity gradients, average metallicities, or the metallicity offset between the globular clusters and the host galaxy. We show that the latter offset appears roughly constant at Δ[Fe/H]~0.8 dex for early-type galaxies spanning a luminosity range of roughly 4 orders of magnitude. We combine the globular cluster metallicity distributions with an empirical technique described in a series of earlier papers to investigate the form of the protogalactic mass spectrum in these cD galaxies. We find that the observed GC metallicity distributions are consistent with those expected if cD galaxies form through the cannibalism of numerous galaxies and protogalactic fragments that formed their stars and globular clusters before capture and disruption. However, the properties of their GC systems suggest that dynamical friction is not the primary mechanism by which these galaxies are assembled. We argue that cD's instead form rapidly, via hierarchical merging, prior to cluster virialization. Based on observations with the NASA/ESA Hubble Space Telescope obtained at the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS 5-26555 Based in part on observations obtained at the European Southern Observatory, for VLT program 68.D-0130(A).

Hubble Space Telescope, Faint Object Camera

Science.gov (United States)

1981-01-01

This drawing illustrates Hubble Space Telescope's (HST's), Faint Object Camera (FOC). The FOC reflects light down one of two optical pathways. The light enters a detector after passing through filters or through devices that can block out light from bright objects. Light from bright objects is blocked out to enable the FOC to see background images. The detector intensifies the image, then records it much like a television camera. For faint objects, images can be built up over long exposure times. The total image is translated into digital data, transmitted to Earth, and then reconstructed. The purpose of the HST, the most complex and sensitive optical telescope ever made, is to study the cosmos from a low-Earth orbit. By placing the telescope in space, astronomers are able to collect data that is free of the Earth's atmosphere. The HST detects objects 25 times fainter than the dimmest objects seen from Earth and provides astronomers with an observable universe 250 times larger than visible from ground-based telescopes, perhaps as far away as 14 billion light-years. The HST views galaxies, stars, planets, comets, possibly other solar systems, and even unusual phenomena such as quasars, with 10 times the clarity of ground-based telescopes. The HST was deployed from the Space Shuttle Discovery (STS-31 mission) into Earth orbit in April 1990. The Marshall Space Flight Center had responsibility for design, development, and construction of the HST. The Perkin-Elmer Corporation, in Danbury, Cornecticut, developed the optical system and guidance sensors.

CANDELS : THE COSMIC ASSEMBLY NEAR-INFRARED DEEP EXTRAGALACTIC LEGACY SURVEY-THE HUBBLE SPACE TELESCOPE OBSERVATIONS, IMAGING DATA PRODUCTS, AND MOSAICS

NARCIS (Netherlands)

Koekemoer, Anton M.; Faber, S. M.; Ferguson, Henry C.; Grogin, Norman A.; Kocevski, Dale D.; Koo, David C.; Lai, Kamson; Lotz, Jennifer M.; Lucas, Ray A.; McGrath, Elizabeth J.; Ogaz, Sara; Rajan, Abhijith; Riess, Adam G.; Rodney, Steve A.; Strolger, Louis; Casertano, Stefano; Castellano, Marco; Dahlen, Tomas; Dickinson, Mark; Dolch, Timothy; Fontana, Adriano; Giavalisco, Mauro; Grazian, Andrea; Guo, Yicheng; Hathi, Nimish P.; Huang, Kuang-Han; van der Wel, Arjen; Yan, Hao-Jing; Acquaviva, Viviana; Alexander, David M.; Almaini, Omar; Ashby, Matthew L. N.; Barden, Marco; Bell, Eric F.; Bournaud, Frederic; Brown, Thomas M.; Caputi, Karina I.; Cassata, Paolo; Challis, Peter J.; Chary, Ranga-Ram; Cheung, Edmond; Cirasuolo, Michele; Conselice, Christopher J.; Cooray, Asantha Roshan; Croton, Darren J.; Daddi, Emanuele; Dave, Romeel; de Mello, Duilia F.; de Ravel, Loic; Dekel, Avishai; Donley, Jennifer L.; Dunlop, James S.; Dutton, Aaron A.; Elbaz, David; Fazio, Giovanni G.; Filippenko, Alexei V.; Finkelstein, Steven L.; Frazer, Chris; Gardner, Jonathan P.; Garnavich, Peter M.; Gawiser, Eric; Gruetzbauch, Ruth; Hartley, Will G.; Haeussler, Boris; Herrington, Jessica; Hopkins, Philip F.; Huang, Jia-Sheng; Jha, Saurabh W.; Johnson, Andrew; Kartaltepe, Jeyhan S.; Khostovan, Ali A.; Kirshner, Robert P.; Lani, Caterina; Lee, Kyoung-Soo; Li, Weidong; Madau, Piero; McCarthy, Patrick J.; McIntosh, Daniel H.; McLure, Ross J.; McPartland, Conor; Mobasher, Bahram; Moreira, Heidi; Mortlock, Alice; Moustakas, Leonidas A.; Mozena, Mark; Nandra, Kirpal; Newman, Jeffrey A.; Nielsen, Jennifer L.; Niemi, Sami; Noeske, Kai G.; Papovich, Casey J.; Pentericci, Laura; Pope, Alexandra; Primack, Joel R.; Ravindranath, Swara; Reddy, Naveen A.; Renzini, Alvio; Rix, Hans-Walter; Robaina, Aday R.; Rosario, David J.; Rosati, Piero; Salimbeni, Sara; Scarlata, Claudia; Siana, Brian; Simard, Luc; Smidt, Joseph; Snyder, Diana; Somerville, Rachel S.; Spinrad, Hyron; Straughn, Amber N.; Telford, Olivia; Teplitz, Harry I.; Trump, Jonathan R.; Vargas, Carlos; Villforth, Carolin; Wagner, Cory R.; Wandro, Pat; Wechsler, Risa H.; Weiner, Benjamin J.; Wiklind, Tommy; Wild, Vivienne; Wilson, Grant; Wuyts, Stijn; Yun, Min S.

2011-01-01

This paper describes the Hubble Space Telescope imaging data products and data reduction procedures for the Cosmic Assembly Near-infrared Deep Extragalactic Legacy Survey (CANDELS). This survey is designed to document the evolution of galaxies and black holes at z approximate to 1.5-8, and to study

A 2.4% DETERMINATION OF THE LOCAL VALUE OF THE HUBBLE CONSTANT

Energy Technology Data Exchange (ETDEWEB)

Riess, Adam G.; Scolnic, Dan; Jones, David O. [Department of Physics and Astronomy, Johns Hopkins University, Baltimore, MD (United States); Macri, Lucas M.; Hoffmann, Samantha L.; Yuan, Wenlong; Brown, Peter J. [George P. and Cynthia Woods Mitchell Institute for Fundamental Physics and Astronomy, Department of Physics and Astronomy, Texas A and M University, College Station, TX (United States); Casertano, Stefano [Space Telescope Science Institute, Baltimore, MD (United States); Filippenko, Alexei V.; Tucker, Brad E. [Department of Astronomy, University of California, Berkeley, CA (United States); Reid, Mark J.; Challis, Peter [Harvard-Smithsonian Center for Astrophysics, Cambridge, MA (United States); Silverman, Jeffrey M. [Department of Astronomy, University of Texas, Austin, TX (United States); Chornock, Ryan [Astrophysical Institute, Department of Physics and Astronomy, Ohio University, Athens, OH (United States); Foley, Ryan J., E-mail: ariess@stsci.edu [Department of Physics, University of Illinois at Urbana-Champaign, Urbana, IL (United States)

2016-07-20

We use the Wide Field Camera 3 (WFC3) on the Hubble Space Telescope (HST) to reduce the uncertainty in the local value of the Hubble constant from 3.3% to 2.4%. The bulk of this improvement comes from new near-infrared (NIR) observations of Cepheid variables in 11 host galaxies of recent type Ia supernovae (SNe Ia), more than doubling the sample of reliable SNe Ia having a Cepheid-calibrated distance to a total of 19; these in turn leverage the magnitude-redshift relation based on ∼300 SNe Ia at z < 0.15. All 19 hosts as well as the megamaser system NGC 4258 have been observed with WFC3 in the optical and NIR, thus nullifying cross-instrument zeropoint errors in the relative distance estimates from Cepheids. Other noteworthy improvements include a 33% reduction in the systematic uncertainty in the maser distance to NGC 4258, a larger sample of Cepheids in the Large Magellanic Cloud (LMC), a more robust distance to the LMC based on late-type detached eclipsing binaries (DEBs), HST observations of Cepheids in M31, and new HST -based trigonometric parallaxes for Milky Way (MW) Cepheids. We consider four geometric distance calibrations of Cepheids: (i) megamasers in NGC 4258, (ii) 8 DEBs in the LMC, (iii) 15 MW Cepheids with parallaxes measured with HST /FGS, HST /WFC3 spatial scanning and/or Hipparcos , and (iv) 2 DEBs in M31. The Hubble constant from each is 72.25 ± 2.51, 72.04 ± 2.67, 76.18 ± 2.37, and 74.50 ± 3.27 km s{sup 1} Mpc{sup 1}, respectively. Our best estimate of H {sub 0} = 73.24 ± 1.74 km s{sup 1} Mpc{sup 1} combines the anchors NGC 4258, MW, and LMC, yielding a 2.4% determination (all quoted uncertainties include fully propagated statistical and systematic components). This value is 3.4 σ higher than 66.93 ± 0.62 km s{sup 1} Mpc{sup 1} predicted by ΛCDM with 3 neutrino flavors having a mass of 0.06 eV and the new Planck data, but the discrepancy reduces to 2.1 σ relative to the prediction of 69.3 ± 0.7 km s{sup 1} Mpc{sup 1} based on the

HFF-DeepSpace Photometric Catalogs of the 12 Hubble Frontier Fields, Clusters, and Parallels: Photometry, Photometric Redshifts, and Stellar Masses

Science.gov (United States)

Shipley, Heath V.; Lange-Vagle, Daniel; Marchesini, Danilo; Brammer, Gabriel B.; Ferrarese, Laura; Stefanon, Mauro; Kado-Fong, Erin; Whitaker, Katherine E.; Oesch, Pascal A.; Feinstein, Adina D.; Labbé, Ivo; Lundgren, Britt; Martis, Nicholas; Muzzin, Adam; Nedkova, Kalina; Skelton, Rosalind; van der Wel, Arjen

2018-03-01

We present Hubble multi-wavelength photometric catalogs, including (up to) 17 filters with the Advanced Camera for Surveys and Wide Field Camera 3 from the ultra-violet to near-infrared for the Hubble Frontier Fields and associated parallels. We have constructed homogeneous photometric catalogs for all six clusters and their parallels. To further expand these data catalogs, we have added ultra-deep K S -band imaging at 2.2 μm from the Very Large Telescope HAWK-I and Keck-I MOSFIRE instruments. We also add post-cryogenic Spitzer imaging at 3.6 and 4.5 μm with the Infrared Array Camera (IRAC), as well as archival IRAC 5.8 and 8.0 μm imaging when available. We introduce the public release of the multi-wavelength (0.2–8 μm) photometric catalogs, and we describe the unique steps applied for the construction of these catalogs. Particular emphasis is given to the source detection band, the contamination of light from the bright cluster galaxies (bCGs), and intra-cluster light (ICL). In addition to the photometric catalogs, we provide catalogs of photometric redshifts and stellar population properties. Furthermore, this includes all the images used in the construction of the catalogs, including the combined models of bCGs and ICL, the residual images, segmentation maps, and more. These catalogs are a robust data set of the Hubble Frontier Fields and will be an important aid in designing future surveys, as well as planning follow-up programs with current and future observatories to answer key questions remaining about first light, reionization, the assembly of galaxies, and many more topics, most notably by identifying high-redshift sources to target.

Recovery of gold from ammonia-thiosulfate media with amberlite IRA-410 ionic exchange resin; Recuperacion de oro desde un medio amoniaco-tiosulfato con resina de intercambio ionico Amberlite IRA-410

Energy Technology Data Exchange (ETDEWEB)

Navarro, P.; Vargas, C.; Reveco, V.; Orellana, J.

2006-07-01

The absorption and elution of gold in thiosulfate-ammonia media were studied at laboratory level using the Amberlite IRA-410 ionic exchange resin. Tests were carried out in a stirred reactor, maintaining constant temperature (25 degree centigree), with a volume of solution/mass of resin ratio of 833,3 ml/g and during 3 h. The variables tested were the following: pH (9-11), thio sufate concentration (0-0,5 M), ammonia concentration (0-0,5 M) and selectivity in the presence of cupric ion. The obtained results indicate that gold adsorption was quick; the presence of thiosulfate decreased strongly the adsorption; and the presence of ammonia did not affect the adsorption mostly. The copper was in a certain measure a competitor of the gold, but its biggest negative effect was that acted as catalyst of the oxidizing reaction of thiosulfate (S{sub 2}O{sub 3}''2-) to tetrathionate (S{sub 4}O{sub 6}''2), which can cause a partial elution of gold during the load stage. Also, the behavior of CLO-''-{sub 4}; SO{sub 3}''2- and CLO''- as effluents was studied in both gold and copper elution. These tests were also carried out in a stirred reactor, to constant temperature (25 degree centigree) with a volume of aqueous solution/mass of resin ratio of 200 ml/g and for 3 h. Results demonstrated that the copper was eluted more quickly that the gold in all the cases. (Author) 34 refs.

Water distribution in shocked regions of the NGC 1333-IRAS 4A protostellar outflow

Science.gov (United States)

Santangelo, G.; Nisini, B.; Codella, C.; Lorenzani, A.; Yıldız, U. A.; Antoniucci, S.; Bjerkeli, P.; Cabrit, S.; Giannini, T.; Kristensen, L. E.; Liseau, R.; Mottram, J. C.; Tafalla, M.; van Dishoeck, E. F.

2014-08-01

Context. Water is a key molecule in protostellar environments because its line emission is very sensitive to both the chemistry and the physical conditions of the gas. Observations of H2O line emission from low-mass protostars and their associated outflows performed with HIFI onboard the Herschel Space Observatory have highlighted the complexity of H2O line profiles, in which different kinematic components can be distinguished. Aims: The goal is to study the spatial distribution of H2O, in particular of the different kinematic components detected in H2O emission, at two bright shocked regions along IRAS 4A, one of the strongest H2O emitters among the Class 0 outflows. Methods: We obtained Herschel-PACS maps of the IRAS 4A outflow and HIFI observations of two shocked positions. The largest HIFI beam of 38'' at 557 GHz was mapped in several key water lines with different upper energy levels, to reveal possible spatial variations of the line profiles. A large velocity gradient (LVG) analysis was performed to determine the excitation conditions of the gas. Results: We detect four H2O lines and CO (16-15) at the two selected shocked positions. In addition, transitions from related outflow and envelope tracers are detected. Different gas components associated with the shock are identified in the H2O emission. In particular, at the head of the red lobe of the outflow, two distinct gas components with different excitation conditions are distinguished in the HIFI emission maps: a compact component, detected in the ground-state water lines, and a more extended one. Assuming that these two components correspond to two different temperature components observed in previous H2O and CO studies, the LVG analysis of the H2O emission suggests that the compact (about 3'', corresponding to about 700 AU) component is associated with a hot (T ~ 1000 K) gas with densities nH2 ~ (1-4) × 105 cm-3, whereas the extended (10''-17'', corresponding to 2400-4000 AU) one traces a warm (T ~ 300

The Evolution of the Observed Hubble Sequence over the past 6Gyr

Science.gov (United States)

Delgado-Serrano, R.; Hammer, F.; Yang, Y. B.; Puech, M.; Flores, H.; Rodrigues, M.

2011-10-01

During the past years we have confronted serious problems of methodology concerning the morphological and kinematic classification of distant galaxies. This has forced us to create a new simple and effective morphological classification methodology, in order to guarantee a morpho-kinematic correlation, make the reproducibility easier and restrict the classification subjectivity. Giving the characteristic of our morphological classification, we have thus been able to apply the same methodology, using equivalent observations, to representative samples of local and distant galaxies. It has allowed us to derive, for the first time, the distant Hubble sequence (~6 Gyr ago), and determine a morphological evolution of galaxies over the past 6 Gyr. Our results strongly suggest that more than half of the present-day spirals had peculiar morphologies, 6 Gyr ago.

Constraining the evolution of the Hubble Parameter using cosmic chronometer

Science.gov (United States)

Scarlata, Claudia; Dickinson, Hugh

2018-01-01

The Lambda-CDM model of Big Bang cosmology relies heavily on the assumption that two components - dark energy and dark matter - encompass 95% of the energy density of the Universe. Despite the dominant influence of these components, their nature is still entirely unknown.We present the initial results from a project that aims to provide new insights regarding the Dark Energy component. We do this by deriving independent constraints on the time-evolution of the Hubble parameter (H_0) using the “cosmic chronometer” method.By analyzing the HST NIR spectra from a large archival sample of passively evolving galaxies in distinct redshift bins between 1.3 and 2 we measure the typical stellar population ages (A) for the galaxies in each bin. The differential evolution of stellar population age with redshift (dA/dz) can be used to infer the corresponding evolution of H_0 which will provide important constraints on the nature of Dark Energy and its equation of state.

A TYPE Ia SUPERNOVA AT REDSHIFT 1.55 IN HUBBLE SPACE TELESCOPE INFRARED OBSERVATIONS FROM CANDELS

International Nuclear Information System (INIS)

Rodney, Steven A.; Riess, Adam G.; Jones, David O.; Dahlen, Tomas; Ferguson, Henry C.; Casertano, Stefano; Grogin, Norman A.; Strolger, Louis-Gregory; Hjorth, Jens; Frederiksen, Teddy F.; Weiner, Benjamin J.; Mobasher, Bahram; Challis, Peter; Kirshner, Robert P.; Faber, S. M.; Filippenko, Alexei V.; Garnavich, Peter; Hayden, Brian; Graur, Or; Jha, Saurabh W.

2012-01-01

We report the discovery of a Type Ia supernova (SN Ia) at redshift z = 1.55 with the infrared detector of the Wide Field Camera 3 (WFC3-IR) on the Hubble Space Telescope (HST). This object was discovered in CANDELS imaging data of the Hubble Ultra Deep Field and followed as part of the CANDELS+CLASH Supernova project, comprising the SN search components from those two HST multi-cycle treasury programs. This is the highest redshift SN Ia with direct spectroscopic evidence for classification. It is also the first SN Ia at z > 1 found and followed in the infrared, providing a full light curve in rest-frame optical bands. The classification and redshift are securely defined from a combination of multi-band and multi-epoch photometry of the SN, ground-based spectroscopy of the host galaxy, and WFC3-IR grism spectroscopy of both the SN and host. This object is the first of a projected sample at z > 1.5 that will be discovered by the CANDELS and CLASH programs. The full CANDELS+CLASH SN Ia sample will enable unique tests for evolutionary effects that could arise due to differences in SN Ia progenitor systems as a function of redshift. This high-z sample will also allow measurement of the SN Ia rate out to z ≈ 2, providing a complementary constraint on SN Ia progenitor models.

The white dwarf mass-radius relation with Gaia, Hubble and FUSE

Science.gov (United States)

Joyce, Simon R. G.; Barstow, Martin A.; Casewell, Sarah L.; Holberg, Jay B.; Bond, Howard E.

2018-04-01

White dwarfs are becoming useful tools for many areas of astronomy. They can be used as accurate chronometers over Gyr timescales. They are also clues to the history of star formation in our galaxy. Many of these studies require accurate estimates of the mass of the white dwarf. The theoretical mass-radius relation is often invoked to provide these mass estimates. While the theoretical mass-radius relation is well developed, observational tests of this relation show a much larger scatter in the results than expected. High precision observational tests to confirm this relation are required. Gaia is providing distance measurements which will remove one of the main source of uncertainty affecting most previous observations. We combine Gaia distances with spectra from the Hubble and FUSE satelites to make precise tests of the white dwarf mass-radius relation.

The Cardassian expansion revisited: constraints from updated Hubble parameter measurements and type Ia supernova data

Science.gov (United States)

Magaña, Juan; Amante, Mario H.; Garcia-Aspeitia, Miguel A.; Motta, V.

2018-05-01

Motivated by an updated compilation of observational Hubble data (OHD) that consist of 51 points in the redshift range of 0.07 Ia supernova (SN Ia) using the compressed and full joint-light-analysis (JLA) samples (Betoule et al.). We also perform a joint analysis using the combination OHD plus compressed JLA. Our results show that the OC and MPC models are in agreement with the standard cosmology and naturally introduce a cosmological-constant-like extra term in the canonical Friedmann equation with the capability of accelerating the Universe without dark energy.

New Target for an Old Method: Hubble Measures Globular Cluster Parallax

Science.gov (United States)

Hensley, Kerry

2018-05-01

Measuring precise distances to faraway objects has long been a challenge in astrophysics. Now, one of the earliest techniques used to measure the distance to astrophysical objects has been applied to a metal-poor globular cluster for the first time.A Classic TechniqueAn artists impression of the European Space Agencys Gaia spacecraft. Gaia is on track to map the positions and motions of a billion stars. [ESA]Distances to nearby stars are often measured using the parallax technique tracing the tiny apparent motion of a target star against the background of more distant stars as Earth orbits the Sun. This technique has come a long way since it was first used in the 1800s to measure the distance to stars a few tens of light-years away; with the advent of space observatories like Hipparcos and Gaia, parallax can now be used to map the positions of stars out to thousands of light-years.Precise distance measurements arent only important for setting the scale of the universe, however; they can also help us better understand stellar evolution over the course of cosmic history. Stellar evolution models are often anchored to a reference star cluster, the properties of which must be known precisely. These precise properties can be readily determined for young, nearby open clusters using parallax measurements. But stellar evolution models that anchor on themore-distant, ancient, metal-poor globular clusters have been hampered by theless-precise indirect methods used tomeasure distance to these faraway clusters until now.Top: An image of NGC 6397 overlaid with the area scanned by Hubble (dashed green) and the footprint of the camera (solid green). The blue ellipse represents the parallax motion of a star in the cluster, exaggerated by a factor of ten thousand. Bottom: An example scan from this field. [Adapted from Brown et al. 2018]New Measurement to an Old ClusterThomas Brown (Space Telescope Science Institute) and collaborators used the Hubble Space Telescope todetermine the

Spike: Artificial intelligence scheduling for Hubble space telescope

Science.gov (United States)

Johnston, Mark; Miller, Glenn; Sponsler, Jeff; Vick, Shon; Jackson, Robert

1990-01-01

Efficient utilization of spacecraft resources is essential, but the accompanying scheduling problems are often computationally intractable and are difficult to approximate because of the presence of numerous interacting constraints. Artificial intelligence techniques were applied to the scheduling of the NASA/ESA Hubble Space Telescope (HST). This presents a particularly challenging problem since a yearlong observing program can contain some tens of thousands of exposures which are subject to a large number of scientific, operational, spacecraft, and environmental constraints. New techniques were developed for machine reasoning about scheduling constraints and goals, especially in cases where uncertainty is an important scheduling consideration and where resolving conflicts among conflicting preferences is essential. These technique were utilized in a set of workstation based scheduling tools (Spike) for HST. Graphical displays of activities, constraints, and schedules are an important feature of the system. High level scheduling strategies using both rule based and neural network approaches were developed. While the specific constraints implemented are those most relevant to HST, the framework developed is far more general and could easily handle other kinds of scheduling problems. The concept and implementation of the Spike system are described along with some experiments in adapting Spike to other spacecraft scheduling domains.

ALMA Compact Array observations of the Fried Egg nebula: Evidence for large-scale asymmetric mass-loss from the yellow hypergiant IRAS 17163-3907.

Science.gov (United States)

Wallström, S H J; Lagadec, E; Muller, S; Black, J H; Cox, N L J; Galván-Madrid, R; Justtanont, K; Longmore, S; Olofsson, H; Oudmaijer, R D; Quintana-Lacaci, G; Szczerba, R; Vlemmings, W; van Winckel, H; Zijlstra, A

2017-01-10

Yellow hypergiants are rare and represent a fast evolutionary stage of massive evolved stars. That evolutionary phase is characterised by a very intense mass loss, the understanding of which is still very limited. Here we report ALMA Compact Array observations of a 50″-mosaic toward the Fried Egg nebula, around one of the few Galactic yellow hypergiants IRAS 17163-3907. The emission from the 12 CO J=2-1 line, H30 α recombination line, and continuum is imaged at a resolution of ~8″, revealing the morphology of the molecular environment around the star. The continuum emission is unresolved and peaks at the position of the star. The radio recombination line H30 α shows unresolved emission at the star, with an approximately gaussian spectrum centered on a velocity of 21±3 km s -1 with a width of 57±6 km s -1 . In contrast, the CO 2-1 emission is complex and decomposes into several components beyond the contamination from interstellar gas in the line of sight. The CO spectrum toward the star is a broad plateau, centered at the systemic velocity of +18 km s -1 and with an expansion velocity of 100±10 km s -1 . Assuming isotropic and constant mass-loss, we estimate a mass-loss rate of 8±1.5 ×10 -5 M ⊙ yr -1 . At a radius of 25″ from the star, we detect CO emission associated with the dust ring previously imaged by Herschel . The kinematics of this ring, however, is not consistent with an expanding shell, but show a velocity gradient of v sys ±20 km s -1 . In addition, we find a puzzling bright feature radially connecting the star to the CO ring, at a velocity of +40 km s -1 relative to the star. This spur feature may trace a unidirectional ejection event from the star. Our ACA observations reveal the complex morphology around IRAS 17163 and illustrate the breakthroughs that ALMA will bring to the field of massive stellar evolution.

HUBBLE CLICKS IMAGES OF IO SWEEPING ACROSS JUPITER

Science.gov (United States)

2002-01-01

While hunting for volcanic plumes on Io, NASA's Hubble Space Telescope captured these images of the volatile moon sweeping across the giant face of Jupiter. Only a few weeks before these dramatic images were taken, the orbiting telescope snapped a portrait of one of Io's volcanoes spewing sulfur dioxide 'snow.' These stunning images of the planetary duo are being released to commemorate the ninth anniversary of the Hubble telescope's launch on April 24, 1990. All of these images were taken with the Wide Field and Planetary Camera 2. The three overlapping snapshots show in crisp detail Io passing above Jupiter's turbulent clouds. The close-up picture of Io (bottom right) reveal a 120-mile-high (200-kilometer) plume of sulfur dioxide 'snow' emanating from Pillan, one of the moon's active volcanoes. 'Other observations have inferred sulfur dioxide 'snow' in Io's plumes, but this image offers direct observational evidence for sulfur dioxide 'snow' in an Io plume,' explains John R. Spencer of Lowell Observatory in Flagstaff, Ariz. A Trip Around Jupiter The three snapshots of the volcanic moon rounding Jupiter were taken over a 1.8-hour time span. Io is roughly the size of Earth's moon but 2,000 times farther away. In two of the images, Io appears to be skimming Jupiter's cloud tops, but it's actually 310,000 miles (500,000 kilometers) away. Io zips around Jupiter in 1.8 days, whereas the moon circles Earth every 28 days. The conspicuous black spot on Jupiter is Io's shadow and is about the size of the moon itself (2,262 miles or 3,640 kilometers across). This shadow sails across the face of Jupiter at 38,000 mph (17 kilometers per second). The smallest details visible on Io and Jupiter measure 93 miles (150 kilometers) across, or about the size of Connecticut. These images were further sharpened through image reconstruction techniques. The view is so crisp that one would have to stand on Io to see this much detail on Jupiter with the naked eye. The bright patches on Io

The Topology of Large-Scale Structure in the 1.2 Jy IRAS Redshift Survey

Science.gov (United States)

Protogeros, Zacharias A. M.; Weinberg, David H.

1997-11-01

We measure the topology (genus) of isodensity contour surfaces in volume-limited subsets of the 1.2 Jy IRAS redshift survey, for smoothing scales λ = 4, 7, and 12 h-1 Mpc. At 12 h-1 Mpc, the observed genus curve has a symmetric form similar to that predicted for a Gaussian random field. At the shorter smoothing lengths, the observed genus curve shows a modest shift in the direction of an isolated cluster or ``meatball'' topology. We use mock catalogs drawn from cosmological N-body simulations to investigate the systematic biases that affect topology measurements in samples of this size and to determine the full covariance matrix of the expected random errors. We incorporate the error correlations into our evaluations of theoretical models, obtaining both frequentist assessments of absolute goodness of fit and Bayesian assessments of models' relative likelihoods. We compare the observed topology of the 1.2 Jy survey to the predictions of dynamically evolved, unbiased, gravitational instability models that have Gaussian initial conditions. The model with an n = -1 power-law initial power spectrum achieves the best overall agreement with the data, though models with a low-density cold dark matter power spectrum and an n = 0 power-law spectrum are also consistent. The observed topology is inconsistent with an initially Gaussian model that has n = -2, and it is strongly inconsistent with a Voronoi foam model, which has a non-Gaussian, bubble topology.

Cosmological Parameters and Hyper-Parameters: The Hubble Constant from Boomerang and Maxima

Science.gov (United States)

Lahav, Ofer

Recently several studies have jointly analysed data from different cosmological probes with the motivation of estimating cosmological parameters. Here we generalise this procedure to allow freedom in the relative weights of various probes. This is done by including in the joint likelihood function a set of `Hyper-Parameters', which are dealt with using Bayesian considerations. The resulting algorithm, which assumes uniform priors on the log of the Hyper-Parameters, is very simple to implement. We illustrate the method by estimating the Hubble constant H0 from different sets of recent CMB experiments (including Saskatoon, Python V, MSAM1, TOCO, Boomerang and Maxima). The approach can be generalised for a combination of cosmic probes, and for other priors on the Hyper-Parameters. Reference: Lahav, Bridle, Hobson, Lasenby & Sodre, 2000, MNRAS, in press (astro-ph/9912105)

Hubble space telescope: The GO and GTO observing programs, version 3.0

Science.gov (United States)

Downes, Ron

1992-01-01

A portion of the observing time with the Hubble Space Telescope (HST) was awarded by NASA to scientists involved in the development of the HST and its instruments. These scientists are the Guaranteed Time Observers (GTO's). Observing time was also awarded to General Observers (GO's) on the basis of the proposal reviews in 1989 and 1991. The majority of the 1989 programs have been completed during 'Cycle 1', while the 1991 programs will be completed during 'Cycle 2', nominally a 12-month period beginning July 1992. This document presents abstracts of these GO and GTO programs, and detailed listings of the specific targets and exposures contained in them. These programs and exposures are protected by NASA policy, as detailed in the HST Call for Proposals (CP), and are not to be duplicated by new programs.

Fast digital 4πβ-4πγ coincidence counting with offline analysis at IRA.

Science.gov (United States)

Teresa Durán, M; Nedjadi, Youcef; Juget, Frédéric; Bochud, François; Bailat, Claude

2018-04-01

IRA recently launched a project to digitize all the data acquisition systems it uses for primary radionuclide standardizations. It is well-known that the digital approach presents numerous advantages over the traditional analog electronics such as information losslessness, scalability, online and/or offline data processing, and it is also a solution to the growing difficulties to repair or renew ageing modules. As a first step in this wider program, our institute set-up a 4πβ-4πγ digital coincidence counting system, with FPGA (Field Programmable Gate Array)-based commercial boards from National Instruments (NI), to perform data acquisition and offline data analysis. Choosing all components and software from the same supplier provides a full compact and consistent electronic system. To demonstrate and validate the capacity of this system to standardize the activity of radioisotopes, we compare its predictions for the activity concentration of 133 Ba, 166m Ho and 18 F solutions with the results from a coincidence counting system with analog electronics, as well as with the results from other primary methods and a secondary measurement performed with an IG11 ionization chamber (CIR, chambre d'ionization de référence) with an equivalent activity traceable to the Système International de Référence. Copyright © 2017 Elsevier Ltd. All rights reserved.

Dwarf Galaxies with Gentle Star Formation and the Counts of Galaxies in the Hubble Deep Field

OpenAIRE

Campos, Ana

1997-01-01

In this paper the counts and colors of the faint galaxies observed in the Hubble Deep Field are fitted by means of simple luminosity evolution models that incorporate a numerous population of fading dwarfs. The observed color distribution of the very faint galaxies now allows us to put constraints on the star formation history in dwarfs. It is shown that the star-forming activity in these small systems has to proceed in a gentle way, i.e., through episodes where each one lasts much longer tha...

Results of a technical analysis of the Hubble Space Telescope nickel-cadmium and nickel-hydrogen batteries

Science.gov (United States)

Manzo, Michelle A.

1991-01-01

The Hubble Space Telescope (HST) Program Office requested the expertise of the NASA Aerospace Flight Battery Systems Steering Committee (NAFBSSC) in the conduct of an independent assessment of the HST's battery system to assist in their decision of whether to fly nickel-cadmium or nickel-hydrogen batteries on the telescope. In response, a subcommittee to the NAFBSSC was organized with membership comprised of experts with background in the nickel-cadmium/nickel-hydrogen secondary battery/power systems areas. The work and recommendations of that subcommittee are presented.

Long term trending of engineering data for the Hubble Space Telescope

Science.gov (United States)

Cox, Ross M.

1993-01-01

A major goal in spacecraft engineering analysis is the detection of component failures before the fact. Trending is the process of monitoring subsystem states to discern unusual behaviors. This involves reducing vast amounts of data about a component or subsystem into a form that helps humans discern underlying patterns and correlations. A long term trending system has been developed for the Hubble Space Telescope. Besides processing the data for 988 distinct telemetry measurements each day, it produces plots of 477 important parameters for the entire 24 hours. Daily updates to the trend files also produce 339 thirty day trend plots each month. The total system combines command procedures to control the execution of the C-based data processing program, user-written FORTRAN routines, and commercial off-the-shelf plotting software. This paper includes a discussion the performance of the trending system and of its limitations.

Science from a glimpse: Hubble SNAPshot observations of massive galaxy clusters

Science.gov (United States)

Repp, A.; Ebeling, H.

2018-06-01

Hubble Space Telescope SNAPshot surveys of 86 X-ray selected galaxy clusters at 0.3 0.3. Examining the evolution of the slope of the cluster red sequence, we observe at best a slight decrease with redshift, indicating minimal age contribution since z ˜ 1. Congruent to previous studies' findings, we note that the two BCGs which are significantly bluer (≥5σ) than their clusters' red sequences reside in relaxed clusters and exhibit pronounced internal structure. Thanks to our targets' high X-ray luminosity, the subset of our sample observed with Chandra adds valuable leverage to the X-ray luminosity-optical richness relation, which, albeit with substantial scatter, is now clearly established from groups to extremely massive clusters of galaxies. We conclude that SNAPshot observations of MACS clusters stand to continue to play a vital pathfinder role for astrophysical investigations across the entire electromagnetic spectrum.

Artificial neural network for the determination of Hubble Space Telescope aberration from stellar images

Science.gov (United States)

Barrett, Todd K.; Sandler, David G.

1993-01-01

An artificial-neural-network method, first developed for the measurement and control of atmospheric phase distortion, using stellar images, was used to estimate the optical aberration of the Hubble Space Telescope. A total of 26 estimates of distortion was obtained from 23 stellar images acquired at several secondary-mirror axial positions. The results were expressed as coefficients of eight orthogonal Zernike polynomials: focus through third-order spherical. For all modes other than spherical the measured aberration was small. The average spherical aberration of the estimates was -0.299 micron rms, which is in good agreement with predictions obtained when iterative phase-retrieval algorithms were used.

The Chrysalis Opens? Photometry from the η Carinae Hubble Space Telescope Treasury Project, 2002-2006

Science.gov (United States)

Martin, J. C.; Davidson, Kris; Koppelman, M. D.

2006-12-01

During the past decade η Car has brightened markedly, possibly indicating a change of state. Here we summarize photometry gathered by the Hubble Space Telescope (HST) as part of the HST Treasury Project on this object. Our data include Space Telescope Imaging Spectrograph (STIS) CCD acquisition images, Advanced Camera for Surveys HRC images in four filters, and synthetic photometry in flux-calibrated STIS spectra. The HST's spatial resolution allows us to examine the central star separate from the bright circumstellar ejecta. Its apparent brightness continued to increase briskly during 2002-2006, especially after the mid-2003 spectroscopic event. If this trend continues, the central star will soon become brighter than its ejecta, quite different from the state that existed only a few years ago. One precedent may be the rapid change observed in 1938-1953. We conjecture that the star's mass-loss rate has been decreasing throughout the past century. This research was conducted as part of the η Car Hubble Space Telescope Treasury project via grant GO-9973 from the Space Telescope Science Institute. HST is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS5-26555. Some of the data presented in this paper were obtained from the Multimission Archive at the Space Telescope Science Institute (MAST). STScI is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS5-26555. Support for MAST for non-HST data is provided by the NASA Office of Space Science via grant NAG5-7584 and by other grants and contracts.

ON THE ORIGIN OF THE MOLECULAR OUTFLOWS IN IRAS 16293–2422

Energy Technology Data Exchange (ETDEWEB)

Girart, Josep M.; Palau, Aina; Torrelles, José M. [Institut de Ciències de l' Espai, (CSIC-IEEC), Campus UAB, Facultat de Ciències, C5p 2, E-08193 Bellaterra, Catalonia (Spain); Estalella, Robert [Departament d' Astronomia i Meteorologia, Institut de Ciències del Cosmos (UB-IEEC), Martí i Franquès, Universitat de Barcelona, E-08028 Barcelona, Catalonia (Spain); Rao, Ramprasad, E-mail: girart@ice.cat [Institute of Astronomy and Astrophysics, Academia Sinica, 645 N. Aohoku Pl., Hilo, HI 96720 (United States)

2014-01-01

We present CO 3-2, SiO 8-7, C{sup 34}S 7-6, and 878 μm dust continuum subarcsecond angular resolution observations with the Submillimeter Array (SMA) toward the IRAS 16293–2422 (I16293) multiple low-mass protostellar system. The C{sup 34}S emission traces the 878 μm dust continuum well, and in addition clearly shows a smooth velocity gradient along the major axis of component I16293A. CO shows emission at moderate high velocities arising from two bipolar outflows, which appear to be perpendicular with respect to each other. The high sensitivity and higher angular resolution of these observations allows us to pinpoint well the origin of these two outflows at the center of component I16293A. Interestingly, the most compact outflow appears to point toward I16293B. Our data show that the previously reported monopolar blueshifted CO outflow associated with component I16293B seems to be part of the compact outflow arising from component I16293A. In addition, the SiO emission is also tracing this compact outflow: on the one hand, the SiO emission appears to have a jet-like morphology along the southern redshifted lobe; on the other hand, the SiO emission associated with the blueshifted northern lobe traces a well-defined arc on the border of component I16293B facing I16293A. The blueshifted CO lobe of the compact outflow splits into two lobes around the position of this SiO arc. All these results lead us to propose that the compact outflow from component I16293A is impacting on the circumstellar gas around component I16293B, possibly being diverged as a consequence of the interaction.

SN 2016jhj at redshift 0.34: extending the Type II supernova Hubble diagram using the standard candle method

Science.gov (United States)

de Jaeger, T.; Galbany, L.; Filippenko, A. V.; González-Gaitán, S.; Yasuda, N.; Maeda, K.; Tanaka, M.; Morokuma, T.; Moriya, T. J.; Tominaga, N.; Nomoto, K.; Komiyama, Y.; Anderson, J. P.; Brink, T. G.; Carlberg, R. G.; Folatelli, G.; Hamuy, M.; Pignata, G.; Zheng, W.

2017-12-01

Although Type Ia supernova cosmology has now reached a mature state, it is important to develop as many independent methods as possible to understand the true nature of dark energy. Recent studies have shown that Type II supernovae (SNe II) offer such a path and could be used as alternative distance indicators. However, the majority of these studies were unable to extend the Hubble diagram above redshift z = 0.3 because of observational limitations. Here, we show that we are now ready to move beyond low redshifts and attempt high-redshift (z ≳ 0.3) SN II cosmology as a result of new-generation deep surveys such as the Subaru/Hyper Suprime-Cam survey. Applying the 'standard candle method' to SN 2016jhj (z = 0.3398 ± 0.0002; discovered by HSC) together with a low-redshift sample, we are able to construct the highest-redshift SN II Hubble diagram to date with an observed dispersion of 0.27 mag (i.e. 12-13 per cent in distance). This work demonstrates the bright future of SN II cosmology in the coming era of large, wide-field surveys like that of the Large Synoptic Survey Telescope.

Hubble Servicing Challenges Drive Innovation of Shuttle Rendezvous Techniques

Science.gov (United States)

Goodman, John L.; Walker, Stephen R.

2009-01-01

Hubble Space Telescope (HST) servicing, performed by Space Shuttle crews, has contributed to what is arguably one of the most successful astronomy missions ever flown. Both nominal and contingency proximity operations techniques were developed to enable successful servicing, while lowering the risk of damage to HST systems, and improve crew safety. Influencing the development of these techniques were the challenges presented by plume impingement and HST performance anomalies. The design of both the HST and the Space Shuttle was completed before the potential of HST contamination and structural damage by shuttle RCS jet plume impingement was fully understood. Relative navigation during proximity operations has been challenging, as HST was not equipped with relative navigation aids. Since HST reached orbit in 1990, proximity operations design for servicing missions has evolved as insight into plume contamination and dynamic pressure has improved and new relative navigation tools have become available. Servicing missions have provided NASA with opportunities to gain insight into servicing mission design and development of nominal and contingency procedures. The HST servicing experiences and lessons learned are applicable to other programs that perform on-orbit servicing and rendezvous, both human and robotic.

Protein (Viridiplantae): 850873 [PGDBj - Ortholog DB

Lifescience Database Archive (English)

Full Text Available OC100796589 Glycine max MEETSWEQRVQALTHILTSPTTTPSLHSQFFIATQIPCYLNWDYPPFLCSSNPQLLK...803:12853 ... 3814:12853 ... 163735:5410 ... 3846:8024 1462606:8024 3847:8024 ... PREDICTED: uncharacterized protein L

Protein (Viridiplantae): 128879 [PGDBj - Ortholog DB

Lifescience Database Archive (English)

Full Text Available 5:248 3803:248 ... 3814:248 ... 163722:3689 ... 3826:3689 ... 3827:3689 ... PREDICTED: uncharacterized protein LOC101515541 Cicer arietinum MNSSTI...CSLFLGLILISQSANAKGHGGGLVVTICKGATDRAACENILGSNSEISHAKSFSQL

The Hubble law and the spiral structures of galaxies from equations of motion in general relativity

International Nuclear Information System (INIS)

Sachs, M.

1975-01-01

Fully exploiting the Lie group that characterizes the underlying symmetry of general relativity theory, Einstein's tensor formalism factorizes, yielding a generalized (16-component) quaternion field formalism. The associated generalized geodesic equation, taken as the equation of motion of a star, predicts the Hubble law from one approximation for the generally covariant equations of motion, and the spiral structure of galaxies from another approximation. These results depend on the imposition of appropriate boundary conditions. The Hubble law follows when the boundary conditions derive from the oscillating model cosmology, and not from the other cosmological models. The spiral structures of the galaxies follow from the same boundary conditions, but with a different time scale than for the whole universe. The solutions that imply the spiral motion are Fresnel integrals. These predict the star's motion to be along the 'Cornu Spiral'. The part of this spiral in the first quadrant is the imploding phase of the galaxy, corresponding to a motion with continually decreasing radii, approaching the galactic center as time increases. The part of the Cornu Spiral' in the third quadrant is the exploding phase, corresponding to continually increasing radii, as the star moves out from the hub. The spatial origin in the coordinate system of this curve is the inflection point, where the explosion changes to implosion. The two- (or many-) armed spiral galaxies are explained here in terms of two (or many) distinct explosions occurring at displaced times, in the domain of the rotating, planar galaxy. (author)

Spectroscopic Properties of Star-Forming Host Galaxies and Type Ia Supernova Hubble Residuals in a Nearly Unbiased Sample

Energy Technology Data Exchange (ETDEWEB)

D' Andrea, Chris B. [Univ. of Pennsylvania, Philadelphia, PA (United States); et al.

2011-12-20

We examine the correlation between supernova host galaxy properties and their residuals on the Hubble diagram. We use supernovae discovered during the Sloan Digital Sky Survey II - Supernova Survey, and focus on objects at a redshift of z < 0.15, where the selection effects of the survey are known to yield a complete Type Ia supernova sample. To minimize the bias in our analysis with respect to measured host-galaxy properties, spectra were obtained for nearly all hosts, spanning a range in magnitude of -23 < M_r < -17. In contrast to previous works that use photometric estimates of host mass as a proxy for global metallicity, we analyze host-galaxy spectra to obtain gas-phase metallicities and star-formation rates from host galaxies with active star formation. From a final sample of ~ 40 emission-line galaxies, we find that light-curve corrected Type Ia supernovae are ~ 0.1 magnitudes brighter in high-metallicity hosts than in low-metallicity hosts. We also find a significant (> 3{\\sigma}) correlation between the Hubble residuals of Type Ia supernovae and the specific star-formation rate of the host galaxy. We comment on the importance of supernova/host-galaxy correlations as a source of systematic bias in future deep supernova surveys.

Constraints on Λ(t)CDM models as holographic and agegraphic dark energy with the observational Hubble parameter data

Energy Technology Data Exchange (ETDEWEB)

Zhai, Zhong-Xu; Liu, Wen-Biao [Department of Physics, Institute of Theoretical Physics, Beijing Normal University, Beijing, 100875 (China); Zhang, Tong-Jie, E-mail: zzx@mail.bnu.edu.cn, E-mail: tjzhang@bnu.edu.cn, E-mail: wbliu@bnu.edu.cn [Department of Astronomy, Beijing Normal University, Beijing, 100875 (China)

2011-08-01

The newly released observational H(z) data (OHD) is used to constrain Λ(t)CDM models as holographic and agegraphic dark energy. By the use of the length scale and time scale as the IR cut-off including Hubble horizon (HH), future event horizon (FEH), age of the universe (AU), and conformal time (CT), we achieve four different Λ(t)CDM models which can describe the present cosmological acceleration respectively. In order to get a comparison between such Λ(t)CDM models and standard ΛCDM model, we use the information criteria (IC), Om(z) diagnostic, and statefinder diagnostic to measure the deviations. Furthermore, by simulating a larger Hubble parameter data sample in the redshift range of 0.1 < z < 2.0, we get the improved constraints and more sufficient comparison. We show that OHD is not only able to play almost the same role in constraining cosmological parameters as SNe Ia does but also provides the effective measurement of the deviation of the DE models from standard ΛCDM model. In the holographic and agegraphic scenarios, the results indicate that the FEH is more preferable than HH scenario. However, both two time scenarios show better approximations to ΛCDM model than the length scenarios.

Protein (Viridiplantae): 888289 [PGDBj - Ortholog DB

Lifescience Database Archive (English)

Full Text Available 0727 3803:10727 ... 3814:10727 ... 163735:2506 ... 3883:1736 ... 3885:1736 ... hypothetical protein PHAVU_009G116600g Phaseolus vulgaris MKKNRMMIM...ICSVGVVWMLLVGGSYGEQCGRQAGGALCPGGNCCSQFGWCGSTTDYCGKDCQSQC

A determination of H-0 with the class gravitational lens B1608+656. II. Mass models and the Hubble constant from lensing

NARCIS (Netherlands)

Koopmans, LVE; Fassnacht, CD

1999-01-01

We present mass models of the four-image gravitational lens system B1608 + 656, based on information obtained through VLBA imaging, VLA monitoring, and Hubble Space Telescope (HST) WFPC2 and NICMOS imaging. We have determined a mass model for the lens galaxies that reproduces (1) all image positions

CONFRONTING THREE-DIMENSIONAL TIME-DEPENDENT JET SIMULATIONS WITH HUBBLE SPACE TELESCOPE OBSERVATIONS

International Nuclear Information System (INIS)

Staff, Jan E.; Niebergal, Brian P.; Ouyed, Rachid; Pudritz, Ralph E.; Cai, Kai

2010-01-01

We perform state-of-the-art, three-dimensional, time-dependent simulations of magnetized disk winds, carried out to simulation scales of 60 AU, in order to confront optical Hubble Space Telescope observations of protostellar jets. We 'observe' the optical forbidden line emission produced by shocks within our simulated jets and compare these with actual observations. Our simulations reproduce the rich structure of time-varying jets, including jet rotation far from the source, an inner (up to 400 km s -1 ) and outer (less than 100 km s -1 ) component of the jet, and jet widths of up to 20 AU in agreement with observed jets. These simulations when compared with the data are able to constrain disk wind models. In particular, models featuring a disk magnetic field with a modest radial spatial variation across the disk are favored.

Dynamic auroral storms on Saturn as observed by the Hubble Space Telescope.

Science.gov (United States)

Nichols, J D; Badman, S V; Baines, K H; Brown, R H; Bunce, E J; Clarke, J T; Cowley, S W H; Crary, F J; Dougherty, M K; Gérard, J-C; Grocott, A; Grodent, D; Kurth, W S; Melin, H; Mitchell, D G; Pryor, W R; Stallard, T S

2014-05-28

We present observations of significant dynamics within two UV auroral storms observed on Saturn using the Hubble Space Telescope in April/May 2013. Specifically, we discuss bursts of auroral emission observed at the poleward boundary of a solar wind-induced auroral storm, propagating at ∼330% rigid corotation from near ∼01 h LT toward ∼08 h LT. We suggest that these are indicative of ongoing, bursty reconnection of lobe flux in the magnetotail, providing strong evidence that Saturn's auroral storms are caused by large-scale flux closure. We also discuss the later evolution of a similar storm and show that the emission maps to the trailing region of an energetic neutral atom enhancement. We thus identify the auroral form with the upward field-aligned continuity currents flowing into the associated partial ring current.

Gravitational Contraction and Fusion Plasma Burn. Universal Expansion and the Hubble Law

International Nuclear Information System (INIS)

Wilhelmsson, Hans

2002-01-01

A dynamic approach is developed for the two principle phases of (i) gravitational condensation, and (ii) burning fusion plasma evolution. Comparison is made with conceptual descriptions of star formation and of subsequent decay towards red giant stars, white dwarfs, and other condensed core objects like neutron stars and black holes. The possibility of treating the expansion of the Universe by means of a similar approach is also discussed. The concept of negative diffusion is introduced for the contraction phase of star formation. The coefficients of defining the nonlinear diffusion are determined uniquely by physical conditions and for the case of the expansion of the universe, by the observation of the Hubble law. The contraction and evolution of large scale 3-D stars and 2-D galactic systems can thus be dynamically surveyed. In particular the time-scales can be determined

Hubble Space Telescope Photometry of Hodge 301: An ``Old'' Star Cluster in 30 Doradus

Science.gov (United States)

Grebel, Eva K.; Chu, You-Hua

2000-02-01

We present Hubble Space Telescope Planetary Camera UVI data for Hodge 301, the little-studied cluster 3' northwest of the central ionizing cluster R136 in 30 Doradus. The average reddening of Hodge 301 is found to be =0.28+/-0.05 mag from published infrared and ultraviolet photometry. Using two different sets of evolutionary models, we derive an age of about 20-25 Myr for Hodge 301, which makes it roughly 10 times as old as R136. Hodge 301 is the most prominent representative of the oldest population in the 30 Dor starburst region, a region that has undergone multiple star formation events. This range of ages is an important consideration for the modeling of starburst regions. Hodge 301 shows a widened upper main sequence largely caused by Be stars. We present a list of Be star candidates. The slope of the initial mass function for intermediate-mass, main-sequence stars ranging from 10 to 1.3 Msolar is found to be Γ=-1.4+/-0.1, in good agreement with a Salpeter law. There is no indication for a truncation or change of slope of the initial mass function (IMF) within this mass range. In accordance with the age of Hodge 301, no obvious pre-main-sequence stars are seen down to about 1 Msolar. We estimate that up to 41+/-7 stars with masses more than 12 Msolar may have turned into supernovae since the formation of the cluster. Multiple supernova explosions are the most likely origin of the extremely violent gas motions and the diffuse X-ray emission observed in the cluster surroundings. Based on observations made with the NASA/ESA Hubble Space Telescope, obtained at the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy, Inc. under NASA contract NAS5-26555.

Probing the z > 6 universe with the first Hubble frontier fields cluster A2744

International Nuclear Information System (INIS)

Atek, Hakim; Kneib, Jean-Paul; Richard, Johan; Clement, Benjamin; Egami, Eiichi; Ebeling, Harald; Jauzac, Mathilde; Jullo, Eric; Limousin, Marceau; Laporte, Nicolas; Natarajan, Priyamvada

2014-01-01

The Hubble Frontier Fields program combines the capabilities of the Hubble Space Telescope (HST) with the gravitational lensing of massive galaxy clusters to probe the distant universe to an unprecedented depth. Here, we present the results of the first combined HST and Spitzer observations of the cluster A-2744. We combine the full near-infrared data with ancillary optical images to search for gravitationally lensed high-redshift (z ≳ 6) galaxies. We report the detection of 15 I 814 dropout candidates at z ∼ 6-7 and one Y 105 dropout at z ∼ 8 in a total survey area of 1.43 arcmin 2 in the source plane. The predictions of our lens model also allow us to identify five multiply imaged systems lying at redshifts between z ∼ 6 and z ∼ 8. Thanks to constraints from the mass distribution in the cluster, we were able to estimate the effective survey volume corrected for completeness and magnification effects. This was in turn used to estimate the rest-frame ultraviolet luminosity function (LF) at z ∼ 6-8. Our LF results are generally in agreement with the most recent blank field estimates, confirming the feasibility of surveys through lensing clusters. Although based on a shallower observations than what will be achieved in the final data set including the full Advanced Camera for Survey observations, the LF presented here goes down to M UV ∼–18.5, corresponding to 0.2L * at z ∼ 7 with one identified object at M UV ∼–15 thanks to the highly magnified survey areas. This early study forecasts the power of using massive galaxy clusters as cosmic telescopes and its complementarity to blank fields.

Probing the z > 6 universe with the first Hubble frontier fields cluster A2744

Energy Technology Data Exchange (ETDEWEB)

Atek, Hakim; Kneib, Jean-Paul [Laboratoire d' Astrophysique, Ecole Polytechnique Fédérale de Lausanne, Observatoire de Sauverny, CH-1290 Versoix (Switzerland); Richard, Johan [CRAL, Observatoire de Lyon, Université Lyon 1, 9 Avenue Ch. André, 69561 Saint Genis Laval Cedex (France); Clement, Benjamin; Egami, Eiichi [Steward Observatory, University of Arizona, 933 North Cherry Avenue, Tucson, AZ, 85721 (United States); Ebeling, Harald [Institute for Astronomy, University of Hawaii, 2680 Woodlawn Drive, Honolulu, Hawaii 96822 (United States); Jauzac, Mathilde [Astrophysics and Cosmology Research Unit, School of Mathematical Sciences, University of KwaZulu-Natal, Durban, 4041 South Africa (South Africa); Jullo, Eric; Limousin, Marceau [Aix Marseille Université, CNRS, LAM (Laboratoire d' Astrophysique de Marseille) UMR 7326, 13388, Marseille (France); Laporte, Nicolas [Instituto de Astrofisica de Canarias (IAC), E-38200 La Laguna, Tenerife (Spain); Natarajan, Priyamvada [Department of Astronomy, Yale University, 260 Whitney Avenue, New Haven, CT 06511 (United States)

2014-05-01

The Hubble Frontier Fields program combines the capabilities of the Hubble Space Telescope (HST) with the gravitational lensing of massive galaxy clusters to probe the distant universe to an unprecedented depth. Here, we present the results of the first combined HST and Spitzer observations of the cluster A-2744. We combine the full near-infrared data with ancillary optical images to search for gravitationally lensed high-redshift (z ≳ 6) galaxies. We report the detection of 15 I {sub 814} dropout candidates at z ∼ 6-7 and one Y {sub 105} dropout at z ∼ 8 in a total survey area of 1.43 arcmin{sup 2} in the source plane. The predictions of our lens model also allow us to identify five multiply imaged systems lying at redshifts between z ∼ 6 and z ∼ 8. Thanks to constraints from the mass distribution in the cluster, we were able to estimate the effective survey volume corrected for completeness and magnification effects. This was in turn used to estimate the rest-frame ultraviolet luminosity function (LF) at z ∼ 6-8. Our LF results are generally in agreement with the most recent blank field estimates, confirming the feasibility of surveys through lensing clusters. Although based on a shallower observations than what will be achieved in the final data set including the full Advanced Camera for Survey observations, the LF presented here goes down to M {sub UV} ∼–18.5, corresponding to 0.2L {sup *} at z ∼ 7 with one identified object at M {sub UV} ∼–15 thanks to the highly magnified survey areas. This early study forecasts the power of using massive galaxy clusters as cosmic telescopes and its complementarity to blank fields.

High-resolution observations of IRAS 08544-4431. Detection of a disk orbiting a post-AGB star and of a slow disk wind

Science.gov (United States)

Bujarrabal, V.; Castro-Carrizo, A.; Winckel, H. Van; Alcolea, J.; Contreras, C. Sánchez; Santander-García, M.; Hillen, M.

2018-06-01

Context. Aims: In order to study the effects of rotating disks in the post-asymptotic giant branch (post-AGB) evolution, we observe a class of binary post-AGB stars that seem to be systematically surrounded by equatorial disks and slow outflows. Although the rotating dynamics had only been well identified in three cases, the study of such structures is thought to be fundamental to the understanding of the formation of disks in various phases of the late evolution of binary stars and the ejection of planetary nebulae from evolved stars. Methods: We present ALMA maps of 12CO and 13CO J = 3-2 lines in the source IRAS 08544-4431, which belongs to the above mentioned class of objects. We analyzed the data by means of nebula models, which account for the expectedly composite source and can reproduce the data. From our modeling, we estimated the main nebula parameters, including the structure and dynamics and the density and temperature distributions. We discuss the uncertainties of the derived values and, in particular, their dependence on the distance. Results: Our observations reveal the presence of an equatorial disk in rotation; a low-velocity outflow is also found, probably formed of gas expelled from the disk. The main characteristics of our observations and modeling of IRAS 08544-4431 are similar to those of better studied objects, confirming our interpretation. The disk rotation indicates a total central mass of about 1.8 M⊙, for a distance of 1100 pc. The disk is found to be relatively extended and has a typical diameter of 4 × 1016 cm. The total nebular mass is 2 × 10-2 M⊙, of which 90% corresponds to the disk. Assuming that the outflow is due to mass loss from the disk, we derive a disk lifetime of 10 000 yr. The disk angular momentum is found to be comparable to that of the binary system at present. Assuming that the disk angular momentum was transferred from the binary system, as expected, the high values of the disk angular momentum in this and other

The Carnegie Hubble Program: The Leavitt Law at 3.6 microns and 4.5 microns in the Large Magellanic Cloud

Science.gov (United States)

Scowcroft, Victoria; Freedman, Wendy L.; Madore, Barry F.; Monson, Andrew J.; Persson, S. E.; Seibert, Mark; Rigby, Jane R.; Sturch, Laura

2011-01-01

The Carnegie Hubble Program (CHP) is designed to improve the extragalactic distance scale using data from the post-cryogenic era of Spitzer. The ultimate goal is a determination of the Hubble constant to an accuracy of 2%. This paper is the first in a series on the Cepheid population of the Large Magellanic Cloud, and focuses on the period-luminosity relations (Leavitt laws) that will be used, in conjunction with observations of Milky Way Cepheids, to set the slope and zero-point of the Cepheid distance scale in the mid-infrared. To this end, we have obtained uniformly-sampled light curves for 85 LMC Cepheids, having periods between 6 and 140 days. Period- luminosity and period-color relations are presented in the 3.6 micron and 4.5 micron bands. We demonstrate that the 3.6 micron band is a superb distance indicator. The cyclical variation of the [3.6]-[4.5] color has been measured for the first time. We attribute the amplitude and phase of the color curves to the dissociation and recombination of CO molecules in the Cepheid s atmosphere. The CO affects only the 4.5 micron flux making it a potential metallicity indicator.

Proper Motions of Dwarf Spheroidal Galaxies from Hubble Space Telescope Imaging. IV. Measurement for Sculptor

Science.gov (United States)

Piatek, Slawomir; Pryor, Carlton; Bristow, Paul; Olszewski, Edward W.; Harris, Hugh C.; Mateo, Mario; Minniti, Dante; Tinney, Christopher G.

2006-03-01

This article presents a measurement of the proper motion of the Sculptor dwarf spheroidal galaxy determined from images taken with the Hubble Space Telescope using the Space Telescope Imaging Spectrograph in the imaging mode. Each of two distinct fields contains a quasi-stellar object that serves as the ``reference point.'' The measured proper motion of Sculptor, expressed in the equatorial coordinate system, is (μα, μδ)=(9+/-13, 2+/-13) mas century-1. Removing the contributions from the motion of the Sun and the motion of the local standard of rest produces the proper motion in the Galactic rest frame: (μGrfα, μGrfδ)=(-23+/-13, 45+/-13) mas century-1. The implied space velocity with respect to the Galactic center has a radial component of Vr=79+/-6 km s-1 and a tangential component of Vt=198+/-50 km s-1. Integrating the motion of Sculptor in a realistic potential for the Milky Way produces orbital elements. The perigalacticon and apogalacticon are 68 (31, 83) and 122 (97, 313) kpc, respectively, where the values in the parentheses represent the 95% confidence interval derived from Monte Carlo experiments. The eccentricity of the orbit is 0.29 (0.26, 0.60), and the orbital period is 2.2 (1.5, 4.9) Gyr. Sculptor is on a polar orbit around the Milky Way: the angle of inclination is 86° (83°, 90°). Based on observations with the NASA/ESA Hubble Space Telescope, obtained at the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS5-26555.

Dissecting the Gravitational lens B1608+656 : II. Precision Measurements of the Hubble Constant, Spatial Curvature, and the Dark Energy Equation of State

NARCIS (Netherlands)

Suyu, S. H.; Marshall, P. J.; Auger, M. W.; Hilbert, S.; Blandford, R. D.; Koopmans, L. V. E.; Fassnacht, C. D.; Treu, T.

2010-01-01

Strong gravitational lens systems with measured time delays between the multiple images provide a method for measuring the "time-delay distance" to the lens, and thus the Hubble constant. We present a Bayesian analysis of the strong gravitational lens system B1608+656, incorporating (1) new, deep

Hubble Space Telescope Trigonometric Parallax of Polaris B, Companion of the Nearest Cepheid

Science.gov (United States)

Bond, Howard E.; Nelan, Edmund P.; Remage Evans, Nancy; Schaefer, Gail H.; Harmer, Dianne

2018-01-01

Polaris, the nearest and brightest Cepheid, is a potential anchor point for the Leavitt period–luminosity relation. However, its distance is a matter of contention, with recent advocacy for a parallax of ∼10 mas, in contrast with the Hipparcos measurement of 7.54 ± 0.11 mas. We report an independent trigonometric parallax determination, using the Fine Guidance Sensors (FGS) on the Hubble Space Telescope. Polaris itself is too bright for FGS, so we measured its eighth-magnitude companion Polaris B, relative to a network of background reference stars. We converted the FGS relative parallax to absolute, using estimated distances to the reference stars from ground-based photometry and spectral classification. Our result, 6.26 ± 0.24 mas, is even smaller than that found by Hipparcos. We note other objects for which Hipparcos appears to have overestimated parallaxes, including the well-established case of the Pleiades. We consider possible sources of systematic error in the FGS parallax, but find no evidence they are significant. If our “long” distance is correct, the high luminosity of Polaris indicates that it is pulsating in the second overtone of its fundamental mode. Our results raise several puzzles, including a long pulsation period for Polaris compared to second-overtone pulsators in the Magellanic Clouds, and a conflict between the isochrone age of Polaris B (∼2.1 Gyr) and the much younger age of Polaris A. We discuss possibilities that B is not a physical companion of A, in spite of the strong evidence that it is, or that one of the stars is a merger remnant. These issues may be resolved when Gaia provides parallaxes for both stars. Based in part on observations made with the NASA/ESA Hubble Space Telescope, obtained by the Space Telescope Science Institute. STScI is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS5-26555.

HUBBLE-BUBBLE 1. A computer program for the analysis of non-equilibrium flows of water

International Nuclear Information System (INIS)

Mather, D.J.

1978-02-01

A description is given of the computer program HUBBLE-BUBBLE I which simulates the non-equilibrium flow of water and steam in a pipe. The code is designed to examine the transient flow developing in a pipe containing hot compressed water following the rupture of a retaining diaphragm. Allowance is made for an area change in the pipe. Particular attention is paid to the non-equilibrium development of vapour bubbles and to the transition from a bubble-liquid regime to a droplet-vapour regime. The mathematical and computational model is described together with a summary of the FORTRAN subroutines and listing of data input. (UK)

Stable exponential cosmological solutions with zero variation of G and three different Hubble-like parameters in the Einstein-Gauss-Bonnet model with a Λ-term

Energy Technology Data Exchange (ETDEWEB)

Ernazarov, K.K. [RUDN University, Institute of Gravitation and Cosmology, Moscow (Russian Federation); Ivashchuk, V.D. [RUDN University, Institute of Gravitation and Cosmology, Moscow (Russian Federation); VNIIMS, Center for Gravitation and Fundamental Metrology, Moscow (Russian Federation)

2017-06-15

We consider a D-dimensional gravitational model with a Gauss-Bonnet term and the cosmological term Λ. We restrict the metrics to diagonal cosmological ones and find for certain Λ a class of solutions with exponential time dependence of three scale factors, governed by three non-coinciding Hubble-like parameters H > 0, h{sub 1} and h{sub 2}, corresponding to factor spaces of dimensions m > 2, k{sub 1} > 1 and k{sub 2} > 1, respectively, with k{sub 1} ≠ k{sub 2} and D = 1 + m + k{sub 1} + k{sub 2}. Any of these solutions describes an exponential expansion of 3d subspace with Hubble parameter H and zero variation of the effective gravitational constant G. We prove the stability of these solutions in a class of cosmological solutions with diagonal metrics. (orig.)

Atmospheric and Fundamental Parameters of Stars in Hubble's Next Generation Spectral Library

Science.gov (United States)

Heap, Sally

2010-01-01

Hubble's Next Generation Spectral Library (NGSL) consists of R approximately 1000 spectra of 374 stars of assorted temperature, gravity, and metallicity. We are presently working to determine the atmospheric and fundamental parameters of the stars from the NGSL spectra themselves via full-spectrum fitting of model spectra to the observed (extinction-corrected) spectrum over the full wavelength range, 0.2-1.0 micron. We use two grids of model spectra for this purpose: the very low-resolution spectral grid from Castelli-Kurucz (2004), and the grid from MARCS (2008). Both the observed spectrum and the MARCS spectra are first degraded in resolution to match the very low resolution of the Castelli-Kurucz models, so that our fitting technique is the same for both model grids. We will present our preliminary results with a comparison with those from the Sloan/Segue Stellar Parameter Pipeline, ELODIE, and MILES, etc.

Legacy ExtraGalactic UV Survey with The Hubble Space Telescope: Stellar Cluster Catalogs and First Insights Into Cluster Formation and Evolution in NGC 628

NARCIS (Netherlands)

Adamo, A.; Ryon, J.E.; Messa, M.; Kim, H.; Grasha, K.; Cook, D.O.; Calzetti, D.; Lee, J.C.; Whitmore, B.C.; Elmegreen, B.G.; Ubeda, L.; Smith, L.J.; Bright, S.N.; Runnholm, A.; Andrews, J.E.; Fumagalli, M.; Gouliermis, D.A.; Kahre, L.; Nair, P.; Thilker, D.; Walterbos, R.; Wofford, A.; Aloisi, A.; Ashworth, G.; Brown, T.M.; Chandar, R.; Christian, C.; Cignoni, M.; Clayton, G.C.; Dale, D.A.; de Mink, S.E.; Dobbs, C.; Elmegreen, D.M.; Evans, A.S.; Gallagher III, J.S.; Grebel, E.K.; Herrero, A.; Hunter, D.A.; Johnson, K.E.; Kennicutt, R.C.; Krumholz, M.R.; Lennon, D.; Levay, K.; Martin, C.; Nota, A.; Östlin, G.; Pellerin, A.; Prieto, J.; Regan, M.W.; Sabbi, E.; Sacchi, E.; Schaerer, D.; Schiminovich, D.; Shabani, F.; Tosi, M.; Van Dyk, S.D.; Zackrisson, E.

2017-01-01

We report the large effort that is producing comprehensive high-level young star cluster (YSC) catalogs for a significant fraction of galaxies observed with the Legacy ExtraGalactic UV Survey (LEGUS) Hubble treasury program. We present the methodology developed to extract cluster positions, verify

Cosmological model-independent test of ΛCDM with two-point diagnostic by the observational Hubble parameter data

Science.gov (United States)

Cao, Shu-Lei; Duan, Xiao-Wei; Meng, Xiao-Lei; Zhang, Tong-Jie

2018-04-01

Aiming at exploring the nature of dark energy (DE), we use forty-three observational Hubble parameter data (OHD) in the redshift range 0 measurements. The binning methods turn out to be promising and considered to be robust. By applying the two-point diagnostic to the binned data, we find that although the best-fit values of Omh^2 fluctuate as the continuous redshift intervals change, on average, they are continuous with being constant within 1 σ confidence interval. Therefore, we conclude that the ΛCDM model cannot be ruled out.

HUBBLE SPACE TELESCOPE PHOTOMETRY OF GLOBULAR CLUSTERS IN M81

International Nuclear Information System (INIS)

Nantais, Julie B.; Huchra, John P.; Zezas, Andreas; Gazeas, Kosmas; Strader, Jay

2011-01-01

We perform aperture photometry and profile fitting on 419 globular cluster (GC) candidates with m V ≤ 23 mag identified in Hubble Space Telescope/Advanced Camera for Surveys BVI imaging, and estimate the effective radii of the clusters. We identify 85 previously known spectroscopically confirmed clusters, and newly identify 136 objects as good cluster candidates within the 3σ color and size ranges defined by the spectroscopically confirmed clusters, yielding a total of 221 probable GCs. The luminosity function peak for the 221 probable GCs with estimated total dereddening applied is V ∼ (20.26 ± 0.13) mag, corresponding to a distance of ∼3.7 ± 0.3 Mpc. The blue and red GC candidates, and the metal-rich and metal-poor spectroscopically confirmed clusters, respectively, are similar in half-light radius. Red confirmed clusters are about 6% larger in median half-light radius than blue confirmed clusters, and red and blue good GC candidates are nearly identical in half-light radius. The total population of confirmed and 'good' candidates shows an increase in half-light radius as a function of galactocentric distance.

Precise Estimates of the Physical Parameters for the Exoplanet System HD 17156 Enabled by Hubble Space Telescope Fine Guidance Sensor Transit and Asteroseismic Observations

DEFF Research Database (Denmark)

Nutzman, Philip; Gilliland, Ronald L.; McCullough, Peter R.

2011-01-01

We present observations of three distinct transits of HD 17156b obtained with the Fine Guidance Sensors on board the Hubble Space Telescope. We analyzed both the transit photometry and previously published radial velocities to find the planet-star radius ratio Rp /R sstarf = 0.07454 ± 0.00035, in......We present observations of three distinct transits of HD 17156b obtained with the Fine Guidance Sensors on board the Hubble Space Telescope. We analyzed both the transit photometry and previously published radial velocities to find the planet-star radius ratio Rp /R sstarf = 0.07454 ± 0......-composition gas giant of the same mass and equilibrium temperature. For the three transits, we determine the times of mid-transit to a precision of 6.2 s, 7.6 s, and 6.9 s, and the transit times for HD 17156 do not show any significant departures from a constant period. The joint analysis of transit photometry...

Correcting a statistical artifact in the estimation of the Hubble; constant based on Type Ia Supernovae results in a change in estimate; of 1.2%

DEFF Research Database (Denmark)

Petersen, JH; Holst, KK; Budtz-Jørgensen, Esben

2010-01-01

The Hubble constant enters big bang cosmology by quantifying the expansion rate of the universe. Existing statistical methods used to estimate Hubble’s constant only partially take into account random measurement errors. As a consequence, estimates of Hubble’s constant are statistically...

A Type II Supernova Hubble Diagram from the CSP-I, SDSS-II, and SNLS Surveys

Science.gov (United States)

de Jaeger, T.; González-Gaitán, S.; Hamuy, M.; Galbany, L.; Anderson, J. P.; Phillips, M. M.; Stritzinger, M. D.; Carlberg, R. G.; Sullivan, M.; Gutiérrez, C. P.; Hook, I. M.; Howell, D. Andrew; Hsiao, E. Y.; Kuncarayakti, H.; Ruhlmann-Kleider, V.; Folatelli, G.; Pritchet, C.; Basa, S.

2017-02-01

The coming era of large photometric wide-field surveys will increase the detection rate of supernovae by orders of magnitude. Such numbers will restrict spectroscopic follow-up in the vast majority of cases, and hence new methods based solely on photometric data must be developed. Here, we construct a complete Hubble diagram of Type II supernovae (SNe II) combining data from three different samples: the Carnegie Supernova Project-I, the Sloan Digital Sky Survey II SN, and the Supernova Legacy Survey. Applying the Photometric Color Method (PCM) to 73 SNe II with a redshift range of 0.01-0.5 and with no spectral information, we derive an intrinsic dispersion of 0.35 mag. A comparison with the Standard Candle Method (SCM) using 61 SNe II is also performed and an intrinsic dispersion in the Hubble diagram of 0.27 mag, I.e., 13% in distance uncertainties, is derived. Due to the lack of good statistics at higher redshifts for both methods, only weak constraints on the cosmological parameters are obtained. However, assuming a flat universe and using the PCM, we derive the universe’s matter density: {{{Ω }}}m={0.32}-0.21+0.30 providing a new independent evidence for dark energy at the level of two sigma. This paper includes data gathered with the 6.5 m Magellan Telescopes, with the du Pont and Swope telescopes located at Las Campanas Observatory, Chile; and the Gemini Observatory, Cerro Pachon, Chile (Gemini Program N-2005A-Q-11, GN-2005B-Q-7, GN-2006A-Q-7, GS-2005A-Q-11, GS-2005B-Q-6, and GS-2008B-Q-56). Based on observations collected at the European Organization for Astronomical Research in the Southern Hemisphere, Chile (ESO Programmes 076.A-0156,078.D-0048, 080.A-0516, and 082.A-0526).

LQG and maximum entropy control design for the Hubble Space Telescope

Science.gov (United States)

Collins, Emmanuel G., Jr.; Richter, Stephen

Solar array vibrations are responsible for serious pointing control problems on the Hubble Space Telescope (HST). The original HST control law was not designed to attenuate these disturbances because they were not perceived to be a problem prior to launch. However, significant solar array vibrations do occur due to large changes in the thermal environment as the HST orbits the earth. Using classical techniques, Marshall Space Flight Center in conjunction with Lockheed Missiles and Space Company developed modified HST controllers that were able to suppress the influence of the vibrations of the solar arrays on the line-of-sight (LOS) performance. Substantial LOS improvement was observed when two of these controllers were implemented on orbit. This paper describes the development of modified HST controllers by using modern control techniques, particularly linear-quadratic-gaussian (LQG) design and Maximum Entropy robust control design, a generalization of LQG that incorporates robustness constraints with respect to modal errors. The fundamental issues are discussed candidly and controllers designed using these modern techniques are described.

Discovery of an Unusual Optical Transient with the Hubble Space Telescope

Energy Technology Data Exchange (ETDEWEB)

The Supernova Cosmology Project; Barbary, Kyle; Dawson, Kyle S.; Tokita, Kouichi; Aldering, Greg; Amanullah, Rahman; Connolly, Natalia V.; Doi, Mamoru; Faccioli, Lorenzo; Fadeyev, Vitaliy; Fruchter, Andrew S.; Goldhaber, Gerson; Goobar, Ariel; Gude, Alexander; Huang, Xiaosheng; Ihara, Yutaka; Konishi, Kohki; Kowalski, Marek; Lidman, Chris; Meyers, Josh; Morokuma, Tomoki; Nugent, Peter; Perlmutter, Saul; Rubin, David; Schlegel, David; Spadafora, Anthony L.; Suzuki, Nao; Swift, Hannah K.; Takanashi, Naohiro; Thomas, Rollin C.; Yasuda, Naoki

2008-09-08

We present observations of SCP 06F6, an unusual optical transient discovered during the Hubble Space Telescope Cluster Supernova Survey. The transient brightened over a period of ~;;100 days, reached a peak magnitude of ~;;21.0 in both i_775 and z_850, and then declined over a similar timescale. There is no host galaxy or progenitor star detected at the location of the transient to a 3 sigma upper limit of i_775 = 26.4 and z_850 = 26.1, giving a corresponding lower limit on the flux increase of a factor of ~;;120. Multiple spectra show five broad absorption bands between 4100 AA and 6500 AA and a mostly featureless continuum longward of 6500 AA. The shape of the lightcurve is inconsistent with microlensing. The transient's spectrum, in addition to being inconsistent with all known supernova types, is not matched to any spectrum in the Sloan Digital Sky Survey (SDSS) database. We suggest that the transient may be one of a new class.

The Carnegie Hubble Program: The Infrared Leavitt Law in IC 1613

Science.gov (United States)

Scowcroft, Victoria; Freedman, Wendy L.; Madore, Barry F.; Monson, Andrew J.; Persson, S. E.; Seibert, Mark; Rigby, Jane R.; Melbourne, Jason

2013-01-01

We have observed the dwarf galaxy IC 1613 at multiple epochs in the midinfrared using Spitzer and the in the near-infrared using the new FourStar near-IR camera on Magellan. We have constructed Cepheid period luminosity relations in the J, H, Ks, [3.6] and [4.5] bands and have used the run of their apparent distance moduli as a function of wavelength to derive the line of sight reddening and distance to IC 1613. Using a nineband fit, we find E(BV ) = 0.050.01 mag and an extinction corrected distance modulus of 0 = 24.29 0.03statistical 0.03systematic mag. By comparing our multiband and [3.6] distance moduli to results from the tip of the red giant branch and red clump distance indicators, we find that metallicity has no measurable effect on Cepheid distances at 3.6 m in the metallicity range 1.0 [Fe/H] 0.2, hence derivations of the Hubble constant at this wavelength require no correction for metallicity.

Ultracompact Blue Dwarf Galaxies: Hubble Space Telescope Imaging and Stellar Population Analysis

Science.gov (United States)

Corbin, Michael R.; Vacca, William D.; Cid Fernandes, Roberto; Hibbard, John E.; Somerville, Rachel S.; Windhorst, Rogier A.

2006-11-01

We present deep Hubble Space Telescope (HST) Advanced Camera for Surveys/High Resolution Channel U-, narrow-V-, and I-band images of nine ``ultracompact'' blue dwarf galaxies (UCBDs) selected from the Sloan Digital Sky Survey (SDSS). We define UCBDs as local (zPOX 186, but the structure of several of them suggests that their current star formation has been triggered by the collisions/mergers of smaller clumps of stars. In one case, HS 0822+3542, the images resolve what may be two small (~100 pc) components that have recently collided, supporting this interpretation. In six of the objects much of the star formation is concentrated in young massive clusters, contributing to their compactness in ground-based images. The evidence that the galaxies consist mainly of ~10 Gyr old stars establishes that they are not protogalaxies, forming their first generation of stars. Their low metallicities are more likely to be the result of the escape of supernova ejecta, rather than youth.

The 1.5 Ms Observing Campaign on IRAS 13224-3809: X-ray Spectral Analysis I.

Science.gov (United States)

Jiang, J.; Parker, M. L.; Fabian, A. C.; Alston, W. N.; Buisson, D. J. K.; Cackett, E. M.; Chiang, C.-Y.; Dauser, T.; Gallo, L. C.; García, J. A.; Harrison, F. A.; Lohfink, A. M.; De Marco, B.; Kara, E.; Miller, J. M.; Miniutti, G.; Pinto, C.; Walton, D. J.; Wilkins, D. R.

2018-03-01

We present a detailed spectral analysis of the recent 1.5 Ms XMM-Newton observing campaign on the narrow line Seyfert 1 galaxy IRAS 13224-3809, taken simultaneously with 500 ks of NuSTAR data. The X-ray lightcurve shows three flux peaks, registering at about 100 times the minimum flux seen during the campaign, and rapid variability with a time scale of kiloseconds. The spectra are well fit with a primary powerlaw continuum, two relativistic-blurred reflection components from the inner accretion disk with very high iron abundance, and a simple blackbody-shaped model for the remaining soft excess. The spectral variability is dominated by the power law continuum from a corona region within a few gravitational radii from the black hole. Additionally, blueshifted Ne X, Mg XII, Si XIV and S XVI absorption lines are identified in the stacked low-flux spectrum, confirming the presence of a highly ionized outflow with velocity up to v = 0.263 and 0.229 c. We fit the absorption features with xstar models and find a relatively constant velocity outflow through the whole observation. Finally, we replace the bbody and supersolar abundance reflection models by fitting the soft excess successfully with the extended reflection model relxillD, which allows for higher densities than the standard relxill model. This returns a disk electron density ne > 1018.7 cm-3 and lowers the iron abundance from Z_Fe=24^{+3}_{-4}Z_⊙ with ne ≡ 1015 cm-3 to Z_Fe=6.6^{+0.8}_{-2.1}Z_⊙.

Gravity waves as a probe of the Hubble expansion rate during an electroweak scale phase transition

International Nuclear Information System (INIS)

Chung, Daniel J. H.; Zhou Peng

2010-01-01

Just as big bang nucleosynthesis allows us to probe the expansion rate when the temperature of the Universe was around 1 MeV, the measurement of gravity waves from electroweak scale first order phase transitions may allow us to probe the expansion rate when the temperature of the Universe was at the electroweak scale. We compute the simple transformation rule for the gravity wave spectrum under the scaling transformation of the Hubble expansion rate. We then apply this directly to the scenario of quintessence kination domination and show how gravity wave spectra would shift relative to Laser Interferometer Space Antenna and Big Bang Observer projected sensitivities.

Ultradeep Near-Infrared ISAAC Observations of the Hubble Deep Field South: Observations, Reduction, Multicolor Catalog, and Photometric Redshifts

Science.gov (United States)

Labbé, Ivo; Franx, Marijn; Rudnick, Gregory; Schreiber, Natascha M. Förster; Rix, Hans-Walter; Moorwood, Alan; van Dokkum, Pieter G.; van der Werf, Paul; Röttgering, Huub; van Starkenburg, Lottie; van der Wel, Arjen; Kuijken, Konrad; Daddi, Emanuele

2003-03-01

We present deep near-infrared (NIR) Js-, H-, and Ks-band ISAAC imaging of the Wide Field Planetary Camera 2 (WFPC2) field of the Hubble Deep Field South (HDF-S). The 2.5‧×2.5‧ high Galactic latitude field was observed with the Very Large Telescope under the best seeing conditions, with integration times amounting to 33.6 hr in Js, 32.3 hr in H, and 35.6 hr in Ks. We reach total AB magnitudes for point sources of 26.8, 26.2, and 26.2, respectively (3 σ), which make it the deepest ground-based NIR observation to date and the deepest Ks-band data in any field. The effective seeing of the co-added images is ~0.45" in Js, ~0.48" in H, and ~0.46" in Ks. Using published WFPC2 optical data, we constructed a Ks-limited multicolor catalog containing 833 sources down to Ktots,AB2.3 (in Johnson magnitudes). Because they are extremely faint in the observed optical, they would be missed by ultraviolet-optical selection techniques, such as the U-dropout method. Based on service mode observations collected at the European Southern Observatory, Paranal, Chile (ESO Program 164.O-0612). Also based on observations with the NASA/ESA Hubble Space Telescope, obtained at the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy (AURA), Inc., under NASA contract NAS 5-26555.

UVUDF: Ultraviolet imaging of the Hubble ultra deep field with wide-field camera 3

Energy Technology Data Exchange (ETDEWEB)

Teplitz, Harry I.; Rafelski, Marc; Colbert, James W.; Hanish, Daniel J. [Infrared Processing and Analysis Center, MS 100-22, Caltech, Pasadena, CA 91125 (United States); Kurczynski, Peter; Gawiser, Eric [Department of Physics and Astronomy, Rutgers University, Piscataway, NJ 08854 (United States); Bond, Nicholas A.; Gardner, Jonathan P.; De Mello, Duilia F. [Laboratory for Observational Cosmology, Astrophysics Science Division, Code 665, Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Grogin, Norman; Koekemoer, Anton M.; Brown, Thomas M.; Coe, Dan; Ferguson, Henry C. [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Atek, Hakim [Laboratoire d' Astrophysique, École Polytechnique Fédérale de Lausanne (EPFL), Observatoire, CH-1290 Sauverny (Switzerland); Finkelstein, Steven L. [Department of Astronomy, The University of Texas at Austin, Austin, TX 78712 (United States); Giavalisco, Mauro [Astronomy Department, University of Massachusetts, Amherst, MA 01003 (United States); Gronwall, Caryl [Department of Astronomy and Astrophysics, The Pennsylvania State University, University Park, PA 16802 (United States); Lee, Kyoung-Soo [Department of Physics, Purdue University, 525 Northwestern Avenue, West Lafayette, IN 47907 (United States); Ravindranath, Swara, E-mail: hit@ipac.caltech.edu [Inter-University Centre for Astronomy and Astrophysics, Pune (India); and others

2013-12-01

We present an overview of a 90 orbit Hubble Space Telescope treasury program to obtain near-ultraviolet imaging of the Hubble Ultra Deep Field using the Wide Field Camera 3 UVIS detector with the F225W, F275W, and F336W filters. This survey is designed to: (1) investigate the episode of peak star formation activity in galaxies at 1 < z < 2.5; (2) probe the evolution of massive galaxies by resolving sub-galactic units (clumps); (3) examine the escape fraction of ionizing radiation from galaxies at z ∼ 2-3; (4) greatly improve the reliability of photometric redshift estimates; and (5) measure the star formation rate efficiency of neutral atomic-dominated hydrogen gas at z ∼ 1-3. In this overview paper, we describe the survey details and data reduction challenges, including both the necessity of specialized calibrations and the effects of charge transfer inefficiency. We provide a stark demonstration of the effects of charge transfer inefficiency on resultant data products, which when uncorrected, result in uncertain photometry, elongation of morphology in the readout direction, and loss of faint sources far from the readout. We agree with the STScI recommendation that future UVIS observations that require very sensitive measurements use the instrument's capability to add background light through a 'post-flash'. Preliminary results on number counts of UV-selected galaxies and morphology of galaxies at z ∼ 1 are presented. We find that the number density of UV dropouts at redshifts 1.7, 2.1, and 2.7 is largely consistent with the number predicted by published luminosity functions. We also confirm that the image mosaics have sufficient sensitivity and resolution to support the analysis of the evolution of star-forming clumps, reaching 28-29th magnitude depth at 5σ in a 0.''2 radius aperture depending on filter and observing epoch.

NASA and ESA astronauts visit ESO. Hubble repair team meets European astronomers in Garching.

Science.gov (United States)

1994-02-01

On Wednesday, February 16, 1994, seven NASA and ESA astronauts and their spouses will spend a day at the Headquarters of the European Southern Observatory. They are the members of the STS-61 crew that successfully repaired the Hubble Space Telescope during a Space Shuttle mission in December 1993. This will be the only stop in Germany during their current tour of various European countries. ESO houses the Space Telescope European Coordinating Facility (ST/ECF), a joint venture by the European Space Agency and ESO. This group of astronomers and computer specialists provide all services needed by European astronomers for observations with the Space Telescope. Currently, the European share is about 20 of the total time available at this telescope. During this visit, a Press Conference will be held on Wednesday, February 16, 11:45 - 12:30 at the ESO Headquarters Karl-Schwarzschild-Strasse 2 D-85748 Garching bei Munchen. Please note that participation in this Press Conference is by invitation only. Media representatives may obtain invitations from Mrs. E. Volk, ESO Information Service at this address (Tel.: +49-89-32006276; Fax.: +49-89-3202362), until Friday, February 11, 1994. After the Press Conference, between 12:30 - 14:00, a light refreshment will be served at the ESO Headquarters to all participants. >From 14:00 - 15:30, the astronauts will meet with students and teachers from the many scientific institutes in Garching in the course of an open presentation at the large lecture hall of the Physics Department of the Technical University. It is a 10 minute walk from ESO to the hall. Later the same day, the astronauts will be back at ESO for a private discussion of various space astronomy issues with their astronomer colleagues, many of whom are users of the Hubble Space Telescope, as well as ground-based telescopes at the ESO La Silla Observatory and elsewhere. The astronauts continue to Switzerland in the evening.

HIGH-RESOLUTION 8 mm AND 1 cm POLARIZATION OF IRAS 4A FROM THE VLA NASCENT DISK AND MULTIPLICITY (VANDAM) SURVEY

Energy Technology Data Exchange (ETDEWEB)

Cox, Erin G.; Harris, Robert J.; Looney, Leslie W.; Segura-Cox, Dominique M. [Department of Astronomy, University of Illinois at Urbana-Champaign, Urbana, IL 61801 (United States); Tobin, John [Leiden Observatory, Leiden University, P.O. Box 9513, 2000-RA Leiden (Netherlands); Li, Zhi-Yun [Department of Astronomy, University of Virginia, Charlottesville, VA 22903 (United States); Tychoniec, Łukasz [Astronomical Observatory Institute, Faculty of Physics, A. Mickiewicz University, Słoneczna 36, PL-60-268 Poznań (Poland); Chandler, Claire J.; Perez, Laura M. [National Radio Astronomy Observatory, Socorro, NM 87801 (United States); Dunham, Michael M. [Harvard-Smithsonian Center for Astrophysics, Cambridge, MA 02138 (United States); Kratter, Kaitlin [Steward Observatory, University of Arizona, Tucson, AZ 85721 (United States); Melis, Carl [Center for Astrophysics and Space Sciences, University of California, San Diego, CA 92093 (United States); Sadavoy, Sarah I., E-mail: egcox2@illinois.edu [Max-Planck-Institut für Astronomie, D-69117 Heidelberg (Germany)

2015-12-01

Magnetic fields can regulate disk formation, accretion, and jet launching. Until recently, it has been difficult to obtain high-resolution observations of the magnetic fields of the youngest protostars in the critical region near the protostar. The VANDAM survey is observing all known protostars in the Perseus Molecular Cloud. Here we present the polarization data of IRAS 4A. We find that with ∼0.″2 (50 AU) resolution at λ = 8.1 and 10.3 mm, the inferred magnetic field is consistent with a circular morphology, in marked contrast with the hourglass morphology seen on larger scales. This morphology is consistent with frozen-in field lines that were dragged in by rotating material entering the infall region. The field morphology is reminiscent of rotating circumstellar material near the protostar. This is the first polarization detection of a protostar at these wavelengths. We conclude from our observations that the dust emission is optically thin with β ∼ 1.3, suggesting that millimeter-/centimeter-sized grains have grown and survived in the short lifetime of the protostar.

Hubble Space Telescope Image of Omega Nebula

Science.gov (United States)

2002-01-01

This sturning image, taken by the newly installed Advanced Camera for Surveys (ACS) aboard the Hubble Space Telescope (HST), is an image of the center of the Omega Nebula. It is a hotbed of newly born stars wrapped in colorful blankets of glowing gas and cradled in an enormous cold, dark hydrogen cloud. The region of nebula shown in this photograph is about 3,500 times wider than our solar system. The nebula, also called M17 and the Swan Nebula, resides 5,500 light-years away in the constellation Sagittarius. The Swan Nebula is illuminated by ultraviolet radiation from young, massive stars, located just beyond the upper-right corner of the image. The powerful radiation from these stars evaporates and erodes the dense cloud of cold gas within which the stars formed. The blistered walls of the hollow cloud shine primarily in the blue, green, and red light emitted by excited atoms of hydrogen, nitrogen, oxygen, and sulfur. Particularly striking is the rose-like feature, seen to the right of center, which glows in the red light emitted by hydrogen and sulfur. As the infant stars evaporate the surrounding cloud, they expose dense pockets of gas that may contain developing stars. One isolated pocket is seen at the center of the brightest region of the nebula. Other dense pockets of gas have formed the remarkable feature jutting inward from the left edge of the image. The color image is constructed from four separate images taken in these filters: blue, near infrared, hydrogen alpha, and doubly ionized oxygen. Credit: NASA, H. Ford (JHU), G. Illingworth (USCS/LO), M. Clampin (STScI), G. Hartig (STScI), the ACS Science Team, and ESA.

The universe in a mirror the saga of the Hubble Space Telescope and the visionaries who built it

CERN Document Server

Zimmerman, Robert

2008-01-01

The Hubble Space Telescope has produced the most stunning images of the cosmos humanity has ever seen. It has transformed our understanding of the universe around us, revealing new information about its age and evolution, the life cycle of stars, and the very existence of black holes, among other startling discoveries. But it took an amazing amount of work and perseverance to get the first space telescope up and running. The Universe in a Mirror tells the story of this telescope and the visionaries responsible for its extraordinary accomplishments. Robert Zimmerman takes readers beh

VizieR Online Data Catalog: Hubble Legacy Archive ACS grism data (Kuemmel+, 2011)

Science.gov (United States)

Kuemmel, M.; Rosati, P.; Fosbury, R.; Haase, J.; Hook, R. N.; Kuntschner, H.; Lombardi, M.; Micol, A.; Nilsson, K. K.; Stoehr, F.; Walsh, J. R.

2011-09-01

A public release of slitless spectra, obtained with ACS/WFC and the G800L grism, is presented. Spectra were automatically extracted in a uniform way from 153 archival fields (or "associations") distributed across the two Galactic caps, covering all observations to 2008. The ACS G800L grism provides a wavelength range of 0.55-1.00um, with a dispersion of 40Å/pixel and a resolution of ~80Å for point-like sources. The ACS G800L images and matched direct images were reduced with an automatic pipeline that handles all steps from archive retrieval, alignment and astrometric calibration, direct image combination, catalogue generation, spectral extraction and collection of metadata. The large number of extracted spectra (73,581) demanded automatic methods for quality control and an automated classification algorithm was trained on the visual inspection of several thousand spectra. The final sample of quality controlled spectra includes 47919 datasets (65% of the total number of extracted spectra) for 32149 unique objects, with a median iAB-band magnitude of 23.7, reaching 26.5 AB for the faintest objects. Each released dataset contains science-ready 1D and 2D spectra, as well as multi-band image cutouts of corresponding sources and a useful preview page summarising the direct and slitless data, astrometric and photometric parameters. This release is part of the continuing effort to enhance the content of the Hubble Legacy Archive (HLA) with highly processed data products which significantly facilitate the scientific exploitation of the Hubble data. In order to characterize the slitless spectra, emission-line flux and equivalent width sensitivity of the ACS data were compared with public ground-based spectra in the GOODS-South field. An example list of emission line galaxies with two or more identified lines is also included, covering the redshift range 0.2-4.6. Almost all redshift determinations outside of the GOODS fields are new. The scope of science projects possible

HUBBLE SPACE TELESCOPE OBSERVATIONS OF MAIN-BELT COMET (596) SCHEILA

International Nuclear Information System (INIS)

Jewitt, David; Weaver, Harold; Mutchler, Max; Larson, Stephen; Agarwal, Jessica

2011-01-01

We present Hubble Space Telescope Observations of (596) Scheila during its recent dust outburst. The nucleus remained point-like with absolute magnitude H V = 8.85 ± 0.02 in our data, equal to the pre-outburst value, with no secondary fragments of diameter ≥100 m (for assumed albedos 0.04). We find a coma having a peak scattering cross section ∼2.2x10 4 km 2 , corresponding to a mass in micron-sized particles of ∼4x10 7 kg. The particles are deflected by solar radiation pressure on projected spatial scales ∼2x10 4 km, in the sunward direction, and swept from the vicinity of the nucleus on timescales of weeks. The coma fades by ∼30% between observations on UT 2010 December 27 and 2011 January 4. The observed mass loss is inconsistent with an origin either by rotational instability of the nucleus or by electrostatic ejection of regolith charged by sunlight. Dust ejection could be caused by the sudden but unexplained exposure of buried ice. However, the data are most simply explained by the impact, at ∼5 km s -1 , of a previously unknown asteroid ∼35 m in diameter.

PACMan to Help Sort Hubble Proposals

Science.gov (United States)

Kohler, Susanna

2017-04-01

Every year, astronomers submit over a thousand proposals requesting time on the Hubble Space Telescope (HST). Currently, humans must sort through each of these proposals by hand before sending them off for review. Could this burden be shifted to computers?A Problem of VolumeAstronomer Molly Peeples gathered stats on the HST submissions sent in last week for the upcoming HST Cycle 25 (the deadline was Friday night), relative to previous years. This years proposal round broke the record, with over 1200 proposals submitted in total for Cycle 25. [Molly Peeples]Each proposal cycle for HST time attracts on the order of 1100 proposals accounting for far more HST time than is available. The proposals are therefore carefully reviewed by around 150 international members of the astronomy community during a six-month process to select those with the highest scientific merit.Ideally, each proposal will be read by reviewers that have scientific expertise relevant to the proposal topic: if a proposal requests HST time to study star formation, for instance, then the reviewers assigned to it should have research expertise in star formation.How does this matching of proposals to reviewers occur? The current method relies on self-reported categorization of the submitted proposals. This is unreliable, however; proposals are often mis-categorized by submitters due to misunderstanding or ambiguous cases.As a result, the Science Policies Group at the Space Telescope Science Institute (STScI) which oversees the review of HST proposals must go through each of the proposals by hand and re-categorize them. The proposals are then matched to reviewers with self-declared expertise in the same category.With the number of HST proposals on the rise and the expectation that the upcoming James Webb Space Telescope (JWST) will elicit even more proposals for time than Hubble scientists at STScI and NASA are now asking: could the human hours necessary for this task be spared? Could a computer program

Hubble Space Telescope Imaging and Spectral Analysis of Two Brown Dwarf Binaries at the L Dwarf/T Dwarf Transition

OpenAIRE

Burgasser, Adam J.; Gagliuffi, Daniella C. Bardalez; Gizis, John E.

2010-01-01

We present a detailed examination of the brown dwarf multiples 2MASS J08503593+1057156 and 2MASS J17281150+3948593, both suspected of harboring components that straddle the L dwarf/T dwarf transition. Resolved photometry from Hubble Space Telescope/NICMOS show opposite trends in the relative colors of the components, with the secondary of 2MASS J0850+1057 being redder than its primary, while that of 2MASS J1728+3948 is bluer. We determine near-infrared component types by matching combined-lig...

Wisconsin Gravity Data for the Sawyers Area

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The gravity station data (3814 records) were compiled by Professor Ervin. This data base was received in April 1993. Principal gravity parameters include Free-Air...

Space Telescope and Optical Reverberation Mapping Project.I. Ultraviolet Observations of the Seyfert 1 Galaxy NGC 5548 with the Cosmic Origins Spectrograph on Hubble Space Telescope

NARCIS (Netherlands)

De Rosa, G.; Peterson, B.M.; Ely, J.; Kriss, G.A.; Crenshaw, D.M.; Horne, K.; Korista, K.T.; Netzer, H.; Pogge, R.W.; Arévalo, P.; Barth, A.J.; Bentz, M.C.; Brandt, W.N.; Breeveld, A.A.; Brewer, B.J.; Dalla Bontà, E.; De Lorenzo-Cáceres, A.; Denney, K.D.; Dietrich, M.; Edelson, R.; Evans, P.A.; Fausnaugh, M.M.; Gehrels, N.; Gelbord, J.M.; Goad, M.R.; Grier, C.J.; Grupe, D.; Hall, P.B.; Kaastra, J.; Kelly, B.C.; Kennea, J.A.; Kochanek, C.S.; Lira, P.; Mathur, S.; McHardy, I.M.; Nousek, J.A.; Pancoast, A.; Papadakis, I.; Pei, L.; Schimoia, J.S.; Siegel, M.; Starkey, D.; Treu, T.; Uttley, P.; Vaughan, S.; Vestergaard, M.; Villforth, C.; Yan, H.; Young, S.; Zu, Y.

2015-01-01

We describe the first results from a six-month long reverberation-mapping experiment in the ultraviolet based on 171 observations of the Seyfert 1 galaxy NGC 5548 with the Cosmic Origins Spectrograph on the Hubble Space Telescope. Significant correlated variability is found in the continuum and

PROBING VERY BRIGHT END OF GALAXY LUMINOSITY FUNCTION AT z ∼> 7 USING HUBBLE SPACE TELESCOPE PURE PARALLEL OBSERVATIONS

International Nuclear Information System (INIS)

Yan Haojing; Yan Lin; Zamojski, Michel A.; Windhorst, Rogier A.; McCarthy, Patrick J.; Fan Xiaohui; Dave, Romeel; Roettgering, Huub J. A.; Koekemoer, Anton M.; Robertson, Brant E.; Cai Zheng

2011-01-01

We report the first results from the Hubble Infrared Pure Parallel Imaging Extragalactic Survey, which utilizes the pure parallel orbits of the Hubble Space Telescope to do deep imaging along a large number of random sightlines. To date, our analysis includes 26 widely separated fields observed by the Wide Field Camera 3, which amounts to 122.8 arcmin 2 in total area. We have found three bright Y 098 -dropouts, which are candidate galaxies at z ∼> 7.4. One of these objects shows an indication of peculiar variability and its nature is uncertain. The other two objects are among the brightest candidate galaxies at these redshifts known to date (L>2L*). Such very luminous objects could be the progenitors of the high-mass Lyman break galaxies observed at lower redshifts (up to z ∼ 5). While our sample is still limited in size, it is much less subject to the uncertainty caused by 'cosmic variance' than other samples because it is derived using fields along many random sightlines. We find that the existence of the brightest candidate at z ∼ 7.4 is not well explained by the current luminosity function (LF) estimates at z ∼ 8. However, its inferred surface density could be explained by the prediction from the LFs at z ∼ 7 if it belongs to the high-redshift tail of the galaxy population at z ∼ 7.

Chemical and Physical Picture of IRAS 16293–2422 Source B at a Sub-arcsecond Scale Studied with ALMA

Science.gov (United States)

Oya, Yoko; Moriwaki, Kana; Onishi, Shusuke; Sakai, Nami; López–Sepulcre, Ana; Favre, Cécile; Watanabe, Yoshimasa; Ceccarelli, Cecilia; Lefloch, Bertrand; Yamamoto, Satoshi

2018-02-01

We have analyzed the OCS, H2CS, CH3OH, and HCOOCH3 data observed toward the low-mass protostar IRAS 16293–2422 Source B at a sub-arcsecond resolution with ALMA. A clear chemical differentiation is seen in their distributions; OCS and H2CS are extended with a slight rotation signature, while CH3OH and HCOOCH3 are concentrated near the protostar. Such a chemical change in the vicinity of the protostar is similar to the companion (Source A) case. The extended component is interpreted by the infalling-rotating envelope model with a nearly face-on configuration. The radius of the centrifugal barrier of the infalling-rotating envelope is roughly evaluated to be (30–50) au. The observed lines show the inverse P-Cygni profile, indicating the infall motion within a few 10 au from the protostar. The nearly pole-on geometry of the outflow lobes is inferred from the SiO distribution, and thus, the infalling and outflowing motions should coexist along the line of sight to the protostar. This implies that the infalling gas is localized near the protostar and the current launching points of the outflow have an offset from the protostar. A possible mechanism for this configuration is discussed.

Protein (Viridiplantae): 356536840 [PGDBj - Ortholog DB

Lifescience Database Archive (English)

Full Text Available 24:2780 3398:2780 71240:414 91827:414 71275:1623 91835:562 72025:981 3803:981 3814:981 163735:1026 3846:1026 3847:1026 PREDICTED: pat...ellin-4-like Glycine max MNNTNECCCNDENGKIVVGVPLVFNFFDKNTNNIEKSLKVQLEKKNQLEDHDCDQEDD

Protein (Viridiplantae): 356543245 [PGDBj - Ortholog DB

Lifescience Database Archive (English)

Full Text Available 24:2780 3398:2780 71240:414 91827:414 71275:1623 91835:562 72025:981 3803:981 3814:981 163735:1026 3846:1026 3847:1026 PREDICTED: pat...ellin-3-like Glycine max MAQNDSNPTPPPEPHVAAEPITEDLVQDKEEEDDSSKIVIPVPESESLSLKEDSNRVS

Protein (Viridiplantae): 356506815 [PGDBj - Ortholog DB

Lifescience Database Archive (English)

Full Text Available 24:2780 3398:2780 71240:414 91827:414 71275:1623 91835:562 72025:981 3803:981 3814:981 163735:1026 3846:1026 3847:1026 PREDICTED: pat...ellin-6-like Glycine max MMDTTSSPLSLQTQKTTFQELPEASPKPYKKGIVATLMGGGLFKEDNYFVSLLRSSEK

X-RAY EMISSION FROM YOUNG STARS IN THE MASSIVE STAR-FORMING REGION IRAS 20126+4104

International Nuclear Information System (INIS)

Anderson, C. N.; Hofner, P.; Creech-Eakman, M.; Shepherd, D.

2011-01-01

We present a 40 ks Chandra observation of the IRAS 20126+4104 core region. In the inner 6'' two X-ray sources were detected, which are coincident with the radio jet source I20S and the variable radio source I20Var. No X-ray emission was detected from the nearby massive protostar I20N. The spectra of both detected sources are hard and highly absorbed, with no emission below 3 keV. For I20S, the measured 0.5-8 keV count rate was 4.3 counts ks -1 . The X-ray spectrum was fitted with an absorbed 1T APEC model with an energy of kT =10 keV and an absorbing column of N H = 1.2 x 10 23 cm -2 . An unabsorbed X-ray luminosity of about 1.4 x 10 32 erg s -1 was estimated. The spectrum shows broad line emission between 6.4 and 6.7 keV, indicative of emission from both neutral and highly ionized iron. The X-ray light curve indicates that I20S is marginally variable; however, no flare emission was observed. The variable radio source I20Var was detected with a count rate of 0.9 counts ks -1 but there was no evidence of X-ray variability. The best-fit spectral model is a 1T APEC model with an absorbing hydrogen column of N H = 1.1 x 10 23 cm -2 and a plasma energy of kT = 6.0 keV. The unabsorbed X-ray luminosity is about 3 x 10 31 erg s -1 .

Thermally Induced Vibrations of the Hubble Space Telescope's Solar Array 3 in a Test Simulated Space Environment

Science.gov (United States)

Early, Derrick A.; Haile, William B.; Turczyn, Mark T.; Griffin, Thomas J. (Technical Monitor)

2001-01-01

NASA Goddard Space Flight Center and the European Space Agency (ESA) conducted a disturbance verification test on a flight Solar Array 3 (SA3) for the Hubble Space Telescope using the ESA Large Space Simulator (LSS) in Noordwijk, the Netherlands. The LSS cyclically illuminated the SA3 to simulate orbital temperature changes in a vacuum environment. Data acquisition systems measured signals from force transducers and accelerometers resulting from thermally induced vibrations of the SAI The LSS with its seismic mass boundary provided an excellent background environment for this test. This paper discusses the analysis performed on the measured transient SA3 responses and provides a summary of the results.

Bayesian `hyper-parameters' approach to joint estimation: the Hubble constant from CMB measurements

Science.gov (United States)

Lahav, O.; Bridle, S. L.; Hobson, M. P.; Lasenby, A. N.; Sodré, L.

2000-07-01

Recently several studies have jointly analysed data from different cosmological probes with the motivation of estimating cosmological parameters. Here we generalize this procedure to allow freedom in the relative weights of various probes. This is done by including in the joint χ2 function a set of `hyper-parameters', which are dealt with using Bayesian considerations. The resulting algorithm, which assumes uniform priors on the log of the hyper-parameters, is very simple: instead of minimizing \\sum \\chi_j2 (where \\chi_j2 is per data set j) we propose to minimize \\sum Nj (\\chi_j2) (where Nj is the number of data points per data set j). We illustrate the method by estimating the Hubble constant H0 from different sets of recent cosmic microwave background (CMB) experiments (including Saskatoon, Python V, MSAM1, TOCO and Boomerang). The approach can be generalized for combinations of cosmic probes, and for other priors on the hyper-parameters.

Theoretical colours and isochrones for some Hubble Space Telescope colour systems. II

Science.gov (United States)

Paltoglou, G.; Bell, R. A.

1991-01-01

A grid of synthetic surface brightness magnitudes for 14 bandpasses of the Hubble Space Telescope Faint Object Camera is presented, as well as a grid of UBV, uvby, and Faint Object Camera surface brightness magnitudes derived from the Gunn-Stryker spectrophotometric atlas. The synthetic colors are used to examine the transformations between the ground-based Johnson UBV and Stromgren uvby systems and the Faint Object Camera UBV and uvby. Two new four-color systems, similar to the Stromgren system, are proposed for the determination of abundance, temperature, and surface gravity. The synthetic colors are also used to calculate color-magnitude isochrones from the list of theoretical tracks provided by VandenBerg and Bell (1990). It is shown that by using the appropriate filters it is possible to minimize the dependence of this color difference on metallicity. The effects of interstellar reddening on various Faint Object Camera colors are analyzed as well as the observational requirements for obtaining data of a given signal-to-noise for each of the 14 bandpasses.

Dynamical 3-Space: Supernovae and the Hubble Expansion — the Older Universe without Dark Energy

Directory of Open Access Journals (Sweden)

Cahill R. T.

2007-10-01

Full Text Available We apply the new dynamics of 3-space to cosmology by deriving a Hubble expansion solution. This dynamics involves two constants; G and — the fine structure constant. This solution gives an excellent parameter-free fit to the recent supernova and gamma- ray burst redshift data without the need for “dark energy” or “dark matter”. The data and theory together imply an older age for the universe of some 14.7Gyrs. The 3-space dynamics has explained the bore hole anomaly, spiral galaxy flat rotation speeds, the masses of black holes in spherical galaxies, gravitational light bending and lensing, all without invoking “dark matter” or “dark energy”. These developments imply that a new understanding of the universe is now available.

THE CARNEGIE HUBBLE PROGRAM: THE LEAVITT LAW AT 3.6 μm AND 4.5 μm IN THE LARGE MAGELLANIC CLOUD

International Nuclear Information System (INIS)

Scowcroft, Victoria; Freedman, Wendy L.; Madore, Barry F.; Monson, Andrew J.; Persson, S. E.; Seibert, Mark; Rigby, Jane R.; Sturch, Laura

2011-01-01

The Carnegie Hubble Program is designed to improve the extragalactic distance scale using data from the post-cryogenic era of Spitzer. The ultimate goal is a determination of the Hubble constant to an accuracy of 2%. This paper is the first in a series on the Cepheid population of the Large Magellanic Cloud, and focusses on the period-luminosity (PL) relations (Leavitt laws) that will be used, in conjunction with observations of Milky Way Cepheids, to set the slope and zero point of the Cepheid distance scale in the mid-infrared. To this end, we have obtained uniformly sampled light curves for 85 LMC Cepheids, having periods between 6 and 140 days. PL and period-color relations are presented in the 3.6 μm and 4.5 μm bands. We demonstrate that the 3.6 μm band is a superb distance indicator. The cyclical variation of the [3.6]–[4.5] color has been measured for the first time. We attribute the amplitude and phase of the color curves to the dissociation and recombination of CO molecules in the Cepheid's atmosphere. The CO affects only the 4.5 μm flux making it a potential metallicity indicator.

The role of near infrared radiation in photoaging of the skin.

Science.gov (United States)

Schroeder, Peter; Haendeler, Judith; Krutmann, Jean

2008-07-01

Infrared (IR) radiation is non-ionizing, electromagnetic radiation with wavelengths between 760 nm and 1 mm, which is further divided into IRA, IRB and IRC. IR accounts for more than half of the solar energy that reaches the human skin. While IRB and IRC do not penetrate deeply into the skin, more than 65% of IRA reaches the dermis. Human skin is increasingly exposed to IRA-radiation; most relevant sources are (i) natural solar radiation consisting of over 30% IRA, (ii) artificial IRA sources used for therapeutic or wellness purposes and (iii) artificial UV sources contaminated with IRA. As part of natural sunlight, IRA significantly contributes to extrinsic skin aging. This article reviews the cutaneous effects of IRA-radiation, the underlying molecular mechanisms and the available protective strategies.

Isochrone Fitting of Hubble Photometry in UV–VIS–IR Bands

Science.gov (United States)

Barker, Hallie; Paust, Nathaniel E. Q.

2018-03-01

We present new isochrone fits to color–magnitude diagrams from Hubble Space Telescope Wide Field Camera 3 and Advanced Camera for Surveys photometry of the globular clusters M13 and M80 in five bands from the ultraviolet to near-infrared. Isochrone fits to the photometry using the Dartmouth Stellar Evolution Program (DSEP), the PAdova and TRieste Stellar Evolution Code (PARSEC), and MESA Isochrones and Stellar Tracks (MIST) are examined to study the isochrone morphology. Additionally, cluster ages, extinctions, and distances are found from the visible-infrared color–magnitude diagrams. We conduct careful qualitative analysis on the inconsistencies of the fits across twelve color combinations of the five observed bands, and find that the (F606W‑F814W) color generally produces very good fits, but that there are large discrepancies when the data is fit using colors including UV bands for all three models. We also find that the best fits in the UV are achieved using MIST isochrones, but that they require metallicities that are lower than the other two models, as well published spectroscopic values. Finally, we directly compare DSEP and PARSEC by performing isochrone-isochrone fitting, and find that, for globular cluster aged populations, similar appearing PARSEC isochrones are on average 1.5 Gyr younger than DSEP isochrones. We find that the two models become less discrepant at lower metallicities.

Variability search in M 31 using principal component analysis and the Hubble Source Catalogue

Science.gov (United States)

Moretti, M. I.; Hatzidimitriou, D.; Karampelas, A.; Sokolovsky, K. V.; Bonanos, A. Z.; Gavras, P.; Yang, M.

2018-06-01

Principal component analysis (PCA) is being extensively used in Astronomy but not yet exhaustively exploited for variability search. The aim of this work is to investigate the effectiveness of using the PCA as a method to search for variable stars in large photometric data sets. We apply PCA to variability indices computed for light curves of 18 152 stars in three fields in M 31 extracted from the Hubble Source Catalogue. The projection of the data into the principal components is used as a stellar variability detection and classification tool, capable of distinguishing between RR Lyrae stars, long-period variables (LPVs) and non-variables. This projection recovered more than 90 per cent of the known variables and revealed 38 previously unknown variable stars (about 30 per cent more), all LPVs except for one object of uncertain variability type. We conclude that this methodology can indeed successfully identify candidate variable stars.

Food selection in Microtus arvalis: the role of plant functional traits

Czech Academy of Sciences Publication Activity Database

Lantová, P.; Lanta, Vojtěch

2009-01-01

Roč. 24, č. 4 (2009), s. 831-838 ISSN 0912-3814 Institutional research plan: CEZ:AV0Z60050516 Keywords : common vole * Electivity index, * plant functional groups Subject RIV: EF - Botanics Impact factor: 1.485, year: 2009

Emission-Line Galaxies from the PEARS Hubble Ultra Deep Field: A 2-D Detection Method and First Results

Science.gov (United States)

Gardner, J. P.; Straughn, Amber N.; Meurer, Gerhardt R.; Pirzkal, Norbert; Cohen, Seth H.; Malhotra, Sangeeta; Rhoads, james; Windhorst, Rogier A.; Gardner, Jonathan P.; Hathi, Nimish P.;

The UDF05 Follow-up of the Hubble Ultra Deep Field. III. The Luminosity Function at z ~ 6

Science.gov (United States)

Su, Jian; Stiavelli, Massimo; Oesch, Pascal; Trenti, Michele; Bergeron, Eddie; Bradley, Larry; Carollo, Marcella; Dahlen, Tomas; Ferguson, Henry C.; Giavalisco, Mauro; Koekemoer, Anton; Lilly, Simon; Lucas, Ray A.; Mobasher, Bahram; Panagia, Nino; Pavlovsky, Cheryl

2011-09-01

In this paper, we present a derivation of the rest-frame 1400 Å luminosity function (LF) at redshift six from a new application of the maximum likelihood method by exploring the five deepest Hubble Space Telescope/Advanced Camera for Surveys (HST/ACS) fields, i.e., the Hubble Ultra Deep Field, two UDF05 fields, and two Great Observatories Origins Deep Survey fields. We work on the latest improved data products, which makes our results more robust than those of previous studies. We use unbinned data and thereby make optimal use of the information contained in the data set. We focus on the analysis to a magnitude limit where the completeness is larger than 50% to avoid possibly large errors in the faint end slope that are difficult to quantify. We also take into account scattering in and out of the dropout sample due to photometric errors by defining for each object a probability that it belongs to the dropout sample. We find the best-fit Schechter parameters to the z ~ 6 LF are α = 1.87 ± 0.14, M * = -20.25 ± 0.23, and phi* = 1.77+0.62 -0.49 × 10-3 Mpc-3. Such a steep slope suggests that galaxies, especially the faint ones, are possibly the main sources of ionizing photons in the universe at redshift six. We also combine results from all studies at z ~ 6 to reach an agreement in the 95% confidence level that -20.45 Universities for Research in Astronomy, Inc., under NASA contract NAS 5-26555. These observations are associated with program 10632 and 11563.

Local work-function changes of Pt(111) studied by STM and IRAS: coadsorption of Cl - with H 3O +, NO, and CO molecules

Science.gov (United States)

Fukushima, Takashi; Song, Moon-Bong; Ito, Masatoki

2000-10-01

The coadsorption of chloride anion (Cl -) with hydronium cation (H 3O +), nitrogen monoxide (NO), and carbon monoxide (CO) on Pt(111) was studied in an ultra-high-vacuum system using scanning tunneling microscopy (STM), infrared reflection absorption spectroscopy (IRAS), and low-energy electron diffraction (LEED). HCl molecules adsorbed on Pt(111) at 100 K form a (3×3) structure ( θCl -=0.44). Water adsorption on the 3×3 structure produces c(4×2)-(Cl -+H 3O +) coadsorption structures. The hydronium cation adsorbs through oxygen lone pair, and hydrogen bonding (OH…Cl) extends on the surface with these structures. Stretching absorption bands of NO (or CO) adsorbed on the 3×3-Cl - and c(4×2)-(Cl -+H 3O +) adlayers on Pt(111) show remarkably higher and lower frequency shifts, respectively. The frequency shifts can be explained by the local charge density states of platinum atoms derived from electron withdrawal or supply from the coadsorbates (Cl - or H 3O +) to platinum atoms.

Are Ultra-faint Galaxies at z = 6-8 Responsible for Cosmic Reionization? Combined Constraints from the Hubble Frontier Fields Clusters and Parallels

Science.gov (United States)

Atek, Hakim; Richard, Johan; Jauzac, Mathilde; Kneib, Jean-Paul; Natarajan, Priyamvada; Limousin, Marceau; Schaerer, Daniel; Jullo, Eric; Ebeling, Harald; Egami, Eiichi; Clement, Benjamin

2015-11-01

We use deep Hubble Space Telescope imaging of the Frontier Fields to accurately measure the galaxy rest-frame ultraviolet luminosity function (UV LF) in the redshift range z ˜ 6-8. We combine observations in three lensing clusters, A2744, MACS 0416, and MACS 0717, and their associated parallel fields to select high-redshift dropout candidates. We use the latest lensing models to estimate the flux magnification and the effective survey volume in combination with completeness simulations performed in the source plane. We report the detection of 227 galaxy candidates at z = 6-7 and 25 candidates at z ˜ 8. While the total survey area is about 4 arcmin2 in each parallel field, it drops to about 0.6-1 arcmin2 in the cluster core fields because of the strong lensing. We compute the UV LF at z ˜ 7 using the combined galaxy sample and perform Monte Carlo simulations to determine the best-fit Schechter parameters. We are able to reliably constrain the LF down to an absolute magnitude of MUV = -15.25, which corresponds to 0.005 L⋆. More importantly, we find that the faint-end slope remains steep down to this magnitude limit with α =-{2.04}-0.17+0.13. We find a characteristic magnitude of {M}\\star =-{20.89}-0.72+0.60 and log(ϕ⋆) = -{3.54}-0.45+0.48. Our results confirm the most recent results in deep blank fields but extend the LF measurements more than two magnitudes deeper. The UV LF at z ˜ 8 is not very well constrained below MUV = -18 owing to the small number statistics and incompleteness uncertainties. To assess the contribution of galaxies to cosmic reionization, we derive the UV luminosity density at z ˜ 7 by integrating the UV LF down to an observational limit of MUV = -15. We show that our determination of log(ρUV) = 26.2 ± 0.13 (erg s-1 Hz-1 Mpc-3) can be sufficient to maintain reionization with an escape fraction of ionizing radiation of fesc = 10%-15%. Future Hubble Frontier Fields observations will certainly improve the constraints on the UV LF at

A Hubble Space Telescope Survey of the Disk Cluster Population of M31. II. Advanced Camera for Surveys Pointings

Science.gov (United States)

Krienke, O. K.; Hodge, P. W.

2008-01-01

This paper reports on a survey of star clusters in M31 based on archival images from the Hubble Space Telescope. Paper I reported results from images obtained with the Wide Field Planetary Camera 2 (WFPC2) and this paper reports results from the Advanced Camera for Surveys (ACS). The ACS survey has yielded a total of 339 star clusters, 52 of which—mostly globular clusters—were found to have been cataloged previously. As for the previous survey, the luminosity function of the clusters drops steeply for absolute magnitudes fainter than MV = -3 the implied cluster mass function has a turnover for masses less than a few hundred solar masses. The color-integrated magnitude diagram of clusters shows three significant features: (1) a group of very red, luminous objects: the globular clusters, (2) a wide range in color for the fainter clusters, representing a considerable range in age and reddening, and (3) a maximum density of clusters centered approximately at V = 21, B - V = 0.30, V - I = 0.50, where there are intermediate-age, intermediate-mass clusters with ages close to 500 million years and masses of about 2000 solar masses. We give a brief qualitative interpretation of the distribution of clusters in the CMDs in terms of their formation and destruction rates. Based on observations with the NASA/ESA Hubble Space Telescope obtained at the Space Telescope Science Institute, which is operated by the Association of Universities for research in astronomy, Inc., under NASA contract NAS 5-26555.

HUBBLE SPACE TELESCOPE ASTROMETRY OF THE PROCYON SYSTEM

Energy Technology Data Exchange (ETDEWEB)

Bond, Howard E. [Department of Astronomy and Astrophysics, Pennsylvania State University, University Park, PA 16802 (United States); Gilliland, Ronald L.; Kozhurina-Platais, Vera; Nelan, Edmund P. [Space Telescope Science Institute, 3700 San Martin Dr., Baltimore, MD 21218 (United States); Schaefer, Gail H. [The CHARA Array of Georgia State University, Mount Wilson Observatory, Mount Wilson, CA 91023 (United States); Demarque, Pierre; Girard, Terrence M. [Department of Astronomy, Yale University, Box 208101, New Haven, CT 06520 (United States); Holberg, Jay B. [Lunar and Planetary Laboratory, University of Arizona, 1541 E. University Blvd., Tucson, AZ 85721 (United States); Gudehus, Donald [Department of Physics and Astronomy, Georgia State University, Atlanta, GA 30303 (United States); Mason, Brian D. [U.S. Naval Observatory, 3450 Massachusetts Ave., Washington, DC 20392 (United States); Burleigh, Matthew R.; Barstow, Martin A., E-mail: heb11@psu.edu [Department of Physics and Astronomy, University of Leicester, Leicester LE1 7RH (United Kingdom)

2015-11-10

The nearby star Procyon is a visual binary containing the F5 IV-V subgiant Procyon A, orbited in a 40.84-year period by the faint DQZ white dwarf (WD) Procyon B. Using images obtained over two decades with the Hubble Space Telescope, and historical measurements back to the 19th century, we have determined precise orbital elements. Combined with measurements of the parallax and the motion of the A component, these elements yield dynamical masses of 1.478 ± 0.012 M{sub ⊙} and 0.592 ± 0.006 M{sub ⊙} for A and B, respectively. The mass of Procyon A agrees well with theoretical predictions based on asteroseismology and its temperature and luminosity. Use of a standard core-overshoot model agrees best for a surprisingly high amount of core overshoot. Under these modeling assumptions, Procyon A’s age is ∼2.7 Gyr. Procyon B’s location in the H-R diagram is in excellent agreement with theoretical cooling tracks for WDs of its dynamical mass. Its position in the mass–radius plane is also consistent with theory, assuming a carbon–oxygen core and a helium-dominated atmosphere. Its progenitor’s mass was 1.9–2.2 M{sub ⊙}, depending on its amount of core overshoot. Several astrophysical puzzles remain. In the progenitor system, the stars at periastron were separated by only ∼5 AU, which might have led to tidal interactions and even mass transfer; yet there is no direct evidence that these have occurred. Moreover the orbital eccentricity has remained high (∼0.40). The mass of Procyon B is somewhat lower than anticipated from the initial-to-final-mass relation seen in open clusters. The presence of heavy elements in its atmosphere requires ongoing accretion, but the place of origin is uncertain.

Hubble Space Telescope Image, Supernova Remnant Cassiopeia A

Science.gov (United States)

2000-01-01

The colorful streamers that float across the sky in this photo taken by NASA's Hubble Space Telescope (HST) were created by the universe's biggest firecracker, the titanic supernova explosion of a massive star. The light from the exploding star reached Earth 320 years ago, nearly a century before the United States celebrated its birth with a bang. The dead star's shredded remains are called Cassiopeia A, or 'Cas A' for short. Cas A is the youngest known supernova remnant in our Milky Way Galaxy and resides 10,000 light-years away in the constellation Cassiopeia, so the star actually blew up 10,000 years before the light reached Earth in the late 1600s. This HST image of Cas A shows for the first time that the debris is arranged into thousands of small, cooling knots of gas. This material eventually will be recycled into building new generations of stars and planets. Our own Sun and planets are constructed from the debris of supernovae that exploded billions of years ago. This photo shows the upper rim of the super nova remnant's expanding shell. Near the top of the image are dozens of tiny clumps of matter. Each small clump, originally just a small fragment of the star, is tens of times larger than the diameter of our solar system. The colors highlight parts of the debris where chemical elements are glowing. The dark blue fragments, for example, are richest in oxygen; the red material is rich in sulfur. The images were taken with the Wide Field and Planetary Camera 2 in January 2000 and January 2002. Image Credit: NASA and HST team (Stoics/AURA). Acknowledgment: R. Fesen (Darmouth) and J. Morse ( Univ. of Colorado).

Hubble Space Telescope Astrometry of the Procyon System

Science.gov (United States)

Bond, Howard E.; Gilliland, Ronald L.; Schaefer, Gail H.; Demarque, Pierre; Girard, Terrence M.; Holberg, Jay B.; Gudehus, Donald; Mason, Brian D.; Kozhurina-Platais, Vera; Burleigh, Matthew R.

2015-01-01

The nearby star Procyon is a visual binary containing the F5 IV-V subgiant Procyon A, orbited in a 40.84-year period by the faint DQZ white dwarf (WD) Procyon B. Using images obtained over two decades with the Hubble Space Telescope, and historical measurements back to the 19th century, we have determined precise orbital elements. Combined with measurements of the parallax and the motion of the A component, these elements yield dynamical masses of 1.478 plus or minus 0.012M and 0.592 plus or minus 0.006M for A and B, respectively. The mass of Procyon A agrees well with theoretical predictions based on asteroseismology and its temperature and luminosity. Use of a standard core-overshoot model agrees best for a surprisingly high amount of core overshoot. Under these modeling assumptions, Procyon A's age is approximately 2.7 Gyr. Procyon B's location in the H-R diagram is in excellent agreement with theoretical cooling tracks for WDs of its dynamical mass. Its position in the mass-radius plane is also consistent with theory, assuming a carbon-oxygen core and a helium-dominated atmosphere. Its progenitor's mass was 1.9-2.2M, depending on its amount of core overshoot. Several astrophysical puzzles remain. In the progenitor system, the stars at periastron were separated by only approximately AU, which might have led to tidal interactions and even mass transfer; yet there is no direct evidence that these have occurred. Moreover the orbital eccentricity has remained high (approximately 0.40). The mass of Procyon B is somewhat lower than anticipated from the initial-to-final-mass relation seen in open clusters. The presence of heavy elements in its atmosphere requires ongoing accretion, but the place of origin is uncertain.

Hubble Space Telescope EVA Power Ratchet Tool redesign

Science.gov (United States)

Richards, Paul W.; Park, Chan; Brown, Lee

The Power Ratchet Tool (PRT) is a self contained, power-driven, 3/8 inch drive ratchet wrench which will be used by astronauts during Extravehicular Activities (EVA). This battery-powered tool is controlled by a dedicated electonic controller. The PRT was flown during the Hubble Space Telescope (HST) Deployment Mission STS-31 to deploy the solar arrays if the automatic mechanisms failed. The PRT is currently intended for use during the first HST Servicing Mission STS-61 as a general purpose power tool. The PRT consists of three major components; the wrench, the controller, and the battery module. Fourteen discrete combinations of torque, turns, and speed may be programmed into the controller before the EVA. The crewmember selects the desired parameter profile by a switch mounted on the controller. The tool may also be used in the manual mode as a non-powered ratchet wrench. The power is provided by a silver-zinc battery module, which fits into the controller and is replaceable during an EVA. The original PRT did not meet the design specification of torque output and hours of operation. To increase efficiency and reliability the PRT underwent a redesign effort. The majority of this effort focused on the wrench. The original PRT drive train consisted of a low torque, high speed brushless DC motor, a face gear set, and a planocentric gear assembly. The total gear reduction was 300:1. The new PRT wrench consists of a low speed, high torque brushless DC motor, two planetary gear sets and a bevel gear set. The total gear reduction is now 75:1. A spline clutch has also been added to disengage the drive train in the manual mode. The design changes to the controller will consist of only those modifications necessary to accomodate the redesigned wrench.

Using Star Clusters as Tracers of Star Formation and Chemical Evolution: The Chemical Enrichment History of the Large Magellanic Cloud

Science.gov (United States)

Chilingarian, Igor V.; Asa’d, Randa

2018-05-01

The star formation (SFH) and chemical enrichment (CEH) histories of Local Group galaxies are traditionally studied by analyzing their resolved stellar populations in a form of color–magnitude diagrams obtained with the Hubble Space Telescope. Star clusters can be studied in integrated light using ground-based telescopes to much larger distances. They represent snapshots of the chemical evolution of their host galaxy at different ages. Here we present a simple theoretical framework for the chemical evolution based on the instantaneous recycling approximation (IRA) model. We infer a CEH from an SFH and vice versa using observational data. We also present a more advanced model for the evolution of individual chemical elements that takes into account the contribution of supernovae type Ia. We demonstrate that ages, iron, and α-element abundances of 15 star clusters derived from the fitting of their integrated optical spectra reliably trace the CEH of the Large Magellanic Cloud obtained from resolved stellar populations in the age range 40 Myr age–metallicity relation. Moreover, the present-day total gas mass of the LMC estimated by the IRA model (6.2× {10}8 {M}ȯ ) matches within uncertainties the observed H I mass corrected for the presence of molecular gas (5.8+/- 0.5× {10}8 {M}ȯ ). We briefly discuss how our approach can be used to study SFHs of galaxies as distant as 10 Mpc at the level of detail that is currently available only in a handful of nearby Milky Way satellites. .

Thick Disks in the Hubble Space Telescope Frontier Fields

Energy Technology Data Exchange (ETDEWEB)

Elmegreen, Bruce G. [IBM Research Division, T.J. Watson Research Center, 1101 Kitchawan Road, Yorktown Heights, NY 10598 (United States); Elmegreen, Debra Meloy; Tompkins, Brittany; Jenks, Leah G., E-mail: bge@us.ibm.com, E-mail: elmegreen@vassar.edu [Department of Physics and Astronomy, Vassar College, Poughkeepsie, NY 12604 (United States)

2017-09-20

Thick disk evolution is studied using edge-on galaxies in two Hubble Space Telescope Frontier Field Parallels. The galaxies were separated into 72 clumpy types and 35 spiral types with bulges. Perpendicular light profiles in F435W, F606W, and F814W ( B , V , and I ) passbands were measured at 1 pixel intervals along the major axes and fitted to sech{sup 2} functions convolved with the instrument line spread function (LSF). The LSF was determined from the average point spread function of ∼20 stars in each passband and field, convolved with a line of uniform brightness to simulate disk blurring. A spread function for a clumpy disk was also used for comparison. The resulting scale heights were found to be proportional to galactic mass, with the average height for a 10{sup 10±0.5} M {sub ⊙} galaxy at z = 2 ± 0.5 equal to 0.63 ± 0.24 kpc. This value is probably the result of a blend between thin and thick disk components that cannot be resolved. Evidence for such two-component structure is present in an inverse correlation between height and midplane surface brightness. Models suggest that the thick disk is observed best between the clumps, and there the average scale height is 1.06 ± 0.43 kpc for the same mass and redshift. A 0.63 ± 0.68 mag V − I color differential with height is also evidence for a mixture of thin and thick components.

Observations of the Hubble Deep Field with the Infrared Space Observatory .1. Data reduction, maps and sky coverage

DEFF Research Database (Denmark)

Serjeant, S.B.G.; Eaton, N.; Oliver, S.J.

1997-01-01

We present deep imaging at 6.7 and 15 mu m from the CAM instrument on the Infrared Space Observatory (ISO), centred on the Hubble Deep Field (HDF). These are the deepest integrations published to date at these wavelengths in any region of sky. We discuss the observational strategy and the data...... reduction. The observed source density appears to approach the CAM confusion limit at 15 mu m, and fluctuations in the 6.7-mu m sky background may be identifiable with similar spatial fluctuations in the HDF galaxy counts. ISO appears to be detecting comparable field galaxy populations to the HDF, and our...

The Black Hole Mass-Bulge Luminosity Relationship for Active Galactic Nuclei From Reverberation Mapping and Hubble Space Telescope Imaging

DEFF Research Database (Denmark)

Bentz, Misty C.; Peterson, Bradley M.; Pogge, Richard W.

2009-01-01

We investigate the relationship between black hole mass and bulge luminosity for active galactic nuclei (AGNs) with reverberation-based black hole mass measurements and bulge luminosities from two-dimensional decompositions of Hubble Space Telescope host galaxy images. We find that the slope...... of the relationship for AGNs is 0.76-0.85 with an uncertainty of ~0.1, somewhat shallower than the M BH vprop L 1.0±0.1 relationship that has been fit to nearby quiescent galaxies with dynamical black hole mass measurements. This difference is somewhat perplexing, as the AGN black hole masses include an overall...

The Carnegie-Chicago Hubble Program. II. The Distance to IC 1613: The Tip of the Red Giant Branch and RR Lyrae Period-luminosity Relations

Science.gov (United States)

Hatt, Dylan; Beaton, Rachael L.; Freedman, Wendy L.; Madore, Barry F.; Jang, In-Sung; Hoyt, Taylor J.; Lee, Myung Gyoon; Monson, Andrew J.; Rich, Jeffrey A.; Scowcroft, Victoria; Seibert, Mark

2017-08-01

IC 1613 is an isolated dwarf galaxy within the Local Group. Low foreground and internal extinction, low metallicity, and low crowding make it an invaluable testbed for the calibration of the local distance ladder. We present new, high-fidelity distance estimates to IC 1613 via its Tip of the Red Giant Branch (TRGB) and its RR Lyrae (RRL) variables as part of the Carnegie-Chicago Hubble Program, which seeks an alternate local route to H 0 using Population II stars. We have measured a TRGB magnitude {I}{ACS}{TRGB}=20.35+/- {0.01}{stat}+/- {0.01}{sys} mag using wide-field observations obtained from the IMACS camera on the Magellan-Baade telescope. We have further constructed optical and near-infrared RRL light curves using archival BI- and new H-band observations from the ACS/WFC and WFC3/IR instruments on board the Hubble Space Telescope (HST). In advance of future Gaia data releases, we set provisional values for the TRGB luminosity via the Large Magellanic Cloud and Galactic RRL zero-points via HST parallaxes. We find corresponding true distance moduli {μ }0{TRGB}=24.30+/- {0.03}{stat}+/- {0.05}{sys} {mag} and =24.28+/- {0.04}{stat+{sys}} mag. We compare our results to a body of recent publications on IC 1613 and find no statistically significant difference between the distances derived from Population I and II stars. Based in part on observations made with the NASA/ESA Hubble Space Telescope, obtained at the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS 5-26555. These observations are associated with programs #10505 and #13691. Additional observations are credited to the Observatories of the Carnegie Institution of Washington for the use of Magellan-Baade IMACS. Presented as part of a dissertation to the Department of Astronomy and Astrophysics, The University of Chicago, in partial fulfillment of the requirements for the Ph.D. degree.

Photosynthetic CO2 affinity of the aquatic carnivorous plant Utricularia australis (Lentibulariaceae) and its investment in carnivory

Czech Academy of Sciences Publication Activity Database

Adamec, Lubomír

2009-01-01

Roč. 24, č. 2 (2009), s. 327-333 ISSN 0912-3814 Institutional research plan: CEZ:AV0Z60050516 Keywords : CO2 compensation point * investment in carnivory * apical shoot growth Subject RIV: EF - Botanics Impact factor: 1.485, year: 2009

Infall of nearby galaxies into the Virgo cluster as traced with Hubble space telescope

Energy Technology Data Exchange (ETDEWEB)

Karachentsev, Igor D. [Special Astrophysical Observatory RAS, Nizhnij Arkhyz, Karachai-Cherkessian Republic 369167 (Russian Federation); Tully, R. Brent; Wu, Po-Feng [Institute for Astronomy, University of Hawaii, 2680 Woodlawn Drive, Honolulu, HI 96822 (United States); Shaya, Edward J. [Department of Astronomy, University of Maryland, College Park, MD 20742 (United States); Dolphin, Andrew E., E-mail: ikar@sao.ru [Raytheon Company, 1151 East Hermans Road, Tucson, AZ 85756 (United States)

2014-02-10

We measured the tip of the red giant branch distances to nine galaxies in the direction to the Virgo cluster using the Advanced Camera for Surveys on the Hubble Space Telescope. These distances put seven galaxies (GR 34, UGC 7512, NGC 4517, IC 3583, NGC 4600, VCC 2037, and KDG 215) in front of Virgo and two galaxies (IC 3023 and KDG 177) likely inside the cluster. Distances and radial velocities of the galaxies situated between us and the Virgo core clearly exhibit the infall phenomenon toward the cluster. In the case of spherically symmetric radial infall, we estimate the radius of the 'zero-velocity surface' to be (7.2 ± 0.7) Mpc, which yields a total mass of the Virgo cluster of (8.0 ± 2.3) × 10{sup 14} M {sub ☉}, in good agreement with its virial mass estimates. We conclude that the Virgo outskirts do not contain significant amounts of dark matter beyond their virial radius.