WorldWideScience

Sample records for iodine 126

  1. Clinical application of iodine 123 with special consideration of radionuclide purity, measuring accuracy and radiation dose

    International Nuclear Information System (INIS)

    Hermann, H.J.; Ammon, J.; Winkel, K. zum; Haubold, U.

    1975-01-01

    Iodine 123 is a nearly 'ideal' radionuclide for thyroid imaging. The production of Iodine 123 requires cyclotrons or accelerators. The production of multicurie amounts of Iodine 123 has been suggested through the use of high-energy accelerators (> 60 MeV). Most of the methods for the production of Iodine 123 using a compact cyclotron result in contamination with f.e. Iodine 124 which reduces the spatial resolution of imaging procedures and increases the radiation dose to the patient. The radiation dose has been calculated for three methods of production. The various contamination with Iodine 124, Iodine 125 and Iodine 126 result in comparable radiation dose of Iodine 131, provided that the time between production and application is more than four half-live-times of Iodine 123. (orig.) [de

  2. Beta decays of 126Cd and 126In to levels in 126In and 126Sn

    International Nuclear Information System (INIS)

    Gartner, M.L.

    1979-01-01

    A study of the beta decays of 126 Cd and 126 In using the TRISTAN on-line isotope separator facility is reported. Gamma-ray singles measurements were made for both decays usng Ge(Li) and LEPS (low energy photon spectrometer) detectors. In addition, gamma--gamma coincidence measurements and gamma multiscale measurements were made for both decays using Ge(Li) detectors. The half-life for 126 Cd was determined to be 0.506 +- 0.015 sec., and the half-lives for the low- and high-spin 126 In isomers were determined to be 1.83 +- 0.11 sec. and 1.96 +- 0.10 sec., respectively. A total of 11 gamma rays were observed in the decay of 126 Cd, and all but one were placed in a level scheme for 126 In. A total of 48 gamma rays were observed in the decay of the low- and high-spin 126 In isomers and all were placed in a level scheme for 126 Sn. Spin and parity assignments were deduced, whenever possible, on the basis of logft values and gamma decay selection rules. The 126 In decay schemes (one has been proposed for each isomer) are compared with earlier decay studies and with results from 124 Sn(t,p) 126 Sn reaction experiments. The systematics associated with the level schemes are discussed and a comparison is made with the nuclear shell model. 49 references

  3. Iodine Deficiency

    Science.gov (United States)

    ... Fax/Phone Home » Iodine Deficiency Leer en Español Iodine Deficiency Iodine is an element that is needed ... world’s population remains at risk for iodine deficiency. Iodine Deficiency FAQs WHAT IS THE THYROID GLAND? The ...

  4. Iodine volatility

    International Nuclear Information System (INIS)

    Beahm, E.C.; Shockley, W.E.

    1984-01-01

    The ultimate aim of this program is to couple experimental aqueous iodine volatilities to a fission product release model. Iodine partition coefficients, for inorganic iodine, have been measured during hydrolysis and radiolysis. The hydrolysis experiments have illustrated the importance of reaction time on iodine volatility. However, radiolysis effects can override hydrolysis in determining iodine volatility. In addition, silver metal in radiolysis samples can react to form silver iodide accompanied by a decrease in iodine volatility. Experimental data are now being coupled to an iodine transport and release model that was developed in the Federal Republic of Germany

  5. Maternal iodine status and the thyroid function of pregnant mothers and their neonates in Jaffna District of Sri Lanka

    Directory of Open Access Journals (Sweden)

    Thirunavukkarasu Yoganathan

    2015-01-01

    Full Text Available Introduction: Iodine status of pregnant women and their newborns have not been studied in Jaffna District, Sri Lanka. This study was planned to assess the maternal iodine status and thyroid function at the third trimester of gestation and the thyrotrophin level of their neonate. Methods: Four hundred and seventy-seven pregnant women and their newborns were randomly selected among six Medical Officers of Health Divisions out of 12 in Jaffna District, Sri Lanka. Maternal thyroid stimulating hormone (TSH, free thyroxine (fT4, thyroglobulin (Tg, urinary iodine levels, and the neonatal thyrotrophin (nTSH level were assessed. Results: In this study, mean age, weight, height, and gestational age of the mothers were 28.95 (±5.46 years, 63.02 (±11.56 kg, 154.39 (±6.00 cm, and 39.33 (±1.37 weeks, respectively. Maternal median urinary iodine concentration (UIC was 140.0 μg/L (inter-quartile range 126.0–268.0 μg/L. Median values of the maternal serum TSH, fT4,and Tg were 1.9 mIU/L, 12.6 pmol/L, and 21.4 IU/L, respectively. Among the 477 newborns, 50.5% (n = 239 were males. Mean birth weight of newborn was 3.03 (±0.43 kg, while the mean length was 51.1 (±2.1 cm. Among the newborns, 18% (n = 86 had nTSH level > mIU/L and 37.7% (n = 180 within TSH level > mIU/L. nTSH level had positive but very weak correlations with maternal thyroid parameters, that is, UIC (r = 0.06, P = 0.13, fT4 (r = 0.01, P = 0.05, TSH (r = 0.09, P = 0.05, and Tg (r = 0.12, P = 0.03. Conclusion: On the basis of the World Health Organization criteria, the iodine status of pregnant women was inadequate in this region and also nTSH levels indicate moderate iodine deficiency during pregnancy. Therefore, the continuous education on adequate iodine intake during pregnancy and monitoring of iodine status are useful.

  6. Radionuclide Basics: Iodine

    Science.gov (United States)

    ... Centers Radiation Protection Contact Us Share Radionuclide Basics: Iodine Iodine (chemical symbol I) is a chemical element. ... in the environment Iodine sources Iodine and health Iodine in the Environment All 37 isotopes of iodine ...

  7. Determination of iodine 129 in environmental samples from Austria by neutron activation analysis

    International Nuclear Information System (INIS)

    Karg, V.; Schoenfeld, T.

    1986-11-01

    For various types of samples (thyroids from humans, from game and cows; ground water, snow and air filters) the 129 I-contents, expressed as 129 I/ 127 I-ratio (R), were determined by neutron activation analysis. The method utilises the neutron induced reactions 129 I(n, γ) 130 I and 127 I(n, 2n) 126 I. Four main steps are involved: 1. Separation of iodine from the sample and conversion to a form suitable for neutron irradiation. 2. Irradiation in a reactor. 3. Chemical processing of the irradiated material, i.e. separation of radio-iodine with addition of carrier. 4. Measurement of activities of 130 I and 126 I with a gammaspectrometer. The 129 I/ 127 I-ratio (R) is then obtained by comparing with the activities produced in a reference sample (usually with R = 1.0 x 10 -8 ) which is irradiated simultaneously. Details of the method are presented in the report. R-values between 0.6 x 10 -8 and 39 x 10 -8 were found. The highest values were those of snow and game thyroids. Ground water contained very little 129 I. The results confirm the expectation that 129 I enters the biosphere mainly via air and precipitation. (Author)

  8. Is placental iodine content related to dietary iodine intake?

    LENUS (Irish Health Repository)

    Burns, R

    2011-08-01

    Delivery of iodine to the foetus depends not only on maternal dietary iodine intake but also on the presence of a functioning placental transport system. A role for the placenta as an iodine storage organ has been suggested, and this study compares the iodine content of placentas from women giving birth at term in Ireland and Iran, areas with median urinary iodine of 79 and 206 μg\\/l respectively.

  9. Chemisorption of organic iodine compounds forming from fission isotopes of radioactive iodine

    International Nuclear Information System (INIS)

    Tot, G.; Galina, F.; Zel'd, E.

    1977-01-01

    Studied is ethyl iodine adsorption, labelled by iodine 131, on palladium black and on aluminium oxide activized by palladium. The desorption of adsorbed iodine in the temperature range of 20-600 deg C by the mass spectroscopy and thermal gravimetric methods was investigated. At the ethyl iodine and palladium interaction the bond between carbon and iodine in the ethyl iodine molecule breaks down and extracting iodine reacts with palladium, forming a stable compound at high temperatures. Desorption of adsorbed iodine is insignificant up to the temperatures of 250-300 deg C. Thus, sorbents, containing palladium, may be successfully applied for iodine absorption from the organic iodine compounds. These compounds spontaneously appear from the iodine fragment ratio isotopes during their interaction with some environmental organic impurities

  10. Altering iodine metabolism in the calf by feeding iodine-binding agents

    International Nuclear Information System (INIS)

    Miller, J.K.; Swanson, E.W.; Lyke, W.A.; Byrne, W.F.

    1975-01-01

    Effects of feeding cottonseed meal and anion-exchange resin on iodine absorption and excretion by calves were investigated. Each additional amount of resin fed from 0.3 to 3.5 g/kg body weight further increased fecal excretion from single oral iodine-131 and intravenous iodine-125 doses. By feeding 3 to 10 g cottonseed meal/kg body weight, excretion of oral iodine-131 given daily was increased 7 to 94 percent in feces and reduced as much as 35 percent in urine, but plasma iodine-131 was not changed. Introducing 1 g resin/kg body weight daily into the diet increased fecal iodine-131 excretion three to five times that with cottonseed meal alone and reduced both plasma and urinary iodine-131. The same amount of resin fed daily had similar effects on excretion of iodine-131 injected subcutaneously each day. Although iodine depletion by a highly efficient iodine binder (resin) in the gastrointestinal tract is probable, iodine binding by a natural feed constituent (cottonseed meal) was relatively inefficient. (U.S.)

  11. Altering iodine metabolism in the calf by feeding iodine-binding agents

    International Nuclear Information System (INIS)

    Miller, J.K.; Swanson, E.W.; Lyke, W.A.; Byrne, W.F.

    1975-01-01

    Effects of feeding cottonseed meal and anion-exchange resin on iodine absorption and excretion by calves were investigated. Each additional amount of resin fed from 0.3 to 3.5 g/kg body weight further increased fecal excretion from single oral iodine-131 and intravenous iodine-125 doses. By feeding 3 to 10 g cottonseed meal/kg body weight, excretion of oral iodine-131 given daily was increased 7 to 94 percent in feces and reduced as much as 35 percent in urine, but plasma iodine-131 was not changed. Introducing 1 g resin/kg body weight daily into the diet increased fecal iodine-131 excretion three to five times that with cottonseed meal alone and reduced both plasma and urinary iodine-131. The same amount of resin fed daily had similar effects on excretion of iodine-131 injected subcutaneously each day. Although iodine depletion by a highly efficient iodine binder (resin) in the gastrointestinal tract is probable, iodine binding by a natural feed constituent (cottonseed meal) was relatively inefficient. (auth)

  12. Iodine doping effects on the lattice thermal conductivity of oxidized polyacetylene nanofibers

    Energy Technology Data Exchange (ETDEWEB)

    Bi, Kedong, E-mail: lishi@mail.utexas.edu, E-mail: kedongbi@seu.edu.cn [Jiangsu Key Laboratory for Design and Manufacture of Micro-Nano Biomedical Instruments, School of Mechanical Engineering, Southeast University, Nanjing 211189 (China); Department of Mechanical Engineering, University of Texas at Austin, Austin, Texas 78712 (United States); Weathers, Annie; Pettes, Michael T.; Shi, Li, E-mail: lishi@mail.utexas.edu, E-mail: kedongbi@seu.edu.cn [Department of Mechanical Engineering, University of Texas at Austin, Austin, Texas 78712 (United States); Matsushita, Satoshi; Akagi, Kazuo [Department of Polymer Chemistry, Kyoto University, Kyoto 615-8510 (Japan); Goh, Munju [Department of Polymer Chemistry, Kyoto University, Kyoto 615-8510 (Japan); Institute of Advanced Composite Materials, Korea Institute of Science and Technology (KIST), Eunha-ri san 101, Bondong-eup, Wanju-gun, Jeolabuk-do 565-905 (Korea, Republic of)

    2013-11-21

    Thermal transport in oxidized polyacetylene (PA) nanofibers with diameters in the range between 74 and 126 nm is measured with the use of a suspended micro heater device. With the error due to both radiation and contact thermal resistance corrected via a differential measurement procedure, the obtained thermal conductivity of oxidized PA nanofibers varies in the range between 0.84 and 1.24 W m{sup −1} K{sup −1} near room temperature, and decreases by 40%–70% after iodine doping. It is also found that the thermal conductivity of oxidized PA nanofibers increases with temperature between 100 and 350 K. Because of exposure to oxygen during sample preparation, the PA nanofibers are oxidized to be electrically insulating before and after iodine doping. The measurement results reveal that iodine doping can result in enhanced lattice disorder and reduced lattice thermal conductivity of PA nanofibers. If the oxidation issue can be addressed via further research to increase the electrical conductivity via doping, the observed suppressed lattice thermal conductivity in doped polymer nanofibers can be useful for the development of such conducting polymer nanostructures for thermoelectric energy conversion.

  13. Iodine doping effects on the lattice thermal conductivity of oxidized polyacetylene nanofibers

    International Nuclear Information System (INIS)

    Bi, Kedong; Weathers, Annie; Pettes, Michael T.; Shi, Li; Matsushita, Satoshi; Akagi, Kazuo; Goh, Munju

    2013-01-01

    Thermal transport in oxidized polyacetylene (PA) nanofibers with diameters in the range between 74 and 126 nm is measured with the use of a suspended micro heater device. With the error due to both radiation and contact thermal resistance corrected via a differential measurement procedure, the obtained thermal conductivity of oxidized PA nanofibers varies in the range between 0.84 and 1.24 W m −1  K −1 near room temperature, and decreases by 40%–70% after iodine doping. It is also found that the thermal conductivity of oxidized PA nanofibers increases with temperature between 100 and 350 K. Because of exposure to oxygen during sample preparation, the PA nanofibers are oxidized to be electrically insulating before and after iodine doping. The measurement results reveal that iodine doping can result in enhanced lattice disorder and reduced lattice thermal conductivity of PA nanofibers. If the oxidation issue can be addressed via further research to increase the electrical conductivity via doping, the observed suppressed lattice thermal conductivity in doped polymer nanofibers can be useful for the development of such conducting polymer nanostructures for thermoelectric energy conversion

  14. Methodology for iodine-129 determination in coniferous plant by neutron activation

    International Nuclear Information System (INIS)

    Quintana, E.E.; Thyssen, S.M.

    1998-01-01

    Full text: The measurement methods of iodine-129 ( 129 I) include liquid scintillation counting, mass spectrometry analysis, X-ray spectrometry and neutron activation analysis. The combination of long half-life and low radiation energy, limit the sensitivity of a direct measurement in environmental matrixes. The neutron activation analysis (NAA) permits the increase in the sensitivity because of the high thermal neutron cross section of 129 I. The reaction produced is 129 I (n,γ) 130 I and the Eγ (536 keV) of iodine-130 (t 1/2 = 12,6 hours) is measured. The developed methodology allows the determination of 129 I in coniferous needles using NAA. The chemical treatment removes the interferences present in the matrix, as well as the Bromine-82 originated in the activation process. The analytical method is divided in six steps: a) digestion by alkaline fusion; b) radiochemical purification of 129 I by distillation followed by solvent extraction; c) distillation and adsorption on activated charcoal; d) neutron irradiation; e) radiochemical purification of 130 I by distillation followed by solvent extraction; f) gamma spectrometry. Iodine-131 tracer is added, and a chemical recovery of 95% in the distillations is obtained. The whole process recovery is within 70% and 85%. The detection limit is 0.48 mBq. Several factors affect this value, such as sample type, variety of coniferous, natural iodine concentration, irradiation time and neutron flux. (author) [es

  15. Recovery of iodine as iodine-125 from biological materials prior to assay

    International Nuclear Information System (INIS)

    Jones, G.B.; Belling, G.B.; Buckley, R.A.

    1979-01-01

    In biological tissues iodine is usually present as iodoamino acids or iodoproteins. The organic material must be oxidised and the iodine converted into iodate prior to the final spectrophotometric determination. At parts per billion (10 9 ) levels, recoveries of added iodine are difficult to measure precisely as iodine can easily be lost from the sample and added inorganic iodine may not be recovered in the same proportions as the naturally occurring iodine. Iodine-125 provides a much more sensitive, specific and accurate means of testing the recovery of nanogram amounts of iodine from biological tissues and it can be incorporated into tissues in the naturally occurring compounds. Plants can be grown in a solution culture containing iodine-125 and animals can be injected with iodine-125 to provide tissues where naturally occurring iodine compounds are labelled with radioactive iodine. These tissues can be used to examine the recovery of iodine after oven drying, freeze drying, alkali ashing and acid digestion of the samples. Experimental details are given for spinach, tobacco, oats, cauliflower and thyroid. Results are given and discussed. (author)

  16. Iodine leaflets in chapter D5 'Distribution of iodine pills'

    International Nuclear Information System (INIS)

    1981-01-01

    Jodine leaflet A will be distributed together with iodine pills in a nuclear disaster. Iodine leaflet B is suitable for informing the public in advance. Iodine leaflet C informs physicians in a scientific way on the benefits and risk of iodine pills. (orig./HP) [de

  17. Perchlorate, iodine supplements, iodized salt and breast milk iodine content

    Energy Technology Data Exchange (ETDEWEB)

    Kirk, Andrea B. [Department of Epidemiology, School of Public Health, University of North Texas Health Sciences Center, 3500 Camp Bowie Blvd., Fort Worth, TX 76107 (United States); Kroll, Martina; Dyke, Jason V.; Ohira, Shin-Ichi; Dias, Rukshan A.; Dasgupta, Purnendu K. [Department of Chemistry and Biochemistry, 700 Planetarium Place, University of Texas at Arlington, Arlington, TX 76019 (United States)

    2012-03-15

    This study was undertaken to determine if increasing maternal iodine intake through single dose tablets will decrease breast milk concentrations of the iodine-uptake inhibitor, perchlorate, through competitive inhibition. We also sought to determine if the timing of supplementation influences the fraction of iodine excreted in milk versus urine and to compare the effectiveness of iodized salt as a means of providing iodine to breastfed infants. Thirteen women who did not use supplements, seven of whom used iodized salt and six of whom used non-iodized salt, submitted four milk samples and a 24-h urine collection daily for three days. Women repeated the sampling protocol for three more days during which {approx} 150 {mu}g of iodine were taken in the evening and again for three days with morning supplementation. Samples were analyzed using isotope-dilution inductively-coupled plasma-mass spectrometry for iodine and isotope-dilution ion chromatography-tandem mass spectrometry for perchlorate. No statistically significant differences were observed in milk iodine or perchlorate concentrations during the two treatment periods. Estimated perchlorate intake was above the U.S. National Academy of Sciences suggested reference dose for most infants. Single daily dose iodine supplementation was not effective in decreasing milk perchlorate concentrations. Users of iodized salt had significantly higher iodine levels in milk than non-users. Iodized salt may be a more effective means of iodine supplementation than tablets. - Highlights: Black-Right-Pointing-Pointer Estimated infant exposures to perchlorate were, on a {mu}g/kg basis, {approx} 5 Multiplication-Sign higher than those of mothers. Black-Right-Pointing-Pointer Daily supplements are less effective than iodized salt in providing iodine to lactating women. Black-Right-Pointing-Pointer Low iodine and high perchlorate in milk may place infants at risk of iodine deficiency.

  18. Iodine deficiency and iodine excess in Jiangsu Province, China

    NARCIS (Netherlands)

    Zhao, J.

    2001-01-01

    Keywords:
    iodine deficiency, iodine excess, endemic goiter, drinking water, iodine intake, thyroid function, thyroid size, iodized salt, iodized oil, IQ, physical development, hearing capacity, epidemiology, meta-analysis, IDD, randomized trial, intervention, USA, Bangladesh,

  19. Iodine in diet

    Science.gov (United States)

    Diet - iodine ... Many months of iodine deficiency in a person's diet may cause goiter or hypothyroidism . Without enough iodine, ... and older children. Getting enough iodine in the diet may prevent a form of physical and intellectual ...

  20. Iodine and thyroid function

    Directory of Open Access Journals (Sweden)

    Hye Rim Chung

    2014-03-01

    Full Text Available Severe iodine deficiency causes hypothyroidism that results in impaired somatic growth and motor development in children. Mild and moderate iodine deficiencies cause multifocal autonomous growth of thyroid, which results in thyrotoxicosis. On the other hand, iodine excess is associated with the development of hypothyroidism and thyroid autoimmunity. In areas of iodine deficiency, a sudden increase in iodine intake is associated with transient hyperthyroidism. Recent studies demonstrated that long-term thyroid function of subjects who experienced both iodine deficiency and iodine excess during childhood tended to be abnormal despite optimization of their current iodine intake. Iodine status in the Korean Peninsula is very unique because people in the Republic of Korea have been shown to have predominantly excessive iodine levels, whereas the Democratic People's Republic of Korea is known to be an iodine-deficient area. Further research is warranted to verify the optimal ranges of iodine intake and to clarify the effects of iodine intake on thyroid disorders in the Korean Peninsula.

  1. Iodine Deficiency

    NARCIS (Netherlands)

    Zimmermann, M.B.

    2009-01-01

    Iodine deficiency has multiple adverse effects in humans, termed iodine deficiency disorders, due to inadequate thyroid hormone production. Globally, it is estimated that 2 billion individuals have an insufficient iodine intake, and South Asia and sub-Saharan Africa are particularly affected.

  2. Experimental study on iodine chemistry (EXSI) - Containment experiments with elemental iodine

    Energy Technology Data Exchange (ETDEWEB)

    Kaerkelae, T.; Auvinen, A. (VTT Technical Research Centre of Finland (Finland)); Holm, J.; Ekberg, C. (Chalmers Univ. of Technology (Sweden)); Glaenneskog, H. (Vattenfall Power Consultant (Sweden))

    2009-10-15

    The behaviour of iodine during a severe accident has been studied in several experimental programs, ranging from the large-scale PHEBUS FP tests and intermediate-scale ThAI tests to numerous separate effect studies. Oxidation of iodine in gas phase has been one of the greatest remaining uncertainties in iodine behaviour during a severe accident. In this study the possible formation of iodine oxide aerosol due to radiolytic oxidation of gaseous iodine is experimentally tested and the reaction products are analysed. The experimental facility applied in this study is based on the sampling system built at VTT for ISTP program project CHIP conducted IRSN. The experimental facility and the measuring technology are sophisticated and unique in the area of nuclear research as well as in the field of aerosol science. The results from the experiments show an extensive particle formation when ozone and gaseous iodine react with each other. The formed particles were collected on filters, while gaseous iodine was trapped into bubbles. The particles were iodine oxides and the size of particles was approximately 100 nm. The transport of gaseous iodine through the facility decreased when both gaseous iodine and ozone were fed together into facility. Experimental study on radiolytic oxidation of iodine was conducted in co-operation between VTT and Chalmers University of Technology as a part of the NKS-R programs. (author)

  3. Experimental study on iodine chemistry (EXSI) - Containment experiments with elemental iodine

    International Nuclear Information System (INIS)

    Kaerkelae, T.; Auvinen, A.; Holm, J.; Ekberg, C.; Glaenneskog, H.

    2009-10-01

    The behaviour of iodine during a severe accident has been studied in several experimental programs, ranging from the large-scale PHEBUS FP tests and intermediate-scale ThAI tests to numerous separate effect studies. Oxidation of iodine in gas phase has been one of the greatest remaining uncertainties in iodine behaviour during a severe accident. In this study the possible formation of iodine oxide aerosol due to radiolytic oxidation of gaseous iodine is experimentally tested and the reaction products are analysed. The experimental facility applied in this study is based on the sampling system built at VTT for ISTP program project CHIP conducted IRSN. The experimental facility and the measuring technology are sophisticated and unique in the area of nuclear research as well as in the field of aerosol science. The results from the experiments show an extensive particle formation when ozone and gaseous iodine react with each other. The formed particles were collected on filters, while gaseous iodine was trapped into bubbles. The particles were iodine oxides and the size of particles was approximately 100 nm. The transport of gaseous iodine through the facility decreased when both gaseous iodine and ozone were fed together into facility. Experimental study on radiolytic oxidation of iodine was conducted in co-operation between VTT and Chalmers University of Technology as a part of the NKS-R programs. (author)

  4. Iodine intake in Ireland

    International Nuclear Information System (INIS)

    Smith, P.P.A.; Hetherton, A.M.; O'Carroll, D.; Smith, D.F.; O'Halloran, M.J.; O'Donovan, D.K.

    1988-01-01

    A study of urinary iodine excretion and thyroid gland uptake of radioactive iodine 131 I was undertaken in the Dublin area with a view to providing data on the current iodine status in Ireland. A mean urinary iodine excretion of 118±82μg/gram creatinine (Median 96) obtained from 821 subjects attending general hospital outpatient clinics in the Dublin area in 1987, while excluding severe iodine deficiency in this particular cohort, obscured the fact that 250 (30%) had iodine excretion values ≤70 μ/g creatinine, a value approximating to the minimum daily iodine requirement. The results provide sufficient evidence of sporadic iodine deficiency to justify a more widespread study of the iodine status of the Irish population with a view to making recommendations on the possible need for iodine prophylaxis

  5. Iodination of phenol

    International Nuclear Information System (INIS)

    Christiansen, J.V.; Feldthus, A.; Carlsen, L.

    1990-01-01

    Phenol is iodinated in aqueous solution at pH 5 (acetate buffer) by elemental iodine or, if the iodine is present as iodide, enzymatically controlled by peroxidases. Generally mono-, di- and triiodophenols are obtained, the overall product composition being virtually identical for the two iodination modes. However, there is a tendency to a higher para to ortho ratio for the enzymatically controlled reaction. The mutual ratios of the single iodophenols depends on the initial concentration ratio between phenol and the iodinating species. The first step in the iodination leads preferentially to substitution in the ortho position rather than in the para position in contract to e.g. the corresponding bromination. The relative rates of the competive reactions in the combined iodination scheme has been derived. (author) 2 tabs., 3 ills., 15 refs

  6. Iodine and Pregnancy

    OpenAIRE

    Yarrington, Christina; Pearce, Elizabeth N.

    2011-01-01

    Iodine is a necessary element for the production of thyroid hormone. We will review the impact of dietary iodine status on thyroid function in pregnancy. We will discuss iodine metabolism, homeostasis, and nutritional recommendations for pregnancy. We will also discuss the possible effects of environmental contaminants on iodine utilization in pregnant women.

  7. Feasibility of Single Scan for Simultaneous Evaluation of Regional Krypton and Iodine Concentrations with Dual-Energy CT: An Experimental Study.

    Science.gov (United States)

    Hong, Sae Rom; Chang, Suyon; Im, Dong Jin; Suh, Young Joo; Hong, Yoo Jin; Hur, Jin; Kim, Young Jin; Choi, Byoung Wook; Lee, Hye-Jeong

    2016-11-01

    Purpose To evaluate the feasibility of a simultaneous single scan of regional krypton and iodine concentrations by using dual-energy computed tomography (CT). Materials and Methods The study was approved by the institutional animal experimental committee. An airway obstruction model was first made in 10 beagle dogs, and a pulmonary arterial occlusion was induced in each animal after 1 week. For each model, three sessions of dual-energy CT (80% krypton ventilation [krypton CT], 80% krypton ventilation with iodine enhancement [mixed-contrast agent CT], and iodine enhancement [iodine CT]) were performed. Krypton maps were made from krypton and mixed-contrast agent CT, and iodine maps were made from iodine and mixed-contrast agent CT. Observers measured overlay Hounsfield units of the diseased and contralateral segments on each map. Values were compared by using the Wilcoxon signed-rank test. Results In krypton maps of airway obstruction, overlay Hounsfield units of diseased segments were significantly decreased compared with those of contralateral segments in both krypton and mixed-contrast agent CT (P = .005 for both). However, the values of mixed-contrast agent CT were significantly higher than those of krypton CT for both segments (P = .005 and .007, respectively). In iodine maps of pulmonary arterial occlusion, values were significantly lower in diseased segments than in contralateral segments for both iodine and mixed-contrast agent CT (P = .005 for both), without significant difference between iodine and mixed-contrast agent CT for both segments (P = .126 and .307, respectively). Conclusion Although some limitations may exist, it might be feasible to analyze regional krypton and iodine concentrations simultaneously by using dual-energy CT. © RSNA, 2016.

  8. Iodine

    Science.gov (United States)

    ... Health Information Supplement Fact Sheets Frequently Asked Questions Making Decisions What you Need To Know About Supplements Dietary ... mild iodine deficiency and of iodine supplements on cognitive ... breasts. It mainly affects women of reproductive age but can also occur ...

  9. Low-level seaweed supplementation improves iodine status in iodine-insufficient women.

    Science.gov (United States)

    Combet, Emilie; Ma, Zheng Feei; Cousins, Frances; Thompson, Brett; Lean, Michael E J

    2014-09-14

    Iodine insufficiency is now a prominent issue in the UK and other European countries due to low intakes of dairy products and seafood (especially where iodine fortification is not in place). In the present study, we tested a commercially available encapsulated edible seaweed (Napiers Hebridean Seagreens® Ascophyllum nodosum species) for its acceptability to consumers and iodine bioavailability and investigated the impact of a 2-week daily seaweed supplementation on iodine concentrations and thyroid function. Healthy non-pregnant women of childbearing age, self-reporting low dairy product and seafood consumption, with no history of thyroid or gastrointestinal disease were recruited. Seaweed iodine (712 μg, in 1 g seaweed) was modestly bioavailable at 33 (interquartile range (IQR) 28-46) % of the ingested iodine dose compared with 59 (IQR 46-74) % of iodine from the KI supplement (n 22). After supplement ingestion (2 weeks, 0·5 g seaweed daily, n 42), urinary iodine excretion increased from 78 (IQR 39-114) to 140 (IQR 103-195) μg/l (Pseaweed was palatable and acceptable to consumers as a whole food or as a food ingredient and effective as a source of iodine in an iodine-insufficient population. In conclusion, seaweed inclusion in staple foods would serve as an alternative to fortification of salt or other foods with KI.

  10. A Spectroscopic Method for Determining Free Iodine in Iodinated Fatty-Acid Esters

    Science.gov (United States)

    Klyubin, V. V.; Klyubina, K. A.; Makovetskaya, K. N.

    2018-01-01

    It is shown that the concentration of free iodine in samples of iodinated fatty-acid esters can be measured using the electronic absorption spectra of their solutions in ethanol. The method proposed is rather simple in use and highly sensitive, allowing detection of presence of less than 10 ppm of free iodine in iodinated compounds. It is shown using the example of Lipiodol that this makes it possible to easily detect small amounts of free iodine in samples containing bound iodine in concentrations down to 40 wt %.

  11. [Assessment of dietary iodine intake of population in non-high-iodine areas in China].

    Science.gov (United States)

    Song, Xiaoyu; Li, Fengqin; Liu, Zhaoping; He, Yuna; Sui, Haixia; Mao, Weifeng; Liu, Sana; Yan, Weixing; Li, Ning; Chen, Junshi

    2011-03-01

    To assess the potential risk of dietary iodine insufficiency of population in non-high-iodine areas (water iodine China. The dietary iodine intake of 13 age-sex population groups were estimated by combining the data of iodine intake from food, table salt and drinking water. Two conditions were considered: consuming iodized salt or non-iodized salt. The data of food and table salt consumption were derived from the Chinese National Nutrition and Health Survey in 2002. Water consumption was calculated as the recommended water intake. Iodine contents of food, table salt and water were calculated from China Food Composition Table and iodine surveillance data. Under the condition of consuming iodized salt, the average iodine intake of all population groups was higher than the Recommended Nutrient Intake (RNI), while the iodine intakes of individuals above Upper Limits (UL) and below RNI were 5.8% and 13.4% respectively, and the iodine intake of individuals lower than the Estimated Average Requirement (EAR) was 9.4% in adults above 18 years of age (including pregnant and lactating women). If non-iodized salt was consumed, the average iodine intake of most sex-age population groups was higher than RNI, but the iodine intake of 97.6% of individuals would be lower than RNI, while the iodine intake of 97.4% of adults would be lower than EAR. The contribution of iodine from table salt was much higher than that from drinking water and food in the condition of consuming iodized salt, while food was the predominant contributor of dietary iodine in the condition of consuming non-iodized salt. The health risk of iodine deficiency was higher than that of iodine excess in areas where water iodine was China, and the risk of iodine insufficiency was much higher if non-iodized salt was consumed. Iodized salt should be the main sources of dietary iodine intake for population in areas where water iodine was China.

  12. The iodine reactivity

    International Nuclear Information System (INIS)

    2003-01-01

    The iodine is an important element because it has long life isotopes (such as iodine 129) and a great mobility in natural media. Iodine presents a complex chemistry because of its volatility and its strong redox reactivity. The S.E.C.R. works to better understand the reactivity of this element in different natural, industrial or biological environments. It plays a part in thermochemical sites as a possible way of hydrogen formation. This seminar gives some aspects relative to the chemical reactivity of iodine, since its thermochemistry in the I/S cycles to produce hydrogen to its reactivity in the natural medium and its potential radiological impact. This document includes 4 presentations transparencies) dealing with: the 129 I cycle rejected in the low radioactive gaseous and liquid effluents of the La Hague reprocessing plant (C. Frechou); a bibliographic review of iodine retention in soils (F. Bazer-Bachi); the hydrogen production and the iodine/sulfur thermochemical cycle (role of iodine in the process); and the direct characterization by electro-spray ionization mass spectroscopy of iodine fixation by fulvic acids (P. Reiller, B. Amekraz, C. Moulin, V. Moulin)

  13. Iodine intake in Denmark

    International Nuclear Information System (INIS)

    Pedersen, K.M.; Noehr, S.B.; Laurberg, P.

    1997-01-01

    Iodine deficiency with a high frequency of goitre and, in severely affected areas, cretinism is common in some areas of the world. In Denmark the iodine intake as evaluated by urinary iodine excretion has been at a stable low level for many years, except for the part of the population now taking iodine supplementation as part of vitamin/mineral preparations. The iodine intake is lowest in the western part to the country where an epidemiological study of elderly subjects has demonstrated a high frequency of goitre and hyperthyroidism in women. This supports the suggestion of a controlled moderate increase in iodine intake via an iodine supplementation program. (au) 40 refs

  14. Iodinated bleomycin

    International Nuclear Information System (INIS)

    Lunghi, F.; Riva, P.; Assone, F.; Villa, M.; Plassic, G.

    1978-01-01

    Bleomycin was labelled with iodine-131 by the iodine monochloride method. Iodination did not alter the chemical and chromatographic features and ''in vitro'' stability studies on freeze-dried 131 I-Bleomycin having a specific activity of 1 mCi/mg, stored at different temperatures, showed no appreciable variation of the free-iodine content. Tissue distribution of 131 I-Bleomycin has been evaluated in tumor bearing rats. Patients have been injected with 0.5-1.0 mCi of 131 I-Bleomycin corresponding to a maximum of 1.5 mg. No adverse reactions have been observed. Total body scans have been performed at 2, 6, 24 and 48 hours after injection. The iodinated Bleomycin was rapidly distributed and cleared from the body and showed an early uptake in the neoplastic tissue. A diagnostic accuracy of 90% has been observed in malignant deseases, while no false positive results have been, at the moment, recorded. (author)

  15. Urinary Iodine Concentrations Indicate Iodine Deficiency in Pregnant Thai Women but Iodine Sufficiency in Their School-Aged Children

    NARCIS (Netherlands)

    Gowachirapant, S.; Winichagoon, P.; Wyss, L.; Tong, B.; Baumgartner, J.; Boonstra, A.; Zimmermann, M.B.

    2009-01-01

    The median urinary iodine concentration (UI) in school-aged children is recommended for assessment of iodine nutrition in populations. If the median UI is adequate in school-aged children, it is usually assumed iodine intakes are also adequate in the remaining population, including pregnant women.

  16. Iodine generator for reclaimed water purification

    Science.gov (United States)

    Wynveen, R. A.; Powell, J. D.; Schubert, F. H. (Inventor)

    1977-01-01

    The system disclosed is for controlling the iodine level in a water supply in a spacecraft. It includes an iodine accumulator which stores crystalline iodine, an electrochemical valve to control the input of iodine to the drinking water and an iodine dispenser. A pump dispenses fluid through the iodine dispenser and an iodine sensor to a potable water tank storage. The iodine sensor electronically detects the iodine level in the water, and through electronic means, produces a correction current control. The correction current control operates the electro-chemical iodine valve to release iodine from the iodine accumulator into the iodine dispenser.

  17. Iodination and stability of somatostatin analogues: comparison of iodination techniques. A practical overview.

    Science.gov (United States)

    de Blois, Erik; Chan, Ho Sze; Breeman, Wouter A P

    2012-01-01

    For iodination ((125/127)I) of tyrosine-containing peptides, chloramin-T, Pre-Coated Iodo-Gen(®) tubes and Iodo-Beads(®) (Pierce) are commonly used for in vitro radioligand investigations and there have been reliant vendors hereof for decades. However, commercial availability of these radio-iodinated peptides is decreasing. For continuation of our research in this field we investigated and optimized (radio-)iodination of somatostatin analogues. In literature, radioiodination using here described somatostatin analogues and iodination techniques are described separately. Here we present an overview, including High Performance Liquid Chromatography (HPLC) separation and characterisation by mass spectrometry, to obtain mono- and di-iodinated analogues. Reaction kinetics of (125/127)I iodinated somatostatin analogues were investigated as function of reaction time and concentration of reactants, including somatostatin analogues, iodine and oxidizing agent. To our knowledge, for the here described somatostatin analogues, no (127)I iodination and optimization are described. (Radio-)iodinated somatostatin analogues could be preserved with a >90% radiochemical purity for 1 month after reversed phase HPLC-purification.

  18. 20 CFR 498.126 - Settlement.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Settlement. 498.126 Section 498.126 Employees' Benefits SOCIAL SECURITY ADMINISTRATION CIVIL MONETARY PENALTIES, ASSESSMENTS AND RECOMMENDED EXCLUSIONS § 498.126 Settlement. The Inspector General has exclusive authority to settle any issues or case...

  19. Chemical species of iodine in some seaweeds. Pt. 2. Iodine-bound biological macromolecules

    International Nuclear Information System (INIS)

    Xiaolin Hou; Chifang Chai; Xiaojun Yan

    2000-01-01

    The distribution of iodine in various biological macromolecules in Sargassum kjellmanianum was studied using neutron activation analysis combined with chemical and biochemical separation techniques. The results indicate that iodine is mainly bound with protein, part of iodine with pigment and polyphenol, and little with polysaccharides, such as algin, fucoidan and cellulose. This result is significant for the mechanism of enriching iodine of algae and utilization of alga iodine. (author)

  20. Modeling an Iodine Hall Thruster Plume in the Iodine Satellite (ISAT)

    Science.gov (United States)

    Choi, Maria

    2016-01-01

    An iodine-operated 200-W Hall thruster plume has been simulated using a hybrid-PIC model to predict the spacecraft surface-plume interaction for spacecraft integration purposes. For validation of the model, the plasma potential, electron temperature, ion current flux, and ion number density of xenon propellant were compared with available measurement data at the nominal operating condition. To simulate iodine plasma, various collision cross sections were found and used in the model. While time-varying atomic iodine species (i.e., I, I+, I2+) information is provided by HPHall simulation at the discharge channel exit, the molecular iodine species (i.e., I2, I2+) are introduced as Maxwellian particles at the channel exit. Simulation results show that xenon and iodine plasma plumes appear to be very similar under the assumptions of the model. Assuming a sticking coefficient of unity, iodine deposition rate is estimated.

  1. Separation of iodine-131 from water using isotopic exchange with iodine-starch compound

    International Nuclear Information System (INIS)

    Ignatov, V.P.; Kolomejtseva, I.V.

    1990-01-01

    Conditions of iodine isotopic exchange with iodine-starch compound (ISC) were studied with the aim of compound utilizatoin for radioactive iodine separation from solution. It is shown that in pH range from 2 to 7 the degree of iodine extraction and coefficient of its distribution practically do not depend on pH, at pH>7 ISC destruction (decolorizing) starts and iodine extraction decreases. Rapid method of iodine separation from solution is suggested. The method can be used in radiochemical techniques. The degree of extraction equals 80 %, a higher degree of extraction can not be achieved owing to ISC formation peculiarities

  2. Iodine budget in surface waters from Atacama: Natural and anthropogenic iodine sources revealed by halogen geochemistry and iodine-129 isotopes

    International Nuclear Information System (INIS)

    Álvarez, Fernanda; Reich, Martin; Snyder, Glen; Pérez-Fodich, Alida; Muramatsu, Yasuyuki; Daniele, Linda; Fehn, Udo

    2016-01-01

    Iodine enrichment in the Atacama Desert of northern Chile is widespread and varies significantly between reservoirs, including nitrate-rich “caliche” soils, supergene Cu deposits and marine sedimentary rocks. Recent studies have suggested that groundwater has played a key role in the remobilization, transport and deposition of iodine in Atacama over scales of millions-of-years. However, and considering that natural waters are also anomalously enriched in iodine in the region, the relative source contributions of iodine in the waters and its extent of mixing remain unconstrained. In this study we provide new halogen data and isotopic ratios of iodine ("1"2"9I/I) in shallow seawater, rivers, salt lakes, cold and thermal spring water, rainwater and groundwater that help to constrain the relative influence of meteoric, marine and crustal sources in the Atacama waters. Iodine concentrations in surface and ground waters range between 0.35 μM and 26 μM in the Tarapacá region and between 0.25 μM and 48 μM in the Antofagasta region, and show strong enrichment when compared with seawater concentrations (I = ∼0.4 μM). In contrast, no bromine enrichment is detected (1.3–45.7 μM for Tarapacá and 1.7–87.4 μM for Antofagasta) relative to seawater (Br = ∼600 μM). These data, coupled to the high I/Cl and low Br/Cl ratios are indicative of an organic-rich sedimentary source (related with an “initial” fluid) that interacted with meteoric water to produce a mixed fluid, and preclude an exclusively seawater origin for iodine in Atacama natural waters. Iodine isotopic ratios ("1"2"9I/I) are consistent with halogen chemistry and confirm that most of the iodine present in natural waters derives from a deep initial fluid source (i.e., groundwater which has interacted with Jurassic marine basement), with variable influence of at least one atmospheric or meteoric source. Samples with the lowest isotopic ratios ("1"2"9I/I from ∼215 to ∼1000 × 10"

  3. Iodine mineral waters

    Directory of Open Access Journals (Sweden)

    Iluta Alexandru

    2011-11-01

    Full Text Available Iodine mineral waters are found especially in sub-Carpathian region, also in regions with Salif deposits. Waters are currently used iodine in drinking cure for chaps and Basedow. Are also indicated in balneology. Iodine water containing at least 1 mg L, there is pure iodine is usually given the nature of other types of mineral waters further: sodium chlorinated water (Bazna (50-70 mg iodine / l, Baile Govora (50 - 70 mg / l, Bălţăteşti (4-5 mg / l, salted Monteoru (30 mg / l, mine water mixed alkaline chlorination, sulphate, which are indicated for crenoterapie (hypo or isotonic to the bathrooms Olăneşti or Călimăneşti-Căciulata.

  4. Iodine status in neonates in Denmark: regional variations and dependency on maternal iodine supplementation

    DEFF Research Database (Denmark)

    Nøhr, S B; Laurberg, P; Børlum, K G

    1994-01-01

    Iodine status of 147 neonates born in five different regions of Denmark was evaluated in relation to the iodine content of breast milk and iodine supplementation taken by the mother. Approximately two-thirds of the women had not received iodine supplementation. They had low iodine concentrations...... in breast milk and urinary iodine concentrations of the neonates at day 5 were low. The median values (milk/urine) were 33.6/31.7 micrograms/l (Randers 22/26, Ringkøbing 29/16, Aalborg 36/31. Arhus 54/41 and Copenhagen 55/59 micrograms/l). Higher values were found in the group where tablets containing...... iodine had been taken (milk/urine: 57.0/61.0 micrograms/l). In general, the values are low compared with internationally recommended levels. We suggest that mothers without autoimmune thyroid disease should receive iodine supplementation in the form of vitamin/mineral tablets containing iodine (150...

  5. 42 CFR 1003.126 - Settlement.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 5 2010-10-01 2010-10-01 false Settlement. 1003.126 Section 1003.126 Public Health OFFICE OF INSPECTOR GENERAL-HEALTH CARE, DEPARTMENT OF HEALTH AND HUMAN SERVICES OIG AUTHORITIES CIVIL MONEY PENALTIES, ASSESSMENTS AND EXCLUSIONS § 1003.126 Settlement. The Inspector General has exclusive...

  6. Urinary Iodine Clearance following Iodinated Contrast Administration: A Comparison of Euthyroid and Postthyroidectomy Subjects

    Directory of Open Access Journals (Sweden)

    Janice D. Ho

    2014-01-01

    Full Text Available Purpose. To compare iodine clearance following iodinated contrast administration in thyroidectomised thyroid cancer patients and euthyroid individuals. Methods. A convenience population (6 thyroidectomised thyroid cancer patients and 7 euthyroid controls was drawn from patients referred for iodinated contrast-enhanced computed tomography (CT studies. Subjects had sequential urine samples collected up to 6 months (50 samples from the thyroidectomised and 63 samples from the euthyroid groups. t-tests and generalised estimating equations (GEE were used to test for group differences in urinary iodine creatinine ratios. Results. Groups had similar urinary iodine creatinine ratios at baseline, with a large increase 2 weeks following iodinated contrast (P=0.005. Both groups had a return of urinary iodine creatinine ratios to baseline by 4 weeks, with no significant group differences overall or at any time point. Conclusions. Thyroidectomised patients did not have a significantly different urinary iodine clearance than euthyroid individuals following administration of iodinated contrast. Both had a return of urinary iodine creatinine ratios to baseline within 4 weeks.

  7. [Study on the iodine nutrition and iodine deficiency disorders status in pasturing areas of Tibet-a non-epidemic area of iodine deficiency disorders in serious iodine deficiency district].

    Science.gov (United States)

    DU, Dan; Li, Su-Mei; Li, Xiu-Wei; Wang, Hai-Yan; Li, Shu-Hua; Nima, Cangjue; Danzeng, Sangbu; Zhuang, Guang-Xiu

    2010-08-01

    To explore the status of iodine nutrition and iodine deficiency disorders in the pasturing areas and agricultural regions in Tibet. 30 families were selected respectively in pastoral Dangxiong county and agricultural Qushui county of Lasa. Drinking water and edible salt were collected for testing the iodine contents. In each type of the following populations including children aged 8 - 10, women of child-bearing age and male adults, 50 subjects were randomly sampled to examine their urinary iodine contents. Among them, 50 children and 50 women were randomly selected for goiter examination by palpation. Water iodine content was less than 2 µg/L, both in pasturing area and in agricultural areas. There was no iodized salt used in the families of pasturing areas, while 90% people consumed iodized salt in agricultural areas. The median of urinary iodine in pasturing area was 50.2 µg/L, significantly lower than that of agricultural area (193.2 µg/L). However, the goiter rate of children and women in pasturing area was significantly lower than that in agricultural area. Although iodine intake of populations in pasturing area of Tibet was severely deficient, there was no epidemic of Iodine Deficiency Disorders. This phenomenon noticed by the researchers deserved further investigation.

  8. Iodine deficiency disorders

    Energy Technology Data Exchange (ETDEWEB)

    Ali, S M [Pakistan Council for Science and Technology, Islamabad (Pakistan)

    1994-12-31

    Iodine deficiency (IDD) is one of the common problem in the diet. Iodine deficiency as prevalence of goiter in population occurs in the mountainous areas. There is consensus that 800 million people are at risk of IDD from living in iodine deficient area and 190 million from goiter. Very high prevalence of IDD in different parts of the world are striking. It has generally observed that in iodine-deficient areas about 50% are affected with goiter, 1-5% from cretinsim and 20% from impaired mental and/or mortor function. (A.B.).

  9. Iodine deficiency and thyroid disorders.

    Science.gov (United States)

    Zimmermann, Michael B; Boelaert, Kristien

    2015-04-01

    Iodine deficiency early in life impairs cognition and growth, but iodine status is also a key determinant of thyroid disorders in adults. Severe iodine deficiency causes goitre and hypothyroidism because, despite an increase in thyroid activity to maximise iodine uptake and recycling in this setting, iodine concentrations are still too low to enable production of thyroid hormone. In mild-to-moderate iodine deficiency, increased thyroid activity can compensate for low iodine intake and maintain euthyroidism in most individuals, but at a price: chronic thyroid stimulation results in an increase in the prevalence of toxic nodular goitre and hyperthyroidism in populations. This high prevalence of nodular autonomy usually results in a further increase in the prevalence of hyperthyroidism if iodine intake is subsequently increased by salt iodisation. However, this increase is transient because iodine sufficiency normalises thyroid activity which, in the long term, reduces nodular autonomy. Increased iodine intake in an iodine-deficient population is associated with a small increase in the prevalence of subclinical hypothyroidism and thyroid autoimmunity; whether these increases are also transient is unclear. Variations in population iodine intake do not affect risk for Graves' disease or thyroid cancer, but correction of iodine deficiency might shift thyroid cancer subtypes toward less malignant forms. Thus, optimisation of population iodine intake is an important component of preventive health care to reduce the prevalence of thyroid disorders. Copyright © 2015 Elsevier Ltd. All rights reserved.

  10. Iodine Status in Pregnant & Breastfeeding Women

    DEFF Research Database (Denmark)

    Andersen, Stine Linding

    Iodine is required for the synthesis of thyroid hormones, which are crucial regulator of early brain development. The source of iodine in the fetus and the breastfed infant is maternal iodine, and adequate iodine intake in pregnant and breastfeeding is of major concern. Severe iodine deficiency can...... cause irreversible brain damage, whereas the consequences of mild to moderate iodine deficiency are less clear. Denmark was previously iodine deficient with regional differences (mild iodine deficiency in East Denmark and moderate iodine deficiency in West Denmark), and also pregnant and breastfeeding...... women suffered from iodine deficiency. A mandatory iodine fortification of household salt and salt used for commercial production of bread was introduced in Denmark in the year 2000. The PhD thesis investigates intake of iodine supplements and urinary iodine status in Danish pregnant and breastfeeding...

  11. Consuming iodine enriched eggs to solve the iodine deficiency endemic for remote areas in Thailand

    Directory of Open Access Journals (Sweden)

    Teeyapant Punthip

    2010-12-01

    Full Text Available Abstract Background Evidence showed that the occurrence of iodine deficiency endemic areas has been found in every provinces of Thailand. Thus, a new pilot programme for elimination of iodine deficiency endemic areas at the community level was designed in 2008 by integrating the concept of Sufficient Economic life style with the iodine biofortification of nutrients for community consumption. Methods A model of community hen egg farm was selected at an iodine deficiency endemic area in North Eastern part of Thailand. The process for the preparation of high content iodine enriched hen food was demonstrated to the farm owner with technical transfer in order to ensure the sustainability in the long term for the community. The iodine content of the produced iodine enriched hen eggs were determined and the iodine status of volunteers who consumed the iodine enriched hen eggs were monitored by using urine iodine excretion before and after the implement of iodine enrichment in the model farm. Results The content of iodine in eggs from the model farm were 93.57 μg per egg for the weight of 55 - 60 g egg and 97.76 μg for the weight of 60 - 65 g egg. The biological active iodo-organic compounds in eggs were tested by determination of the base-line urine iodine of the volunteer villagers before and after consuming a hard boiled iodine enriched egg per volunteer at breakfast for five days continuous period in 59 volunteers of Ban Kew village, and 65 volunteers of Ban Nong Nok Kean village. The median base-line urine iodine level of the volunteers in these two villages before consuming eggs were 7.00 and 7.04 μg/dL respectively. After consuming iodine enriched eggs, the median urine iodine were raised to the optimal level at 20.76 μg/dL for Ban Kew and 13.95 μg/dL for Ban Nong Nok Kean. Conclusions The strategic programme for iodine enrichment in the food chain with biological iodo-organic compound from animal origins can be an alternative method to

  12. Iodine in meat in Macedonia

    International Nuclear Information System (INIS)

    Bogdanov, Bogdan; Gonev, Mihajlo; Tadzher, Isak

    2000-01-01

    Iodine deficiency in Macedonia still persists in a mild form. In 1999 the iodination of salt rose to 20 m gr iodine in Kg salt. The consumption of salt diminished after the last war from 20-30 gr salt per day to 10-20 gr salt daily. This shows that the problem of the elimination of iodine deficiency is being vigorously tackled. Since 1956 the iodine in salt in Macedonia rose to 10 m gr KI/Kg salt. The content of iodine in the Macedonian diet seems to be important. The amount of iodine in milk, eggs and bread is low as found by the investigation of MANU. The content of iodine in meat is low, compared to British meat is 10 times lower. The average iodine content in Macedonian meat is 95.15 micro gr per Kg, whereas in British meat it is 850-1510 micro gr iodine per k gr meat. (Original)

  13. 46 CFR 126.130 - Cranes.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Cranes. 126.130 Section 126.130 Shipping COAST GUARD... § 126.130 Cranes. (a) Except as provided by paragraph (b) of this section, cranes, if installed, must... chapter. (b) The manufacturer of a crane may have tests and inspections conducted in compliance with § 107...

  14. 33 CFR 157.126 - Pumps.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Pumps. 157.126 Section 157.126... Washing (COW) System on Tank Vessels Design, Equipment, and Installation § 157.126 Pumps. (a) Crude oil must be supplied to the COW machines by COW system pumps or cargo pumps. (b) The pumps under paragraph...

  15. Iodine Hall Thruster

    Science.gov (United States)

    Szabo, James

    2015-01-01

    Iodine enables dramatic mass and cost savings for lunar and Mars cargo missions, including Earth escape and near-Earth space maneuvers. The demonstrated throttling ability of iodine is important for a singular thruster that might be called upon to propel a spacecraft from Earth to Mars or Venus. The ability to throttle efficiently is even more important for missions beyond Mars. In the Phase I project, Busek Company, Inc., tested an existing Hall thruster, the BHT-8000, on iodine propellant. The thruster was fed by a high-flow iodine feed system and supported by an existing Busek hollow cathode flowing xenon gas. The Phase I propellant feed system was evolved from a previously demonstrated laboratory feed system. Throttling of the thruster between 2 and 11 kW at 200 to 600 V was demonstrated. Testing showed that the efficiency of iodine fueled BHT-8000 is the same as with xenon, with iodine delivering a slightly higher thrust-to-power (T/P) ratio. In Phase II, a complete iodine-fueled system was developed, including the thruster, hollow cathode, and iodine propellant feed system. The nominal power of the Phase II system is 8 kW; however, it can be deeply throttled as well as clustered to much higher power levels. The technology also can be scaled to greater than 100 kW per thruster to support megawatt-class missions. The target thruster efficiency for the full-scale system is 65 percent at high specific impulse (Isp) (approximately 3,000 s) and 60 percent at high thrust (Isp approximately 2,000 s).

  16. Marine geochemistry of iodine

    International Nuclear Information System (INIS)

    Kennedy, H.; Elderfield, H.

    1985-01-01

    Iodine has long been classified as a biophilic element with analyses showing that iodine is strongly enriched, relative to seawater concentrations in both plankton and particulate matter and that the concentration of iodine found in surface sediments is still further enriched relative to that found in the sedimenting particulate matter. The extent of enrichment of iodine relative to carbon in deep sea surface sediments has been shown to depend on the carbon accumulation rate. Iodine decomposition rates have been calculated and are shown to vary with the sedimentation rate in the same manner as has been shown for organic carbon. Vertical profiles of total dissolved iodine, iodate and iodide in interstitial waters of sediments from the north east Atlantic are characterised by three zones of reaction as identified by changes in the concentration of iodate and iodide. These reaction zones represent (i) iodide production (ii) iodide oxidation and (iii) iodate reduction. Pore water and solid phase iodine profiles from cores containing turbidite units have shown that iodine, released to pore waters as iodide during the oxidation of the organic matter, has been scavenged after diffusing upwards into a less reducing region of the sediment. (author)

  17. Analysis of iodine content in seaweed by GC-ECD and estimation of iodine intake

    Directory of Open Access Journals (Sweden)

    Tai Sheng Yeh

    2014-06-01

    Full Text Available Edible seaweed products have been consumed in many Asian countries. Edible seaweeds accumulate iodine from seawater, and are therefore a good dietary source of iodine. An adequate consumption of seaweed can eliminate iodine deficiency disorders, but excessive iodine intake is not good for health. The recommended dietary reference intake of 0.15 mg/d and 0.14 mg/d for iodine has been established in the United States and Taiwan, respectively. In this study, 30 samples of seaweed were surveyed for iodine content. The samples included 10 nori (Porphyra, 10 wakame (Undaria, and 10 kombu (Laminaria products. The iodine in seaweed was derivatized with 3-pentanone and detected by gas chromatography-electron capture detector (GC-ECD. The method detection limit was 0.5 mg/kg. The iodine content surveyed for nori was 29.3–45.8 mg/kg, for wakame 93.9–185.1 mg/kg, and for kombu 241–4921 mg/kg. Kombu has the highest average iodine content 2523.5 mg/kg, followed by wakame (139.7 mg/kg and nori (36.9 mg/kg. The GC-ECD method developed in this study is a low-cost alternative to inductively coupled plasma-optical emission spectroscopy for iodine detection in seaweeds. The iodine intake from seaweed in the current survey was calculated and compared with the iodine dietary reference intake of Taiwan. The risk and benefit of seaweed consumption is also discussed.

  18. Breast-Milk Iodine Concentrations and Iodine Levels of Infants According to the Iodine Status of the Country of Residence: A Systematic Review and Meta-Analysis.

    Science.gov (United States)

    Nazeri, Pantea; Kabir, Ali; Dalili, Hosein; Mirmiran, Parvin; Azizi, Fereidoun

    2018-01-01

    Iodine, an essential micronutrient, plays a critical role in normal growth and development, especially during the first two years of life. This systematic review and meta-analysis is among the first to evaluate breast-milk iodine concentrations and infant iodine status in countries characterized by iodine sufficiency or deficiency. PubMed, Web of Science, Cochrane Library, Google Scholar, and other relevant databases, as well as reference lists of previous reviews, were searched for relevant studies published between 1986 and 2016. Mean or median breast-milk and infant urinary iodine concentrations, along with other relevant data, were extracted from eligible studies. Each study was assessed for quality and risk of bias. Of the 496 identified studies, 57 met the criteria for inclusion in the meta-analysis. The mean (confidence interval [CI]) iodine concentrations in maternal colostrum were 152.0 μg/L [CI 106.2-198.7 μg/L] and 57.8 μg/L [CI 41.4-74.1 μg/L] in iodine-sufficient and -deficient countries, respectively, indicating a significant difference between the two iodine statuses. By contrast, the corresponding values in mature milk did not differ significantly between mothers in iodine-sufficient and -deficient countries (71.5 μg/L [CI 51.0-92.0 μg/L] and 28.0 μg/L [CI -13.8 to 69.9 μg/L], respectively]. The weighted urinary iodine levels [CIs] of breast-fed infants in iodine-sufficient countries were significantly higher than those in iodine-deficient countries (164.5 μg/L [CI 116.4-212.7 μg/L] vs. 70.4 μg/L [CI 46.2-94.6 μg/L]). Similarly, a significant difference was observed in the pooled estimates of urinary iodine levels [CIs] among formula-fed infants in iodine-sufficient versus iodine-deficient countries (310.3 μg/L [CI 287.4-342.1 μg/L] vs. 38.3 μg/L [CI 23.4-53.2 μg/L]). The meta-analysis reveals that in iodine-sufficient countries, the mean iodine concentrations in colostrum and mature breast milk

  19. Radioactive iodine intake through foodstuff

    International Nuclear Information System (INIS)

    Omomo, Yoichiro

    1974-01-01

    The transition of radioactive iodine to human bodies is affected by the amount of coexisting stable iodine. The intake of stable iodine through foodstuffs was studied from the stand point of I) discussion of the literature which states the approximate amounts of stable iodine contained in environmental materials, and II) the authors' research on the consumption of foodstuffs. For example, the amounts of iodine intake of fishermen living in Kuji-cho (Ibaragi Prefecture) was estimated from I and II, and was revealed as 2704p. The national average iodine intake was about 800p indicating that the former estimated value was remarkably high. Eighty Four per cent of the 2.7 mg iodine intake was taken from marine products, indicating that marine products are important sources of iodine supply. (Tsukamoto, Y.)

  20. FDA regulations regarding iodine addition to foods and labeling of foods containing added iodine12

    Science.gov (United States)

    Trumbo, Paula R

    2016-01-01

    The US Food and Drug Administration (FDA) regulates the addition of iodine to infant formulas, the iodization of salt, and the addition of salt and iodine to foods. The required amount of iodine in infant formulas is based on caloric content, and the label must provide the iodine content per 100 kcal. Cuprous iodide and potassium iodide may be added to table salt as a source of dietary iodine at a maximum amount of 0.01%; if added, the label must indicate that the salt is iodized. Table salt to which iodine has not been added must bear the statement, “This salt does not supply iodide, a necessary nutrient.” If a nutrient is to be appropriately added to a food for the purpose of correcting a dietary insufficiency, there should be sufficient scientific information available to demonstrate a nutritional deficiency and/or identify a public health problem. Furthermore, the population groups that would benefit from the proposed fortification should be identified. If iodine is added to a food, the percent Daily Value of iodine must be listed. There are no FDA regulations governing ingredient standards for dietary supplements. As a result, some dietary supplements include iodine and others do not. If a supplement contains iodine, the Supplement Facts label must list iodine as a nutrient ingredient. If iodine is not listed on the Supplement Facts label, then it has not been added. There are similarities between the FDA, which establishes US food regulations and policies, and the Codex Alimentarius (Codex), which develops international food standards and guidelines under the aegis of the FAO and the WHO. Both the FDA and Codex call for the labeling of table salt to indicate fortification with iodine, voluntary labeling of iodine on foods, and a Daily Value (called a Nutrient Reference Value by Codex) of 150 μg for iodine. PMID:27534626

  1. LWR severe accident simulation: Iodine behaviour in FPT2 experiment and advances on containment iodine chemistry

    Energy Technology Data Exchange (ETDEWEB)

    Girault, N., E-mail: nathalie.girault@irsn.fr [Institut de Radioprotection et de Surete Nucleaire (IRSN), BP3 - 13115 St.-Paul-lez-Durance (France); Bosland, L. [Institut de Radioprotection et de Surete Nucleaire (IRSN), BP3 - 13115 St.-Paul-lez-Durance (France); Dickinson, S. [National Nuclear Laboratory, Harwell, Oxon OX11 0QT (United Kingdom); Funke, F. [AREVA NP Gmbh, PO Box 1109, 91001 Erlangen (Germany); Guentay, S. [Paul Scherrer Institut, 5232 Villigen PSI (Switzerland); Herranz, L.E. [Centro des Investigaciones Energeticas, MedioAmbiantales y Tecnologicas, av. Complutense 2, 28040 Madrid (Spain); Powers, D. [Sandia National Laboratories, New Mexico, PO Box 5800, Albuquerque, NM 87185 (United States)

    2012-02-15

    Highlights: Black-Right-Pointing-Pointer Short term gaseous iodine fraction can be produced either in primary circuit or on containment condensing surfaces. Black-Right-Pointing-Pointer Gaseous radiolytic reactions convert volatile iodine into non-volatile iodine oxide particulates. Black-Right-Pointing-Pointer Alkaline and evaporating sump decrease the iodine volatility in containment. Black-Right-Pointing-Pointer Release of volatile iodine from containment surfaces explained the long term stationary residual gaseous iodine concentration. - Abstract: The Phebus Fission Product (FP) Program studies key phenomena of severe accidents in water-cooled nuclear reactors. In the framework of the Phebus program, five in-pile experiments have been performed that cover fuel rod degradation and behaviour of fission products released via the coolant circuit into the containment vessel. The focus of this paper is on iodine behaviour during the Phebus FPT2 test. FPT2 used a 33 GWd/t uranium dioxide fuel enriched to 4.5%, re-irradiated in situ for 7 days to a burn-up of 130 MWd/t. This test was performed to study the impact of steam-poor conditions and boric acid on the fission product chemistry. For the containment vessel, more specifically, the objective was to study iodine chemistry in an alkaline sump under evaporating conditions. The iodine results of the Phebus FPT2 test confirmed many of the essential features of iodine behaviour in the containment vessel provided by the first two Phebus tests, FPT0 and FPT1. These are the existence of an early gaseous iodine fraction, the persistence of low gaseous iodine concentrations and the importance of the sump in suppressing the iodine partitioning from sump to atmosphere. The main new insights provided by the Phebus FPT2 test were the iodine desorption from stainless steel walls deposits and the role of the evaporating sump in further iodine depletion in the containment atmosphere. The current paper presents an interpretation of

  2. Radioactive Iodine Treatment for Hyperthyroidism

    Science.gov (United States)

    ... Balance › Radioactive Iodine for Hyperthyroidism Fact Sheet Radioactive Iodine for Hyperthyroidism April, 2012 Download PDFs English Zulu ... prepare for RAI or surgery. How does radioactive iodine treatment work? Iodine is important for making thyroid ...

  3. Estimation of iodine intake from various urinary iodine measurements in population studies

    DEFF Research Database (Denmark)

    Vejbjerg, P.; Knudsen, N.; Perrild, H.

    2009-01-01

    Background: Iodine intake is often measured by a surrogate measure, namely urine iodine excretion as almost all ingested iodine is excreted in the urine. However, the methods for urine collection and the reporting of the results vary. These methods, and their advantages and disadvantages, are con...

  4. Suboptimal Iodine Concentration in Breastmilk and Inadequate Iodine Intake among Lactating Women in Norway.

    Science.gov (United States)

    Henjum, Sigrun; Lilleengen, Anne Marie; Aakre, Inger; Dudareva, Anna; Gjengedal, Elin Lovise Folven; Meltzer, Helle Margrete; Brantsæter, Anne Lise

    2017-06-22

    Breastfed infants depend on sufficient maternal iodine intake for optimal growth and neurological development. Despite this, few studies have assessed iodine concentrations in human milk and there is currently no published data on iodine status among lactating women in Norway. The aim of this study was to assess iodine concentrations in breast milk (BMIC) in lactating women and estimate iodine intake. Five Mother and Child Health Centres in Oslo were randomly selected during 2016, and 175 lactating women between 2nd and 28th weeks postpartum participated. Each of the women provided four breastmilk samples which were pooled and analysed for iodine concentrations. Participants also provided information on iodine intake from food and supplements covering the last 24 h and the habitual iodine intake (food frequency questionnaire). The median (p25, p75 percentiles) BMIC was 68 (45, 98) µg/L and 76% had BMIC food (p25, p75) was 121 (82, 162) µg/day and the total intake (food and supplements) was 134 (95, 222) µg/day. The majority of lactating women had suboptimal BMIC and inadequate intake of iodine from food and supplements.

  5. Measurement of thyroid volume, iodine concentration and total iodine content by CT and its clinical significance

    International Nuclear Information System (INIS)

    Nakaji, Shunsuke; Imanishi, Yoshimasa; Okamoto, Kyouko; Shinagawa, Toshihito

    2007-01-01

    Recently, Imanishi et al have developed new CT software for quantitative in vivo measurement of thyroid iodine. Using a CT system with the software, we measured volume, iodine concentration and total iodine content of thyroids in 63 controls and 435 patients with various diffuse thyroid diseases and thyroid nodules. In controls, all of them showed no difference between the sexes. Although the iodine concentration of the thyroid showed no difference among children, adults and seniles, the volume and total iodine content of the thyroid appeared smaller in children and seniles than in adults. In addition, although the volume and iodine concentration of the thyroid had two peaks in distribution, the total iodine content had almost normal distribution. Normal range of volume, iodine concentration and total iodine content in adults were 5.2-15.5 cm 3 , 0.28831-0.85919 mg/cm 3 and 2.35-11.69 mg, respectively. In thyroid nodule, there is no significant difference in volume, iodine concentration and total iodine content between benign and malignant nodules. All nodules with iodine concentration of less than 0.00007 mg/cm 3 were benign. No thyroid was higher in iodine concentration than the normal range although the thyroid was lower in 78.7% of patients with diffuse thyroid diseases. In all thyroids with increasing iodine concentration and total iodine content in medication course, thyroidal symptoms and signs were uncontrollable by the medication. In 43.8% of patients with long-period systemic diseases, the thyroid showed abnormality in any of the three. We concluded that quantitative in vivo measurement of thyroid iodine by CT could assist the diagnosis of thyroid diseases and decision of therapeutic methods. (author)

  6. Assessment of spatial variation in drinking water iodine and its implications for dietary intake: A new conceptual model for Denmark

    Energy Technology Data Exchange (ETDEWEB)

    Voutchkova, Denitza Dimitrova, E-mail: ddv@geo.au.dk [Department of Geoscience, Aarhus University, Høegh-Guldbergs Gade 2, DK-8000 Aarhus C (Denmark); Geological Survey of Denmark and Greenland (GEUS), Lyseng Allé 1, DK-8270 Højbjerg (Denmark); Geological Survey of Denmark and Greenland (GEUS), Øster Voldgade 10, DK-1350 Copenhagen K (Denmark); Ernstsen, Vibeke [Geological Survey of Denmark and Greenland (GEUS), Øster Voldgade 10, DK-1350 Copenhagen K (Denmark); Hansen, Birgitte; Sørensen, Brian Lyngby [Geological Survey of Denmark and Greenland (GEUS), Lyseng Allé 1, DK-8270 Højbjerg (Denmark); Zhang, Chaosheng [GIS Centre and School of Geography and Archaeology, National University of Ireland, Galway (Ireland); Kristiansen, Søren Munch [Department of Geoscience, Aarhus University, Høegh-Guldbergs Gade 2, DK-8000 Aarhus C (Denmark)

    2014-09-15

    Iodine is essential for human health. Many countries have therefore introduced universal salt iodising (USI) programmes to ensure adequate intake for the populations. However, little attention has been paid to subnational differences in iodine intake from drinking water caused by naturally occurring spatial variations. To address this issue, we here present the results of a Danish nationwide study of spatial trends of iodine in drinking water and the relevance of these trends for human dietary iodine intake. The data consist of treated drinking water samples from 144 waterworks, representing approx. 45% of the groundwater abstraction for drinking water supply in Denmark. The samples were analysed for iodide, iodate, total iodine (TI) and other major and trace elements. The spatial patterns were investigated with Local Moran's I. TI ranges from < 0.2 to 126 μg L{sup −1} (mean 14.4 μg L{sup −1}, median 11.9 μg L{sup −1}). Six speciation combinations were found. Half of the samples (n = 71) contain organic iodine; all species were detected in approx. 27% of all samples. The complex spatial variation is attributed both to the geology and the groundwater treatment. TI > 40 μg L{sup −1} originates from postglacial marine and glacial meltwater sand and from Campanian–Maastrichtian chalk aquifers. The estimated drinking water contribution to human intake varies from 0% to > 100% of the WHO recommended daily iodine intake for adults and from 0% to approx. 50% for adolescents. The paper presents a new conceptual model based on the observed clustering of high or low drinking-water iodine concentrations, delimiting zones with potentially deficient, excessive or optimal iodine status. Our findings suggest that the present coarse-scale nationwide programme for monitoring the population's iodine status may not offer a sufficiently accurate picture. Local variations in drinking-water iodine should be mapped and incorporated into future adjustment of the

  7. Assessment of spatial variation in drinking water iodine and its implications for dietary intake: A new conceptual model for Denmark

    International Nuclear Information System (INIS)

    Voutchkova, Denitza Dimitrova; Ernstsen, Vibeke; Hansen, Birgitte; Sørensen, Brian Lyngby; Zhang, Chaosheng; Kristiansen, Søren Munch

    2014-01-01

    Iodine is essential for human health. Many countries have therefore introduced universal salt iodising (USI) programmes to ensure adequate intake for the populations. However, little attention has been paid to subnational differences in iodine intake from drinking water caused by naturally occurring spatial variations. To address this issue, we here present the results of a Danish nationwide study of spatial trends of iodine in drinking water and the relevance of these trends for human dietary iodine intake. The data consist of treated drinking water samples from 144 waterworks, representing approx. 45% of the groundwater abstraction for drinking water supply in Denmark. The samples were analysed for iodide, iodate, total iodine (TI) and other major and trace elements. The spatial patterns were investigated with Local Moran's I. TI ranges from < 0.2 to 126 μg L −1 (mean 14.4 μg L −1 , median 11.9 μg L −1 ). Six speciation combinations were found. Half of the samples (n = 71) contain organic iodine; all species were detected in approx. 27% of all samples. The complex spatial variation is attributed both to the geology and the groundwater treatment. TI > 40 μg L −1 originates from postglacial marine and glacial meltwater sand and from Campanian–Maastrichtian chalk aquifers. The estimated drinking water contribution to human intake varies from 0% to > 100% of the WHO recommended daily iodine intake for adults and from 0% to approx. 50% for adolescents. The paper presents a new conceptual model based on the observed clustering of high or low drinking-water iodine concentrations, delimiting zones with potentially deficient, excessive or optimal iodine status. Our findings suggest that the present coarse-scale nationwide programme for monitoring the population's iodine status may not offer a sufficiently accurate picture. Local variations in drinking-water iodine should be mapped and incorporated into future adjustment of the monitoring and/or the

  8. Local radiolytic effectiveness of Auger electrons of iodine-125 in benzene-iodine solutions

    International Nuclear Information System (INIS)

    Uenak, P.; Uenak, T.

    1987-01-01

    High radiotoxicity of iodine-125 has been mainly attributed to the local radiolytic effects of Auger electrons on biological systems. In the present study, experimental and theoretical results are compared. The agreement between the experimental and theoretical results explains that the energy absorption of iodine aggregates has an important role in the radiolytic effectiveness of Auger electrons and iodine-125 in benzene-iodine solutions. (author) 18 refs.; 3 figs

  9. Molecular environment of iodine in naturally iodinated humic substances: Insight from X-ray absorption spectroscopy

    International Nuclear Information System (INIS)

    Schlegel, Michel L.; Mercier-Bion, Florence; Barre, Nicole; Reiller, Pascal; Moulin, Valerie

    2006-01-01

    The molecular environment of iodine in reference inorganic and organic compounds, and in dry humic and fulvic acids (HAs and FAs) extracted from subsurface and deep aquifers was probed by iodine L-3-edge X-ray absorption spectroscopy. The X-ray absorption near-edge structure (XANES) of iodine spectra from HAs and FAs resembled those of organic references and displayed structural features consistent with iodine forming covalent bonds with organic molecules. Simulation of XANES spectra by linear combination of reference spectra suggested the predominance of iodine forming covalent bonds to aromatic rings (aromatic-bound iodine). Comparison of extended X-ray absorption fine structure (EXAFS) spectra of reference and samples further showed that iodine was surrounded by carbon shells at distances comparable to those for references containing aromatic-bound iodine. Quantitative analysis of EXAFS spectra indicated that iodine was bound to about one carbon at a distance d(I-C) of 2.01(4)-2.04(9) angstrom, which was comparable to the distances observed for aromatic-bound iodine in references (1.99(1)-2.07(6) angstrom), and significantly shorter than that observed for aliphatic-bound iodine (2.15(2)-2.16(2) angstrom). These results are in agreement with previous conclusions from X-ray photoelectron spectroscopy and from electro-spray ionization mass spectrometry. These results collectively suggest that the aromatic-bound iodine is stable in the various aquifers of this study. (authors)

  10. Controversies in urinary iodine determinations

    OpenAIRE

    Soldin, Offie Porat

    2002-01-01

    Iodine deficiency (ID) is associated with increased prevalence of goiter, increased risk for neurodevelopmental disorders, and is the world’s leading cause of intellectual deficits. Iodine nutritional status of a population is assessed by measurements of urinary iodine concentrations which are also used to define, indicate, survey and monitor iodine deficiency and consequently its treatment. Several methods are available for urinary iodine determination. Discussed here are some of the limitat...

  11. A rechargeable iodine-carbon battery that exploits ion intercalation and iodine redox chemistry.

    Science.gov (United States)

    Lu, Ke; Hu, Ziyu; Ma, Jizhen; Ma, Houyi; Dai, Liming; Zhang, Jintao

    2017-09-13

    Graphitic carbons have been used as conductive supports for developing rechargeable batteries. However, the classic ion intercalation in graphitic carbon has yet to be coupled with extrinsic redox reactions to develop rechargeable batteries. Herein, we demonstrate the preparation of a free-standing, flexible nitrogen and phosphorus co-doped hierarchically porous graphitic carbon for iodine loading by pyrolysis of polyaniline coated cellulose wiper. We find that heteroatoms could provide additional defect sites for encapsulating iodine while the porous carbon skeleton facilitates redox reactions of iodine and ion intercalation. The combination of ion intercalation with redox reactions of iodine allows for developing rechargeable iodine-carbon batteries free from the unsafe lithium/sodium metals, and hence eliminates the long-standing safety issue. The unique architecture of the hierarchically porous graphitic carbon with heteroatom doping not only provides suitable spaces for both iodine encapsulation and cation intercalation but also generates efficient electronic and ionic transport pathways, thus leading to enhanced performance.Carbon-based electrodes able to intercalate Li + and Na + ions have been exploited for high performing energy storage devices. Here, the authors combine the ion intercalation properties of porous graphitic carbons with the redox chemistry of iodine to produce iodine-carbon batteries with high reversible capacities.

  12. Effect of chronic douching with polyvinylpyrrolidone-iodine on iodine absorption and thyroid function

    International Nuclear Information System (INIS)

    Safran, M.; Braverman, L.E.

    1982-01-01

    Daily vaginal douching with polyvinylpyrrolidone-iodine in 12 euthyroid volunteers for 14 days resulted in a significant increase in serum total iodine concentration and urine iodine excretion. The increase in serum total iodine was associated with a marked decrease in 24-hour 123 I uptake by the thyroid and a small but significant increase in serum thyrotropin (TSH) concentration. However, values for serum TSH never rose above the normal range. No significant changes in serum thyroxine (T4), free T4 index (FTI), or triiodothyronine concentrations were observed, although serum T4 and FTI did decrease slightly during treatment. The findings suggest that iodine is absorbed across the vaginal mucosa and that the subsequent increase in serum total iodine does induce subtle increases in serum TSH concentration. There was no evidence, however, of overt hypothyroidism in these euthyroid women

  13. Iodine tablets and a nuclear accident

    International Nuclear Information System (INIS)

    Paile, W.

    1992-01-01

    Radioactive iodine is one of the major substances released during severe nuclear accidents. Radioactive iodine is easily gasified, and if present in fallout it can enter the lungs, and thereby the circulatory system, with the inhalation of air. Once in a body, radioactive iodine accumulates in the thyroid and may result in tumours in the thyroid and, in extreme cases, impaired thyroid function. Accumulation of radioactive iodine can be prevented by taking non-radioactive, 'cold' iodine as tablets. Iodine tablets dilute the radioactive iodine that has entered the body. A dose of iodine also paralyses the thyroid temporarily by saturating its iodine-carrying capacity. To be useful iodine tablets should be taken immediately when a radioactive emission has occurred. If the tablets are taken too early or too late, they give little protection. Iodine tablets should not be taken just to be on the safe side, since their use may involve harmful side effects. Dosing instructions should also be followed with care. (orig.)

  14. Iodine deficiency and nutrition in Scandinavia

    DEFF Research Database (Denmark)

    Manousou, Sofia; Dahl, Lisbeth; Heinsbaek Thuesen, Betina

    2017-01-01

    Iodine nutrition is a result of geological conditions, iodine fortification and monitoring strategies within a country together with the dietary habits of the population. This review summarizes the basis for the current iodine situation in the Scandinavian countries in order to identify gaps...... strategies have been used in Scandinavia to improve iodine nutrition. The major source of iodine is iodized salt in Sweden and from milk and dairy products in Norway. In Denmark, drinking water, milk, dairy products and iodized salt used in commercial production of bread are the important sources of iodine....... The current iodine status in Scandinavia is not optimal and action is ongoing to increase iodination in Denmark, where there is mild iodine deficiency in the general population. Data from all three countries indicate insufficient iodine nutrition during pregnancy and there is a need for data from children...

  15. Iodine requirements and the risks and benefits of correcting iodine deficiency in populations

    NARCIS (Netherlands)

    Zimmermann, M.B.

    2008-01-01

    Iodine deficiency has multiple adverse effects on growth and development due to inadequate thyroid hormone production that are termed the iodine deficiency disorders (IDD). IDD remains the most common cause of preventable mental impairment worldwide. IDD assessment methods include urinary iodine

  16. Volatilization of iodine from vegetation

    International Nuclear Information System (INIS)

    Amiro, B.D.; Johnston, F.L.

    1989-01-01

    Gaseous emissions of iodine were measured from bean plant foliage. A gamma-emitting iodine tracer, Na 125 I, was taken up by the plants from a hydroponic growth medium and released to a cuvette atmosphere. The dynamics of the flux were studied using a flow-through gamma detector. The relationship between leaf radioactive tracer activity and growth-medium activity was linear, as was the relationship between the iodine flux and both leaf and growth-medium activity. Iodine flux and leaf conductance to water responded similarly to changes in light levels, suggesting that the stomata may partially control the flux. The flux was inhibited by aeration of the hydroponic growth media, and we postulate that methylation causes the iodine flux. Iodine emissions from living vegetation probably contribute < 0.1% to the stable iodine concentration in the atmosphere above terrestrial areas. However, this pathway may be a direct route for radioactive iodine transport from contaminated soils to the atmosphere. (author)

  17. Volatilization of iodine from vegetation

    Energy Technology Data Exchange (ETDEWEB)

    Amiro, B D; Johnston, F L [Atomic Energy of Canada Ltd., Pinawa, MB (Canada). Whiteshell Nuclear Research Establishment

    1989-01-01

    Gaseous emissions of iodine were measured from bean plant foliage. A gamma-emitting iodine tracer, Na {sup 125}I, was taken up by the plants from a hydroponic growth medium and released to a cuvette atmosphere. The dynamics of the flux were studied using a flow-through gamma detector. The relationship between leaf radioactive tracer activity and growth-medium activity was linear, as was the relationship between the iodine flux and both leaf and growth-medium activity. Iodine flux and leaf conductance to water responded similarly to changes in light levels, suggesting that the stomata may partially control the flux. The flux was inhibited by aeration of the hydroponic growth media, and we postulate that methylation causes the iodine flux. Iodine emissions from living vegetation probably contribute < 0.1% to the stable iodine concentration in the atmosphere above terrestrial areas. However, this pathway may be a direct route for radioactive iodine transport from contaminated soils to the atmosphere. (author).

  18. 5 CFR 1201.126 - Final decisions.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Final decisions. 1201.126 Section 1201.126 Administrative Personnel MERIT SYSTEMS PROTECTION BOARD ORGANIZATION AND PROCEDURES PRACTICES AND PROCEDURES Procedures for Original Jurisdiction Cases Special Counsel Disciplinary Actions § 1201.126 Final...

  19. The Status of Iodine Nutrition and Iodine Deficiency Disorders ...

    African Journals Online (AJOL)

    Background: Iodine deficiency disorders are serious public health problems in Ethiopia. The aim of this study was to measure the prevalence and severity of iodine deficiency disorders among school children in Metekel Zone. Methods: A cross-sectional school based descriptive study was conducted between February 2011 ...

  20. Iodine filters in nuclear installations

    International Nuclear Information System (INIS)

    Wilhelm, J.G.

    1982-01-01

    The present report discusses the significance for environmental exposure of the iodine released with the gaseous effluents of nuclear power stations and reprocessing plants in relation to releases of other airborne radionuclides. Iodine filtration processes are described. The release pathways and the composition of airborne fission product iodine mixtures and their bearing on environmental exposure are discussed on the basis of measured fission product iodine emissions. The sorbents which can be used for iodine filtration, their removal efficiencies and range of applications are dealt with in detail. The particular conditions governing iodine removal, which are determined by the various gaseous iodine species, are illustrated on the basis of experimentally determined retention profiles. Particular attention is given to the limitations imposed by temperature, humidity, radiation and filter poisoning. The types of filter normally used are described, their advantages and drawbacks discussed, the principles underlying their design are outlined and the sources of error indicated. The methods normally applied to test the efficiency of various iodine sorbents are described and assessed. Operating experience with iodine filters, gathered from surveillance periods of many years, is supplemented by a large number of test results and the findings of extensive experiments. Possible ways of prolonging the permissible service lives of iodine filters are discussed and information is given on protective measures. The various iodine removal processes applied in reprocessing plants are described and compared with reference to efficiency and cost. The latest developments in filter technology in reprocessing plants are briefly outlined

  1. Generation of atomic iodine via fluorine for chemical oxygen-iodine laser

    International Nuclear Information System (INIS)

    Jirasek, Vit; Spalek, Otomar; Censky, Miroslav; Pickova, Irena; Kodymova, Jarmila; Jakubec, Ivo

    2007-01-01

    A method of the chemical generation of atomic iodine for a chemical oxygen-iodine laser (COIL) using atomic fluorine as a reaction intermediate was studied experimentally. This method is based on the reaction between F 2 and NO providing F atoms, and the reaction of F with HI resulting in iodine atoms generation. Atomic iodine was produced with efficiency exceeding 40% relative to initial F 2 flow rate. This efficiency was nearly independent on pressure and total gas flow rate. The F atoms were stable in the reactor up to 2 ms. An optimum ratio of the reactants flow rates was F 2 :NO:HI = 1:1:1. A rate constant of the reaction of F 2 with HI was determined. The numerical modelling showed that remaining HI and IF were probably consumed in their mutual reaction. The reaction system was found suitable for employing in a generator of atomic iodine with its subsequent injection into a supersonic nozzle of a COIL

  2. Breastfeeding and maternal and infant iodine nutrition.

    Science.gov (United States)

    Azizi, Fereidoun; Smyth, Peter

    2009-05-01

    The aim of this review is to explore information available regarding iodine secretion in milk, both mothers and infants iodine nutrition during breastfeeding and to make recommendations for appropriate iodine supplementation during lactation. MEDLINE was queried for studies between 1960 and 2007 that included lactation and breastfeeding with iodine and iodine deficiency. Studies were selected if they studied (i) Secretion of iodine in breast milk; (ii) breastfeeding and iodine nutrition; (iii) factors affecting maternal iodine metabolism and (iv) recommendations for iodine supplementation during breastfeeding. Thirty-six articles met the selection criteria. The iodine content of breast milk varies with dietary iodine intake, being lowest in areas of iodine deficiency with high prevalence of goitre. Milk iodine levels are correspondingly higher when programs of iodine prophylaxis such as salt iodization or administration of iodized oil have been introduced. The small iodine pool of the neonatal thyroid turns over very rapidly and is highly sensitive to variations in dietary iodine intake. Expression of the sodium iodide symporter is up-regulated in the lactating mammary gland which results in preferential uptake of iodide. In areas of iodine sufficiency breast milk iodine concentration should be in the range of 100-150 microg/dl. Studies from France, Germany, Belgium, Sweden, Spain, Italy, Denmark, Thailand and Zaire have shown breast milk concentrations of nutrition. The current WHO/ICCIDD/UNICEF recommendation for daily iodine intake (250 microg for lactating mothers) has been selected to ensure that iodine deficiency dose not occur in the postpartum period and that the iodine content of the milk is sufficient for the infant's iodine requirement.

  3. 32 CFR 643.126 - Transportation licenses.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 4 2010-07-01 2010-07-01 true Transportation licenses. 643.126 Section 643.126... ESTATE Additional Authority of Commanders § 643.126 Transportation licenses. Installation commanders are... free competitive proposals of all available companies or individuals. (b) DD Form 694 (Transportation...

  4. 18 CFR 284.126 - Reporting requirements.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Reporting requirements. 284.126 Section 284.126 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION... AUTHORITIES Certain Transportation by Intrastate Pipelines § 284.126 Reporting requirements. (a) Notice of...

  5. An Assessment of the Selenium Status of Iodine-Deficient and Non-Iodine Deficient Filipino Children

    Directory of Open Access Journals (Sweden)

    Ma. Sofia Amarra

    2002-06-01

    Full Text Available The aim of this study is to examine and compare blood selenium levels in iodine-deficient and non-iodine deficient children. Two groups of children were examined: one group with iodine deficiency (n=31 and the other group with normal iodine status (n=32. Blood was extracted by venipuncture from children aged 6-10 years attending first grade in Commonwealth Elementary School in Quezon City. Whole blood selenium was examined by electrothermal atomic absorption spectrophotometry (AAS. Iodine status was determined by goiter palpation and urinary iodine excretion. Mean selenium levels of deficient and non-deficient children were compared using T-test. Using a cut-off value of 60 mg Se/L whole blood, the proportion of children with normal and deficient iodine status who fell below this cut-off was compared using chi-square test. Whole blood selenium values ranged from 17.6 to 133.6 mg/L. There were no significant differences in mean selenium levels between children with normal and deficient iodine status. Children with normal iodine status had a mean blood selenium level of 55.87 ± 26.3 mg/L while children with deficient iodine status had a mean level of 58.76 ± 26.4 mg/L. Sixty percent of children had blood selenium levels below the arbitrary cut-off of 60 mg/L with no significant difference between groups (p = 0.165, indicating that selenium deficiency is prevalent in this group of children regardless of iodine status. Since selenium deficiency limits the response to iodine supplementation, further investigation is needed to determine whether the same situation exists in children from other areas.

  6. Dicty_cDB: AHB126 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AH (Link to library) AHB126 (Link to dictyBase) - - - Contig-U16336-1 AHB126P (Link... to Original site) AHB126F 598 AHB126Z 500 AHB126P 1078 - - Show AHB126 Library AH (Link to library) Clone ID AHB126 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dict...RGIRNHKKNETKFINQCINEIKEELKGDMQKKTVAVQKLTYIQMLGFDI SWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQSEAYLAL NCLSNICT...KKNETKFINQCINEIKEELKGDMQKKTVAVQKLTYIQMLGFDI SWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQSEAYLAL NCLSNICT

  7. Iodine removal from a gas phase

    International Nuclear Information System (INIS)

    Vikis, A. Ch.

    1982-01-01

    Iodine, e.g. radioactive iodine, present as one or more organic iodides, optionally with elemental iodine, in a gas phase (e.g. air) are removed by photochemically decomposing the organic iodides to elemental iodine, reacting the iodine produced, and any initially present with excess ozone, preferably photochemically produced in situ in the gas phase to produce solid iodine oxides, and removing the solid oxides from the gas phase. (author)

  8. Iodine removal from a gas phase

    International Nuclear Information System (INIS)

    Vikis, A.C.

    1984-01-01

    Iodine, e.g. radioactive iodine, present as one or more organic iodides, optionally with elemental iodine, in a gas phase (e.g. air) are removed by photochemically decomposing the organic iodides to elemental iodine, reacting the iodine produced, and any initially present with excess ozone, preferably photochemically produced in situ in the gas phase to produce solid iodine oxides, and removing the solid oxides from the gas phase

  9. Determination of iodide, iodate and organo-iodine in waters with a new total organic iodine measurement approach.

    Science.gov (United States)

    Gong, Tingting; Zhang, Xiangru

    2013-11-01

    The dissolved iodine species that dominate aquatic systems are iodide, iodate and organo-iodine. These species may undergo transformation to one another and thus affect the formation of iodinated disinfection byproducts during disinfection of drinking waters or wastewater effluents. In this study, a fast, sensitive and accurate method for determining these iodine species in waters was developed by derivatizing iodide and iodate to organic iodine and measuring organic iodine with a total organic iodine (TOI) measurement approach. Within this method, organo-iodine was determined directly by TOI measurement; iodide was oxidized by monochloramine to hypoiodous acid and then hypoiodous acid reacted with phenol to form organic iodine, which was determined by TOI measurement; iodate was reduced by ascorbic acid to iodide and then determined as iodide. The quantitation limit of organo-iodine or sum of organo-iodine and iodide or sum of organo-iodine, iodide and iodate was 5 μg/L as I for a 40 mL water sample (or 2.5 μg/L as I for an 80 mL water sample, or 1.25 μg/L as I for a 160 mL water sample). This method was successfully applied to the determination of iodide, iodate and organo-iodine in a variety of water samples, including tap water, seawater, urine and wastewater. The recoveries of iodide, iodate and organo-iodine were 91-109%, 90-108% and 91-108%, respectively. The concentrations and distributions of iodine species in different water samples were obtained and compared. Copyright © 2013 Elsevier Ltd. All rights reserved.

  10. 22 CFR 126.13 - Required information.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Required information. 126.13 Section 126.13... PROVISIONS § 126.13 Required information. (a) All applications for licenses (DSP-5, DSP-61, DSP-73, and DSP... are multiple consignors, consignees or freight forwarders, and all the required information cannot be...

  11. Effects of diuretics on iodine uptake in non-toxic goitre: comparison with low-iodine diet

    Energy Technology Data Exchange (ETDEWEB)

    Kapucu, L.Ozlem; Azizoglu, Firat [Department of Nuclear Medicine, Gazi University, Ankara (Turkey); Ayvaz, Goksun; Karakoc, Ayhan [Department of Endocrinology, Gazi University, Ankara (Turkey)

    2003-09-01

    Low-iodine diet has been employed to achieve iodine depletion prior to radioiodine (RI) therapy. However, treatment with diuretics may be more effective than low-iodine diet in causing iodine depletion and subsequent increase in RI uptake by the thyroid. Fifty-five patients with non-toxic goitre were given 0.20 MBq RI p.o. on the first day of the study and thyroid uptake was measured. In 15 patients, a low-iodine diet was started and continued for 14 days. The remaining 40 patients received furosemide 40 mg/day orally for 5 days with an unrestricted diet. On the 15th day of the study, all patients were given 0.20 MBq RI p.o. and thyroid RI uptake was measured again. Additionally, 24-h urinary iodine excretion and RI clearance were measured on the 1st and 6th days in 21 patients from the furosemide group and on the 1st and 15th days in eight patients from the diet group. Furosemide administration led to a 58.40% increase in iodine uptake over the baseline value, which was significantly higher than the increase caused by low-iodine diet (17.22%) (P<0.0001). Urinary excretion of RI decreased in both groups similarly (furosemide, 29.45%; low-iodine diet, 21.06%; P=0.33). Iodine clearance also decreased in each group similarly (10.61% vs 7.53%, P=0.53). Treatment with furosemide prior to administration of RI increases the uptake of RI by the thyroid more effectively than does low-iodine diet. (orig.)

  12. Iodine content in bread and salt in Denmark after iodization and the influence on iodine intake

    DEFF Research Database (Denmark)

    Rasmussen, Lone Banke; Ovesen, Lars; Christensen, Tue

    2007-01-01

    Objective To measure the iodine content in bread and household salt in Denmark after mandatory iodine fortification was introduced and to estimate the increase in iodine intake due to the fortification. Design The iodine content in rye breads, wheat breads and salt samples was assessed. The incre......, and the current fortification level of salt ( 13 ppm) seems reasonable.......% of the rye breads and 90% of the wheat breads were iodized. The median iodine intake from bread increased by 25 ( 13-43) mu g/day and the total median iodine intake increased by 63 (36-104) mu g/day. Conclusions The fortification of bread and salt has resulted in a desirable increase in iodine intake...

  13. Modelling the chemistry of iodine

    International Nuclear Information System (INIS)

    Paquette, J.

    1989-01-01

    We have assembled a kinetic model, based on elementary chemical reactions, that describes the chemical behaviour of iodine in aqueous solution as a function of time and various parameters such as pH, concentration and radiation field. The model is conceptually divided into six section: aqueous iodine chemistry, aqueous organic iodide chemistry, water radiolysis, radiolysis of iodine solutions, radiolysis of organic iodide solutions and mass transfer. The model indicates that, in the absence of a radiation field, the rate of production of volatile iodine species is controlled by the rate of oxidation of the iodide ion. The volatile iodine species are dominated by organic iodides if organic impurities are present. The single most important parameter controlling iodine volatility is the pH of the solution; high pH values tend to minimize iodine volatility. In the presence of a radiation field, the volatility of iodine is controlled by the radiation-induced oxidation of the iodide ion. Again, iodine volatility is dominated by organic iodides if organic impurities are present. High pH values minimize iodine volatility. A sensitivity analysis has been performed on some sections of the model to identify reactions to which the volatility of iodine is most sensitive. In the absence of a radiation field, the volatility is most sensitive, first, to the rate of oxidation of the iodide ion, and, second, to the rate of mass transfer of volatile species between the aqueous and the gaseous phases. This approach should be useful in identifying reactions for which accurate rate constants are required and in decreasing the complexity of the model. 37 refs

  14. Iodine status in neonates in Denmark

    DEFF Research Database (Denmark)

    Nøhr, S B; Laurberg, Peter; Børlum, K G

    1994-01-01

    Iodine status of 147 neonates born in five different regions of Denmark was evaluated in relation to the iodine content of breast milk and iodine supplementation taken by the mother. Approximately two-thirds of the women had not received iodine supplementation. They had low iodine concentrations...... in breast milk and urinary iodine concentrations of the neonates at day 5 were low. The median values (milk/urine) were 33.6/31.7 micrograms/l (Randers 22/26, Ringkøbing 29/16, Aalborg 36/31. Arhus 54/41 and Copenhagen 55/59 micrograms/l). Higher values were found in the group where tablets containing...... iodine had been taken (milk/urine: 57.0/61.0 micrograms/l). In general, the values are low compared with internationally recommended levels. We suggest that mothers without autoimmune thyroid disease should receive iodine supplementation in the form of vitamin/mineral tablets containing iodine (150...

  15. Mixed-layered bismuth--oxygen--iodine materials for capture and waste disposal of radioactive iodine

    Science.gov (United States)

    Krumhansl, James L; Nenoff, Tina M

    2015-01-06

    Materials and methods of synthesizing mixed-layered bismuth oxy-iodine materials, which can be synthesized in the presence of aqueous radioactive iodine species found in caustic solutions (e.g. NaOH or KOH). This technology provides a one-step process for both iodine sequestration and storage from nuclear fuel cycles. It results in materials that will be durable for repository conditions much like those found in Waste Isolation Pilot Plant (WIPP) and estimated for Yucca Mountain (YMP). By controlled reactant concentrations, optimized compositions of these mixed-layered bismuth oxy-iodine inorganic materials are produced that have both a high iodine weight percentage and a low solubility in groundwater environments.

  16. Mixed-layered bismuth-oxygen-iodine materials for capture and waste disposal of radioactive iodine

    Science.gov (United States)

    Krumhansl, James L; Nenoff, Tina M

    2013-02-26

    Materials and methods of synthesizing mixed-layered bismuth oxy-iodine materials, which can be synthesized in the presence of aqueous radioactive iodine species found in caustic solutions (e.g. NaOH or KOH). This technology provides a one-step process for both iodine sequestration and storage from nuclear fuel cycles. It results in materials that will be durable for repository conditions much like those found in Waste Isolation Pilot Plant (WIPP) and estimated for Yucca Mountain (YMP). By controlled reactant concentrations, optimized compositions of these mixed-layered bismuth oxy-iodine inorganic materials are produced that have both a high iodine weight percentage and a low solubility in groundwater environments.

  17. Iodine in the environment revisited

    International Nuclear Information System (INIS)

    Christiansen, J.V.; Carlsen, L.

    1989-05-01

    The report gives an overview of the environmental cycle of iodine, especially focusing on the possible reactions being responsible for the retention of iodine in the terrestrial environment. During the last two decades evidence for the presence of iodine in soil as organically bound has been presented. The major part of inorganic iodine in the terrestrial environment will, under physical and chemical conditions normally prevailing, exist as iodide. No evidence for a direct reaction between iodide and organic material has been presented, whereas strong support for the engagement of microbial activity in the formation of organic iodine compounds in soil has been obtained. Incorporation of iodine in humic substances as a result of enzymatic catalysis, involving an enzyme of the perozidase group apperas reasonable. It is concluded that microbiological activity involving extracellular enzymes most probably is responsible for the possible retention of iodine in the terrestrial environment. It is suggested that these reactions in detail should be studied experimentally. (author) 3 tabs., 2 ills., 51 refs

  18. Iodine Intakes of Victorian Schoolchildren Measured Using 24-h Urinary Iodine Excretion

    Directory of Open Access Journals (Sweden)

    Kelsey Beckford

    2017-08-01

    Full Text Available Mandatory fortification of bread with iodized salt was introduced in Australia in 2009, and studies using spot urine collections conducted post fortification indicate that Australian schoolchildren are now replete. However an accurate estimate of daily iodine intake utilizing 24-h urinary iodine excretion (UIE μg/day has not been reported and compared to the estimated average requirement (EAR. This study aimed to assess daily total iodine intake and status of a sample of primary schoolchildren using 24-h urine samples. Victorian primary school children provided 24-h urine samples between 2011 and 2013, from which urinary iodine concentration (UIC, μg/L and total iodine excretion (UIE, μg/day as an estimate of intake was determined. Valid 24-h urine samples were provided by 650 children, mean (SD age 9.3 (1.8 years (n = 359 boys. The mean UIE of 4–8 and 9–13 year olds was 94 (48 and 111 (57 μg/24-h, respectively, with 29% and 26% having a UIE below the age-specific EAR. The median (IQR UIC was 124 (83,172 μg/L, with 36% of participants having a UIC < 100 μg/L. This convenience sample of Victorian schoolchildren were found to be iodine replete, based on UIC and estimated iodine intakes derived from 24-h urine collections, confirming the findings of the Australian Health Survey.

  19. Status of urinary iodine and I-131 uptake after universal iodination of common salt

    International Nuclear Information System (INIS)

    Alam, F.; Begum, F.; Haque, M.; Karim, M.A.; Faruque, O.; Ali, L.; Khan, A.K.A.

    2002-01-01

    This work was carried out in the Institute of Institute of Nuclear Medicine (INM), Bangabandhu Sheikh Mujib Medical University and Bangladesh Institute of Research and Rehabilitation in Diabetes, Endocrine and Metabolic Disorders, Dhaka. Here we have tried to explore present status of urinary iodine and uptake status in Bangabandhu. Period study was from 1998 to 2000. Total study population was 300, of them 84 was male and 216 was female. Populations of all social and economic strata have been studied, starting from bottoms to top-level income groups as well as urban, rural and suburban populations are included randomly. We studied I-131 uptake and urinary iodine. I-131 given orally in liquid form and the quantity accumulated by the thyroid gland at 24 hours intervals of time is measured using a gamma scintillation counter. Gamma-ray emission of 364 keV energy by I-131 is detected gamma scintillation counter. Urinary iodine is estimated by CIS-BIO kit. Urine is digested with chloric acid under mild conditions and determined manually by its catalytic role in the reduction of ceric ammonium sulfate in the presence of arsenious acid. The uptake was grouped into four categories according to their uptake percentage. Group-A; (lowest uptake group) 99 subject, have uptake between 0 to 4.9%, Group-B; 100 subjects, (relatively low uptake) who have uptake between 4.91-9.9%, group-C; 73 subjects, who have uptake between 10-30% and in-group D, there was 28 subjects their uptake was above 30%. We have also found in group-A median uptake is 3.0% and urinary iodine level is 43.31 μg/dl, in group-B median uptake is 7.0% and urinary iodine level is 33.95 μg/dl, in group-C median uptake is 23.0% and urinary iodine level is 12.97 μg/dl, in group-D median uptake is 34.0% and urinary iodine level is 9.35 μg/dl. We have found 1.04% have severe type low urinary iodine, 3.48% moderate type of low urinary iodine, 3.48%, 16.72% mild type of low urinary iodine and 78.74% have normal

  20. Activation energies for iodine-exchange systems containing organic iodine compounds

    Energy Technology Data Exchange (ETDEWEB)

    Ikeda, N. (Takyo Univ. of Education (Japan). Faculty of Science) Takahashi, Yasuko

    1976-01-01

    In studies on the nonequilibrium isotopic exchange method for determining iodine in organic iodine compounds, activation energies have been measured to find systems having appropriate rate of exchange reactions. Activation energies are discussed by considering the effect of the structure of organic iodine compounds, the concentrations of reactants and solvent, etc. In homogeneous systems, activation energy is found to become larger in the order of CH/sub 3/Iiodine ratio between I/sub 2/ and organic iodine is a predominant factor in determining the rate of the exchange reaction.

  1. Iodine filters in nuclear power stations

    International Nuclear Information System (INIS)

    Wilhelm, J.G.

    1977-04-01

    On the basis of calculated and recorded release rates of nuclear power plants, the significance of iodine releases in the invironmental impact relative to other nuclides is discussed. The release pathways for iodine in LWR-type reactors and the efficiency of various methods to lower the activity release are given. The airborne species of iodine are discussed with regard to their removal in iodine sorption filters and environmental impact. The technical status of iodine removal by means of iodine sorption filters is studied for normal operation and accident conditions in nuclear power stations on the basis of the data given in the relevant literature for the efficiency of a number of iodine sorption materials. The applicability of concepts for ventilation and containment and their influence on iodine filter systems are discussed. Design, structure, and testing of iodine sorption filters are treated in detail; recommendations for design are given, and failure sources are mentioned. (orig.) [de

  2. Iodine Satellite

    Science.gov (United States)

    Kamhawi, Hani; Dankanich, John; Martinez, Andres; Petro, Andrew

    2015-01-01

    The Iodine Satellite (iSat) spacecraft will be the first CubeSat to demonstrate high change in velocity from a primary propulsion system by using Hall thruster technology and iodine as a propellant. The mission will demonstrate CubeSat maneuverability, including plane change, altitude change and change in its closest approach to Earth to ensure atmospheric reentry in less than 90 days. The mission is planned for launch in fall 2017. Hall thruster technology is a type of electric propulsion. Electric propulsion uses electricity, typically from solar panels, to accelerate the propellant. Electric propulsion can accelerate propellant to 10 times higher velocities than traditional chemical propulsion systems, which significantly increases fuel efficiency. To enable the success of the propulsion subsystem, iSat will also demonstrate power management and thermal control capabilities well beyond the current state-of-the-art for spacecraft of its size. This technology is a viable primary propulsion system that can be used on small satellites ranging from about 22 pounds (10 kilograms) to more than 1,000 pounds (450 kilograms). iSat's fuel efficiency is ten times greater and its propulsion per volume is 100 times greater than current cold-gas systems and three times better than the same system operating on xenon. iSat's iodine propulsion system consists of a 200 watt (W) Hall thruster, a cathode, a tank to store solid iodine, a power processing unit (PPU) and the feed system to supply the iodine. This propulsion system is based on a 200 W Hall thruster developed by Busek Co. Inc., which was previously flown using xenon as the propellant. Several improvements have been made to the original system to include a compact PPU, targeting greater than 80 percent reduction in mass and volume of conventional PPU designs. The cathode technology is planned to enable heaterless cathode conditioning, significantly increasing total system efficiency. The feed system has been designed to

  3. Long-term migration of iodine in sedimentary rocks based on iodine speciation and 129I/127I ratio

    Science.gov (United States)

    Togo, Y.; Takahashi, Y.; Amano, Y.; Matsuzaki, H.; Suzuki, Y.; Muramatsu, Y.; Iwatsuki, T.

    2012-12-01

    [Introduction] 129I is one of the available indexes of long-term migration of groundwater solutes, because of its long half-life (15.7 million years) and low sorption characteristics. The Horonobe underground research center (Japan Atomic Energy Agency), at which are conducted research and development of fundamental techniques on geological disposal of high-level radioactive waste, is an appropriate site for natural analogue studies, because iodine concentration in groundwater is high in this area. To predict iodine behavior in natural systems, speciation of iodine is essential because of different mobility among each species. In this study, we determined iodine speciation and129I/127I isotope ratios of rock and groundwater samples to investigate long term migration of iodine. [Methods] All rock and groundwater samples were collected at Horonobe underground research center. The region is underlain mainly by Neogene to Quaternary marine sedimentary rocks, the Wakkanai Formation (Wk Fm, siliceous mudstones), and the overlying Koetoi Formation (Kt Fm, diatomaceous mudstones). Iodine species in rock samples were determined by iodine K-edge X-ray absorption near edge structure (SPring-8 BL01B1). Thin sections of rock samples were prepared, and iodine mapping were obtained by micro-XRF analysis (SPring-8 BL37XU). Iodine species (IO3-, I-, and organic I) in groundwater were separately detected by high performance liquid chromatography connected to ICP-MS. The 129I/127I ratios in groundwater and rock samples were measured by accelerator mass spectrometry (MALT, Univ. of Tokyo). Iodine in rock samples were separated by pyrohydrolysis and water extraction. [Results and discussion] Concentration of iodine in groundwater varied widely and was much higher than that of seawater showing a high correlation with that of chlorine (R2 = 0.90). Species of iodine in groundwater was mainly I-. Iodine in rock samples decreased near the boundary between Wk and Kt Fms. Iodine K-edge XANES

  4. Serum thyroglobulin and urinary iodine concentration are the most appropriate indicators of iodine status and thyroid function under conditions of increasing iodine supply in schoolchildren in Benin

    NARCIS (Netherlands)

    van den Briel, T.; West, C. E.; Hautvast, J. G.; Vulsma, T.; de Vijlder, J. J.; Ategbo, E. A.

    2001-01-01

    Iodine deficiency control programs have greatly reduced iodine deficiency disorders worldwide. For monitoring changes in iodine status, different indicators may be used. The aim of this study was to evaluate the suitability of indicators of iodine status and thyroid function, thyroglobulin (Tg),

  5. Retrospective reconstruction of Iodine-131 distribution through the analysis of Iodine-129

    Science.gov (United States)

    Matsuzaki, Hiroyuki; Muramatsu, Yasuyuki; Ohno, Takeshi; Mao, Wei

    2017-09-01

    Iodine-131 distribution released from the Fukushima Dai-ichi Nuclear Power Plant accident was reconstructed through the iodine-129 measurements. From nearly 1,000 surface soil samples iodine was extracted by the pyro hydrolysis method. Extracted iodine was then mixed with carrier, purified and finally collected as silver iodide. Silver iodide sample was pressed into the cathode holder and set at the ion source of the MALT facility, The University of Tokyo. The isotopic ratio 129I/127I was measured by means of Accelerator Mass Spectrometry. From 129I data obtained, 131I deposition map was constructed. There observed various fine structures in the map which could not estimated neither by the simulation nor 137Cs distribution.

  6. Thyroid disorders in mild iodine deficiency

    DEFF Research Database (Denmark)

    Laurberg, P; Nøhr, S B; Pedersen, K M

    2000-01-01

    Comparative epidemiologic studies in areas with low and high iodine intake and controlled studies of iodine supplementation have demonstrated that the major consequence of mild-to-moderate iodine deficiency for the health of the population is an extraordinarily high occurrence of hyperthyroidism...... endangered but the consequences of severe iodine deficiency for brain development are grave and a considerable safety margin is advisable. Moreover, a shift toward less malignant types of thyroid cancer and a lower radiation dose to the thyroid in case of nuclear fallout support that mild-to-moderate iodine...... deficiency should be corrected. However, there is evidence that a high iodine intake may be associated with more autoimmune hypothyroidism, and that Graves' disease may manifest at a younger age and be more difficult to treat. Hence, the iodine intake should be brought to a level at which iodine deficiency...

  7. Biofortification of lettuce (Lactuca sativa L.) with iodine: the effect of iodine form and concentration in the nutrient solution on growth, development and iodine uptake of lettuce grown in water culture.

    Science.gov (United States)

    Voogt, Wim; Holwerda, Harmen T; Khodabaks, Rashied

    2010-04-15

    Iodine is an essential trace element for humans. Two billion individuals have insufficient iodine intake. Biofortification of vegetables with iodine offers an excellent opportunity to increase iodine intake by humans. The main aim was to study the effect of iodine form and concentration in the nutrient solution on growth, development and iodine uptake of lettuce, grown in water culture. In both a winter and summer trial, dose rates of 0, 13, 39, 65, and 90 or 129 microg iodine L(-1), applied as iodate (IO(3)(-)) or iodide (I(-)), did not affect plant biomass, produce quality or water uptake. Increases in iodine concentration significantly enhanced iodine content in the plant. Iodine contents in plant tissue were up to five times higher with I(-) than with IO(3)(-). Iodine was mainly distributed to the outer leaves. The highest iodide dose rates in both trials resulted in 653 and 764 microg iodine kg(-1) total leaf fresh weight. Biofortification of lettuce with iodine is easily applicable in a hydroponic growing system, both with I(-) and IO(3)(-). I(-) was more effective than IO(3)(-). Fifty grams of iodine-biofortified lettuce would provide, respectively, 22% and 25% of the recommended daily allowance of iodine for adolescents and adults. (c) 2010 Society of Chemical Industry.

  8. Assessing iodine intake, iodine status, and the effects of maternal iodine supplementation: introduction to articles arising from 3 workshops held by the NIH Office of Dietary Supplements12

    Science.gov (United States)

    Ershow, Abby G; Coates, Paul M; Swanson, Christine A

    2016-01-01

    The NIH Office of Dietary Supplements (ODS) convened 3 workshops on iodine nutrition in 2014, each held in Rockville, Maryland. These workshops were part of the ongoing ODS Iodine Initiative, begun in 2011 in response to concerns that US pregnant women may be at risk of iodine deficiency and that a high fraction of prenatal dietary supplements do not contain the recommended amounts of iodine. The primary purpose of the workshops was to consider the data and resources necessary to evaluate the clinical and public health benefits and risks of maternal iodine supplementation in the United States. The first workshop focused on the assessment of iodine intake, the second focused on the assessment of iodine status, and the third focused on the design and interpretation of clinical trials of maternal iodine supplementation. Here we provide the background of the ODS Iodine Initiative, summarize the 3 workshops held in 2014, and introduce the articles that arose from the workshops and are published in this supplement issue. PMID:27534646

  9. Dietary Iodine Intake of the Australian Population after Introduction of a Mandatory Iodine Fortification Programme

    Directory of Open Access Journals (Sweden)

    Karen Charlton

    2016-11-01

    Full Text Available To address mild iodine deficiency in Australia, a mandatory fortification program of iodised salt in bread was implemented in 2009. This study aimed to determine factors associated with achieving an adequate dietary iodine intake in the Australian population post-fortification, and to assess whether bread consumption patterns affect iodine intake in high-risk groups. Using nationally representative data of repeated 24-h dietary recalls from the 2011–2012 Australian National Nutrition and Physical Activity Survey, dietary iodine intakes and food group contributions were compared by age, socioeconomic status (SES, and geographical remoteness (N = 7735. The association between fortified bread intake and adequacy of iodine intake (meeting age and sex-specific Estimated Average Requirements was investigated using logistic regression models in women of childbearing age 14–50 years (n = 3496 and children aged 2–18 years (n = 1772. The effect of SES on bread consumption was further investigated in a sub group of children aged 5–9 years (n = 488. Main sources of iodine intake at the time of the survey were cereal and cereal products, followed by milk products and dishes. Differences in iodine intake and dietary iodine habits according to age, SES and location were found (p < 0.001 for women of child-bearing age. Fortified bread consumption at ≥100 g/day was associated with five times greater odds of achieving an adequate iodine intake (OR 5.0, 95% CI 4.96–5.13; p < 0.001 compared to lower bread consumption in women and 12 times in children (OR 12.34, 95% CI 1.71–89.26; p < 0.001. Disparities in dietary iodine intake exist within sectors of the Australian population, even after mandatory fortification of a staple food. On-going monitoring and surveillance of iodine status is required.

  10. Iodine-deficiency disorders

    NARCIS (Netherlands)

    Zimmermann, M.B.; Jooste, P.L.; Pandav, C.S.

    2008-01-01

    billion individuals worldwide have insufficient iodine intake, with those in south Asia and sub-Saharan Africa particularly affected. Iodine deficiency has many adverse effects on growth and development. These effects are due to inadequate production of thyroid hormone and are termed

  11. Radioactive iodine absorbing properties of tetrathiafulvalene

    Energy Technology Data Exchange (ETDEWEB)

    Ito, Tomiyasu; Nakamura, Asao (Ajinomoto Co. Inc., Kawasaki, Kanagawa (Japan). Central Research Labs.); Nogawa, Norio; Oohashi, Kunio; Morikawa, Naotake

    1989-05-01

    For the purpose of searching some effective absorbents of gaseous radioactive iodine, 16 substances considered as having an affinity for iodine were investigated with regular iodine and /sup 125/I. In a preliminary survey, only tetrathiafulvalene (TTF) was found to have satisfactory absorbing properties comparable to activated charcoal. A further detailed comparison of the properties between TTF and activated charcoal led us to the conclusion that the former has more preferable properties as absorbent of radioactive iodine than the latter in all points studied. The results are summarized as follows: (1) The absorption of iodine on TTF in atmosphere was about twice as much as that on activated charcoal. Desorption of iodine from saturatedly absorbed iodine on TTF was practically negligible except trace amount of initial desorption, while that on activated charcoal was considerable (3%/50h) even in the air at room temperature. (2) Absorbed amount of iodine on activated charcoal decreased with increasing gaseous iodine concentration, air flow rate, on humidity of flowing-air. On the other hand, those factors scarcely affected that on TTF. Under an air flow rate of 1m/s, activated charcoal absorbs only 80% of iodine, while TTF absorbs more than 99%. (3) In flowing-air saturated with water vapor, iodine absorbed on activated charcoal was gradually liberated although by small amount (0.08%/100h), while that on TTF was much more stable for a long period (0.004%/100h). As a conclusion, TTF is considered to be useful as a quite effective radioactive iodine absorbent, especially in the case where protection from radioactive iodine should be serious, though it is expensive now. (author).

  12. Radioactive iodine absorbing properties of tetrathiafulvalene

    International Nuclear Information System (INIS)

    Ito, Tomiyasu; Nakamura, Asao; Nogawa, Norio; Oohashi, Kunio; Morikawa, Naotake.

    1989-01-01

    For the purpose of searching some effective absorbents of gaseous radioactive iodine, 16 substances considered as having an affinity for iodine were investigated with regular iodine and 125 I. In a preliminary survey, only tetrathiafulvalene (TTF) was found to have satisfactory absorbing properties comparable to activated charcoal. A further detailed comparison of the properties between TTF and activated charcoal led us to the conclusion that the former has more preferable properties as absorbent of radioactive iodine than the latter in all points studied. The results are summarized as follows: (1) The absorption of iodine on TTF in atmosphere was about twice as much as that on activated charcoal. Desorption of iodine from saturatedly absorbed iodine on TTF was practically negligible except trace amount of initial desorption, while that on activated charcoal was considerable (3%/50h) even in the air at room temperature. (2) Absorbed amount of iodine on activated charcoal decreased with increasing gaseous iodine concentration, air flow rate, on humidity of flowing-air. On the other hand, those factors scarcely affected that on TTF. Under an air flow rate of 1m/s, activated charcoal absorbs only 80% of iodine, while TTF absorbs more than 99%. (3) In flowing-air saturated with water vapor, iodine absorbed on activated charcoal was gradually liberated although by small amount (0.08%/100h), while that on TTF was much more stable for a long period (0.004%/100h). As a conclusion, TTF is considered to be useful as a quite effective radioactive iodine absorbent, especially in the case where protection from radioactive iodine should be serious, though it is expensive now. (author)

  13. Thyroid disorders in mild iodine deficiency.

    Science.gov (United States)

    Laurberg, P; Nøhr, S B; Pedersen, K M; Hreidarsson, A B; Andersen, S; Bülow Pedersen, I; Knudsen, N; Perrild, H; Jørgensen, T; Ovesen, L

    2000-11-01

    Comparative epidemiologic studies in areas with low and high iodine intake and controlled studies of iodine supplementation have demonstrated that the major consequence of mild-to-moderate iodine deficiency for the health of the population is an extraordinarily high occurrence of hyperthyroidism in elderly subjects, especially women, with risk of cardiac arrhythmias, osteoporosis, and muscle wasting. The hyperthyroidism is caused by autonomous nodular growth and function of the thyroid gland and it is accompanied by a high frequency of goiter. Pregnant women and small children are not immediately endangered but the consequences of severe iodine deficiency for brain development are grave and a considerable safety margin is advisable. Moreover, a shift toward less malignant types of thyroid cancer and a lower radiation dose to the thyroid in case of nuclear fallout support that mild-to-moderate iodine deficiency should be corrected. However, there is evidence that a high iodine intake may be associated with more autoimmune hypothyroidism, and that Graves' disease may manifest at a younger age and be more difficult to treat. Hence, the iodine intake should be brought to a level at which iodine deficiency disorders are avoided but not higher. Iodine supplementation programs should aim at relatively uniform iodine intake, avoiding deficient or excessive iodine intake in subpopulations. To adopt such a strategy, surveillance programs are needed.

  14. Iodine kinetics and effectiveness of stable iodine prophylaxis after intake of radioiodine: a review

    International Nuclear Information System (INIS)

    Geoffroy, B.; Verger, P.; Le Guen, B.

    2000-01-01

    Ingestion of stable iodine (potassium iodide) offers an efficient protection against the irradiation of the thyroid when an accidental exposure to radioiodine occurs. This prophylaxis aims at obtaining a rapid and maximum thyroid protection without antithyroid effects. This article reviews studies on iodine kinetics in the human and on stable iodine effectiveness to protect the thyroid. In adults with a normal thyroid function, ingestion of 100 mg of iodide just before exposure to radioiodine allows a percentage of thyroid averted dose equal or greater than 95%. If the exposure persists after iodide ingestion (100 mg), the percentage of averted dose may decrease significantly. Repeated ingestion of daily amounts of 15 mg of stable iodine would then allow to maintain a 90% effectiveness. Iodide effectiveness and antithyroid effects also depend on external and individual factors such as iodine amounts in the diet, thyroid function and age. It is recommended to adapt the amount of ingested stable iodine according to age at the time of exposure. (author)

  15. Iodine oxides in large-scale THAI tests

    International Nuclear Information System (INIS)

    Funke, F.; Langrock, G.; Kanzleiter, T.; Poss, G.; Fischer, K.; Kühnel, A.; Weber, G.; Allelein, H.-J.

    2012-01-01

    Highlights: ► Iodine oxide particles were produced from gaseous iodine and ozone. ► Ozone replaced the effect of ionizing radiation in the large-scale THAI facility. ► The mean diameter of the iodine oxide particles was about 0.35 μm. ► Particle formation was faster than the chemical reaction between iodine and ozone. ► Deposition of iodine oxide particles was slow in the absence of other aerosols. - Abstract: The conversion of gaseous molecular iodine into iodine oxide aerosols has significant relevance in the understanding of the fission product iodine volatility in a LWR containment during severe accidents. In containment, the high radiation field caused by fission products released from the reactor core induces radiolytic oxidation into iodine oxides. To study the characteristics and the behaviour of iodine oxides in large scale, two THAI tests Iod-13 and Iod-14 were performed, simulating radiolytic oxidation of molecular iodine by reaction of iodine with ozone, with ozone injected from an ozone generator. The observed iodine oxides form submicron particles with mean volume-related diameters of about 0.35 μm and show low deposition rates in the THAI tests performed in the absence of other nuclear aerosols. Formation of iodine aerosols from gaseous precursors iodine and ozone is fast as compared to their chemical interaction. The current approach in empirical iodine containment behaviour models in severe accidents, including the radiolytic production of I 2 -oxidizing agents followed by the I 2 oxidation itself, is confirmed by these THAI tests.

  16. Prophylactic iodine treatment in radiation protection

    International Nuclear Information System (INIS)

    Oberhausen, E.

    1980-01-01

    Prophylactic iodine treatment is to prevent accumulation of radioactive iodine in the thyroid. This is done by administering a large amount of stable iodine before uptake of radioactive iodine so that further accummulation of iodine in the thyroid will be impossible. This blocking effect should be as complete as possible. This is achieved by administering an initial dose of 200 mg potassium iodide. As the release of radioactive iodine may last several hours or even days; for this reason, maintenance doses of 100 mg potassium iodide should be administered in 8-hour intervals. The risk of prophylactiv iodine treatment is rather low; however, provocation of latent hyperthyreoses must be expected in, at the most, 0.2% of the exposed population. (orig./MG) [de

  17. Iodine excretion in school children in Copenhagen

    DEFF Research Database (Denmark)

    Rasmussen, Lone B.; Kirkegaard-Klitbo, Ditte Marie; Laurberg, Peter

    2016-01-01

    INTRODUCTION: Studies of dietary habits show a high iodine intake in children in Denmark. Iodine excretion in children has not previously been assessed. Iodine excretion in adults is below the recommended threshold, and it is therefore being discussed to increase the fortification level. The main...... objective of this study was to assess iodine excretion in children living in Copenhagen to establish whether a moderate increase in iodine fortification would lead to excess iodine intake in this group. METHODS: Children in first and fifth grade were recruited through schools in Copenhagen. In total, 244...... children de-ivered a urine sample. Urine samples were analysed for iodine and creatinine, and the results were expressed as urinary iodine concentration (UIC) and as estimated 24-h iodine excretion. Iodine excretion in children was also compared with that of adults living in the same area, investigated...

  18. Values of iodine metabolism biomarkers in assessing the iodine nutrition status in surgically treated patients with thyroid disease.

    Science.gov (United States)

    Han, Jian-hua; Wu, Lian; Yu, Song-lin; Fang, Hui-ling; Kamg, Wei-ming; Cheng, Xin-qi; Lu, Jie; Yu, Jian-chun; Qiu, Ling

    2015-04-01

    To assess the clinical application value of iodine metabolism biomarkers in assessing iodine nutrition status in surgically treated patients with thyroid disease. Blood,morning urine and 24-hour urine samples were collected in 31 healthy volunteers and in 30 surgically treated patients with thyroid disease before and after surgery. Iodine concentration was analyzed by inductively coupled plasma mass spectrometry. The iodine metabolism biomarkers including serum iodine (SI), morning urine iodine(UI), morning urine iodine/urine creatinine ratio (UI/UCr), 24-hour urine iodine (24 h UI), and 24-hour urine iodine excretion (24 h UIE) were evaluated in these two groups. In addition, the validation coincidence rate of iodine metabolism biomarkers in healthy volunteers to different reference ranges including World Health Organization, Mayo Clinic, and Quest Diagnostics were calculated. The UI/UCr ratio of pre-operative thyroid disease patients was significantly lower than that of healthy volunteers (P0.05) between these two groups. The SI, UI ,and 24 h UI in postoperative thyroid disease patients were significantly higher than those of the pre-operative patients (all Piodine metabolism biomarkers. The UI/UCr ratio may be used for iodine nutrition evaluation in surgically treated patients with thyroid disease.

  19. 22 CFR 126.3 - Exceptions.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Exceptions. 126.3 Section 126.3 Foreign Relations DEPARTMENT OF STATE INTERNATIONAL TRAFFIC IN ARMS REGULATIONS GENERAL POLICIES AND PROVISIONS... of the United States Government, the Director, Office of Defense Trade Controls may make an exception...

  20. Longitudinal study of iodine in toenails following IV administration of an iodine-containing contrast agent

    International Nuclear Information System (INIS)

    Spate, V.L.; Morris, J.S.; Nichols, T.A.; Baskett, C.K.; Mason, M.M.; Horsman, T.L.; McDougall, I.R.

    1998-01-01

    The literature on the relationship between diet and thyroid cancer (TC) risk and the higher incidence of TC among Asian immigrants to the US compared to second and third generation subgroups has prompted epidemiologists to hypothesize that increased levels of iodine consumption may be associated with TC risk, particularly among persons with a history of clinical or subclinical thyroid dysfunction. At the University of Missouri Research Reactor (MURR), we have applied epiboron neutron activation analysis to investigate human nails as a dietary monitor for iodine. Preliminary studies have indicated a positive correlation between dietary iodine intake and the concentration of iodine in toenails. However, these studies are confounded by high iodine levels (up to 30 ppm) in approximately 5% of the nails studied. We hypothesize that, in the subjects we have studied, the high iodine levels may be due to iodine-containing medications, in particular contrast-agents containing iopamidol. This paper will report on longitudinal studies using contrast agent subjects who where followed-up for almost two years compared to a longitudinal control and a population mean. Based on this study, we suggest that iodine-containing contrast agents contaminate nail samples via non-specific binding in the short term followed by incorporation in the nail as a result of absorption. (author)

  1. Study on adsorption performance of coal based activated carbon to radioactive iodine and stable iodine

    International Nuclear Information System (INIS)

    Zhou, Junbo; Hao, Shan; Gao, Liping; Zhang, Youchen

    2014-01-01

    Highlights: • The impregnated coal-based activated carbons as adsorbent for removing methyl iodide. • The coal-based activated carbons to remove stable iodine. • Iodine residues are under 0.5 μg/ml after adsorption treatment. • The decontamination factor is much higher than 1000. - Abstract: Nuclear power plant, nuclear reactors and nuclear powered ship exhaust contains a large amount of gaseous radioactive iodine, and can damage to the workplace and the surrounding environment. The quantitative test to remove methyl iodide and the qualitative test for removing stable iodine were investigated using the impregnated coal-based activated carbons and coal-based activated carbons as adsorbents. The research conducted in this work shows that iodine residues were under 0.5 μg/ml after adsorption treatment and the decontamination factor of the coal-based activated carbon for removing the stable iodine was more than 1000, which can achieve the purpose of removing harmful iodine, and satisfy the requirement of gaseous waste treatment of nuclear powered vessel and other nuclear plants

  2. The speciation of iodine in the environment

    International Nuclear Information System (INIS)

    Bulman, R.A.

    1986-01-01

    The speciation of iodine in the environment is discussed under the following topics: (i) sea surface to atmosphere, (ii) chemistry in bulk seawater, (iii) iodine in rocks, (iv) iodine in soils, (v) iodine in plants and (vi) iodine in solidified wastes. (author)

  3. Iodine deficiency in pregnancy in Denmark. Regional variations and frequency of individual iodine supplementation

    DEFF Research Database (Denmark)

    Nøhr, S B; Laurberg, Peter; Børlum, K G

    1993-01-01

    Iodine requirements are increased during pregnancy and lactation and adequate iodine intake is important for normal brain development of the fetus/newborn child. The aim of the present study was to evaluate the extent to which this increase in iodine requirement is met in pregnant women living...... micrograms/g creatinine). These values are far below internationally recommended levels. The consequences remain to be evaluated and no firm recommendations can be given. It seems reasonable, however, to recommend a high intake of food containing iodine (e.g. milk products) during pregnancy and lactation...

  4. Iodine deficiency in pregnancy in Denmark. Regional variations and frequency of individual iodine supplementation

    DEFF Research Database (Denmark)

    Nøhr, S B; Laurberg, P; Børlum, K G

    1993-01-01

    micrograms/g creatinine). These values are far below internationally recommended levels. The consequences remain to be evaluated and no firm recommendations can be given. It seems reasonable, however, to recommend a high intake of food containing iodine (e.g. milk products) during pregnancy and lactation...... containing vitamin/mineral tablets. Approximately one third of the women had received tablets containing iodine. In women who had not received iodine supplementation urinary iodine was low with a median value of 39.7 micrograms/g creatinine (Aalborg 28, Randers 33, Ringkøbing 34, Arhus 43 and Copenhagen 62...

  5. Effect of iodine solutions on polyaniline films

    International Nuclear Information System (INIS)

    Ayad, M.M.; Amer, W.A.; Stejskal, J.

    2009-01-01

    Polyaniline (PANI) emeraldine-base films have been exposed to iodine solutions. The interaction between the films and the iodine solution was studied using the quartz-crystal microbalance (QCM) technique and the UV-visible absorption spectroscopy. The iodine-treated film of emeraldine base was subjected to dedoping process using 0.1 M ammonia solution. The resulting film was exposed again to the previously used iodine solution. Iodine was found to play multiple roles: the ring-iodination of PANI film, the oxidation of PANI to pernigraniline base, and iodine doping to PANI salt. A sensor based on PANI-coated electrode of QCM was developed to monitor the presence of iodine in solution.

  6. 7 CFR 12.6 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Administration. 12.6 Section 12.6 Agriculture Office....6 Administration. (a) General. A determination of ineligibility for benefits in accordance with the... making such determinations, as provided in this section. (b) Administration by FSA. (1) The provisions of...

  7. Electrochemistry of iodine

    Energy Technology Data Exchange (ETDEWEB)

    Yaraliev, Ya.A. (AN Azerbajdzhanskoj SSR, Baku. Inst. Neorganicheskoj i Fizicheskoj Khimii)

    1982-06-01

    The review is devoted to investigations into oxidation-reduction processes in different systems including iodine. The data on adsorption of iodine on metals are discussed; the connection between the nature of iodine adsorption and the mechanism of its electrode reactions is considered. The metals studied can be placed in the following series taking into account the degree of I sorption on them: Cd approximately Tl < Sn approximately Pb < Ga < Bi < Hg < Co approximately Ni < Fe < Ag approximately Rh approximately Pd approximately Ir < Pt. The data are given of standard and equilibrium potentials in iodine systems. Electric oxidation and electric reduction of iodide ions is investigated using the methods of Faraday impedance and rectification, methods of voltamperometry and oscillopolarography, rotating disc electrode, chronopotentiometry. Anode and cathode processes of oxidation-reduction reactions in I/sup -//IO/sub 3//sup -/, I/sub 2//IO/sub 3//sup -/ and I/sub 2//I/sup +/ systems are analyzed.

  8. Study on iodine levels in thyroids of iodine-supplemented rats by epithermal neutron activation analysis

    International Nuclear Information System (INIS)

    Wang Xuefei; Zhang Fang; Xu Qing; Liu Nianqing; Chai Zhifang; Zhao Xueqin; Zuo Aijun

    2003-01-01

    The second generation female Wistar rats that have been treated with iodine-deficient food, after their delivery, are divided into three groups i.e. excessive-iodine (EI), adequate-iodine (AI) and iodine-deficient (ID) according to the KIO 3 concentration in the drinking water (3.0, 0.4, 0 mg/L). In addition, the normal rats with low iodine food and 0.4 mg/L KIO 3 water are used as the control group (C). The iodine content in thyroid and the serum thyroid hormone levels of the third generation rats are measured by means of epithermal neutron activation analysis (ENAA), and the method of enzyme-linked immunosorbent assay (ELISA), respectively. The results indicate that the total thyroxine (TT 4 ) and the free thyroxine (FT 4 ) of the EI, compared with those of the controls, are significantly decreased (p 3 ) evidently increased (p 4 , FT 4 and goiter

  9. Iodine excretion has decreased in Denmark between 2004 and 2010 - the importance of iodine content in milk

    DEFF Research Database (Denmark)

    Rasmussen, Lone Banke; Carlé, Allan; Jørgensen, Torben

    2014-01-01

    Fortification with the essential trace element iodine is widespread worldwide. In the present study, results on iodine excretion and intake of iodine-rich foods from a cross-sectional study carried out in 2004-5, 4 to 5 years after the implementation of mandatory iodine fortification, were compared...... with data in a study carried out in 2008-10. The 2008-10 study was a follow-up of a cross-sectional study carried out before iodine fortification was implemented. Participants in the cross-sectional studies were randomly selected. Both studies were carried out in the cities of Aalborg and Copenhagen...... in Denmark. The median urinary iodine concentration decreased in women from 97 μg/l (n 2862) to 78 μg/l (n 2041) (Piodine excretion. The prevalence of users of iodine containing dietary...

  10. Separation and retention of iodine

    International Nuclear Information System (INIS)

    Thomas, T.R.

    1976-01-01

    Caustic and mercuric nitrate scrubbers have been used for iodine recovery from process offgas, but they exhibit low decontamination factors for organic iodide removal and produce liquid wastes that are unsuitable for final storage. The Iodox process gives high decontamination factors for both organic iodides and elemental iodine. The liquid waste can be evaporated to a solid or concentrated and fixed in cement. Efficient separation and retention of gaseous iodine species can be obtained with silver-loaded adsorbents. The waste is a dry solid easily handled and stored. Adsorbents containing cheaper metals appear to have lower iodine-loading capacities and may be unsuitable for bulk iodine removal from process offgas because of the large amounts of solid waste that would be generated. A potential method for regenerationg and recycling silver-loaded adsorbents is being evaluated. In conjunction with the regeneration, lead-exchanged zeolite is used as a secondary adsorbent for the final fixation and storage of the iodine

  11. The importance of iodine nutrition during pregnancy.

    Science.gov (United States)

    Glinoer, Daniel

    2007-12-01

    To examine the importance of iodine nutrition during pregnancy. Review of existing literature of iodine in pregnancy. Population surveys and metabolic studies. Pregnant women. The main changes in thyroid function associated with pregnancy are due to an increase in hormone requirements that begin in the first trimester of gestation. This increase can only be met by a proportional increase in hormone production, something that depends directly upon the availability of iodine. When dietary iodine is lacking, an adequate physiological adaptation is difficult to achieve and is progressively replaced by pathological alterations that occur in parallel with the degree and duration of iodine deprivation. Iodine prophylaxis should be given systematically to women during pregnancy. In most public health programmes dealing with the correction of iodine deficiency disorders, iodised salt has been used as the preferred means to deliver iodine to households. Iodised salt, however, is not the ideal means of delivering iodine in the specific instances of pregnancy, breast-feeding and complementary feeding because of the need to limit salt intake during these periods. In European countries, presently it is proposed that iodine is given to pregnant women and breast-feeding mothers by systematically administering multivitamin tablets containing iodine in order to reach the recommended dietary allowance of 250 microg iodine day-1.

  12. Biofortification of lettuce (Lactuca sativa L.) with iodine: The effect of iodine form and concentration in the nutrient solution on growth, development and iodine uptake of lettuce grown in water culture

    NARCIS (Netherlands)

    Voogt, W.; Holwerda, H.T.; Khodabaks, M.R.

    2010-01-01

    BACKGROUND: Iodine is an essential trace element for humans. Two billion individuals have insufficient iodine intake. Biofortification of vegetables with iodine offers an excellent opportunity to increase iodine intake by humans. The main aim was to study the effect of iodine form and concentration

  13. Photochemistry of DNA containing iodinated cytosine

    Energy Technology Data Exchange (ETDEWEB)

    Rahn, R O; Stafford, R S [Oak Ridge National Lab., TN (USA)

    1979-10-01

    Irradiation at 313 nm of compounds containing iodinated cytosine moieties results in the photolysis of iodine. Photolysis occurs with a quantum yield of 0.022-0.024 for 5-iododeoxycytidine and 5-iododeoxycytidine monophosphate, and 0.004-0.008 for iodinated DNA as well as for iodinated polycytidylate. Photodegradation of the cytosine moiety occurs when air is present during irradiation, presumably due to the reaction of oxygen with the cytosyl radical formed when iodine is lost. This oxygen promoted photodegradation destroys the cytosine chromophore and is complete in the monomers but occurs to only a limited extent in the polymers. In the absence of oxygen or in the presence of ethanol, photodegradation is prevented and the loss of iodine leads exclusively to the formation of the cytosine chromophore. In DNA, the loss of iodine is accompanied by the formation of sugar damage and/or chain breaks. As measured by sedimentation in alkaline sucrose gradients, approximately one break is made for every six iodines lost in denatured DNA. The frequency of chain breakage per iodine photolyzed is reduced 2-fold in renatured DNA. Analysis in neutral gradients suggests that half of the breaks observed in alkali are alkali-labile bonds. Both ethanol and cysteamine reduce the number of chain breaks in alkali by approximately 3-fold.

  14. 22 CFR 126.12 - Continuation in force.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Continuation in force. 126.12 Section 126.12... PROVISIONS § 126.12 Continuation in force. All determinations, authorizations, licenses, approvals of... previous provisions of this subchapter, continue in full force and effect until or unless modified, revoked...

  15. Experimental reproduction of iodine deficiency in cattle.

    Science.gov (United States)

    McCoy, M A; Smyth, J A; Ellis, W A; Arthur, J R; Kennedy, D G

    1997-11-22

    The role of iodine deficiency in stillbirth/perinatal weak calf syndrome was investigated in pregnant heifers. Five heifers were fed an iodine deficient diet (mean [sd] iodine concentration 0.06 [0.01] mg/kg dry matter [DM]) and six received an iodine sufficient diet (mean [sd] iodine concentration 1.45 [0.27] mg/kg DM). The diets consisted of wheat and soyabean meal with added minerals and vitamins (with or without iodine) and were fed to the heifers over the final four to five months of pregnancy. The iodine deficient diet produced clinicopathological changes and pathological changes in the thyroid glands of both the heifers and their offspring. However, all the calves in the iodine deficient group were born clinically normal.

  16. Iodine removing method in organic solvent

    International Nuclear Information System (INIS)

    Suzuki, Takeo; Sakurai, Manabu

    1988-01-01

    Purpose: To effectively remove iodine in an organic solvent to thereby remove iodine in the solvent that can be re-used or put to purning treatment. Method: Organic solvent formed from wastes of nuclear facilities is mixed with basic lead acetate, or silica gel or activated carbon incorporated with such a compound to adsorb iodine in the organic solvent to the basic lead acetate. Then, iodine in the organic solvent is removed by separating to eliminate the basic lead acetate adsorbing iodine from the organic solvent or by passing the organic solvent through a tower or column charged or pre-coated with silica gel or activated carbon incorporated with lead acetate. By using basic lead acetate as the adsorbents, iodine can effective by adsorbed and eliminated. Thus, the possibility of circumstantial release of iodine can be reduced upon reusing or burning treatment of the organic solvent. (Kamimura, M.)

  17. 127I Moessbauer study of some oxygen bonded iodine(I) and iodine(III) complexes

    International Nuclear Information System (INIS)

    Bardhan, M.; Birchall, T.; Frampton, C.; Kapoor, P.

    1988-01-01

    127 I Moessbauer spectra have been recorded at 4.2 0 K for a series of oxygen bonded iodine(I) and iodine(III) complexes. The sign of the quadrupole coupling constant is dependant only on the primary arrangement of ligands about the central iodine nucleus whereas the magnitude and the asymmetry parameter are more sensitive to ligand electronegativity and type. (orig.)

  18. Chemical generation of iodine atoms

    Energy Technology Data Exchange (ETDEWEB)

    Hewett, Kevin B. [Directed Energy Directorate, Air Force Research Laboratory, 3550 Aberdeen Avenue SE, Kirtland AFB, NM 87117-5776 (United States)]. E-mail: kevin.hewett@kirtland.af.mil; Hager, Gordon D. [Directed Energy Directorate, Air Force Research Laboratory, 3550 Aberdeen Avenue SE, Kirtland AFB, NM 87117-5776 (United States); Crowell, Peter G. [Northrup Grumman Information Technology, Science and Technology Operating Unit, Advanced Technology Division, P.O. Box 9377, Albuquerque, NM 87119-9377 (United States)

    2005-01-10

    The chemical generation of atomic iodine using a chemical combustor to generate the atomic fluorine intermediate, from the reaction of F{sub 2} + H{sub 2}, followed by the production of atomic iodine, from the reaction of F + HI, was investigated. The maximum conversion efficiency of HI into atomic iodine was observed to be approximately 75%, which is in good agreement with the theoretical model. The conversion efficiency is limited by the formation of iodine monofluoride at the walls of the combustor where the gas phase temperature is insufficient to dissociate the IF.

  19. Clinical and Biochemical Uses of Stable Iodine Measurements

    Energy Technology Data Exchange (ETDEWEB)

    Koutras, D. A. [Thyroid Section, Alexandra Hospital, Athens (Greece)

    1970-07-01

    Iodine and thyroid function are closely linked, since the only known role of iodine is its participation in the synthesis of thyroid hormones. Iodine metabolism may be represented as a metabolic cycle consisting of three main pools: the Plasma Inorganic Iodine (PIl) pool into which dietary iodine goes and from where it is either taken up by the thyroid or excreted by the kidneys, the intrathyroidal iodine pool, where. thyroid hormone synthesis occurs, and finally the peripheral pool of thyroid hormones, of which about 80% are deiodinated and 20% excreted with the faeces. Endemic goitre is usually due to iodine deficiency. There is no renal homeostatic mechanism to keep the PII level constant, and so adaptation to iodine deficiency occurs by increasing the thyroidal iodide clearance rate. Stable iodine measurements are necessary for a complete study of iodine metabolism. Estimates of the serum Protein-Bound Iodine (PBl) are the best index of thyroid function, estimates of the PII and of the urinary iodine are the best indices of iodine nutrition. (author)

  20. Iodine nutrition status in lactating mothers residing in countries with mandatory and voluntary iodine fortification programs: an updated systematic review.

    Science.gov (United States)

    Nazeri, Pantea; Mirmiran, Parvin; Shiva, Niloofar; Mehrabi, Yadollah; Mojarrad, Mehdi; Azizi, Fereidoun

    2015-06-01

    The aim of this review is to assess data available on iodine nutrition status in lactating mothers residing in countries with mandatory and voluntary iodine fortification programs and/or iodine supplementation. A systematic review was conducted by searching articles published between 1964 and 2013 in Pub Med, ISI Web, and Cochrane Library using iodine nutrition, lactation, iodine supplementation, and iodine fortification as keywords for titles and/or abstracts. Relevant articles were included if they reported urinary iodine concentration (UIC) in lactating mothers and, if determined, the type of iodine fortification program and/or iodine supplementation. Forty-two studies met the inclusion criteria. Among these, 21 studies assessed lactating mothers in countries with a mandatory iodine fortification program, 17 studies were from countries with voluntary and/or without iodine fortification programs, and four studies assessed iodine nutrition status in lactating mothers undergoing iodine supplementation. Among countries with mandatory iodine fortification programs, the range of salt iodization level in lactating mothers with a UIC 100 μg/L, it was between 15 and 60 ppm. Levels of UIC Chile, Iran, Mongolia, New Guinea, and Nigeria, the median or mean of UIC was >100 μg/L. There was a median or mean UIC program was voluntary, including Switzerland, Australia, New Zealand, Ireland, and Germany. However, in some countries with voluntary iodine fortification programs, such as the United States, Spain, and Japan, a mean or median UIC of >100 μg/L has been reported. Although universal salt iodization is still the most feasible and cost-effective approach for iodine deficiency control in pregnant and lactating mothers, UIC in lactating mothers of most countries with voluntary programs and in areas with mandatory iodine fortification is still within the iodine deficiency range, indicating that iodine supplementation in daily prenatal vitamin/mineral supplements in

  1. 7 CFR 1710.126 - Federal debt delinquency.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 11 2010-01-01 2010-01-01 false Federal debt delinquency. 1710.126 Section 1710.126... and Basic Policies § 1710.126 Federal debt delinquency. (a) Prior to approval of a loan or advance of... reasons for the delinquency must be explained, and RUS will take such explanation into consideration in...

  2. The high-power iodine laser

    Science.gov (United States)

    Brederlow, G.; Fill, E.; Witte, K. J.

    The book provides a description of the present state of the art concerning the iodine laser, giving particular attention to the design and operation of pulsed high-power iodine lasers. The basic features of the laser are examined, taking into account aspects of spontaneous emission lifetime, hyperfine structure, line broadening and line shifts, stimulated emission cross sections, the influence of magnetic fields, sublevel relaxation, the photodissociation of alkyl iodides, flashlamp technology, excitation in a direct discharge, chemical excitation, and questions regarding the chemical kinetics of the photodissociation iodine laser. The principles of high-power operation are considered along with aspects of beam quality and losses, the design and layout of an iodine laser system, the scalability and prospects of the iodine laser, and the design of the single-beam Asterix III laser.

  3. Geochemical Cycling of Iodine Species in Soils

    International Nuclear Information System (INIS)

    Hu, Q.; Moran, J.E.; Blackwood, V.

    2007-01-01

    Iodine is an important element in studies of environmental protection and human health, global-scale hydrologic processes and nuclear nonproliferation. Biogeochemical cycling of iodine in soils is complex, because iodine occurs in multiple oxidation states and as inorganic and organic species that may be hydrophilic, atmophilic, and biophilic. In this study, we applied new analytical techniques to study the content and speciation of stable iodine in representative surface soils, and sorption and transport behavior of iodine species (iodide, iodate, and 4-iodoaniline) in sediments collected at numerous nuclear facilities in the United States, where anthropogenic 129 I from prior nuclear fuel processing activities poses an environmental risk. The surface soil samples were chosen for their geographic locations (e.g., near the ocean or nuclear facilities) and for their differing physico-chemical characteristics (organic matter, texture, etc). Extracted solutions were analyzed by IC and ICP-MS methods to determine iodine concentrations and to examine iodine speciation (iodide, iodate, and organic iodine). In natural soils, iodine is mostly (nearly 90% of total iodine) present as organic species, while inorganic iodine becomes important (up to 50%) only in sediments with low organic matter. Results from laboratory column studies, aimed at examining transport of different iodine species, showed much greater retardation of 4-iodoaniline than iodide or iodate. Careful attention must be given to potential interconversion among species when interpreting the biogeochemical behavior of iodine in the environment. In addition to speciation, input concentration and residence time effects will influence the biogeochemical cycling of anthropogenic 129I deposited on surface soils

  4. Mock iodine-125 radiation source

    International Nuclear Information System (INIS)

    Coffey, D.L.

    1976-01-01

    An intimate mixture of americium-241 and iodine-129 provides an energy spectrum that reliably simulates the spectrum of iodine-125 in a well-type detector. As such, it may be used as a long-lived standard to calibrate instruments such as well scintillation spectrometers in which measurements are to be made involving iodine-125

  5. Iodine deficiency disorders in Sarawak, Malaysia.

    Science.gov (United States)

    Kiyu, A; Tambi, Z; Ahmad, Y

    1998-12-01

    The state of Sarawak in Malaysia has a high prevalence of iodine deficiency disorders (IDD). This has been revealed through a review of goitre surveys that were carried out in the State from the early 1970s to the 1990s. The primary cause was low iodine intake. Contributory factors were low iodine content in the soil and water as well as high cassava consumption. Virtual elimination of IDD is one of the nutritional goals of the IDD prevention and control programs. The strategies adopted include the iodination of coarse salt, which is sold in the market by shopkeepers and also provided free from government health clinics; legislation requiring that salt sold in IDD-gazetted areas must be iodised; and the use of iodinators to iodise water supplied by the gravity-feed system to villages and boarding schools in rural areas. The indicators used in the monitoring and evaluation of the program include the availability of iodised salt in the market and households, iodine levels in water supply that had been fitted with iodinators, goitre volume measured by ultrasound, and urinary iodine excretion among school children.

  6. Iodine in soil

    International Nuclear Information System (INIS)

    Johanson, Karl Johan

    2000-12-01

    A literature study of the migration and the appearance of iodine isotopes in the bio-sphere particularly in soil is presented. Some important papers in the field of iodine appearance in soil and the appearance of 129 I in the surroundings of reprocessing plants are discussed. The most important conclusions are: 1. Iodine binds to organic matter in the soil and also to some oxides of aluminium and iron. 2. If the iodine is not bound to the soil a large fraction of added 129 I is volatilized after a rather short period. 3. The binding and also the volatilisation seems to be due to biological activity in the soil. It may take place within living microorganisms or by external enzymes excreted from microorganisms. 4. Due to variations in the composition of soil there may be a large variation in the distribution of 129 I in the vertical profile of soil - usually most of the 129 I in the upper layer - which also results in large variations in the 129 I uptake to plants

  7. Iodine in soil

    Energy Technology Data Exchange (ETDEWEB)

    Johanson, Karl Johan [Swedish Univ. of Agricultural Sciences, Uppsala (Sweden). Dept. of Forest Mycology and Pathology

    2000-12-01

    A literature study of the migration and the appearance of iodine isotopes in the bio-sphere particularly in soil is presented. Some important papers in the field of iodine appearance in soil and the appearance of {sup 129}I in the surroundings of reprocessing plants are discussed. The most important conclusions are: 1. Iodine binds to organic matter in the soil and also to some oxides of aluminium and iron. 2. If the iodine is not bound to the soil a large fraction of added {sup 129}I is volatilized after a rather short period. 3. The binding and also the volatilisation seems to be due to biological activity in the soil. It may take place within living microorganisms or by external enzymes excreted from microorganisms. 4. Due to variations in the composition of soil there may be a large variation in the distribution of {sup 129}I in the vertical profile of soil - usually most of the {sup 129}I in the upper layer - which also results in large variations in the {sup 129}I uptake to plants.

  8. Intravascular enhancement with identical iodine delivery rate using different iodine contrast media in a circulation phantom.

    Science.gov (United States)

    Mihl, Casper; Wildberger, Joachim E; Jurencak, Tomas; Yanniello, Michael J; Nijssen, Estelle C; Kalafut, John F; Nalbantov, Georgi; Mühlenbruch, Georg; Behrendt, Florian F; Das, Marco

    2013-11-01

    Both iodine delivery rate (IDR) and iodine concentration are decisive factors for vascular enhancement in computed tomographic angiography. It is unclear, however, whether the use of high-iodine concentration contrast media is beneficial to lower iodine concentrations when IDR is kept identical. This study evaluates the effect of using different iodine concentrations on intravascular attenuation in a circulation phantom while maintaining a constant IDR. A circulation phantom with a low-pressure venous compartment and a high-pressure arterial compartment simulating physiological circulation parameters was used (heart rate, 60 beats per minute; stroke volume, 60 mL; blood pressure, 120/80 mm Hg). Maintaining a constant IDR (2.0 g/s) and a constant total iodine load (20 g), prewarmed (37°C) contrast media with differing iodine concentrations (240-400 mg/mL) were injected into the phantom using a double-headed power injector. Serial computed tomographic scans at the level of the ascending aorta (AA), the descending aorta (DA), and the left main coronary artery (LM) were obtained. Total amount of contrast volume (milliliters), iodine delivery (grams of iodine), peak flow rate (milliliter per second), and intravascular pressure (pounds per square inch) were monitored using a dedicated data acquisition program. Attenuation values in the AA, the DA, and the LM were constantly measured (Hounsfield unit [HU]). In addition, time-enhancement curves, aortic peak enhancement, and time to peak were determined. All contrast injection protocols resulted in similar attenuation values: the AA (516 [11] to 531 [37] HU), the DA (514 [17] to 531 [32] HU), and the LM (490 [10] to 507 [17] HU). No significant differences were found between the AA, the DA, and the LM for either peak enhancement (all P > 0.05) or mean time to peak (AA, 19.4 [0.58] to 20.1 [1.05] seconds; DA, 21.1 [1.0] to 21.4 [1.15] seconds; LM, 19.8 [0.58] to 20.1 [1.05] seconds). This phantom study demonstrates that

  9. Study of Iodine Prophylaxis Following Nuclear Accidents

    International Nuclear Information System (INIS)

    Sri Widayati; Tedjasari, R. S.; Elfida

    2007-01-01

    Study of iodine prophylaxis following nuclear accidents has been done. Giving stable iodine to a population exposed by I-131 is one of preventive action from internal radiation to the thyroid gland. Stable iodine could be given as Kl tablet in a range of dose of 30 mg/day to 130 mg/day. Improper giving of stable iodine could cause side effect to health, so then some factors should be considered i. e. dose estimation, age, dose of stable iodine to be given, duration of stable iodine prophylaxis and risk of health. (author)

  10. Theoretical and experimental investigations on the behaviour of iodine during severe accidents: volatile iodine. Final report

    International Nuclear Information System (INIS)

    Funke, F.; Zeh, P.; Greger, G.U.; Hellmann, S.

    1999-01-01

    Analysis of the consequences of severe accidents in nuclear power plants requires knowledge of the behaviour of radionuclides relevant from the radiological viewpoint, especially the iodine. The current modelling of iodine behaviour is not conclusive, owing to insufficiently known data. This project is intended to eliminate some of these data gaps in critical areas. 350 tests on the radiation-induced oxidation of elemental iodine (I 2 ) in the containment atmosphere were performed yielding an extended database. Moreover, irradiation tests were performed on the formation and decomposition of ozone which is a reaction partner for I 2 . The reaction with ozone converts volatile I 2 into non-volatile iodine oxides or iodate. An improved kinetic modelling was developed for the iodine accident code IMPAIR. Now the model is valid also for steam-containing atmospheres and, additionally, considers dose rate and thus the actual ozone concentration. An assessment of the literature concludes that β and γ radiation have no different impact on iodine chemistry and thus do not need to be modelled separately in iodine accident codes. An assessment of the literature shows a partly significant chemical interaction of volatile iodine with aerosols. Since such reactions lead to a faster decrease of volatile iodine at least at high aerosol concentrations, a modelling should be foreseen in the future. In the frame of the international ISP-41 project, calculations to an integral test in the Canadian Radioiodine Test Facility (RTF) were performed with IMPAIR. The existing model of the radiation-induced I 2 formation in the sump in IMPAIR is identified as a weakness requiring future improvement. A theoretical assessment on the iodine chemistry in the droplets of a spray system concludes that a modelling is necessary in case of spraying with fresh water, and that this is already contained in available spray models. During recirculation spraying in an examplary, hypothetical EPR case, no

  11. Iodine deficiency in pregnancy and the effects of maternal iodine supplementation on the offspring: a review

    NARCIS (Netherlands)

    Zimmermann, M.B.

    2009-01-01

    The World Health Organization (WHO) recently increased their recommended iodine intake during pregnancy from 200 to 250 µg/d and suggested that a median urinary iodine (UI) concentration of 150-249 µg/L indicates adequate iodine intake in pregnant women. Thyrotropin concentrations in blood collected

  12. Iodine-125 and Iodine-131 in the Thames Valley and other areas

    International Nuclear Information System (INIS)

    Howe, J.R.; Lloyd, M.K.; Bowlt, C.

    1985-01-01

    Part of the Iodine-125 and Iodine-131 waste from hospitals and research centres is discarded down drains and passes through sewage and water reclamation works into the river system. Relatively high concentration of radioiodine occur in outfalls that discharge into the river Thames, lower levels are found in the mainstream river and less still in the reservoirs and tap water supplies abstracted from the river. The pathway from waste to drinking water could account for the low levels of Iodine-125 found in the thyroid glands of some farm animals and human beings in the Thames valley

  13. Evaluation of soil-plant transfer factors of iodine. Estimation of annual ingestion for iodine from the diet

    International Nuclear Information System (INIS)

    Saas, Arsene.

    1980-11-01

    The author presents the iodine middle contents of the soils and vegetables. A synthesis on the iodine evolution in the soils and vegetables allows to conclude that the vegetable absorption of this isotope is correlated with the isotopiquely exchangeable iodine of the soil. The soil-plant transfer-factors are calculated for the vegetables, cereals, fruits from the stable iodine quantitative analysis. The annual iodine ingestion has been estimated from the dietary of the European Communites areas. This one is a little different of the quantity estimated by CRESTA-LACOURLY-R 2979, yet the contribution by consummation unity is different [fr

  14. Chemical oxygen-iodine laser with atomic iodine generated via fluorine atoms

    Czech Academy of Sciences Publication Activity Database

    Jirásek, Vít; Čenský, Miroslav; Špalek, Otomar; Kodymová, Jarmila; Picková, Irena; Jakubec, Ivo

    2008-01-01

    Roč. 345, č. 1 (2008), 14-22 ISSN 0301-0104 R&D Projects: GA ČR GA202/05/0359 Institutional research plan: CEZ:AV0Z10100523; CEZ:AV0Z40320502 Keywords : atomic iodine * atomic fluorine * chemical oxygen–iodine laser * COIL Subject RIV: BH - Optics, Masers, Lasers Impact factor: 1.961, year: 2008

  15. Mineral resource of the month: iodine

    Science.gov (United States)

    Polyak, Désirée E.

    2009-01-01

    The article focuses on iodine, its benefits and adverse effects, and its production and consumption. It states that iodine is essential to humans for it produces thyroid hormones to nourish thyroid glands but excessive intake could cause goiter, hyperthyroidism or hypothyroidism. U.S. laws require salt iodization to help prevent diseases. Chile and Japan are the world's leading iodine producer while in the U.S. iodine is mined from deep well brines in northern Oklahoma.

  16. The Swiss lodized Salt Program Provides Adequate Iodine for School Children and Pregnant Women, but Weaning Infants Not Receiving Iodine-Containing Complementary Foods as well as Their Mothers Are Iodine Deficient

    NARCIS (Netherlands)

    Andersson, M.; Aeberli, I.; Wüst, N.; Piacenza, A.M.; Bucher, T.; Henschen, I.; Haldimann, M.; Zimmermann, M.B.

    2010-01-01

    Background: If children and pregnant women in the population are iodine sufficient, it is generally assumed infants are also sufficient. But weaning infants may be at risk of iodine deficiency because iodized salt contributes little dietary iodine during this period. To fill this gap, iodine

  17. Iodine behaviour in severe accidents

    Energy Technology Data Exchange (ETDEWEB)

    Dutton, L M.C.; Grindon, E; Handy, B J; Sutherland, L [NNC Ltd., Knutsford (United Kingdom); Bruns, W G; Sims, H E [AEA Technology, Harwell (United Kingdom); Dickinson, S [AEA Technology, Winfrith (United Kingdom); Hueber, C; Jacquemain, D [IPSN/CEA, Cadarache, Saint Paul-Lez-Durance (France)

    1996-12-01

    A description is given of analyses which identify which aspects of the modelling and data are most important in evaluating the release of radioactive iodine to the environment following a potential severe accident at a PWR and which identify the major uncertainties which affect that release. Three iodine codes are used namely INSPECT, IODE and IMPAIR, and their predictions are compared with those of the PSA code MAAP. INSPECT is a mechanistic code which models iodine behaviour in the aqueous aerosol, spray water and sump water, and the partitioning of volatile species between the aqueous phases and containment gas space. Organic iodine is not modelled. IODE and IMPAIR are semi-empirical codes which do not model iodine behaviour in the aqueous aerosol, but model organic iodine. The fault sequences addressed are based on analyses for the Sizewell `B` design. Two types of sequence have been analysed.: (a) those in which a major release of fission products from the primary circuit to the containment occur, e.g. a large LOCAS, (b) those where the release by-passes the containment, e.g. a leak into the auxiliary building. In the analysis of the LOCA sequences where the pH of the sump is controlled to be a value of 8 or greater, all three codes predict that the oxidation of iodine to produce gas phase species does not make a significant contribution to the source term due to leakage from the reactor building and that the latter is dominated by iodide in the aerosol. In the case where the pH of the sump is not controlled, it is found that the proportion of gas phase iodine increases significantly, although the cumulative leakage predicted by all three codes is not significantly different from that predicted by MAAP. The radiolytic production of nitric acid could be a major factor in determining the pH, and if the pH were reduced, the codes predict an increase in gas phase iodine species leaked from the containment. (author) 4 figs., 7 tabs., 13 refs.

  18. Iodine in Enteral and Parenteral Nutrition

    NARCIS (Netherlands)

    Zimmermann, M.B.; Crill, C.M.

    2010-01-01

    Iodine deficiency (ID) has multiple adverse effects on growth and development due to inadequate thyroid hormone production. Methods for assessment of iodine nutrition in individuals include the urinary iodine concentration (UI), thyroid size and thyroid function tests. The UI measured in several

  19. Formation and behaviour of organic iodine

    International Nuclear Information System (INIS)

    Zilliacus, R.; Koukkar, P.; Karjunen, T.; Sjoevall, H.

    2002-01-01

    The report presents experimental studies on the formation of organic iodine in severe reactor accidents. The analyses were performed to evaluate the amount of alkaline chemical needed for effective pH control of containment water during the accidents. The formation of organic iodine in solutions used in the filtered venting system and the absorption of iodine compounds in the solutions were studied. Experiments for the formation of organic iodine on painted surfaces were also performed. (au)

  20. Iodine chemistry in a reactor regulation

    Energy Technology Data Exchange (ETDEWEB)

    Powers, D A [Nuclear Regulatory Commission, Washington, DC (United States). Advisory Committee on Reactor Safeguards

    1996-12-01

    Radioactive iodine has always been an important consideration in the regulation of nuclear power reactors to assure the health and safety of the public. Regulators adopted conservatively bounding predictions of iodine behavior in the earliest days of the development of nuclear power because there was so little known about either accidents or the chemistry of iodine. Today there is a flood of new information and understanding of the chemistry of iodine under reactor accident conditions. This paper offers some thoughts on how the community of scientists engaged in the study of iodine chemistry can present the results of their work so that it is more immediately adopted by the regulator. It is suggested that the scientific community consider the concept of consensus standards so effectively used within the engineering community to define the status of the study of radioactive iodine chemistry for reactor safety. (author) 9 refs.

  1. Iodine chemistry in a reactor regulation

    International Nuclear Information System (INIS)

    Powers, D.A.

    1996-01-01

    Radioactive iodine has always been an important consideration in the regulation of nuclear power reactors to assure the health and safety of the public. Regulators adopted conservatively bounding predictions of iodine behavior in the earliest days of the development of nuclear power because there was so little known about either accidents or the chemistry of iodine. Today there is a flood of new information and understanding of the chemistry of iodine under reactor accident conditions. This paper offers some thoughts on how the community of scientists engaged in the study of iodine chemistry can present the results of their work so that it is more immediately adopted by the regulator. It is suggested that the scientific community consider the concept of consensus standards so effectively used within the engineering community to define the status of the study of radioactive iodine chemistry for reactor safety. (author) 9 refs

  2. Iodine Prophylaxis and Nuclear Accidents

    International Nuclear Information System (INIS)

    Franic, Z.

    1998-01-01

    Iodine is a highly volatile element therefore being very mobile in the environment. It enters the metabolism of living organisms and is selectively taken up and concentrated in the thyroid gland. The plume (cloud-like formation) of radioactive material that might be released in the environment in the case of a serious nuclear accident, primarily consists of the radioactive isotopes of iodine. Among those, due to its decay properties, is the most important 131 I. The effective means of protecting the thyroid gland against exposure to radioactive iodine is an intake of stable iodine. Therefore, one of the central issues in the emergency planning is to determine whether and at which projected thyroid radiation dose stable iodine should be given to the population. The International Atomic Energy Agency (IAEA) set the generic optimized intervention value for iodine prophylaxis to 100 mGy of avertable committed dose to a thyroid.The prophylaxis is implemented by utilizing the pills of pills of potassium iodine (KI). The efficacy of KI in protecting the thyroid gland depends upon the time of intake relative to the start of exposure to radioactive iodine. The best results are obtained if KI is taken 1-2 hours before or immediately after the start of exposure. The recommended dosage, based upon the study performed by Il'in et.al. is 130 mg/day. KI should be taken at least three days after the acute exposure to radioiodine, to prevent accumulation in a thyroid gland of radioiodine excreted from the other compartments of the body. The largest epidemiological study on the effects of KI prophylaxis ever performed was the one in Poland after the Chernobyl accident. Stable iodine was given as single dose of KI solution to 10.5 million of children and 7 millions of adults. Among children no serious side effects were seen while only two adults (with previously recorded iodine sensitivity) had severe respiratory distresses. Polish experiences showed that rapid response to such

  3. Transfer of gaseous iodine to Tradescantia

    International Nuclear Information System (INIS)

    Nakamura, Yuji; Ohmomo, Yoichiro.

    1984-01-01

    Transfer rates of gaseous elemental iodine and methyliodide from atmosphere to Tradescantia were investigated in relation to supposed genetic mutation due to radioactive iodine released from nuclear facilities. The estimated transfer rate of elemental iodine to the young buds of Tradescantia, which was given as the ratio of iodine uptake rate per unit weight of the plant to the concentration of the element in the air, was approximately 7 x 10 -2 cm 3 /g.sec, about 30 to 40 times higher than that of methyliodide. The contribution of direct deposition of elemental iodine was suggested to be significant, although methyliodide was mainly absorbed by respiration through stomata of the plant. (author)

  4. Direct evidence for coastal iodine particles from Laminaria macroalgae – linkage to emissions of molecular iodine

    Directory of Open Access Journals (Sweden)

    G. McFiggans

    2004-01-01

    Full Text Available Renewal of ultrafine aerosols in the marine boundary layer may lead to repopulation of the marine distribution and ultimately determine the concentration of cloud condensation nuclei (CCN. Thus the formation of nanometre-scale particles can lead to enhanced scattering of incoming radiation and a net cooling of the atmosphere. The recent demonstration of the chamber formation of new particles from the photolytic production of condensable iodine-containing compounds from diiodomethane (CH2I2, (O'Dowd et al., 2002; Kolb, 2002; Jimenez et al., 2003a; Burkholder and Ravishankara, 2003, provides an additional mechanism to the gas-to-particle conversion of sulphuric acid formed in the photo-oxidation of dimethylsulphide for marine aerosol repopulation. CH2I2 is emitted from seaweeds (Carpenter et al., 1999, 2000 and has been suggested as an initiator of particle formation. We demonstrate here for the first time that ultrafine iodine-containing particles are produced by intertidal macroalgae exposed to ambient levels of ozone. The particle composition is very similar both to those formed in the chamber photo-oxidation of diiodomethane and in the oxidation of molecular iodine by ozone. The particles formed in all three systems are similarly aspherical. When small, those formed in the molecular iodine system swell only moderately when exposed to increased humidity environments, and swell progressively less with increasing size; this behaviour occurs whether they are formed in dry or humid environments, in contrast to those in the CH2I2 system. Direct coastal boundary layer observations of molecular iodine, ultrafine particle production and iodocarbons are reported. Using a newly measured molecular iodine photolysis rate, it is shown that, if atomic iodine is involved in the observed particle bursts, it is of the order of at least 1000 times more likely to result from molecular iodine photolysis than diiodomethane photolysis. A hypothesis for molecular

  5. Immobilization of iodine in concrete

    International Nuclear Information System (INIS)

    Clark, W.E.; Thompson, C.T.

    1977-01-01

    A method for immobilizing fission product radioactive iodine recovered from irradiated nuclear fuel comprises combining material comprising water, Portland cement and about 3 to 20 wt percent iodine as Ba(IO 3 ) 2 to provide a fluid mixture and allowing the fluid mixture to harden, said Ba(IO 3 ) 2 comprising said radioactive iodine. An article for solid waste disposal comprises concrete prepared by this method. 10 claims, 2 figures

  6. MDCT angiography of the pulmonary arteries: intravascular contrast enhancement does not depend on iodine concentration when injecting equal amounts of iodine at standardized iodine delivery rates

    International Nuclear Information System (INIS)

    Keil, S.; Plumhans, C.; Behrendt, F.F.; Das, M.; Muehlenbruch, G.; Mahnken, A.H.; Guenther, R.W.; Stanzel, S.; Seidensticker, P.; Knackstedt, C.; Wildberger, J.E.

    2008-01-01

    To compare the impact of iodine concentration using two different contrast materials (CM) at standardized iodine delivery rate (IDR) and overall iodine load in 16-multidetector-row-CT-angiography (MDCTA) of the pulmonary arteries of 192 patients with known or suspected pulmonary embolism. One hundred three patients (group A) received 148 ml of a CM containing 300 mg iodine/ml (Ultravist 300 trademark, BayerScheringPharma) at a flow rate of 4.9 ml/s. Eighty-nine patients (group B) received 120 ml of a CM with a concentration of 370 mg iodine/ml (Ultravist370 trademark) at a flow rate of 4.0 ml/s, resulting in a standardized IDR (∝1.5 gI/s) and the same overall amount of iodine (44.4 g). Both CM injections were followed by a saline chaser. Mean density values were determined in the pulmonary trunk, the ascending and the descending aorta, respectively. Applying repeated-measures ANOVA, no statistically significant differences between both MDCTA protocols were found (p=0.5790): the mean density in the pulmonary trunk was 355±116 Hounsfield Units (group A) and 358±115 (group B). The corresponding values for the ascending and descending aorta were 295±79 (group A) and 284±65 (group B) as well as 272±71 and 262±70. In conclusion, the use of standardized IDR and overall iodine load provides comparable intravascular CM density in pulmonary 16-MDCTA for delivering contrast materials with different iodine concentrations. (orig.)

  7. 29 CFR 570.126 - Parental exemption.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Parental exemption. 570.126 Section 570.126 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR REGULATIONS CHILD LABOR REGULATIONS, ORDERS AND STATEMENTS OF INTERPRETATION General Statements of Interpretation of the Child Labor...

  8. Iodine in drinking water varies by more than 100-fold in Denmark. Importance for iodine content of infant formulas

    DEFF Research Database (Denmark)

    Pedersen, K M; Laurberg, P; Nøhr, S

    1999-01-01

    The iodine intake level of the population is of major importance for the occurrence of thyroid disorders in an area. The aim of the present study was to evaluate the importance of drinking water iodine content for the known regional differences in iodine intake in Denmark and for the iodine content...

  9. Immobilization of iodine in concrete

    Science.gov (United States)

    Clark, Walter E.; Thompson, Clarence T.

    1977-04-12

    A method for immobilizing fission product radioactive iodine recovered from irradiated nuclear fuel comprises combining material comprising water, Portland cement and about 3-20 wt. % iodine as Ba(IO.sub.3).sub.2 to provide a fluid mixture and allowing the fluid mixture to harden, said Ba(IO.sub.3).sub.2 comprising said radioactive iodine. An article for solid waste disposal comprises concrete prepared by this method. BACKGROUND OF THE INVENTION This invention was made in the course of, or under a contract with the Energy Research and Development Administration. It relates in general to reactor waste solidification and more specifically to the immobilization of fission product radioactive iodine recovered from irradiated nuclear fuel for underground storage.

  10. Risk of suboptimal iodine intake in pregnant Norwegian women.

    Science.gov (United States)

    Brantsæter, Anne Lise; Abel, Marianne Hope; Haugen, Margaretha; Meltzer, Helle Margrete

    2013-02-06

    Pregnant women and infants are exceptionally vulnerable to iodine deficiency. The aims of the present study were to estimate iodine intake, to investigate sources of iodine, to identify predictors of low or suboptimal iodine intake (defined as intakes below 100 μg/day and 150 μg/day) in a large population of pregnant Norwegian women and to evaluate iodine status in a sub-population. Iodine intake was calculated based on a validated Food Frequency Questionnaire in the Norwegian Mother and Child Cohort. The median iodine intake was 141 μg/day from food and 166 μg/day from food and supplements. Use of iodine-containing supplements was reported by 31.6%. The main source of iodine from food was dairy products, contributing 67% and 43% in non-supplement and iodine-supplement users, respectively. Of 61,904 women, 16.1% had iodine intake below 100 μg/day, 42.0% had iodine intake below 150 μg/day and only 21.7% reached the WHO/UNICEF/ICCIDD recommendation of 250 μg/day. Dietary behaviors associated with increased risk of low and suboptimal iodine intake were: no use of iodine-containing supplements and low intake of milk/yogurt, seafood and eggs. The median urinary iodine concentration measured in 119 participants (69 μg/L) confirmed insufficient iodine intake. Public health strategies are needed to improve and secure the iodine status of pregnant women in Norway.

  11. Weight, iodine content and iodine uptake of the thyroid gland of normal Japanese

    International Nuclear Information System (INIS)

    Yoshizawa, Yasuo; Kusama, Tomoko

    1976-01-01

    Various questions arise in the application of ICRP ''Standard Man'' values to Japanese. One of the questions is that ''Standard Man'' values of the thyroid are different from normal Japanese values. A systematic survey of past reports was carried out with a view to search for normal Japanese values of the thyroid. The subjects of search were weight, iodine content and iodine uptake rate (f sub(w)) of the thyroid. These are important factors in the estimation of the radiation dose of the thyroid caused by internal contamination of radioiodine, and are foreseen to have the difference between Japanese and ''Standard Man''. The result of study suggested that the weight of the thyroid of normal Japanese is about 19 g for adult male and about 17 g for adult female, and that the iodine content is 12-22 mg and iodine uptake rate (f sub(w)) is about 0.2. (auth.)

  12. Dissociation of molecular iodine in RF discharge for oxygen-iodine laser

    Czech Academy of Sciences Publication Activity Database

    Jirásek, Vít; Schmiedberger, Josef; Čenský, Miroslav; Kodymová, Jarmila

    2012-01-01

    Roč. 66, č. 4 (2012), 1-6 ISSN 1434-6060 R&D Projects: GA ČR GA202/09/0310 Grant - others:European Office for Aerospace R&D(XE) FA8655-09-1-3092 Institutional research plan: CEZ:AV0Z10100523 Keywords : molecular iodine * RF discharge * dissociation * oxygen-iodine laser * COIL Subject RIV: BH - Optics, Masers, Lasers Impact factor: 1.513, year: 2012

  13. Effectiveness and risks of stable iodine prophylaxis

    International Nuclear Information System (INIS)

    Waight, P.J.

    1995-01-01

    The factors upon which the efficacy of stable iodine prophylaxis depends are reviewed, with particular reference to the dose of stable iodine, the timing of the dose, the influence of dietary iodine and the impact of the other prospective actions. The risks of stable iodine ingestion are estimated, and their application to the principle of Justification in outlined. (Author)

  14. Aged anthropogenic iodine in a boreal peat bog

    International Nuclear Information System (INIS)

    Maillant, S.; Sheppard, M.I.; Denys, S.; Leclerc Cessac, E.

    2004-01-01

    Iodine-129 is a radionuclide of major concern in the international safety assessments for deep geological storage and disposal of nuclear waste because it migrates quickly through the geosphere to the biosphere and then from the soil to humans through the food-chain. However, in organic soils the 129 I may be immobilized over a long time period, and so these soils represent a potential accumulation point in the biosphere. Effects of long residence times of iodine in soils are scarce. The present paper gives some insight on the aging of stable iodine, under natural conditions. Stable iodine was introduced as KI in 1987 at the base of a small natural sphagnum bog to simulate arrival of iodine via a groundwater discharge from the geosphere. Previous data revealed the spread of the iodine outwards spatially from the basal spike and also recorded its rise towards the bog surface. Fifteen years later, the groundwater, the soil and the vegetation have been sampled and analyzed for iodine. The results we will present give insight on the mobility of 'aged' iodine with time, the retention properties of the peat, and provide iodine transfer factors for native boreal plant species. The data show iodine: - continues to slowly spread from the spike after 15 years, - is more strongly retained on the solid phase at the surface than at depth, - the chemical structure of the peat may influence the retention of iodine as shown by NMR analysis, - iodine retention has become greater with time, and - herbaceous species are the greatest accumulators. This study demonstrates bogs present good sinks for iodine and limit the transfer of iodine to some of the 'wildlife' food-chains. (author)

  15. Iodine Contents in Baby Food Consumed in Japan

    Directory of Open Access Journals (Sweden)

    Yoshida M.

    2013-04-01

    Full Text Available To evaluate iodine intake in Japanese infants, iodine contents were determined in both commercial and homemade baby food samples consumed in Japan. Fifty-three samples of commercial bottled or retort baby food and 25 samples of homemade baby food for one day were collected and their iodine contents were determined by inductively coupled plasma mass spectrometry after an extraction with 0.5% tetramethylammonium hydroxide. Among the commercial baby food samples, 35 samples showed low iodine values ( 1000 ng/g wet weight. Significantly higher iodine values were observed in 15 samples composed of dishes cooked using kombu (a kind of kelp than other samples. Among the homemade baby food samples, 12 samples brought very low iodine intake (< 1- 24 μg/d, while 5 samples brought very high iodine intake (283-978 μg/d. These results indicate that intermittent high iodine baby food including dishes cooked using kombu contributes to sufficient iodine intake in Japanese infants.

  16. An assessment of the iodine status and the correlation between iodine nutrition and thyroid function during pregnancy in an iodine sufficient area.

    Science.gov (United States)

    Amouzegar, A; Khazan, M; Hedayati, M; Azizi, F

    2014-03-01

    Iodine as a micronutrient is mandatory for thyroid hormone production and inadequate iodine intakes during pregnancy may result in varying degrees of hypothyroidism affecting pregnancy outcomes adversely. The aim of this study was to evaluate nutritional status and its effects on thyroid function in pregnant women during all trimesters of pregnancy. In this cohort study, we assessed a total of 203 pregnant women in the first trimester of pregnancy and followed them in the second and third trimesters. They were divided into two groups, group I with urinary iodine excretion (UIE) pregnancy, respectively; UIEpregnancy, respectively. The median (range) of TSH was 1.7 (0.9-2.7) mIU/l, 1.9(1.2-2.7) mIU/l and 1.8 (1.1-2.8) mIU/l in the three trimesters of pregnancy, respectively. There was no correlation between UIE, TSH, TT4, FT4I, T3 and TPOAb in the first and second trimesters, but there was a weak correlation between UIE, TSH, T3 and TgAb in the third trimester. In our cohort of pregnant women the iodine intakes were sufficient, and no correlation between urinary iodine concentration and thyroid function tests was found.

  17. The Impact of Carrot Enriched in Iodine through Soil Fertilization on Iodine Concentration and Selected Biochemical Parameters in Wistar Rats

    Science.gov (United States)

    Piątkowska, Ewa; Kopeć, Aneta; Bieżanowska-Kopeć, Renata; Pysz, Mirosław; Kapusta-Duch, Joanna; Koronowicz, Aneta Agnieszka; Smoleń, Sylwester; Skoczylas, Łukasz; Ledwożyw-Smoleń, Iwona; Rakoczy, Roksana; Maślak, Edyta

    2016-01-01

    Iodine is one of the trace elements which are essential for mammalian life. The major objective of iodine biofortification of plants is to obtain food rich in this trace element, which may increase its consumption by various populations. Additionally, it may reduce the risk of iodine deficiency diseases. In this research for the first time we have assessed the bioavailability of iodine from raw or cooked carrot biofortified with this trace element on iodine concentration in selected tissues and various biochemical parameters as well as mRNA expression of some genes involved in iodine metabolism in Wistar rats. Statistically, a significantly higher iodine level was determined in urine, faeces and selected tissues of rats fed a diet containing biofortified raw carrot as compared to a diet without iodine and a diet containing control cooked carrot. Biofortified raw carrot significantly increased triiodothyronine concentration as compared to animals from other experimental groups. The highest thyroid stimulating hormone level was determined in rats fed control cooked carrots. mRNA expression of selected genes was affected by different dietary treatment in rats’ hearts. Biofortified raw and cooked carrot could be taken into account as a potential source of iodine in daily diets to prevent iodine deficiency in various populations. PMID:27043135

  18. Criteria for safe working with iodine-125

    International Nuclear Information System (INIS)

    Linsley, G.S.

    1977-01-01

    Radio-immunoassay and other saturation assay tests involving the use of iodine-125 are finding wide application for the determination of hormone concentrations in biological fluids. In such tests, iodinations involving concentrations of a milli-curie per micro-litre are common. Iodine-125 presents a problem from the monitoring standpoint because of its low energy photon emission (27 and 35 keV). Iodine is preferentially taken up by the thyroid gland and work involving moderate amounts of radio-iodine may give rise to a significant hazard in an accident situation. The general precautions which should be taken in work with unsealed radioactive substances are briefly summarized, working limits for iodine-125 are identified, and methods of personal protection and monitoring in an emergency situation described. (author)

  19. The placenta as a compensatory iodine storage organ.

    LENUS (Irish Health Repository)

    Burns, Robert

    2011-05-01

    The production of iodine-containing thyroid hormones necessary for brain development in the fetus depends not only on maternal dietary intake but also on placental iodine transport. The optimum level of iodine nutrition during pregnancy and the proportion of the pregnant population reaching this level have previously been evaluated. Little information exists on the ability of the placenta to either accumulate or store iodine. This study aims to investigate iodine uptake and tissue iodine content within placental tissue obtained from women delivering at term.

  20. Hygienic assessment of radioactive iodine isotopes

    International Nuclear Information System (INIS)

    Vasilenko, I.Ya.

    1987-01-01

    Sources of radioactive iodine isotopes and their biological significance depending on the way of intake are discussed. The degree of food contamination by radioactive iodine as well as products, which serve as the source of its intake into the human body, and results of their processing are considered. The danger of radioactive iodine intake by different groups of population as well as thyroid irradiation effects are discussed. Description of activities, directed to the human body protection against radioactive iodine and assessment of these protection measures efficiency is presented

  1. Iodine

    Science.gov (United States)

    ... leg ulcers and reduce the chance of a future infection. Conjunctivitis (pinkeye). Research suggests that using eye ... National Institute of Medicine has set Adequate Intake (AI) of iodine for infants: 0 to 6 months, ...

  2. Generation of atomic iodine via fluorine for chemical oxygen-iodine laser

    Czech Academy of Sciences Publication Activity Database

    Jirásek, Vít; Špalek, Otomar; Čenský, Miroslav; Picková, Irena; Kodymová, Jarmila; Jakubec, Ivo

    2007-01-01

    Roč. 334, - (2007), s. 167-174 ISSN 0301-0104 R&D Projects: GA ČR GA202/05/0359 Grant - others:USAF European Office for Research and Development(XE) FA 8655-05-M-4027 Institutional research plan: CEZ:AV0Z10100523; CEZ:AV0Z40320502 Keywords : atomic iodine * atomic fluorine * chemical oxygen-iodine laser Subject RIV: BH - Optics, Masers, Lasers Impact factor: 1.805, year: 2007

  3. Experimental and analytical studies of iodine mass transfer from xenon-iodine mixed gas bubble to liquid sodium pool

    International Nuclear Information System (INIS)

    Miyahara, S.; Sagawa, N.; Shimoyama, K.

    1996-01-01

    In the fuel pin failure accident of a liquid metal fast reactor, volatile fission products play an important role in the assessment of radiological consequences. Especially the radioisotopes of elemental iodine are important because of their high volatility and of the low permissible dose to human thyroid. The released iodines are known to be retained in the coolant sodium as sodium iodide due to the chemical affinity between alkali metals and halogens. However, the xenon and krypton released with iodines into the sodium pool as bubbles may influence the reaction rate of iodine with sodium during the bubble rising. So far, the only few experimental results have been available concerning the decontamination factor (DF: the ratio of the initial iodine mass in the mixed gas bubble to the released mass into the cover gas) of iodine in this phenomenon. Therefore, experimental and analytical studies were carried out to study the mass transfer of iodine from a xenon-iodine mixed gas bubble to the liquid sodium pool. In the experiments, the bubble was generated in the sodium pool by cracking a quartz ball which contains the xenon-iodine mixed gas and then, the mixed gas released into the argon cover gas was collected to determine the transferred iodine mass into the pool. A rising velocity of the bubble was measured by Chen-type void sensors arranged vertically in the pool. From the measured rising velocity and another observation of bubble behavior in simulated water experiments, it is found that the generated bubble breaks up into several smaller bubbles of spherical cap type during the rising period. Transferred iodine mass per unit initial bubble volume from the bubble to the sodium pool shows increases with increasing time and the initial iodine concentration. A mass transfer rate obtained by differentiating the transferred iodine mass with respect to the time indicates a rapid decrease just after the bubble generation and a slow decrease for the successive period

  4. A Review: Radiographic Iodinated Contrast Media-Induced Thyroid Dysfunction

    Science.gov (United States)

    Leung, Angela M.; Braverman, Lewis E.; Brent, Gregory A.; Pearce, Elizabeth N.

    2015-01-01

    Context: Thyroid hormone production is dependent on adequate iodine intake. Excess iodine is generally well-tolerated, but thyroid dysfunction can occur in susceptible individuals after excess iodine exposure. Radiological iodinated contrast media represent an increasingly common source of excess iodine. Objective: This review will discuss the thyroidal response after acute exposure to excess iodine; contrast iodine-induced thyroid dysfunction; risks of iodine-induced thyroid dysfunction in vulnerable populations, such as the fetus, neonate, and patients with impaired renal function; and recommendations for the assessment and treatment of contrast iodine-induced thyroid dysfunction. Methods: Data for this review were identified by searching PubMed, Google Scholar, and references from relevant articles from 1948 to 2014. Conclusions: With the increase in the use of computed tomography scans in the United States, there is increasing risk of contrast-induced thyroid dysfunction. Patients at risk of developing iodine-induced thyroid dysfunction should be closely monitored after receiving iodinated contrast media and should be treated as needed. PMID:25375985

  5. Iodine nutritional status in Asturian schoolchildren.

    Science.gov (United States)

    Riestra Fernández, María; Menéndez Torre, Edelmiro; Díaz Cadórniga, Francisco; Fernández Fernández, Juan Carlos; Delgado Álvarez, Elías

    2017-11-01

    Iodine deficiency is a public health problem, and iodine nutritional status should therefore be regularly measured. To ascertain iodine nutritional status in Asturias and its relation to use of iodized salt and to other sociodemographic and nutritional parameters. A descriptive, observational study was conducted in a random sample of schoolchildren aged 5 to 14 years, in whom urinary iodine levels were measured by high-performance liquid chromatography. Families completed a survey on use of iodized salt, consumption of dairy products and fish, and sociodemographic data. The study sample consisted of 705 schoolchildren (51.1% females) with a mean age of 9.9 years (SD 2.6). In a total of 620 valid measurements, mean urinary iodine level was 204.1 μg/L (SD 120.6), while the median value was 180.7 μg/L (P 25 -P 75 : 124-252.3 μg/L, interquartile range 128.3 μg/L). Urinary iodine levels were y SED. Publicado por Elsevier España, S.L.U. All rights reserved.

  6. Milk Iodine Content in Slovakia

    Directory of Open Access Journals (Sweden)

    I. Paulíková

    2008-01-01

    Full Text Available The aim of this work was to map actual iodine status and its seasonal differences in raw milk of dairy cows, sheep, and goats in various regions of Slovakia. Iodine concentrations were determined in 457 samples of raw milk from dairy cows, 78 samples of sheep, and 16 samples of goat milk collected in various regions of Slovakia from 2002 to 2007. Among all the 457 samples of bovine milk, iodine content below 50 μg l-1 was recorded in 114 samples (24.94%; 294 samples (64.33% ranged between 50 and 200 μg l-1; 19 samples (4.16% from 200 to 500 μg l-1; 17 samples (3.72% between 500 and 1 000 μg l-1, and 13 samples (2.85% showed iodine concentrations over 1 000 μg l-1. regional concentrations showed the highest values in the Western, then Middle and Eastern Slovakia, and the lowest values in Northern Slovakia (p p -1 in 49 sheep (62.8% and in 6 goats below 60 μg l-1 (37.5%, which are indicative of iodine deficiency. When comparing seasonal differences, sheep and goat milk had higher iodine content during the winter feeding period, however, in dairy cows we recorded the opposite ratio. Except for goat milk (p < 0.01 the seasonal differences were not significant.

  7. Global iodine nutrition: Where do we stand in 2013?

    Science.gov (United States)

    Pearce, Elizabeth N; Andersson, Maria; Zimmermann, Michael B

    2013-05-01

    Dietary iodine intake is required for the production of thyroid hormone. Consequences of iodine deficiency include goiter, intellectual impairments, growth retardation, neonatal hypothyroidism, and increased pregnancy loss and infant mortality. In 1990, the United Nations World Summit for Children established the goal of eliminating iodine deficiency worldwide. Considerable progress has since been achieved, largely through programs of universal salt iodization. Approximately 70% of all households worldwide currently have access to adequately iodized salt. In 2013, as defined by a national or subnational median urinary iodine concentration of 100-299 μg/L in school-aged children, 111 countries have sufficient iodine intake. Thirty countries remain iodine-deficient; 9 are moderately deficient, 21 are mildly deficient, and none are currently considered severely iodine-deficient. Ten countries have excessive iodine intake. In North America, both the United States and Canada are generally iodine-sufficient, although recent data suggest pregnant U.S. women are mildly iodine-deficient. Emerging issues include discrepancies between urinary iodine status in pregnant women compared to school-aged children in some populations, the problem of re-emerging iodine deficiency in parts of the developed world, the importance of food industry use of iodized salt, regions of iodine excess, and the potential effects of initiatives to lower population sodium consumption on iodine intake. Although substantial progress has been made over the last several decades, iodine deficiency remains a significant health problem worldwide and affects both industrialized and developing nations. The ongoing monitoring of population iodine status remains crucially important, and particular attention may need to be paid to monitoring the status of vulnerable populations, such as pregnant women and infants. There is also need for ongoing monitoring of iodized salt and other dietary iodine sources in

  8. The retention of iodine by iodine filters in nuclear power plants in the case of fire

    International Nuclear Information System (INIS)

    Giraud, V.

    1985-01-01

    Due to the liberation of considerable amounts of gaseous combustion products, fires in nuclear power plants may lead to a deterioration in the retention of radioiodine by iodine filters. The combustion products of the burnable materials, i.e., insulations, lubricants and paints, vary considerably with the development of the fire. Combustion product analyses of these materials have been performed only to a limited extent. The reaction of iodine with combustion products as well as the retention of the resulting iodine reaction products by sorbents have not yet been investigated. The reduction in the removal efficiencies of iodine sorbents due to the presence of combustion products is unknown. (orig.) [de

  9. Radioactive Iodine (I-131) Therapy for Hyperthyroidism

    Science.gov (United States)

    ... Physician Resources Professions Site Index A-Z Radioactive Iodine (I-131) Therapy Radioiodine therapy is a nuclear ... thyroid cancer. When a small dose of radioactive iodine I-131 (an isotope of iodine that emits ...

  10. Mission and System Advantages of Iodine Hall Thrusters

    Science.gov (United States)

    Dankanich, John W.; Szabo, James; Pote, Bruce; Oleson, Steve; Kamhawi, Hani

    2014-01-01

    The exploration of alternative propellants for Hall thrusters continues to be of interest to the community. Investments have been made and continue for the maturation of iodine based Hall thrusters. Iodine testing has shown comparable performance to xenon. However, iodine has a higher storage density and resulting higher ?V capability for volume constrained systems. Iodine's vapor pressure is low enough to permit low-pressure storage, but high enough to minimize potential adverse spacecraft-thruster interactions. The low vapor pressure also means that iodine does not condense inside the thruster at ordinary operating temperatures. Iodine is safe, it stores at sub-atmospheric pressure, and can be stored unregulated for years on end; whether on the ground or on orbit. Iodine fills a niche for both low power (10kW) electric propulsion regimes. A range of missions have been evaluated for direct comparison of Iodine and Xenon options. The results show advantages of iodine Hall systems for both small and microsatellite application and for very large exploration class missions.

  11. The behaviour of iodine in the terrestrial environment

    International Nuclear Information System (INIS)

    Christiansen, J.V.

    1990-02-01

    Literature on the geochemistry of iodine is surveyed, focusing on fundamental chemical aspects which influence the migration behaviour of iodine in the terrestrial environment. It is stated that the organic fraction in soil plays the predominant role in the retention of iodine. Simple aromatic molecules serve as simple models for humic acid, and humic acid is iodinated catalyzed by haloperoxidases. The enzymatically controlled iodination of humic acid is described in detail and it is demonstrated that the results may reflect a kind of equilibrium. It is shown that soil extracts are able to catalyze the iodination of humic acid and it is suggested that extracellular peroxidases in soil are reponsible for the reaction. The enzymatically controlled iodination of humic acid is discussed and some considerations about the influence on the migration of iodine in the terrestrial environment are given. (author) 4 tabs., 26 ills., 82 refs

  12. Contrast induced hyperthyroidism due to iodine excess

    OpenAIRE

    Mushtaq, Usman; Price, Timothy; Laddipeerla, Narsing; Townsend, Amanda; Broadbridge, Vy

    2009-01-01

    Iodine induced hyperthyroidism is a thyrotoxic condition caused by exposure to excessive iodine. Historically this type of hyperthyroidism has been described in areas of iodine deficiency. With advances in medicine, iodine induced hyperthyroidism has been observed following the use of drugs containing iodine—for example, amiodarone, and contrast agents used in radiological imaging. In elderly patients it is frequently difficult to diagnose and control contrast related hyperthyroidism, as most...

  13. The effect of radioactive iodine treatment in well differentiated thyroid carcinoma with lymphnode metastasis

    International Nuclear Information System (INIS)

    Liou, M. J.; Lin, J. D.; Chao, T. C.; Wen, H. F.; Ho, Y. S.

    1994-01-01

    Background: To exam the effect of radioactive iodine treatment for thyroid remnant ablation and/or distant metastasis. A total of 134 well-differentiated thyroid cancer patients with cervical lymphnode metastasis at the time of diagnosis were retrospectively reviewed at Chang Gung Medical Center in Taiwan from 1977 to 1995. Methods: Among them, 126 cases were papillary carcinomas and 8 cases were follicular carcinomas. The mean age was 37.0 ± 14.6 years old. After the operation, 127 (95 %) patients received 131 I treatment (mean dose: 146.6 ± 109.5 mCi, range 30 - 550 mCi) and long-term follow-up. The mean follow-up period is 5.9 ± 3.9 yrs. All patients were restage at the end of 1995. Clinical biochemical results were also analyzed. Results: Among 127 cases who received postoperative radioactive iodine treatment, the majority of cases (92.5 % in papillary ca. vs. 57.1 % in follicular ca.) improved to stage I, 11 (8.6 %) cases remained on the same disease and stages. 13 cases (10.2 %, 10 papillary and 3 follicular) deteriorated to stage III or IV. However, in the non-treatment group, only 33.3 % of papillary carcinoma patients improved to stage I and 16.7 % of the patients remained as stage II. There were 5 cases (3.7 %) of mortality. Two cases with stage IV papillary carcinomas died of metastatic or recurrent malignancy, and the other 2 cases with stage I or III papillary carcinomas died of tracheal cancer or valvular heart disease. One patient with stage IV follicular carcinoma died of cerebral vascular accident. Conclusions: Radioactive iodine ( 131 I) treatment plays a significant role in the management of well-differentiated thyroid carcinoma patients with cervical lymphnode metastasis. The effect of postoperative 131 I treatment on papillary carcinoma was better than that on follicular carcinoma. The optimal dosage and frequency of radioactive iodine treatment warrant further study. (author)

  14. Maternal urinary iodine concentration in pregnancy and children's cognition: results from a population-based birth cohort in an iodine-sufficient area

    NARCIS (Netherlands)

    Ghassabian, A.; Steenweg- de Graaff, J.; Peeters, R.P.; Ross, H.A.; Jaddoe, V.W.; Hofman, A.; Verhulst, F.C.; White, T.; Tiemeier, H.

    2014-01-01

    OBJECTIVE: Reports from populations with an insufficient iodine intake suggest that children of mothers with mild iodine deficiency during pregnancy are at risk for cognitive impairments. However, it is unknown whether, even in iodine-sufficient areas, low levels of iodine intake occur that

  15. IODINE CONTENT OF ENTERAL AND PARENTERAL NUTRITION SOLUTIONS.

    Science.gov (United States)

    Willard, Devina L; Young, Lorraine S; He, Xuemei; Braverman, Lewis E; Pearce, Elizabeth N

    2017-07-01

    Iodine is essential for thyroid hormone synthesis, and iodine deficiency may result in thyroid disorders including goiter and hypothyroidism. Patients on long-term enteral nutrition (EN) or parenteral nutrition (PN) may be at risk for micronutrient deficiencies. The recommended daily allowance for iodine intake is 150 μg for nonpregnant adults. However, there is no current consensus among scientific societies regarding the quantity of iodine to be added in adult EN and PN formulations. The objective of this study was to determine the iodine content of U.S. adult enteral and parenteral nutrition solutions. This study also aimed to determine whether adult patients in the United States who are receiving long-term artificial nutrition may be at risk for iodine deficiency. Ten enteral nutrition solutions and 4 parenteral nutrition solutions were evaluated. The iodine contents of these solutions were measured spectrophotometrically and compared to the labeled contents. Measured and labeled EN iodine contents were similar (range 131-176 μg/L and 106-160 μg/L, respectively). In contrast, PN formulas were found to contain small, unlabeled amounts of iodine, averaging 27 μg/L. Typical fluid requirements are 30 to 40 mL/kg/day for adults receiving either total EN (TEN) or total PN (TPN). Adults on long-term TEN likely consume enough servings to meet their daily iodine requirements. However, patients on long-term TPN would require on average 5.6 L PN/day to meet the recommended daily allowance of iodine. This volume of PN is far in excess of typical consumption. Thus, U.S. patients requiring long-term TPN may be at risk for iodine deficiency. EN = enteral nutrition; PN = parenteral nutrition; TEN = total enteral nutrition; TPN = total parenteral nutrition; UIC = urinary iodine concentration.

  16. Current iodine nutrition status and progress toward elimination of iodine deficiency disorders in Jazan, Saudi Arabia

    Directory of Open Access Journals (Sweden)

    Alsanosy Rashad Mohammed

    2012-11-01

    Full Text Available Abstract Background The term iodine deficiency disorders (IDD refers to all the effects of iodine deficiency on growth and development in human and animal populations that can be prevented by correction of the iodine deficiency. The objective of this paper was to determine the iodine nutrition status among schoolchildren in the Jazan Region of the Kingdom of Saudi Arabia (KSA, by measuring urinary iodine concentrations and by clinical assessments of goiter rate. Methods A school-based cross-sectional survey was conducted in the Jazan region of southwestern KSA from May to November 2010. A total of 311 children, aged 6–13 years, drawn from 12 schools, were selected by a three-stage cluster random sampling method. Data on sociodemographic characteristics were collected using a structured questionnaire. Urine samples were collected and physical examinations were conducted to determine the presence or absence of goiter. Data were analyzed using SPSS version 17.0. Chi square and independent t-tests were used for proportions and mean comparisons between groups. Results Out of 360 selected children, 311 were examined. There were 131 males (42% and 180 females (58%. The median urinary iodine concentration (UIC of the study group was 421 μg/L. The study population proportion with UIC > 300 μg/L was 74% with a higher proportion among males and urban populations. The proportion of children with UIC of 100–300 μg/L was only 21% and was significantly higher among females compared with males (p Conclusions The present study demonstrates a remarkable achievement in Universal Salt Iodization (USI and IDD elimination goals in the Jazan area. However, UIC levels reflect excessive iodine intake and may put the population at risk of adverse health consequences like iodine-induced hyperthyroidism and autoimmune thyroid diseases.

  17. Consensus statement on iodine deficiency disorders in Hong Kong.

    Science.gov (United States)

    But, Betty; Chan, C W; Chan, Fredriech; Chan, K W; Cheng, Anna W F; Cheung, Patrick; Choi, K L; Chow, C B; Chow, Francis C C; Eastman, Creswell; Fok, T F; Fung, L M; Gomes, Cynthia; Huen, K F; Ip, T P; Kung, Annie W C; Lam, Karen S L; Lam, Y Y; Lao, Terence; Lee, C Y; Lee, K F; Leung, Jenny; Leung, N K; Li, Dominic; Li, June; Lo, K W; Lo, Louis; Ng, K L; Siu, S C; Tam, Sidney; Tan, Kathryn C B; Tiu, S C; Tse, H Y; Tse, Winnie; Wong, Gary; Wong, Shell; Wong, William; Yeung, Vincent T F; Young, Rosie; Yu, C M; Yu, Richard

    2003-12-01

    This article reviews the available data on the study of iodine deficiency disorders in Hong Kong and to discuss the approach towards preventing such disorders in Hong Kong. The importance of iodine and iodine deficiency disorders is described, and the available data on the dietary iodine intake and urinary iodine concentration in different populations of Hong Kong are summarised and discussed. Dietary iodine insufficiency among pregnant women in Hong Kong is associated with maternal goitrogenesis and hypothyroxinaemia as well as neonatal hypothyroidism. Borderline iodine deficiency exists in the expectant mothers in Hong Kong. Women of reproductive age, and pregnant and lactating women should be made aware and educated to have an adequate iodine intake, such as iodised salt, as an interim measure. A steering group involving all stakeholders should be formed to advise on the strategy of ensuring adequate iodine intake, including universal iodisation of salt in Hong Kong. Continuous surveillance of iodine status in the Hong Kong population is necessary.

  18. Systematic review using meta-analyses to estimate dose-response relationships between iodine intake and biomarkers of iodine status in different population groups.

    Science.gov (United States)

    Ristić-Medić, Danijela; Dullemeijer, Carla; Tepsić, Jasna; Petrović-Oggiano, Gordana; Popović, Tamara; Arsić, Aleksandra; Glibetić, Marija; Souverein, Olga W; Collings, Rachel; Cavelaars, Adriënne; de Groot, Lisette; van't Veer, Pieter; Gurinović, Mirjana

    2014-03-01

    The objective of this systematic review was to identify studies investigating iodine intake and biomarkers of iodine status, to assess the data of the selected studies, and to estimate dose-response relationships using meta-analysis. All randomized controlled trials, prospective cohort studies, nested case-control studies, and cross-sectional studies that supplied or measured dietary iodine and measured iodine biomarkers were included. The overall pooled regression coefficient (β) and the standard error of β were calculated by random-effects meta-analysis on a double-log scale, using the calculated intake-status regression coefficient (β) for each individual study. The results of pooled randomized controlled trials indicated that the doubling of dietary iodine intake increased urinary iodine concentrations by 14% in children and adolescents, by 57% in adults and the elderly, and by 81% in pregnant women. The dose-response relationship between iodine intake and biomarkers of iodine status indicated a 12% decrease in thyroid-stimulating hormone and a 31% decrease in thyroglobulin in pregnant women. The model of dose-response quantification used to describe the relationship between iodine intake and biomarkers of iodine status may be useful for providing complementary evidence to support recommendations for iodine intake in different population groups.

  19. Total iodine quantification in fluids and tissues from iodine- or iodide-supplemented rats by ion chromatography following microwave-assisted digestion.

    Science.gov (United States)

    Delgado, Guadalupe; Muñoz-Torres, Carolina; Orozco-Esquivel, Teresa; Anguiano, Brenda; Aceves, Carmen

    2015-03-01

    Iodine is a crucial component of thyroid hormones, and several reports have shown that iodine per se is implicated in the physiopathology of other organs. Innovative ion chromatography detection following a four-step temperature ramp microwave digestion in 25-50 mM nitric acid was developed to measure total iodine in biological fluids and tissue samples from female Sprague-Dawley rats supplemented with 0.05% molecular iodine (I2) or 0.05% potassium iodide (I(-)) in drinking water. The reported method allows the measurement of total iodine with a limit of quantification of 13.7 μg L(-1), recoveries of 96.3-100.3%, and intra- and inter-assay variations, of 3.5% and 7.4% respectively. Analysis of biological fluids showed that after 48 hours, iodine-supplemented animals exhibited significantly higher levels of total iodine in both serum and urine compared with those supplemented with iodide. The half-life of iodine in serum and urine measured over the first 48 h showed similar patterns for both the I2 (7.89 and 7.76 hours) and I(-) (8.27 and 8.90 hours) supplements. Differential uptake patterns were observed in tissues after 6 days of supplements, with I(-) preferentially retained by thyroid, lactating mammary gland, and milk, and a slightly but significantly higher capture of I2 in pituitary, ovary, and virgin mammary gland. We developed a rapid, selective, and accurate digestion method to process fluid and tissue samples that permits reproducible measurements of total iodine by ion chromatography; iodine or iodide supplement show a similar serum and urine half-life, but organ-specific uptake depends on the chemical form of the iodine supplement.

  20. A model to secure a stable iodine concentration in milk

    Directory of Open Access Journals (Sweden)

    Gisken Trøan

    2015-12-01

    Full Text Available Background: Dairy products account for approximately 60% of the iodine intake in the Norwegian population. The iodine concentration in cow's milk varies considerably, depending on feeding practices, season, and amount of iodine and rapeseed products in cow fodder. The variation in iodine in milk affects the risk of iodine deficiency or excess in the population. Objective: The first goal of this study was to develop a model to predict the iodine concentration in milk based on the concentration of iodine and rapeseed or glucosinolate in feed, as a tool to securing stable iodine concentration in milk. A second aim was to estimate the impact of different iodine levels in milk on iodine nutrition in the Norwegian population. Design: Two models were developed on the basis of results from eight published and two unpublished studies from the past 20 years. The models were based on different iodine concentrations in the fodder combined with either glucosinolate (Model 1 or rapeseed cake/meal (Model 2. To illustrate the impact of different iodine concentrations in milk on iodine intake, we simulated the iodine contribution from dairy products in different population groups based on food intake data in the most recent dietary surveys in Norway. Results: The models developed could predict iodine concentration in milk. Cross-validation showed good fit and confirmed the explanatory power of the models. Our calculations showed that dairy products with current iodine level in milk (200 µg/kg cover 68, 49, 108 and 56% of the daily iodine requirements for men, women, 2-year-old children, and pregnant women, respectively. Conclusions: Securing a stable level of iodine in milk by adjusting iodine concentration in different cow feeds is thus important for preventing excess intake in small children and iodine deficiency in pregnant and non-pregnant women.

  1. MARGINAL IODINE DEFICIENCY EXACERBATES PERCHLORATE THYROID TOXICITY.

    Science.gov (United States)

    The environmental contaminant perchlorate disrupts thyroid homeostasis via inhibition of iodine uptake into the thyroid. This work tested whether iodine deficiency exacerbates the effects of perchlorate. Female 27 day-old LE rats were fed a custom iodine deficient diet with 0, 50...

  2. Iodine isotopes and radiation safety

    International Nuclear Information System (INIS)

    Styro, B.; Nedvekajte, T.; Filistovich, V.

    1992-01-01

    Methods of concentration determination of stable and radioactive iodine isotopes in the Earth's different geospheres are described. Iodine isotopes concentration data, chemical forms and transformations as well as their exchange among separate geospheres of their global biochemical circulation (ocean, atmosphere, lithosphere and biosphere) are presented. Information on iodine isotopes as after-effects of nuclear installations accident (in particular, the Chernobyl accident) is generalized. The book is intended for scientists and practical workers in ecology and radioactivity protection and for a students of physics. 442 refs.; 82 figs.; 36 tabs

  3. Application of radiopharmaceuticals in iodine disorder studies

    International Nuclear Information System (INIS)

    Rajurkar, N.S.

    2015-01-01

    Iodine is an essential trace element and is of much interest in nutritional research. It is essential for the production of the hormones in the thyroid gland. However, deficiency or excess of iodine can cause disorders, commonly known as iodine disorders. Total quantity of iodine present in the body is 15-20 mg, mostly in thyroid gland and the safe and adequate intake of iodine is in the range of 50-200 μg.d -1 . Most of the iodine taken from food is accumulated in thyroid glands which plays a vital role in the well being as it controls growth and metabolism. In some people gland becomes over active (hyper thyroiditis) and in some people gland becomes sluggish (hypo thyroiditis). However, both the conditions are unhealthy and lead to serious consequences. The condition can be detected and treated with the help of radioiodine

  4. WHO's new recommendations about iodine prophylaxis at nuclear catastrophes

    International Nuclear Information System (INIS)

    Paile, Wendla

    1999-01-01

    WHO has prepared new advice about using stable iodine as protection against emission of radioactive iodine from nuclear catastrophes. The experiences from Chernobyl show that the risk for thyroid gland cancer after emission of radio-iodine is significant. The risk of serious side effects of stable iodine as single dose is stated to be minimal. Stable iodine is a safe, effective remedy for protecting the thyroid gland against radioactive iodine. It is recommended to adjust different criteria for iodine prophylaxis for new-born, children, young people and adults older than 40 years. For children of the age up to 18 years iodine prophylaxis should be considered at 10 mGy thyroid gland doses, and for young adults at 100 mGy. For adults of 40 years or more the cancer risk of radioactive iodine is very low and iodine prophylaxis is unnecessary provided that the expected does not exceed 5 Gy. The new information about risk and advantage must be considered in planning for distribution and storage of stable iodine. WHO also commends that everybody has the possibility to buy it in a pharmacy. (EHS)

  5. The distribution and transformations of iodine in the environment

    International Nuclear Information System (INIS)

    Whitehead, D.C.

    1984-01-01

    Iodine in the atmosphere is derived largely from seawater. It is probable that the biological production of methyl iodide is important in this transfer. Subsequent photolytic dissociation and oxidation of the methyl iodide, together with other inputs, with partial sorption of the products by aerosols, results in the atmospheric iodine being distributed between various gaseous and particulate forms. Atmospheric iodine is the major source of the iodine in soils, and the process of enrichment continues throughout soil formation and development until ultimately an equilibrium concentration is attained. The atmosphere is also a direct source of iodine for plants, and in some situations may be more important than the soil. Iodine may be lost from soils by leaching, volatilization, and removal in crops. The amounts of iodine reported in groundwaters, and in rivers and lakes remote from human activity, suggest that some leaching of iodine is widespread. Increased amounts of iodine occur in rivers receiving effluent from sewage works. Milk and milk products are now major dietary sources of iodine because their content is often increased by concentrate feedingstuffs supplemented with iodine and/or by the use in dairies of iodophor detergents and sterilants. (author)

  6. Overview of the ACEX project iodine work

    Energy Technology Data Exchange (ETDEWEB)

    Merilo, M

    1996-12-01

    The ACEX project is an internationally sponsored research program that focuses on several aspects of severe accidents. The areas addressed are iodine behavior in containments, pool scrubbing, molten corium concrete interactions, and ex-vessel core debris coolability. These areas all represent extensions to the previous and current ACE and MACE programs respectively. The ACE-Phase B (iodine) project, and other recent research efforts, have clarified the roles of the important phenomena that influence iodine volatility in reactor containments during severe accidents. The ACE Iodine Chemistry Subcommittee concluded that even though enough data has been generated to support reasonably good quantification of the important phenomena, a few important areas remain where quantification is still uncertain. This is due to a lack of agreement on how to utilize the existing database, as well as the possible absence of critical test and/or property data. Technical resolution of the overall iodine behavior issue is therefore not feasible until these uncertainties are fully assessed and practical solutions have been identified, implemented, and verified. The overall objectives of the ACEX iodine research program are to ensure that the iodine database can be used to predict the airborne concentration of iodine, the conditions for iodine reservoir stability, and to provide a mechanistic understanding for these phenomena. The first phase of this work involves a comprehensive review and interpretation of the existing database in order to formulate practical strategies for dealing with significant uncertainties and/or deficiencies. Several projects are underway involving the effects of organic reactions and structural surface interactions. In addition effort is being expended on standardizing the aqueous iodine kinetics database, specifying useful mass transfer models, and defining methodology for pH prediction. (Abstract Truncated)

  7. Content iodine in sauces of type emulsion

    Directory of Open Access Journals (Sweden)

    M. Bakirov

    2015-05-01

    Full Text Available Introduction. The scarcity of natural resources arouse a necessity to find additional sources of protein, fat, carbohydrates, and their complexes with scarce mineral compounds. Therefore, a relevant issue is to enrich the diets deficient iodine compounds through research and development of new food products. Materials and methods. Investigation of iodine content in emulsion-type sauces at all stages was performed using Xray -fluorescence analyzer «Elvax». X-ray -fluorescence method consists of the appearance characteristic X-radiation of atoms of a chemical element at infringement they the primary X-ray irradiation. Results and discussion. Investigated for the determination of organic and inorganic forms of iodine in content of food items, and installed the total loss of iodine in sauces after cooking and storage at +5 ... +10 ° C for 30 days. Using iodine-proteinaceous additive from 0.5 ... 2.5% by mass of iodine 0.01% can be achieved from 15 to 50% of the human daily requirement by iodine. The resulting product does not lose its organoleptic, physico - chemical, consumer characteristics and meets the requirements of normative documents. As a result of our research, it was found that the addition of the supplements enriched protein-mineral (SEPM in composition sauces does not adversely affect the physical -chemical characteristics of sauces, but due to the stabilizing effect of additives iodine-proteinaceous increased emulsion stability up to 98 - 100% without additional foo d additives (emulsifiers. This additive has passed a series of tests that indicate on compliance with requirements normative and technical documentation. Conclusions. Used methodical approach allowed us to estimate the level of organic and inorganic iodine, as well as describe in more detail and correctly interpret the chemical composition of foods fortified with iodine and predict their health properties.

  8. Overview of the ACEX project iodine work

    International Nuclear Information System (INIS)

    Merilo, M.

    1996-01-01

    The ACEX project is an internationally sponsored research program that focuses on several aspects of severe accidents. The areas addressed are iodine behavior in containments, pool scrubbing, molten corium concrete interactions, and ex-vessel core debris coolability. These areas all represent extensions to the previous and current ACE and MACE programs respectively. The ACE-Phase B (iodine) project, and other recent research efforts, have clarified the roles of the important phenomena that influence iodine volatility in reactor containments during severe accidents. The ACE Iodine Chemistry Subcommittee concluded that even though enough data has been generated to support reasonably good quantification of the important phenomena, a few important areas remain where quantification is still uncertain. This is due to a lack of agreement on how to utilize the existing database, as well as the possible absence of critical test and/or property data. Technical resolution of the overall iodine behavior issue is therefore not feasible until these uncertainties are fully assessed and practical solutions have been identified, implemented, and verified. The overall objectives of the ACEX iodine research program are to ensure that the iodine database can be used to predict the airborne concentration of iodine, the conditions for iodine reservoir stability, and to provide a mechanistic understanding for these phenomena. The first phase of this work involves a comprehensive review and interpretation of the existing database in order to formulate practical strategies for dealing with significant uncertainties and/or deficiencies. Several projects are underway involving the effects of organic reactions and structural surface interactions. In addition effort is being expended on standardizing the aqueous iodine kinetics database, specifying useful mass transfer models, and defining methodology for pH prediction. The results of this work are expected to identify where additional data

  9. Industrial system for producing iodine-123

    International Nuclear Information System (INIS)

    Brantley, J.C.

    1985-01-01

    An industrial system to produce iodine-123 required a complex set of steps involving new approaches by the Food and Drug Administration, difficult distribution procedures, and evidence from potential users that either very pure iodine-123 or inexpensive iodine-123 is needed. Industry has shown its willingness to invest in new radionuclides but needs strong evidence as to product potential to justify those investments

  10. Development of Databases on Iodine in Foods and Dietary Supplements

    Science.gov (United States)

    Ershow, Abby G.; Skeaff, Sheila A.; Merkel, Joyce M.; Pehrsson, Pamela R.

    2018-01-01

    Iodine is an essential micronutrient required for normal growth and neurodevelopment; thus, an adequate intake of iodine is particularly important for pregnant and lactating women, and throughout childhood. Low levels of iodine in the soil and groundwater are common in many parts of the world, often leading to diets that are low in iodine. Widespread salt iodization has eradicated severe iodine deficiency, but mild-to-moderate deficiency is still prevalent even in many developed countries. To understand patterns of iodine intake and to develop strategies for improving intake, it is important to characterize all sources of dietary iodine, and national databases on the iodine content of major dietary contributors (including foods, beverages, water, salts, and supplements) provide a key information resource. This paper discusses the importance of well-constructed databases on the iodine content of foods, beverages, and dietary supplements; the availability of iodine databases worldwide; and factors related to variability in iodine content that should be considered when developing such databases. We also describe current efforts in iodine database development in the United States, the use of iodine composition data to develop food fortification policies in New Zealand, and how iodine content databases might be used when considering the iodine intake and status of individuals and populations. PMID:29342090

  11. Dry method for recycling iodine-loaded silver zeolite

    International Nuclear Information System (INIS)

    Thomas, T.R.; Staples, B.A.; Murphy, L.P.

    1978-01-01

    Fission product iodine is removed from a waste gas stream and stored by passing the gas stream through a bed of silver-exchanged zeolite until the zeolite is loaded with iodine, passing dry hydrogen gas through the bed to remove the iodine and regenerate the bed, and passing the hydrogen stream containing the hydrogen iodide thus formed through a lead-exchanged zeolite which absorbs the radioactive iodine from the gas stream and permanently storing the lead-exchanged zeolite loaded with radioactive iodine

  12. Quantitative method for determination of body inorganic iodine

    International Nuclear Information System (INIS)

    Filatov, A.A.; Tatsievskij, V.A.

    1991-01-01

    An original method of quantitation of body inorganic iodine, based upon a simultaneous administration of a known dose of stable and radioactive iodine with subsequent radiometry of the thyroid was proposed. The calculation is based upon the principle of the dilution of radiactive iodine in human inorganic iodine space. The method permits quantitation of the amount of inorganic iodine with regard to individual features of inorganic space. The method is characterized by simplicity and is not invasive for a patient

  13. The Role of Circulating MicroRNA-126 (miR-126: A Novel Biomarker for Screening Prediabetes and Newly Diagnosed Type 2 Diabetes Mellitus

    Directory of Open Access Journals (Sweden)

    Yang Liu

    2014-06-01

    Full Text Available Recent studies suggested an association of endothelial microRNA-126 (miR-126 with type 2 diabetes mellitus (T2DM. In the current study, we examined whether circulating miR-126 is associated with T2DM and pre-diabetic syndrome. The study included 82 subjects with impaired glucose tolerance (IGT, 75 subjects with impaired fasting glucose (IFG, 160 patients with newly diagnosed T2DM, and 138 healthy individuals. Quantitative polymerase chain reaction (qPCR was used to examine serum miR-126. Serum miR-126 was significantly lower in IGT/IFG subjects and T2DM patients than in healthy controls (p < 0.05. After six months of treatment (diet control and exercise in IGT/IFG subjects, insulin plus diet control and exercise in T2DM patients, serum miR-126 increased significantly (p < 0.05. An analysis based on serum miR-126 in the sample revealed a significantly higher odds ratio (OR for the subjects with the lowest 1/3 of serum miR-126 for T2DM (OR: 3.500, 95% confidence interval: 1.901–6.445, p < 0.05 than subjects within the highest 1/3 of serum miR-126. Such an association was still apparent after adjusting for other major risk factors. The area under the curve (AUC for the receiver-operating characteristic (ROC analysis was 0.792 (95% confidence interval: 0.707–0.877, p < 0.001. These results encourage the use of serum miR-126 as a biomarker for pre-diabetes and diabetes mellitus, as well as therapeutic response.

  14. Iodine in eggs in an iodopenic region

    International Nuclear Information System (INIS)

    Bogdanov, Bogdan; Gonev, Mihail; Tadzher, Isak S.

    1996-01-01

    Macedonia is a region with a recognized precarious iodine balance, due to iodine deficiency in almost all water sources. Five percent iodine intake through eggs in the daily diet of adults is significant in this balance. The content of 40-220 micro g I - /kg eggs is lower than the British one (average 340-370 micro g I - /kg). The amount per egg is 3-6 micro g I' far less than 711 micro g I - in special iodine-enriched eggs designed for treatment of thyroid and metabolic disorders by feeding chickens with kelp additives. The iodine content of our manufacturers, provides substantial part of former Yugoslavia with eggs, is entirely dependent on imported fishmeal in chicken feed. (Author)

  15. Iodine excretion in school children in Copenhagen

    DEFF Research Database (Denmark)

    Rasmussen, Lone B; Kirkegaard-Klitbo, Ditte Marie; Laurberg, Peter

    2016-01-01

    INTRODUCTION: Studies of dietary habits show a high iodine intake in children in Denmark. Iodine excretion in children has not previously been assessed. Iodine excretion in adults is below the recommended threshold, and it is therefore being discussed to increase the fortification level. The main...

  16. The role of circulating microRNA-126 (miR-126): a novel biomarker for screening prediabetes and newly diagnosed type 2 diabetes mellitus.

    Science.gov (United States)

    Liu, Yang; Gao, Guangqiang; Yang, Chun; Zhou, Kun; Shen, Baozhong; Liang, Hongyan; Jiang, Xiaofeng

    2014-06-12

    Recent studies suggested an association of endothelial microRNA-126 (miR-126) with type 2 diabetes mellitus (T2DM). In the current study, we examined whether circulating miR-126 is associated with T2DM and pre-diabetic syndrome. The study included 82 subjects with impaired glucose tolerance (IGT), 75 subjects with impaired fasting glucose (IFG), 160 patients with newly diagnosed T2DM, and 138 healthy individuals. Quantitative polymerase chain reaction (qPCR) was used to examine serum miR-126. Serum miR-126 was significantly lower in IGT/IFG subjects and T2DM patients than in healthy controls (pdiet control and exercise in IGT/IFG subjects, insulin plus diet control and exercise in T2DM patients), serum miR-126 increased significantly (pdiabetes and diabetes mellitus, as well as therapeutic response.

  17. Simulation of ISTP-EPICUR Iodine Chemistry Tests with RAIM

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Han-Chul; Cho, Yeong-Hun; Jang, Dong-Ju; Ryu, Myung-Hyun [Nuclear Korea Institute of Nuclear Safety, Daejeon (Korea, Republic of)

    2014-10-15

    The amount of iodine release largely depends on its volatility in the containment. Iodine has several chemical forms including aerosols, vapor, and gas. Among them gaseous iodine such as I{sub 2} and organic iodide are dominating due to their high volatility. Therefore, such iodine behavior has been extensively examined. Korea Institute of Nuclear Safety (KINS) has been joining the relevant international programs such as ISTP-EPICUR, OECD-BIP and OECD-STEM. In the course of this study, a simple iodine model, RAIM (Radio-Active Iodine chemistry Model) has been developed, based on the IMOD methodology and other previous studies. This model deals with chemical reactions associated with formation and destruction of iodine species in the containment atmosphere and the sump in a simple manner, as shown in Fig. 1. It also treats adsorption and desorption of volatile iodine on the paint surface. The iodine species modeled are inorganic volatile iodine, organic iodides of high volatility (HVRI) and low volatility (LVRI), non-volatiles, non-aqueous iodine, and iodine oxide aerosols (IO{sub x}). Many other material participating in the iodine reactions, e.g., air radiolysis products (ARP) such as ozone, are also modeled. This paper especially shows the analysis results after addition of gaseous reaction model to RAIM, which was further accompanied by adjustments of the existing reaction rate constants even for the aqueous reactions. After integration of iodine reaction models for gas and aqueous phase, RAIM was applied the S1-9 and S1-11 tests which were carried out in aqueous phase. In addition, re-analysis of the S2-6-5-2 test, for which iodine-loaded coupons were tested in gas phase, was also performed.

  18. Leak test method and test device for iodine filter

    International Nuclear Information System (INIS)

    Fukasawa, Tetsuo; Funabashi, Kiyomi; Miura, Noboru; Miura, Eiichi.

    1995-01-01

    An air introduction device which can change a humidity is disposed upstream of an iodine filter to be tested, and a humidity measuring device is disposed downstream of the iodine filter respectively. At first, dried air reduced with humidity is flown from the air introduction device to the iodine filter, to remove moisture content from an iodine adsorber in the iodine filter. Next, air at an increased humidity is supplied to the iodine filter. The difference between the time starting the supply of the highly humid air and the time detecting the high humidity at the humidity measuring device is measured. When the time difference is smaller than the time difference measured previously in a normal iodine filter, it shows the presence of leak in the iodine filter to be tested. With such procedures, leakage in the iodine filter which removes radioactive iodine from off-gases discharged from the radioactive material handling facilities can be detected easily by using water (steams), namely, a naturally present material. (I.N.)

  19. Iodine supply in diet in various european regions and risks of iodine prophylaxis

    International Nuclear Information System (INIS)

    Dumont, J.E.

    1991-01-01

    The main risk of low level irradiation of the thyroid is the induction of thyroid neoplasia. In the case of nuclear accidents this risk depends on the level of radioiodine uptake and half life in the thyroid, on the size of the gland and on the relative biological efficiency of the emitted radiation especially at low doses. The level of radioiodine uptake is inversely related to stable iodine supply in the diet. In this study it was proposed to: 1. systematically survey iodine supply in the diet, radioiodine uptake and thyroid kinetics in various European regions. Most of these data are readily available. Taken together with presently accepted estimates of relative biological efficiency, the radiation doses at various contamination levels and risks could be computed and tabulated as an easy-to-use basis for decision guidelines. 2. to obtain in vitro from human autopsy material, radioiodine kinetics data in fetal thyroid to complement data in vivo in a model animal close to man (the chimpanzee) at various dietary iodine levels. Urinary iodine excretions vary in Europe from one region to another from 16 to 250 ug/day. The full spectrum from severe iodine deficiency to normal dietary intake exists in Europe. It is therefore quite to be expected that 24h thyroid radioiodine uptakes vary from 19 to 83%. Therefore for a similar radioiodide contamination the thyroid exposure will vary from one region to another by a factor of 4

  20. Nutritional status of iodine in pregnant women in Catalonia (Spain): study on hygiene-dietetic habits and iodine in urine.

    Science.gov (United States)

    Prieto, Gemma; Torres, Maria Teresa; Francés, Lidia; Falguera, Gemma; Vila, Lluis; Manresa, Josep María; Casamitjana, Roser; Barrada, Juan Ramón; Acera, Amèlia; Guix, Dolors; Torrent, Anna; Grau, Josep; Torán, Pere

    2011-03-08

    It is a priority to achieve an adequate nutritional status of iodine during pregnancy since iodine deficiency in this population may have repercussions on the mother during both gestation and post partum as well as on the foetus, the neonate and the child at different ages. According to the WHO, iodine deficiency is the most frequent cause of mental retardation and irrreversible cerebral lesions around the world. However, few studies have been published on the nutritional status of iodine in the pregnant population within the Primary Care setting, a health care level which plays an essential role in the education and control of pregnant women. Therefore, the aim of the present study is: 1.- To know the hygiene-dietetic habits related to the intake of foods rich in iodine and smoking during pregnancy. 2.- To determine the prevalence of iodine deficiency and the factors associated with its appearance during pregnancy. We will perform a cluster randomised, controlled, multicentre trial. Randomisation unit: Primary Care Team. 898 pregnant women over the age of 17 years attending consultation to a midwife during the first trimester of pregnancy in the participating primary care centres. consumption of iodine-rich foods and iodine deficiency. Points of assessment: each trimester of the gestation. group education during the first trimester of gestation on healthy hygiene-dietetic habits and the importance of an adequate iodine nutritional status. descriptive analysis of all variables will be performed as well as multilevel logistic regression. All analyses will be done carried out on an intention to treat basis and will be fitted for potential confounding factors and variables of clinical importance. Evidence of generalised iodine deficiency during pregnancy could lead to the promotion of interventions of prevention such as how to improve and intensify health care educational programmes for pregnant women. ClinicalTrials.gov: NCT01301768.

  1. Determination of iodine and iodine compounds in marine samples by ICPMS and HPLC-ICPMS

    DEFF Research Database (Denmark)

    Hansen, Maiken Sødergreen; Lewandowski, Daniel Jacob; Rasmussen, Rie Romme

    2014-01-01

    seaweed and fish, which contain elevated levels of iodine (fish typically 1-10 mg/kg and seaweed up to 8000 mg/kg). These marine food items may contain different iodine species, which may have different bioavailability and toxicity, and hence there is an increased interest in developing analytical methods...

  2. Iodinated Contrast Media and the Alleged "Iodine Allergy": An Inexact Diagnosis Leading to Inferior Radiologic Management and Adverse Drug Reactions.

    Science.gov (United States)

    Böhm, Ingrid; Nairz, Knud; Morelli, John N; Keller, Patricia Silva Hasembank; Heverhagen, Johannes T

    2017-04-01

    Purpose  To test the hypothesis that the incomplete diagnosis "iodine allergy" is a possibly dangerous concept for patients under routine radiologic conditions. Materials and Methods  300 patients with a history of an "iodine allergy" were retrospectively screened and compared with two age-, sex-, and procedure-matched groups of patients either diagnosed with a nonspecific "iodine contrast medium (ICM) allergy" or an allergy to a specific ICM agent. For all groups, the clinical symptoms of the most recent past adverse drug reaction (ADR), prophylactic actions taken for subsequent imaging, and ultimate outcome were recorded and analyzed. Results  The diagnosis "iodine allergy" was not otherwise specified in 84.3 % patients. For this group, in most cases, the symptoms of the previous ADRs were not documented. In contrast, the type of ADR was undocumented in only a minority of patients in the comparison groups. In the group of patients with an "iodine allergy" the percentage of unenhanced CT scans was greater than within the other two groups (36.7 % vs. 28.7 %/18.6 %). ADRs following prophylactic measures were only observed in the "iodine allergy" group (OR of 9.24 95 % CI 1.16 - 73.45; p contrast media containing covalently bound iodine.. · There is a clear correlation between the exactness of the diagnosis - from the alleged "iodine allergy" to "contrast media allergy" to naming the exact culprit CM - and the quality of documentation of the symptoms.. · Management of patients diagnosed with "iodine allergy" was associated with uncertainty leading to unenhanced scans and sometimes unnecessary prophylactic actions.. · The term "iodine allergy" should be omitted, because it is potentially dangerous and can decrease the quality of radiology exams.. Citation Format · Böhm Ingrid, Nairz Knud, Morelli John N et al. Iodinated Contrast Media and the Alleged "Iodine Allergy": An Inexact Diagnosis Leading to Inferior Radiologic Management and

  3. Geographical distribution of drinking-water with high iodine level and association between high iodine level in drinking-water and goitre: a Chinese national investigation.

    Science.gov (United States)

    Shen, Hongmei; Liu, Shoujun; Sun, Dianjun; Zhang, Shubin; Su, Xiaohui; Shen, Yanfeng; Han, Hepeng

    2011-07-01

    Excessive iodine intake can cause thyroid function disorders as can be caused by iodine deficiency. There are many people residing in areas with high iodine levels in drinking-water in China. The main aim of the present study was to map the geographical distribution of drinking-water with high iodine level in China and to determine the relationship between high iodine level in drinking-water and goitre prevalence. Iodine in drinking-water was measured in 1978 towns of eleven provinces in China, with a total of 28,857 water samples. We randomly selected children of 8-10 years old, examined the presence of goitre and measured their urinary iodine in 299 towns of nine provinces. Of the 1978 towns studied, 488 had iodine levels between 150 and 300 μg/l in drinking-water, and in 246 towns, the iodine level was >300 μg/l. These towns are mainly distributed along the original Yellow River flood areas, the second largest river in China. Of the 56 751 children examined, goitre prevalence was 6.3 % in the areas with drinking-water iodine levels of 150-300 μg/l and 11.0 % in the areas with drinking-water iodine >300 μg/l. Goitre prevalence increased with water and urinary iodine levels. For children with urinary iodine >1500 μg/l, goitre prevalence was 3.69 times higher than that for those with urinary iodine levels of 100-199 μg/l. The present study suggests that drinking-water with high iodine levels is distributed in eleven provinces of China. Goitre becomes more prevalent with the increase in iodine level in drinking-water. Therefore, it becomes important to prevent goitre through stopping the provision of iodised salt and providing normal drinking-water iodine through pipelines in these areas in China.

  4. Treatment of hyperthyroidism with radioactive iodine

    International Nuclear Information System (INIS)

    Bell, R.L.

    1974-01-01

    While radioactive iodine is clearly the therapy of choice for Graves' disease (even in younger patients) the use of radioactive iodine for therapy of the toxic multinodular or uninodular goiter presents an entirely different problem. Although these two entities can be treated with radioactive iodine provided there is some suppression of the tissue that is not autonomous, transient release of thyroid hormone may induce symptoms of thyroid storm in the very large multinodular toxic goiter treated with radioiodine therapy. These toxic nodules generally require much larger doses of radioiodine than is commonly used for classical Graves' disease and may either require fractional administration of radioisotopes or concomitant use of antithyroid drugs and iodides. In general, surgery remains the treatment of choice for large toxic multinodular goiters, after proper preparation by medical means including radioactive iodine. Radioactive iodine therapy for hyperthyroidism is contraindicated in pregnancy and generally is not used in children below five years of age. (U.S.)

  5. Mandatory iodine fortification of bread and salt increases iodine excretion in adults in Denmark - A 11-year follow-up study

    DEFF Research Database (Denmark)

    Rasmussen, Lone Banke; Jørgensen, Torben; Perrild, Hans

    2014-01-01

    intake (diet plus supplements) had increased by 16 (-18-48) μg/day. Iodine excretion had increased significantly in all age and gender groups, but was still below the recommended amount at follow-up. The increase in iodine excretion was positively associated with changes in milk intake, with changes...... in the use of iodine supplements, and with bread intake at follow-up. Salt intake, education, self-rated health, smoking, alcohol intake and physical activity were not associated with the increase in iodine excretion. Conclusions: The strategy to combat iodine deficiency in Denmark seems to be working...

  6. Assessment of iodine status in children, adults, pregnant women and lactating women in iodine-replete areas of China.

    Directory of Open Access Journals (Sweden)

    Fangang Meng

    Full Text Available BACKGROUND: Iodine deficiency disorders (IDD are widespread in China. Presently, IDD have been put under control by Universal Salt Iodisation (USI in China; however, there is a lack of evidence on whether the iodine status in adults, pregnant women and lactating women is optimal. This study was therefore conducted to assess the iodine nutrition and thyroid function of children, adults, pregnant women and lactating women residing in areas where the USI program is fully established. DESIGN: Six areas were selected according to the geographical regions in China. In each of these areas, we selected 4 distinct groups of subjects (children, adults, pregnant women and lactating women in regions where the coverage rate of iodised salt was more than 95% and the levels of iodine and fluoride in drinking water were less than or equal to 10 µg/L and 1 mg/L, respectively. We tested the iodine content of salt, urinary iodine (UI, free thyroxin (FT4, thyrotropin (TSH, thyroglobulin (Tg, thyroglobulin antibody (Tg-Ab and antimicrosomal antibody (TM-Ab in the 4 groups, and examined the thyroid volume in children. RESULTS: The median urinary iodine (MUI concentrations were 271.4 μg/L, 260.2 μg/L, 205.9 μg/L and 193.9 μg/L in children, adults, pregnant women and lactating women, respectively; MUI in children and adults were more than adequate. The goitre prevalence (GP in children was 6.70%. The odds ratios (OR of subclinical hypothyroidism in the Tg-Ab- or TM-Ab-positive groups were 3.80, 7.65, 2.01 and 7.47 for children, adults, pregnant women and lactating women, respectively, compared with the negative groups. CONCLUSIONS: The iodine status in children and adults is above the requirement, we should reduce their iodine intake. Subclinical hypothyroidism easily occurs in the Tg-Ab or TM-Ab positive groups.

  7. 22 CFR 126.9 - Advisory opinions and related authorizations.

    Science.gov (United States)

    2010-04-01

    .... 126.9 Section 126.9 Foreign Relations DEPARTMENT OF STATE INTERNATIONAL TRAFFIC IN ARMS REGULATIONS GENERAL POLICIES AND PROVISIONS § 126.9 Advisory opinions and related authorizations. (a) Advisory opinion. Any person desiring information as to whether the Directorate of Defense Trade Controls would be...

  8. Management modes for iodine-129

    International Nuclear Information System (INIS)

    White, I.F.; Smith, G.M.

    1984-01-01

    This study completes a two-stage programme, supported by the Commission of the European Communities, on management modes for iodine-129. The models for the radiological assessment of iodine-129 management modes have been reviewed and, where necessary, revised, and a generic radiological assessment has been carried out using these models. Cost benefit analysis has been demonstrated for a variety of iodine-129 management modes; for a wide range of assumptions, the costs of abatement of atmospheric discharges would be outweighed by the radiological benefits. The cost benefit analysis thus complements and confirms the preliminary conclusion of the previous study: iodine-129 should be trapped to a large extent from the off-gases of a large reprocessing plant and disposed of by other suitable means, in order to ensure that all exposures from this radionuclide are as low as reasonably achievable. Once the major fraction of the iodine-129 throughput of a reprocessing plant has been trapped from the dissolver off-gases, there are unlikely to be strong radiation protection incentives either for further trapping from the dissolver off-gases or for trapping from the vessel off-gases. In a generic study it is not possible to state an optimum choice of process(es) for abatement of atmospheric discharges of iodine-129. This choice must be determined by assessments in the specific context of a particular reprocessing plant, its site, the waste disposal routes that are actually available, and also in the wider context of the management plans for all radioactive wastes at the plant in question

  9. Iodine and microbial interactions in an organic soil

    International Nuclear Information System (INIS)

    Sheppard, M.I.; Hawkins, J.L.

    1995-01-01

    Iodine-129 in groundwater discharging from a geological disposal vault could accumulate in wetlands by chemical sorption onto low pH, highly organic solid surfaces or by direct or indirect microbial processes. Previous work indicated that saturation of anion sorption sites, microbial toxicity, or swamping of the I reduction/oxidation reaction decreased the retention of a wetland sphagnum for iodine with increased iodine porewater concentrations. Bog water and peat of an iodine-rich bog were studied to elucidate the role of micro-organisms in the retention and accumulation of iodine in a temperate wetland. (author)

  10. Absorption spectrum of Iodine around 5915 A

    International Nuclear Information System (INIS)

    1990-01-01

    The iodine absorption spectrum around 5915 A is of interest for many authors especially the hyperfine structure of the iodine line. Lodine absorption spectrum was obtained due to the interaction of iodine vapour with dye laser [(R6G) (0.5A) scanning range around 5915 A] which is pumped by(Ar + )laser absorption spectrum. The decrease in the peak of the transmission line around 5915 A shows the signal futher decreased by heating the iodine cell. This analysis has been done using a monochromator

  11. 7 CFR 959.126 - Handling of culls.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Handling of culls. 959.126 Section 959.126 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements...) Handled for canning or freezing. (b) As a safeguard against culls entering fresh market channels each...

  12. Effects of elevated iodine in milk replacer on calf performance.

    Science.gov (United States)

    Jenkins, K J; Hidiroglou, M

    1990-03-01

    Calves were fed milk replacer containing .57, 10, 50, 100, or 200 ppm iodine (from ethylenediaminedihydroiodide) in DM, from 3 to 38 d of age, to estimate the minimum toxic concentration of iodine. Only the 200 ppm iodine intake reduced weight gains, DM intake, feed efficiency, and DM digestibility. At the 100 and 200 ppm iodine intakes, protein digestibility was reduced, and calves showed typical symptoms of iodine toxicity (nasal discharge, excessive tear and saliva formation, and coughing from tracheal congestion). Thyroid iodine increased with every elevation in iodine intake. Iodine in plasma, bile, and non-thyroid tissues started to increase at the 50 ppm intake and, except for muscle, tended to increase again at the 100 and 200 ppm intakes. Thus, the preruminant calf tolerated up to 50 ppm iodine in milk replacer DM for 5 wk postpartum. However, as iodine concentrations in plasma and nonthyroid tissues started to increase at 50 ppm iodine, an upper limit of 10 ppm would be more preferable.

  13. Excessive iodine intake does not increase the recurrence rate of graves' disease after withdrawal of the antithyroid drug in an iodine-replete area.

    Science.gov (United States)

    Park, Sun Mi; Cho, Yoon Young; Joung, Ji Young; Sohn, Seo Young; Kim, Sun Wook; Chung, Jae Hoon

    2015-03-01

    The relationship between iodine intake and effects of antithyroid drugs (ATD) for Graves' disease, especially in iodine-deficient areas, has been demonstrated in many studies. However, it was not clear how chronic high iodine intake influenced the effectiveness of ATD in an iodine-replete area. This study aimed to clarify the effect of iodine intake on clinical outcomes of Graves' disease after discontinuation of ATD in Korea, an iodine-replete area. A total of 142 patients with Graves' disease who visited the outpatient clinic regularly and stopped their ATD between October 2011 and April 2013 were enrolled in our study. Urinary iodine concentration (UIC) was measured just before and after the discontinuation of ATD. Median UIC was not significantly different between the remission and relapse groups, as well as among the four treatment groups (group 1, remission after initial treatment; group 2, remission after repeated treatment; group 3, early relapse within a year; group 4, late relapse after a year). Remission rates did not show a significant difference between the excessive iodine intake (UIC ≥300 μg/l) and average iodine intake groups (UIC Graves' disease in an iodine-replete area, and therefore diet control with iodine restriction might not be necessary in the management of Graves' disease.

  14. 21 CFR 520.1157 - Iodinated casein tablets.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Iodinated casein tablets. 520.1157 Section 520...) ANIMAL DRUGS, FEEDS, AND RELATED PRODUCTS ORAL DOSAGE FORM NEW ANIMAL DRUGS § 520.1157 Iodinated casein tablets. (a) Specifications. Each 1-gram tablet contains 25 milligrams of iodinated casein. (b) Sponsor...

  15. Iodine and creatinine testing in urine dried on filter paper

    Energy Technology Data Exchange (ETDEWEB)

    Zava, Theodore T., E-mail: ttzava@zrtlab.com [ZRT Laboratory, 8605 SW Creekside Place, Beaverton, OR 97008 (United States); Kapur, Sonia, E-mail: soniak@zrtlab.com [ZRT Laboratory, 8605 SW Creekside Place, Beaverton, OR 97008 (United States); Zava, David T., E-mail: dzava@zrtlab.com [ZRT Laboratory, 8605 SW Creekside Place, Beaverton, OR 97008 (United States)

    2013-02-18

    Highlights: ► Dried urine iodine and creatinine extract quantitatively correlates well with liquid urine. ► Filter paper strips can be easily shipped and stored. ► Urine iodine and creatinine are stable at ambient temperature when dried on filter paper. ► Dried urine iodine and creatinine are run using a 96-well format. -- Abstract: Iodine deficiency is a world-wide health problem. A simple, convenient, and inexpensive method to monitor urine iodine levels would have enormous benefit in determining an individual's recent iodine intake or in identifying populations at risk for iodine deficiency or excess. Current methods used to monitor iodine levels require collection of a large volume of urine and its transport to a testing laboratory, both of which are inconvenient and impractical in parts of the world lacking refrigerated storage and transportation. To circumvent these limitations we developed and validated methods to collect and measure iodine and creatinine in urine dried on filter paper strips. We tested liquid urine and liquid-extracted dried urine for iodine and creatinine in a 96-well format using Sandell–Kolthoff and Jaffe reactions, respectively. Our modified dried urine iodine and creatinine assays correlated well with established liquid urine methods (iodine: R{sup 2} = 0.9483; creatinine: R{sup 2} = 0.9782). Results demonstrate that the dried urine iodine and creatinine assays are ideal for testing the iodine status of individuals and for wide scale application in iodine screening programs.

  16. Iodine and creatinine testing in urine dried on filter paper

    International Nuclear Information System (INIS)

    Zava, Theodore T.; Kapur, Sonia; Zava, David T.

    2013-01-01

    Highlights: ► Dried urine iodine and creatinine extract quantitatively correlates well with liquid urine. ► Filter paper strips can be easily shipped and stored. ► Urine iodine and creatinine are stable at ambient temperature when dried on filter paper. ► Dried urine iodine and creatinine are run using a 96-well format. -- Abstract: Iodine deficiency is a world-wide health problem. A simple, convenient, and inexpensive method to monitor urine iodine levels would have enormous benefit in determining an individual's recent iodine intake or in identifying populations at risk for iodine deficiency or excess. Current methods used to monitor iodine levels require collection of a large volume of urine and its transport to a testing laboratory, both of which are inconvenient and impractical in parts of the world lacking refrigerated storage and transportation. To circumvent these limitations we developed and validated methods to collect and measure iodine and creatinine in urine dried on filter paper strips. We tested liquid urine and liquid-extracted dried urine for iodine and creatinine in a 96-well format using Sandell–Kolthoff and Jaffe reactions, respectively. Our modified dried urine iodine and creatinine assays correlated well with established liquid urine methods (iodine: R 2 = 0.9483; creatinine: R 2 = 0.9782). Results demonstrate that the dried urine iodine and creatinine assays are ideal for testing the iodine status of individuals and for wide scale application in iodine screening programs

  17. An assessment of iodine in cheese in Macedonia

    International Nuclear Information System (INIS)

    Bogdanov, Bogdan; Gonev, Mihail; Tadzher, Isak S.

    1998-01-01

    We assessed some products in Macedonian food containing iodine: milk, bread, eggs, iodized salt. These nutritional items are deficient in iodine compared to western technology of,food preparation. Cheese prepared as white cheese from sheep and cow's milk is a much-used nutritional product. According to the Central Macedonian Statistical Bureau at the. Ministry of Health the laboratory measured iodine dosage in order to have an estimation of what the contribution of cheese is in the daily Macedonian diet. The collection of cheese was independently performed by the food inspectors in all regions of Macedonia. In June 1998 all specimens were in the laboratory. Macedonian white cheese has 57 micro g/dl iodine. In comparison to other nutritional items as milk, eggs and bread with a low contingent of iodine, the Macedonian cheese covers a good part of daily iodine necessity. We present our results with a brief comment on iodine metabolism. (Original)

  18. [Application of iodine metabolism analysis methods in thyroid diseases].

    Science.gov (United States)

    Han, Jian-hua; Qiu, Ling

    2013-08-01

    The main physiological role of iodine in the body is to synthesize thyroid hormone. Both iodine deficiency and iodine excess can lead to severe thyroid diseases. While its role in thyroid diseases has increasingly been recognized, few relevant platforms and techniques for iodine detection have been available in China. This paper summarizes the advantages and disadvantages of currently iodine detection methods including direct titration, arsenic cerium catalytic spectrophotometry, chromatography with pulsed amperometry, colorimetry based on automatic biochemistry, inductively coupled plasma mass spectrometry, so as to optimize the iodine nutrition for patients with thyroid diseases.

  19. [Changes of iodine nutrition status and thyroid function among pregnant women in iodine sufficient rural area of Gansu province].

    Science.gov (United States)

    Wang, Yanling; Sun, Wei; Zhu, Xiaonan; Cao, Yongqin; Ge, Pengfei

    2014-01-01

    To assess the iodine nutrition and thyroid function of pregnant women during different periods of pregnancy, to provide evidence for guiding iodine supplementation for them. A cross-sectional survey was performed in 215 pregnant women in Yongjing couty from May to June 2013. Samples of blood and random urine were collected, and serum thyrotrophin (TSH), free triiodothyronine (FT3), free thyroxine (FT4), anti-thyroid peroxidase (anti-TPO), antithyroglobulin ( anti-TG)and urinary iodine were measured. The medians of urinary iodine from the three groups of pregnant women(first, second and third trimester) were 189.8 µg/L, 152.5 µg/L and 144.9 µg/L respectively. With the exception of pregnant women in the third trimester, the urinary iodine medians of pregnant women in the first and second trimesters were within the 150-249 µg/L range which was defined as optimal by WHO/UNICEF/ICCIDD. With the increase of gestational age, the level of FT3 decreased (P iodine TSH levels and the gestational age. The medians of anti-TG and anti-TPO appeared the lowest in the first trimester, and remained at a high level in women at second and third trimesters. Significant difference was seen in anti-TG, anti-TPO levels of the three groups of pregnant women (first, second and third trimester) (P iodine levels were not obvious. With the increase of gestational age, the incidence of iodine deficiency also increased among pregnant women. Abnormal thyroid hormones, TSH, positive anti-TG and anti-TPO were mainly existed in the early pregnancy. Programs as monitoring urinary iodine as well as thyroid function targeting all the pregnant women should be carried out.

  20. Determination of iodine to compliment mass spectrometric measurements

    International Nuclear Information System (INIS)

    Hohorst, F.A.

    1994-11-01

    The dose of iodine-129 to facility personnel and the general public as a result of past, present, and future activities at DOE sites is of continuing interest, WINCO received about 160 samples annually in a variety of natural matrices, including snow, milk, thyroid tissue, and sagebrush, in which iodine-129 is determined in order to evaluate this dose, Currently, total iodine and the isotopic ratio of iodine-127 to iodine-129 are determined by mass spectrometry. These two measurements determine the concentration of iodine-129 in each sample, These measurements require at least 16 h of mass spectrometer operator time for each sample. A variety of methods are available which concentrate and determine small quantities of iodine. Although useful, these approaches would increase both time and cost. The objective of this effort was to determine total iodine by an alternative method in order to decrease the load on mass spectrometry by 25 to 50%. The preparation of each sample for mass spectrometric analysis involves a common step--collection of iodide on an ion exchange bed. This was the focal point of the effort since the results would be applicable to all samples

  1. Iodine Status and Goiter Prevalence in Nizhegorodsky Region

    Directory of Open Access Journals (Sweden)

    Yu I Tarasov

    2005-03-01

    Full Text Available The undertaken study was to evaluate the severity of iodine deficiency and to establish the prevalence of goiter in the city of Nizhny Novgorod and in 35 districts of Nizhegorodsky region. 1868 children aged 8—11 years were examined. The median of urinary iodine concentration was measured, and the size of the thyroid was determined by palpation and by ultrasound study. Among all the examinees, the detection rate of the goiter was 19.4% (as evidenced by palpation and the median of urinary iodine concentration was 45.05 μg/l. The findings indicate natural iodine deficiency on the whole territory studied with severity variations from mild to moderate, and the disparity in goiter rate and iodine excretion level in some districts of Nizhegorodsky region. Cluster analysis and automatic classification of the districts based on goiter prevalence and urinary iodine parameters may be useful for a comprehensive assessment of iodine status in the whole region. Analyzing the pattern of the spread of goiter has demonstrated the role of geochemical, social and medical factors existing in the region. Key words: iodine deficiency, goiter, population based stady, thyroid.

  2. Iodine metabolism and food needs

    International Nuclear Information System (INIS)

    Mornex, R.

    1992-01-01

    Iodine is an element that is necessary for the growth and mental development of a child and for the maintenance of the activity of all cells at all ages. In this article, the author recalls the iodine sources, its metabolism and the food needs and contributions

  3. Suboptimal Iodine Status among Pregnant Women in the Oslo Area, Norway.

    Science.gov (United States)

    Henjum, Sigrun; Aakre, Inger; Lilleengen, Anne Marie; Garnweidner-Holme, Lisa; Borthne, Sandra; Pajalic, Zada; Blix, Ellen; Gjengedal, Elin Lovise Folven; Brantsæter, Anne Lise

    2018-02-28

    Norway has been considered iodine replete for decades; however, recent studies indicate reemergence of inadequate iodine status in different population groups. We assessed iodine status in pregnant women based on urinary iodine concentration (UIC), urinary iodine excretion (UIE), and iodine intake from food and supplements. In 804 pregnant women, 24-h iodine intakes from iodine-rich foods and iodine-containing supplements were calculated. In 777 women, iodine concentration was measured in spot urine samples by inductively coupled plasma/mass spectrometry (ICP-MS). In addition, 49 of the women collected a 24-h urine sample for assessment of UIE and iodine intake from food frequency questionnaire (FFQ). Median UIC was 92 µg/L. Fifty-five percent had a calculated iodine intake below estimated average requirement (EAR) (160 µg/day). Iodine intake from food alone did not provide the amount of iodine required to meet maternal and fetal needs during pregnancy. In multiple regression models, hypothyroidism, supplemental iodine and maternal age were positively associated with UIC, while gestational age and smoking were negatively associated, explaining 11% of the variance. This study clearly shows that pregnant women in the Oslo area are mild to moderate iodine deficient and public health strategies are needed to improve and secure adequate iodine status.

  4. 9 CFR 354.126 - Carcasses held for further examination.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Carcasses held for further examination. 354.126 Section 354.126 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF... Inspection § 354.126 Carcasses held for further examination. Each carcass, including all parts thereof, in...

  5. Bacterial contribution to iodine volatilization in the environment

    Energy Technology Data Exchange (ETDEWEB)

    Amachi, S; Kasahara, M; Fujii, T [Chiba Univ., Dept. of Bioresources Chemistry, Matsudo, Chiba (Japan); Muramatsu, Y [National Inst. of Radiological Sciences, Chiba (Japan)

    2003-09-01

    The roles of microorganisms in iodine volatilization from the environment were studied. More than 100 bacterial strains were isolated from various environments such as soils, seawater and marine sediments, and were examined their capacities for volatilizing iodine. Approximately 40% of these bacteria showed significant capacities for volatilizing iodine. Gas chromatographic determinations revealed that the chemical species of gaseous iodine is methyl iodide (CH{sub 3}I). Phylogenetic analysis based on 16S ribosomal DNA showed that these 'iodine-volatilizing bacteria' are widely distributed through the bacterial domain. The iodide-methylating reaction was mediated by an enzyme protein with S-adenosyl-L-methionine (SAM) as the methyl donor. We then estimated bacterial contribution to iodine volatilization from soils. Iodine in soils was volatilized mainly as CH{sub 3}I. CH{sub 3}I emission was enhanced in the presence of glucose or yeast extract, but was inhibited by autoclaving of soils. Little CH{sub 3}I was produced under anaerobic conditions. Furthermore, the addition of streptomycin and tetracycline, antibiotics which inhibit bacterial growth, strongly inhibited CH{sub 3}I emission, while a fungal inhibitor cycloheximide caused little effect. These results suggest that iodine in soils is volatilized as CH{sub 3}I mainly by the action of aerobic soil bacteria. Similar experiment was carried out by using sea water samples. The emission of iodine from sea waters occurred biologically, and bacterial (and also other microbial) contribution was confirmed. Our results suggest that iodine is methylated and volatilized into the atmosphere as a result of bacterial activities. Since bacteria are so abundant and widespread in the environments, they may significantly contribute to global iodine volatilization. This indicates that if {sup 129}I would be released from nuclear facilities, weapons testing or ground storage of nuclear wastes, the pathway of volatilization by

  6. Gravimetric determination of the iodine number of carbon black

    International Nuclear Information System (INIS)

    Murphy, L.J. Jr.

    1991-01-01

    This paper discusses a gravimetric method for the determination of the iodine adsorption number of carbon black. It comprises determining the concentration of an accurately weighed iodine blank solution by adding a standardized titrant to the iodine solution until a titration endpoint is reached and determining the concentration of the iodine solution by accurately weighing the amount of the standardized titrant necessary to reach the endpoint, accurately weighing an amount of carbon black and adding an appropriate amount of an accurately weighed portion of the iodine solution, equilibrating the carbon black-iodine solution mixture, adding the standardized titrant to an accurately weighed portion of the supernatant from the carbon black-iodine mixture until a titration endpoint is reached and determining the concentration of the supernatant by accurately weighing the amount of the standardized titrant necessary to reach the endpoint, wherein the titration endpoint of the supernatant is obtained using an indicating and a reference electrode, and calculating the iodine adsorption number of the carbon black based on the gravimetrically determined concentration of the titrant, the iodine solution, and the supernatant

  7. Present status of iodine research at IPSN

    Energy Technology Data Exchange (ETDEWEB)

    Bardelay, J [IPSN/DPEA/SEAC (France)

    1996-12-01

    Since several years, IPSN has conducted an effort in order to evaluate the release of radioactive iodine in case of hypothetical severe accident in a realistic manner. This source-term evaluation is performed with IODE code which is a module of the EXCADRE system of codes. This code is validated against: -analytical experiments: in these experiments, IPSN studies radiolytic effects and chemical processes in the sump, organic formation, mass transfer, effect of spray (CARAIDAS experiment), - the CAIMAN semi global experiment; this experiment will allow to study the phenomena linked to iodine behavior under representative containment geometry in the presence of painted surfaces and global irradiation, - the PHEBUS FP program. The paper consists to describe succinctly the current status of IODE and the various experiments for its validation. In case of hypothetical severe accident iodine can induce important perturbations of human organism. The effects are principally radiological, in particular on the thyroid. At short term, radioactive iodine is the most important contributor for the sanitary risk. It represents 55% of effective dose and 92% of thyroid dose at 10 km in case of controlled rejects with current assumptions. This is the reason why it must be actively studied. In France, the safety evaluations are performed with mechanistic codes or lumped parameter codes like EXCADRE which contains a module devoted to iodine studies: IODINE. The objective of the French experimental program on iodine is to understand and quantify important phenomena in order to put kinetic parameters in IODE module. The experiments can be classified in analytical experiments, the semi-global experiment CAIMAN which takes into account different phenomena studied in analytical experiments and the global experiment PHEBUS PF, not only devoted to iodine behavior study. In the following text we will present the needs of IODINE code and these different experiments. (author).

  8. Present status of iodine research at IPSN

    International Nuclear Information System (INIS)

    Bardelay, J.

    1996-01-01

    Since several years, IPSN has conducted an effort in order to evaluate the release of radioactive iodine in case of hypothetical severe accident in a realistic manner. This source-term evaluation is performed with IODE code which is a module of the EXCADRE system of codes. This code is validated against: -analytical experiments: in these experiments, IPSN studies radiolytic effects and chemical processes in the sump, organic formation, mass transfer, effect of spray (CARAIDAS experiment), - the CAIMAN semi global experiment; this experiment will allow to study the phenomena linked to iodine behavior under representative containment geometry in the presence of painted surfaces and global irradiation, - the PHEBUS FP program. The paper consists to describe succinctly the current status of IODE and the various experiments for its validation. In case of hypothetical severe accident iodine can induce important perturbations of human organism. The effects are principally radiological, in particular on the thyroid. At short term, radioactive iodine is the most important contributor for the sanitary risk. It represents 55% of effective dose and 92% of thyroid dose at 10 km in case of controlled rejects with current assumptions. This is the reason why it must be actively studied. In France, the safety evaluations are performed with mechanistic codes or lumped parameter codes like EXCADRE which contains a module devoted to iodine studies: IODINE. The objective of the French experimental program on iodine is to understand and quantify important phenomena in order to put kinetic parameters in IODE module. The experiments can be classified in analytical experiments, the semi-global experiment CAIMAN which takes into account different phenomena studied in analytical experiments and the global experiment PHEBUS PF, not only devoted to iodine behavior study. In the following text we will present the needs of IODINE code and these different experiments. (author)

  9. Iodine nutrition and risk of thyroid irradiation from nuclear accidents

    International Nuclear Information System (INIS)

    Delange, F.

    1990-01-01

    The objectives of this paper are to discuss the following aspects of physiopathology of iodine nutrition related to thyroid irradiation by nuclear accidents: (1) The cycle of iodine in nature, the dietary sources of iodine and the recommended dietary allowances for iodine. (2) The anomalies of thyroid metabolism induced by iodine deficiency. The caricatural situation as seen in endemic goitre will be used as mode. (3) The specific paediatric aspects of adaptation to iodine deficiency. (4) The present status of iodine nutrition in Europe. (author)

  10. Iodine status in the Nordic countries - past and present.

    Science.gov (United States)

    Nyström, Helena Filipsson; Brantsæter, Anne Lise; Erlund, Iris; Gunnarsdottir, Ingibjörg; Hulthén, Lena; Laurberg, Peter; Mattisson, Irene; Rasmussen, Lone Banke; Virtanen, Suvi; Meltzer, Helle Margrete

    2016-01-01

    Adequate iodine nutrition is dependent on ground water content, seafood, and, as many countries use iodized cow fodder, dairy products. In most countries, salt fortification programs are needed to assure adequate iodine intake. The objectives are threefold: 1) to describe the past and present iodine situation in the Nordic countries, 2) to identify important gaps of knowledge, and 3) to highlight differences among the Nordic countries' iodine biomonitoring and fortification policies. Historical data are compared with the current situation. The Nordic countries' strategies to achieve recommended intake and urine iodine levels and their respective success rates are evaluated. In the past, the iodine situation ranged from excellent in Iceland to widespread goiter and cretinism in large areas of Sweden. The situation was less severe in Norway and Finland. According to a 1960 World Health Organization (WHO) report, there were then no observations of iodine deficiency in Denmark. In Sweden and Finland, the fortification of table salt was introduced 50-75 years ago, and in Norway and Finland, the fortification of cow fodder starting in the 1950s helped improve the population's iodine status due to the high intake of milk. In Denmark, iodine has been added to household salt and salt in bread for the past 15 years. The Nordic countries differ with regard to regulations and degree of governmental involvement. There are indications that pregnant and lactating women, the two most vulnerable groups, are mildly deficient in iodine in several of the Nordic countries. The Nordic countries employ different strategies to attain adequate iodine nutrition. The situation is not optimal and is in need of re-evaluation. Iodine researchers, Nordic national food administrations, and Nordic governmental institutions would benefit from collaboration to attain a broader approach and guarantee good iodine health for all.

  11. Iodine-Catalyzed Isomerization of Dimethyl Muconate

    Energy Technology Data Exchange (ETDEWEB)

    Settle, Amy E [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Berstis, Laura R [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Zhang, Shuting [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Rorrer, Nicholas [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Hu, Haiming [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Richards, Ryan [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Beckham, Gregg T [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Crowley, Michael F [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Vardon, Derek R [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

    2018-04-12

    cis,cis-Muconic acid is a platform biobased chemical that can be upgraded to drop-in commodity and novel monomers. Among the possible drop-in products, dimethyl terephthalate can be synthesized via esterification, isomerization, Diels-Alder cycloaddition, and dehydrogenation. The isomerization of cis,cis-dimethyl muconate (ccDMM) to the trans,trans-form (ttDMM) can be catalyzed by iodine; however, studies have yet to address (i) the mechanism and reaction barriers unique to DMM, and (ii) the influence of solvent, potential for catalyst recycle, and recovery of high-purity ttDMM. To address this gap, we apply a joint computational and experimental approach to investigate iodine-catalyzed isomerization of DMM. Density functional theory calculations identified unique regiochemical considerations due to the large number of halogen-diene coordination schemes. Both transition state theory and experiments estimate significant barrier reductions with photodissociated iodine. Solvent selection was critical for rapid kinetics, likely due to solvent complexation with iodine. Under select conditions, ttDMM yields of 95% were achieved in <1 h with methanol, followed by high purity recovery (>98%) with crystallization. Lastly, post-reaction iodine can be recovered and recycled with minimal loss of activity. Overall, these findings provide new insight into the mechanism and conditions necessary for DMM isomerization with iodine to advance the state-of-the-art for biobased chemicals.

  12. Iodine uptake and distribution in horticultural and fruit tree species

    Directory of Open Access Journals (Sweden)

    Alessandra Caffagni

    2012-07-01

    Full Text Available Iodine is an essential microelement for humans and iodine deficiency disorder (IDD is one of the most widespread nutrient-deficiency diseases in the world. Iodine biofortification of plants provides an attractive opportunity to increase iodine intake in humans and to prevent and control IDD. This study was conducted to investigate the iodine uptake and accumulation in edible portion of two fruit trees: plum and nectarine, and two horticultural crops: tomato and potato. Two type of iodine treatments (soil and foliar spray application, and, for fresh market tomato, two production systems (open field and greenhouse hydroponic culture were tested. The distribution of iodine in potato stem and leaves, and in plum tree fruits, leaves, and branches was investigated. Iodine content of potato tubers after postharvest storage and processing (cooking, and iodine content of nectarine fruits after postharvest storage and processing (peeling were also determined. Differences in iodine accumulation were observed among the four crops, between applications, and between production systems. In open field, the maximum iodine content ranged from 9.5 and 14.3 μg 100 g−1 for plum and nectarine fruit, to 89.4 and 144.0 μg 100 g−1 for potato tuber and tomato fruit, respectively. These results showed that nectarine and plum tree accumulated significantly lower amounts of iodine in their edible tissues, in comparison with potato and tomato. The experiments also indicated hydroponic culture as the most efficient system for iodine uptake in tomato, since its fresh fruits accumulated up to 2423 μg 100 g−1 of iodine. Iodine was stored mainly in the leaves, in all species investigated. Only a small portion of iodine was moved to plum tree branches and fruits, and to potato stems and tubers. No differences in iodine content after fruit peeling was observed. A significant increase in iodine content of potato was observed after baking, whereas a significant decrease was

  13. Iodine metabolism and thyroid functions in various species of domestic animals and poultry birds. II - Distribution of iodine-131 in developing ova in poultry birds

    International Nuclear Information System (INIS)

    Parshad, Omkar; Setia, M.S.; Rattan, P.J.S.; Sodhi, S.P.S.; Varman, P.N.

    1974-01-01

    To study the distribution of iodine in different stages of developing ova in relation to iodine metabolism, twentyfour healthy laying birds were randomly distributed into four groups of 6 birds each. Each bird was injected with 25.26 μCi. of carrier-free iodine-131. Afterwards, birds of group I, II, III and IV were sacrificed at 24, 48, 72 and 96 hours respectively. The results have revealed that : (i) the state of development of ovum may be an important factor in controlling the distribution of iodine in ova; (ii) the iodine may be found distributed in both the lipid as well as non-lipid fractions of the ova; (iii) most of the iodine in the ova may be present in the form of inorganic iodine whereas very minor amount of the iodine may be as butanol-extractable iodine and (iv) the changes in iodine content in different stages of development of ova observed during the present study may be considered to have a direct effect on the overall metabolism of iodine in the poultry birds. (author)

  14. Iodine-129 in thyroids of grazing animals

    International Nuclear Information System (INIS)

    Ballad, R.V.; Holman, D.W.; Hennecke, E.W.; Johnson, J.E.; Manuel, O.K.; Nicholson, L.M.

    1976-01-01

    A combination of neutron activation and mass spectrometry has been used to determine the concentrations of fissiogenic 129 I and stable 127 I in thyroids of grazing animals and in mineral iodine. The 129 I/ 127 I ratios are lowest in mineral iodine and in a given area lower in cow thyroids than in deer thyroids. Near saturation levels of mineral iodine in commercial feeds and salt licks may account for differences in the 129 I levels of cows and deer. Values of the 129 I/ 127 I ratio in deer appear to vary inversely with the iodine concentration of the thyroid. (author)

  15. 29 CFR 794.126 - Computations for a new business.

    Science.gov (United States)

    2010-07-01

    ... million test of the exemption. In other cases, where doubt exists, the gross receipts of the new business... 29 Labor 3 2010-07-01 2010-07-01 false Computations for a new business. 794.126 Section 794.126... of Sales § 794.126 Computations for a new business. When a new business is commenced the employer...

  16. Low iodine content in the diets of hospitalized preterm infants.

    Science.gov (United States)

    Belfort, Mandy B; Pearce, Elizabeth N; Braverman, Lewis E; He, Xuemei; Brown, Rosalind S

    2012-04-01

    Iodine is critical for normal thyroid hormone synthesis and brain development during infancy, and preterm infants are particularly vulnerable to the effects of both iodine deficiency and excess. Use of iodine-containing skin antiseptics in intensive care nurseries has declined substantially in recent years, but whether the current dietary iodine intake meets the requirement for hospitalized preterm infants is unknown. The aim of the study was to measure the iodine content of enteral and parenteral nutrition products commonly used for hospitalized preterm infants and estimate the daily iodine intake for a hypothetical 1-kg infant. We used mass spectrometry to measure the iodine concentration of seven preterm infant formulas, 10 samples of pooled donor human milk, two human milk fortifiers (HMF) and other enteral supplements, and a parenteral amino acid solution and soy-based lipid emulsion. We calculated the iodine provided by typical diets based on 150 ml/kg · d of formula, donor human milk with or without HMF, and parenteral nutrition. Preterm formula provided 16.4-28.5 μg/d of iodine, whereas unfortified donor human milk provided only 5.0-17.6 μg/d. Adding two servings (six packets) of Similac HMF to human milk increased iodine intake by 11.7 μg/d, whereas adding two servings of Enfamil HMF increased iodine intake by only 0.9 μg/d. The other enteral supplements contained almost no iodine, nor did a parenteral nutrition-based diet. Typical enteral diets for hospitalized preterm infants, particularly those based on donor human milk, provide less than the recommended 30 μg/d of iodine, and parenteral nutrition provides almost no iodine. Additional iodine fortification should be considered.

  17. Postpartum thyroid dysfunction in pregnant thyroid peroxidase antibody-positive women living in an area with mild to moderate iodine deficiency: is iodine supplementation safe?

    DEFF Research Database (Denmark)

    Nøhr, S B; Jørgensen, A; Pedersen, K M

    2000-01-01

    In moderately iodine-deficient, pregnant, thyroid peroxidase antibody (TPO-Ab)-positive women the role of iodine supplementation in the development of postpartum thyroid dysfunction (PPTD) was studied in a placebo-controlled, randomized, double blind trial. Screening for TPO-Ab was performed......-Ab-positive women living in an area with mild to moderate iodine deficiency did not induce or worsen PPTD. The study confirmed that screening for TPO-Ab in early pregnancy can predict women at high risk for development of PPTD. Udgivelsesdato: 2000-Sep...... microg iodine or no iodine. The +/+ group received iodine during pregnancy and the postpartum period, the +/- group received iodine during pregnancy only, and the -/- group received no iodine supplementation. A total of 66 TPO-Ab positive women were followed, and in the postpartum period sera were...

  18. Experience of iodine removal in Tokai reprocessing plant

    International Nuclear Information System (INIS)

    Kikuchi, K.; Komori, Y.; Takeda, K.

    1985-01-01

    In the Tokai reprocessing plant about 170 ton of irradiated fuels have been processed since the beginning of hot operations in 1977. There was no effective equipment for iodine removal from the off-gas except for alkaline scrubbers when the plant construction was completed. In order to reduce the iodine discharge to the atmosphere, silver-exchanged zeolite (AgX) filters were installed additionally in 1979 and 1980, and they have been effective. However, those decontamination factors (DFs) were not as high as expected, and increasing the reprocessing amount of spent fuels it became necessary to lower the iodine discharge to the atmosphere. Therefore, other iodine removal equipment is planned to be installed in the plant. Concerning these investigations and development of iodine removal techniques, the iodine concentration of actual off-gases was measured and useful data were obtained

  19. Iodine tablets - many benefits and few disadvantages

    International Nuclear Information System (INIS)

    Paile, W.

    1996-01-01

    The number of thyroid cancers among children has increased steeply around Chernobyl after the nuclear catastrophe. An iodine tablet taken at the right time would have protected the thyroid from the effects of radioiodine. Nuclear fallout may contain large amounts of radioactive iodine. If this enters the body, either through inhalation or ingestion, most of it ends up in the thyroid. As a result, the thyroid may be exposed to a considerable radiation dose. High doses endanger the functioning of the thyroid, and even smaller doses may cause benign or malignant tumours in the thyroid. Sensitivity of the thyroid to radiation depends largely on the person's age. The younger the child, the higher the risk. Adults probably have a low risk. It has not been shown that people over 40 years of age would have any risk of contracting radiation-induced thyroid cancer. Iodine tablets are particularly important for children. Iodine has fewer side effects than had been thought previously. At least for children, the risk of side effects caused by one dose of iodine is so small that it can be ignored when considering whether iodine should be given in a fallout situation. The risk increases with age. It must unconditionally be left for the authorities to decide who should be given iodine tablets and when. (orig.)

  20. Iodine-129 Dose in LLW Disposal Facility Performance Assessments

    International Nuclear Information System (INIS)

    Wilhite, E.L.

    1999-01-01

    Iodine-129 has the lowest Performance Assessment derived inventory limit in SRS disposal facilities. Because iodine is concentrated in the body to one organ, the thyroid, it has been thought that dilution with stable iodine would reduce the dose effects of 129I.Examination of the dose model used to establish the Dose conversion factor for 129I shows that, at the levels considered in performance assessments of low-level waste disposal facilities, the calculated 129I dose already accounts for ingestion of stable iodine. At higher than normal iodine ingestion rates, the uptake of iodine by the thyroid itself decrease, which effectively cancels out the isotopic dilution effect

  1. Mechanism of dark decomposition of iodine donor in the active medium of a pulsed chemical oxygen - iodine laser

    International Nuclear Information System (INIS)

    Andreeva, Tamara L; Kuznetsova, S V; Maslov, A I; Sorokin, Vadim N

    2002-01-01

    A scheme is proposed that describes the dark decomposition of iodide - the donor of iodine - and the relaxation of singlet oxygen in the chlorine-containing active medium of a pulsed chemical oxygen - iodine laser (COIL). For typical compositions of the active media of pulsed COILs utilising CH 3 I molecules as iodine donors, a branching chain reaction of the CH 3 I decomposition accompanied by the efficient dissipation of singlet oxygen is shown to develop even at the stage of filling the active volume. In the active media with CF 3 I as the donor, a similar chain reaction is retarded due to the decay of CF 3 radicals upon recombination with oxygen. The validity of this mechanism is confirmed by a rather good agreement between the results of calculations and the available experimental data. The chain decomposition of alkyliodides accompanied by an avalanche production of iodine atoms represents a new way of efficient chemical production of iodine for a COIL. (active media)

  2. Instrumental determination of iodine in milk by neutron activation analysis

    International Nuclear Information System (INIS)

    Isaac Olive, K.; Chatt, A.

    2006-01-01

    Iodine is an essential trace element. It is related to thyroid functions and its deficiency or excess can be harmful. Deficiency of iodine leads to brain damage including cretinism, excess of iodine blocks the thyroid gland ultimately producing iodine deficiency as well. World Health Organization has set a daily iodine intake dose of 150 μg d -1 . Currently there are 740 million people in the world at risk of iodine deficiency disorders; therefore the monitoring of iodine intake is necessary. Although the iodized salt policy has been adopted in many countries, milk is also one of the major natural sources of iodine and it is also the principal food in children. Therefore, the determination of iodine in milk is needed. This work deals with the determination of iodine in milk by neutron activation analysis. Different methods of irradiation-counting are compared in terms of sensitivity and detection limits. The quantification of iodine was calculated using also two methods, the classic relative one and the standardization of k 0 parameter. A brief analysis of the uncertainty sources in the analytical method is also discussed.(Full text)

  3. Teratology public affairs committee position paper: iodine deficiency in pregnancy.

    Science.gov (United States)

    Obican, Sarah G; Jahnke, Gloria D; Soldin, Offie P; Scialli, Anthony R

    2012-09-01

    Iodine deficiency is an important nutritional deficiency, with more than 2 billion people worldwide estimated to be at risk. The developing fetus and young children are particularly at risk. During pregnancy and lactation, iodine requirements increase, whether in iodine-poor or iodine-sufficient countries, making the mother and the developing fetus vulnerable. The American Thyroid Association (ATA) recommends 250 micrograms per day of iodine intake for pregnant and lactating women. The thyroid gland is able to adapt to the changes associated with pregnancy as long as sufficient iodine is present. Dietary intake is the sole source of iodine, which is essential to the synthesis of thyroid hormones. Iodine is found in multiple dietary sources including iodized salt, dairy products, seaweed, and fish. Prenatal vitamins containing iodine are a good source of iodine, but iodine content in multivitamin supplements is highly variable. Congenital hypothyroidism is associated with cretinism. Clinical hypothyroidism has been associated with increased risk of poor perinatal outcome including prematurity, low birth weight, miscarriage, preeclampsia, fetal death, and impaired fetal neurocognitive development. Subclinical hypothyroidism is also associated with poor pregnancy outcomes and potential fetal neurocognitive deficits, but the data are more variable than those for clinical hypothyroidism. We concur with the ATA recommendation that all pregnant and lactating women should ingest (through diet and supplements) 250 micrograms of iodine daily. To achieve this goal, we recommend that all pregnant and lactating women take daily iodine supplementation of 150 micrograms. Copyright © 2012 Wiley Periodicals, Inc.

  4. Iodine deficiency in pregnancy is prevalent in vulnerable groups in Denmark

    DEFF Research Database (Denmark)

    Kirkegaard-Klitbo, Ditte Marie; Perslev, Kathrine; Andersen, Stine Linding

    2016-01-01

    -containing supplements (86%). The median UIC was 118 (interquartile range (IQR): 79-196) µg/l in iodine supplement users and 82 (IQR: 41-122) µg/l in non-users (p education, non-Danish origin and pre-pregnancy obesity....... CONCLUSIONS: The iodine status in Danish pregnant women was below WHO recommendations. Iodine supplement non-users are at a particular risk of iodine deficiency. Low maternal education, non-Danish origin and pre-pregnancy obesity are predictors of non-iodine supplement use. An increase in iodine fortification......INTRODUCTION: Iodine is essential for the production of thyroid hormones. In pregnancy, physiological changes occur that can lead to iodine deficiency and impairment of fetal neurological development. We aimed to assess the iodine intake in pregnant women in Eastern Denmark, compare iodine levels...

  5. 21 CFR 862.1640 - Protein-bound iodine test system.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Protein-bound iodine test system. 862.1640 Section... Systems § 862.1640 Protein-bound iodine test system. (a) Identification. A protein-bound iodine test system is a device intended to measure protein-bound iodine in serum. Measurements of protein-bound...

  6. Median Urinary Iodine Concentrations Are Indicative of Adequate Iodine Status among Women of Reproductive Age in Prey Veng, Cambodia.

    Science.gov (United States)

    Karakochuk, Crystal D; Michaux, Kristina D; Chai, Tze L; Chan, Benny B; Whitfield, Kyly C; Barr, Susan I; McLean, Judy; Talukder, Aminuzzaman; Hou, Kroeun; Ly, Sokhoing; Green, Tim J

    2016-03-03

    Iodine deficiency disorders are estimated to affect over 1.9 million people worldwide. Iodine deficiency is especially serious for women during pregnancy and lactation because of the negative consequences for both mother and infant. The aim of this cross-sectional study was to determine the median urinary iodine concentration (UIC) as a population-level indicator of iodine status among rural women farmers of reproductive age (18-45 years) in the province of Prey Veng, Cambodia. A total of 450 women provided a spot morning urine sample in 2012. Of those women, 93% (n = 420) were non-pregnant and 7% (n = 30) were pregnant at the time of collection. UIC was quantified using the Sandell-Kolthoff reaction with modifications. The median UIC of non-pregnant (139 μg/L) and pregnant women (157 μg/L) were indicative of adequate iodine status using the WHO/UNICEF/ICCIDD epidemiological criteria for both groups (median UIC between 100-199 and 150-249 μg/L, respectively). We conclude that non-pregnant and pregnant women in rural Prey Veng, Cambodia had adequate iodine status based on single spot morning urine samples collected in 2012. More research is warranted to investigate iodine status among larger and more representative populations of women in Cambodia, especially in light of recent policy changes to the national program for universal salt iodization.

  7. Stabilisation of microalgae: Iodine mobilisation under aerobic and anaerobic conditions.

    Science.gov (United States)

    Han, Wei; Clarke, William; Pratt, Steven

    2015-10-01

    Mobilisation of iodine during microalgae stabilisation was investigated, with the view of assessing the potential of stabilised microalgae as an iodine-rich fertiliser. An iodine-rich waste microalgae (0.35 ± 0.05 mg I g(-1) VS(added)) was stabilised under aerobic and anaerobic conditions. Iodine mobilisation was linearly correlated with carbon emission, indicating iodine was in the form of organoiodine. Comparison between iodine and nitrogen mobilisation relative to carbon emission indicated that these elements were, at least in part, housed separately within the cells. After stabilisation, there were 0.22 ± 0.05 and 0.19 ± 0.01 mg g(-1) VS(added) iodine remaining in the solid in the aerobic and anaerobic processed material respectively, meaning 38 ± 5.0% (aerobic) and 50 ± 8.6% (anaerobic) of the iodine were mobilised, and consequently lost from the material. The iodine content of the stabilised material is comparable to the iodine content of some seaweed fertilisers, and potentially satisfies an efficient I-fertilisation dose. Copyright © 2015 Elsevier Ltd. All rights reserved.

  8. Veganism as a cause of iodine deficient hypothyroidism.

    Science.gov (United States)

    Yeliosof, Olga; Silverman, Lawrence A

    2018-01-26

    Iodine deficiency is the most common cause of acquired hypothyroidism worldwide. Although uncommon in the Western world, the incidence of iodine deficiency may be rising due to the increased use of restrictive diets. We present a 23-month-old boy diagnosed with iodine deficiency hypothyroidism, induced by a vegan diet. This case highlights the risk for iodine deficiency in children on a vegan diet after discontinuation of breast/formula feeding that could lead to acquired hypothyroidism.

  9. Iodine behavior in containment under LWR accident conditions

    International Nuclear Information System (INIS)

    Wisbey, S.J.; Beahm, E.C.; Shockley, W.E.; Wang, Y.M.

    1986-01-01

    The description of containment iodine behavior in reactor accident sequences requires an understanding of iodine volatility effects, deposition and revaporization/resuspension (from surfaces and aerosols), chemical changes between species, and mass transport. The experimental work in this program has largely centered on the interactions of iodine in or with water pools. The formation of volatile iodine, as I 2 or organic iodides, is primarily dependent on radiation and solution pH. Lower pH results in increased formation of volatile iodine species; thus, for example, a pH of 3.05 resulted in a conversion of I - to I 2 that was more than two orders of magnitude greater than tests run at pH 6.1 or 6.8. The formation or organic iodides involving water pools has been linked to the presence of iodine as I 2 , the solution/gas contact, and to the type of organic material

  10. Modelling iodine behaviour using LIRIC 3.0

    Energy Technology Data Exchange (ETDEWEB)

    Wren, J C; Glowa, G A; Ball, J M [Atomic Energy of Canada Ltd., Pinawa, MB (Canada). Whiteshell Labs.

    1996-12-01

    The overall objective of the iodine chemistry research program at the Whiteshell Laboratories of AECL is to develop and validate the LIRIC (Library of Iodine Reactions In Containment) model. The model, once validated, is intended as either a stand-alone analytical tool or for incorporation into a code for licensing analyses of fission-product behaviour in containment. LIRIC is currently being used to assess the role and importance of individual phenomena on iodine volatility under reactor accident conditions and, thus, help to establish priorities within the iodine research program. The LIRIC model has undergone significant alterations since it was last reported (LIRIC 2.0), mainly as a result of considerable development in understanding of iodine behaviour over the last few years. The new version, LIRIC 3.0, has been used to simulate various results from the Radioiodine Test Facility (RTF) with reasonable success, although under somewhat limited conditions.

  11. Solar-simulator-pumped atomic iodine laser kinetics

    Science.gov (United States)

    Wilson, H. W.; Raju, S.; Shiu, Y. J.

    1983-01-01

    The literature contains broad ranges of disagreement in kinetic data for the atomic iodine laser. A kinetic model of a solar-simulator-pumped iodine laser is used to select those kinetic data consistent with recent laser experiments at the Langley Research Center. Analysis of the solar-simulator-pumped laser experiments resulted in the following estimates of rate coefficients: for alkyl radical (n-C3F7) and atomic iodine (I) recombination, 4.3 x 10 to the 11th power (1.9) + or - cu cm/s; for n-C3F7I stabilized atomic iodine recombination (I + I) 3.7 x 10 to the -32nd power (2.3) + or -1 cm to the 6th power/s; and for molecular iodine (I2) quenching, 3.1 x 10 to the -11th power (1.6) + or - 1 cu cm/s. These rates are consistent with the recent measurements.

  12. Age and speciation of iodine in groundwater and mudstones of the Horonobe area, Hokkaido, Japan: Implications for the origin and migration of iodine during basin evolution

    Science.gov (United States)

    Togo, Yoko S.; Takahashi, Yoshio; Amano, Yuki; Matsuzaki, Hiroyuki; Suzuki, Yohey; Terada, Yasuko; Muramatsu, Yasuyuki; Ito, Kazumasa; Iwatsuki, Teruki

    2016-10-01

    This paper reports the concentration, speciation and isotope ratio (129I/127I) of iodine from both groundwater and host rocks in the Horonobe area, northern Hokkaido, Japan, to clarify the origin and migration of iodine in sedimentary rocks. Cretaceous to Quaternary sedimentary rocks deposited nearly horizontally in Tenpoku Basin and in the Horonobe area were uplifted above sea level during active tectonics to form folds and faults in the Quaternary. Samples were collected from the Pliocene Koetoi and late Miocene Wakkanai formations (Fms), which include diatomaceous and siliceous mudstones. The iodine concentration in groundwater, up to 270 μmol/L, is significantly higher than that of seawater, with the iodine enrichment factor relative to seawater reaching 800-1500. The iodine concentration in the rocks decreases from the Koetoi to Wakkanai Fms, suggesting that iodine was released into the water from the rocks of deeper formations. The iodine concentration in the rocks is sufficiently high for forming iodine-rich groundwater as found in this area. X-ray absorption near edge structure (XANES) analysis shows that iodine exists as organic iodine and iodide (I-) in host rocks, whereas it exists mainly as I- in groundwater. The isotope ratio is nearly constant for iodine in the groundwater, at [0.11-0.23] × 10-12, and it is higher for iodine in rocks, at [0.29-1.1] × 10-12, giving iodine ages of 42-60 Ma and 7-38 Ma, respectively. Some iodine in groundwater must have originated from Paleogene and even late Cretaceous Fms, which are also considered as possible sources of oil and gas, in view of the old iodine ages of the groundwater. The iodine ages of the rocks are older than the depositional ages, implying that the rocks adsorbed some iodine from groundwater, which was sourced from greater depths. The iodine concentration in groundwater decreases with decreasing chlorine concentration due to mixing of iodine-rich connate water and meteoric water. A likely scenario

  13. Iodine-129 separation and determination by neutron activation analysis

    International Nuclear Information System (INIS)

    Bate, L.C.; Stokely, J.R.

    1982-01-01

    This paper describes a method for analysis of iodine-129 in fission product mixtures originating from fuel reprocessing studies and low-level wastes. The method utilizes conventional iodine valence adjustment and solvent extraction techniques to chemically separate iodine-129 from most fission products. The iodine-129 is determined by neutron irradiation and measurement of the 12.4 hour iodine-130 produced by the neutron capture reaction. Special techniques were devised for neutron irradiation of iodine-129 samples in the pneumatic tube irradiation facilities at the High Flux Isotope (HFIR) and Oak Ridge Research (ORR) Reactors. Chemically separated iodine-129 is adsorbed on an anion exchange resin column made from an irradiation container. The loaded resin is then irradiated in either of the pneumatic facilities to produce iodine-130. Sensitivity of the analysis with the HFIR facility (flux: 5x10 14 n/cm 2 /s) and a 100 second irradiation time is approximately 0.03 nanograms. Samples up to 250 ml in volume can be easily processed. (author)

  14. The impact of iodised salt or iodine supplements on iodine status during pregnancy lactation and infancy

    NARCIS (Netherlands)

    Zimmermann, M.B.

    2007-01-01

    Objectives: Monitoring of iodine status during pregnancy, lactation and infancy is difficult as there are no established reference criteria for urinary iodine concentration (UI) for these groups; so it is uncertain whether iodized salt programs meet the needs of these life stages. Design and

  15. Iodine release from sodium pool combustion

    International Nuclear Information System (INIS)

    Sagawa, N.; Fukushima, Y.; Yokota, N.; Akagane, K.; Mochizuki, K.

    1979-01-01

    Iodine release associated with sodium pool combustion was determined by heating 20 gr sodium containing sodium iodide, which was labelled with 131 I and dissolved in the sodium in concentration of 1∼1,000 ppm, to burn on a nickel crucible in conditioned atmosphere in a closed vessel of 0.4 m 3 . Oxygen concentration was changed in 5∼21% and humidity in 0∼89% by mixing nitrogen gas and air. Combustion products were trapped by a Maypack filter composed of particle filters, copper screens and activated charcoal beds and by a glass beads pack cooled by liquid argon. Iodine collected on these filter elements was determined by radio-gas chromatography. When the sodium sample burned in the atmosphere of air at room temperature, the release fractions observed were 6∼33% for sodium and 1∼20% for iodine added in the sodium. The release iodine was present in aerosol at a ratio of 98%, and the remainder in the gas form. The release fraction of iodine trended to decrease as oxygen concentration and humidity in the atmosphere increased. No organic iodide was detected in the combustion products. (author)

  16. Iodine deficiency in pregnancy is prevalent in vulnerable groups in Denmark

    DEFF Research Database (Denmark)

    Kirkegaard-Klitbo, Ditte Marie; Perslev, Kathrine; Andersen, Stine Linding

    2016-01-01

    INTRODUCTION: Iodine is essential for the production of thyroid hormones. In pregnancy, physiological changes occur that can lead to iodine deficiency and impairment of fetal neurological development. We aimed to assess the iodine intake in pregnant women in Eastern Denmark, compare iodine levels....... CONCLUSIONS: The iodine status in Danish pregnant women was below WHO recommendations. Iodine supplement non-users are at a particular risk of iodine deficiency. Low maternal education, non-Danish origin and pre-pregnancy obesity are predictors of non-iodine supplement use. An increase in iodine fortification...... in Eastern and Western Denmark and to identify potentially vulnerable groups. METHODS: This was a cross-sectional cohort study of pregnant Danish women (n = 240). Questionnaires and urine samples were collected at the Ultrasound Clinic, Hvidovre Hospital, Denmark, and urinary iodine concentrations (UIC) (µg...

  17. Measurement of Iodine-129 concentration in environmental water samples around Fukushima area - Role of river system in the global iodine cycle

    Science.gov (United States)

    Matsuzaki, Hiroyuki; Tokuyama, Hironori; Miyake, Yasuto; Honda, Maki; Yamagata, Takeyasu; Muramatsu, Yasuyuki

    2013-04-01

    According to Fukushima Dai-ichi Nuclear Power Plant (FDNPP) accident, vast amount of radioactive nuclides including radioactive iodine were spilled out into the environment. There is no question about that detailed observation of distribution of radioactive nuclides and evaluation of the radiation exposure of residents is extremely important. On the other hand, from the view of an elemental dynamics in the environment, this event can be considered as a spike of the radioactive isotope. It is also the case for the iodine. A rare isotope Iodine-129 was widely distributed in a very short time by the FDNPP accident. Iodine-129 directly landing on the soil surface had been trapped in the upper layer of the soil and the depth profile should indicate the migration in and the interaction with the soil. If Iodine-129 was trapped in the woods, it seems to take rather longer time to landing on the ground. Either way, a certain portion of the Iodine-129 should be moving downward and finally washed out by the groundwater or river with a certain rate and transported into the sea. The concentration of Iodine-129 in environmental water samples taken from rivers and ponds are considered to reflect the iodine transportation process by the fluvial system. For the detailed discussion of the role of the fluvial system in the global iodine cycle, Iodine-129 concentration of various water samples collected from Fukushima area was measured by means of Accelerator Mass Spectrometry. The results ranged from 3E06 atoms/L to 3E09 atoms/L. Samples from Abukuma area (South West of FDNPP) showed lower concentration. On the other hand, samples collected from North West part (Iitate village and Minami Soma region) showed higher concentration (more than 1E8 atoms/L). Delayed enhancement of Iodine-129 concentration over a year in river systems surrounded by woods was also observed which is considered to correspond to the delayed release from the woods.

  18. Misclassification of iodine intake level from morning spot urine samples with high iodine excretion among Inuit and non-Inuit in Greenland.

    Science.gov (United States)

    Andersen, Stig; Waagepetersen, Rasmus; Laurberg, Peter

    2015-05-14

    Iodine nutrition is commonly assessed from iodine excretion in urine. A 24 h urine sample is ideal, but it is cumbersome and inconvenient. Hence, spot urine samples with creatinine to adjust for differences in void volume are widely used. Still, the importance of ethnicity and the timing of spot urine samples need to be settled. We, thus, collected 104 early morning spot urine samples and 24 h urine samples from Inuit and non-Inuit living in Greenland. Diet was assessed by a FFQ. Demographic data were collected from the national registry and by questionnaires. Iodine was measured using the Sandell-Kolthoff reaction, creatinine using the Jaffe method and para-amino benzoic acid by the HPLC method for the estimation of completeness of urine sampling and compensation of incomplete urine samples to 24 h excretion. A population-based recruitment was done from the capital city, a major town and a settlement (n 36/48/20). Participants were seventy-eight Inuit and twenty-six non-Inuit. The median 24 h iodine excretion was 138 (25th-75th percentile 89-225) μg/97 (25th-75th percentile 72-124) μg in Inuit/non-Inuit (P= 0.030), and 153 (25th-75th percentile 97-251) μg/102 (25th-75th percentile 73-138) μg (P= 0.026) when including compensated iodine excretion. Iodine excretion in 24 h urine samples increased with a rising intake of traditional Inuit foods (P= 0.005). Iodine excretion was lower in morning spot urine samples than in 24 h urine samples (P< 0.001). This difference was associated with iodine intake levels (P< 0.001), and was statistically significant when the iodine excretion level was above 150 μg/24 h. In conclusion, the iodine intake level was underestimated from morning spot urine samples if iodine excretion was above the recommended level.

  19. Iodine poisoning

    Science.gov (United States)

    ... Iodine is also used during the production of methamphetamine. Note: This list may not be all inclusive. ... breathing machine (ventilator) Blood and urine tests Chest x-ray EKG (electrocardiogram, or heart tracing) Fluids through a ...

  20. The kinetic study of oxidation of iodine by hydrogen peroxide

    Energy Technology Data Exchange (ETDEWEB)

    Cantrel, L [Institut de Protection et de Surete Nucleaire, IPNS, CEN Cadarache, Saint Paul lez Durance (France); Chopin, J [Laboratoire d` Electrochimie Inorganique, ENSSPICAM, Marseille (France)

    1996-12-01

    Iodine chemistry is one of the most important subjects of research in the field of reactor safety because this element can form volatile species which represent a biological hazard for environment. As the iodine and the peroxide are both present in the sump of the containment in the event of a severe accident on a light water nuclear reactor, it can be important to improve the knowledge on the reaction of oxidation of iodine by hydrogen peroxide. The kinetics of iodine by hydrogen peroxide has been studied in acid solution using two different analytical methods. The first is a UV/Vis spectrophotometer which records the transmitted intensity at 460 nm as a function of time to follow the decrease of iodine concentration, the second is an amperometric method which permits to record the increase of iodine+1 with time thanks to the current of reduction of iodine+1 to molecular iodine. The iodine was generated by Dushman reaction and the series of investigations were made at 40{sup o}C in a continuous stirring tank reactor. The influence of the initial concentrations of iodine, iodate, hydrogen peroxide, H{sup +} ions has been determined. The kinetics curves comprise two distinct chemical phases both for molecular iodine and for iodine+1. The relative importance of the two processes is connected to the initial concentrations of [I{sub 2}], [IO{sub 3}{sup -}], [H{sub 2}O{sub 2}] and [H{sup +}]. A rate law has been determined for the two steps for molecular iodine. (author) figs., tabs., 22 refs.

  1. The kinetic study of oxidation of iodine by hydrogen peroxide

    International Nuclear Information System (INIS)

    Cantrel, L.; Chopin, J.

    1996-01-01

    Iodine chemistry is one of the most important subjects of research in the field of reactor safety because this element can form volatile species which represent a biological hazard for environment. As the iodine and the peroxide are both present in the sump of the containment in the event of a severe accident on a light water nuclear reactor, it can be important to improve the knowledge on the reaction of oxidation of iodine by hydrogen peroxide. The kinetics of iodine by hydrogen peroxide has been studied in acid solution using two different analytical methods. The first is a UV/Vis spectrophotometer which records the transmitted intensity at 460 nm as a function of time to follow the decrease of iodine concentration, the second is an amperometric method which permits to record the increase of iodine+1 with time thanks to the current of reduction of iodine+1 to molecular iodine. The iodine was generated by Dushman reaction and the series of investigations were made at 40 o C in a continuous stirring tank reactor. The influence of the initial concentrations of iodine, iodate, hydrogen peroxide, H + ions has been determined. The kinetics curves comprise two distinct chemical phases both for molecular iodine and for iodine+1. The relative importance of the two processes is connected to the initial concentrations of [I 2 ], [IO 3 - ], [H 2 O 2 ] and [H + ]. A rate law has been determined for the two steps for molecular iodine. (author) figs., tabs., 22 refs

  2. 13 CFR 126.701 - Can these subcontracting percentages requirements change?

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Can these subcontracting percentages requirements change? 126.701 Section 126.701 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION HUBZONE PROGRAM Contract Performance Requirements § 126.701 Can these subcontracting percentages...

  3. Comparison of urine iodine/creatinine ratio between patients following stringent and less stringent low iodine diet for radioiodine remnant ablation of thyroid cancer

    International Nuclear Information System (INIS)

    Roh, Jee Ho; Kim, Byung Il; Ha, Ji Su; Chang, Sei Joong; Shin, Hye Young; Choi, Joon Hyuk; Kim, Do Min; Kim, Chong Soon

    2006-01-01

    A low iodine diet (LID) for 1 ∼ 2 weeks is recommended for patients who undergoing radioiodine remnant ablation. However, the LID educations for patients are different among centers because there is no concrete recommendation for protocol of LID. In this investigation, we compared two representative types of LID protocols performed in several centers in Korea using urine iodine to creatinine tatio (urine I/Cr). From 2006, April to June, patients referred to our center for radioiodine remnant ablation of thyroid cancer from several local hospitals which had different LID protocols were included. We divided into two groups, stringent LID for 1 week and less stringent LID for 2 weeks, then measured their urine I/Cr ratio with spot urine when patients were admitted to the hospital. Total 27 patients were included in this investigation (M:F = 1:26; 13 in one-week stringent LID; 14 in two-week less stringent LID). Average of urine I/Cr ratio was 127.87 ± 78.52 μ g/g in stringent LID for 1 week, and 289.75 ± 188.24 μ g/g in less stringent LID for 2 weeks. It was significantly lower in stringent LID for 1 week group (ρ = 0.008). The number of patients whose urine I/Cr ratios were below 100 μ g/g was 6 of 13 in stringent LID for 1 week group, and 3 of 14 in less stringent LID for 2 weeks group. Stringent LID for 1 week resulted in better urinary I/Cr ratio in our investigation compared with the other protocol. However it still resulted in plenty of inadequate range of I/Cr ratio, so more stringent protocol such as stringent LID for 2 weeks is expected more desirable

  4. The retention of iodine by iodine filters in nuclear power plants in the case of fire (a literature review)

    International Nuclear Information System (INIS)

    Giraud, V.

    1985-03-01

    Due to the liberation of considerable amounts of gaseous combustion products, fires in nuclear power plants may lead to a deterioration in the retention of radioiodine by iodine filters. The combustion products of the burnable materials, i.e., insulations, lubricants and paints, vary considerably with the development of the fire. Combustion product analyses of these materials have been performed only to a limited extent. The reaction of iodine with combustion products as well as the retention of the resulting iodine reaction products by sorbents have not yet been investigated. The reduction in the removal efficiencies of iodine sorbents due to the presence of combustion products is unknown. (orig.) [de

  5. Thyroid volume and urinary iodine in European schoolchildren: standardization of values for assessment of iodine deficiency

    NARCIS (Netherlands)

    Delange, F.; Benker, G.; Caron, P.; Eber, O.; Ott, W.; Peter, F.; Podoba, J.; Simescu, M.; Szybinsky, Z.; Vertongen, F.; Vitti, P.; Wiersinga, W.; Zamrazil, V.

    1997-01-01

    Up to 1992, most European countries used to be moderately to severely iodine deficient. The present study aimed at evaluating possible changes in the status of iodine nutrition in 12 European countries during the past few years. Thyroid volume was measured by ultrasonography in 7599 schoolchildren

  6. Sorption of iodine onto Japanese soils

    Energy Technology Data Exchange (ETDEWEB)

    Yoshida, Satoshi [National Inst. of Radiological Sciences, Hitachinaka, Ibaraki (Japan). Nakaminato Lab. Branch

    1996-04-01

    Soils were collected from various regions of Japan. Iodine concentrations in the soils were quantitatively determined. The adsorption ratio and the distribution coefficients of iodine onto the soils were derived and effects of co-existing ions were studied. (J.P.N.)

  7. Sorption of iodine onto Japanese soils

    International Nuclear Information System (INIS)

    Yoshida, Satoshi

    1996-01-01

    Soils were collected from various regions of Japan. Iodine concentrations in the soils were quantitatively determined. The adsorption ratio and the distribution coefficients of iodine onto the soils were derived and effects of co-existing ions were studied. (J.P.N.)

  8. 7 CFR 1.26 - Representation before the Department of Agriculture.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Representation before the Department of Agriculture. 1.26 Section 1.26 Agriculture Office of the Secretary of Agriculture ADMINISTRATIVE REGULATIONS Departmental Proceedings § 1.26 Representation before the Department of Agriculture. (a) Applicability. This...

  9. 40 CFR 89.126 - Denial, revocation of certificate of conformity.

    Science.gov (United States)

    2010-07-01

    ... conformity. 89.126 Section 89.126 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... Standards and Certification Provisions § 89.126 Denial, revocation of certificate of conformity. (a) If... issued certificate of conformity if the Administrator finds any one of the following infractions to be...

  10. Iodine Supplementation in Pregnancy and the Dilemma of Ambiguous Recommendations

    DEFF Research Database (Denmark)

    Andersen, Stine Linding; Laurberg, Peter

    2016-01-01

    Iodine requirements are increased during pregnancy, predominantly caused by an increase in renal iodide clearance and in the use of iodine for thyroid hormone production. Because iodine deficiency (ID) in pregnancy may be associated with neurodevelopmental deficits in the offspring, a pertinent...... sufficient for at least 2 years. However, guidance on this differs between scientific societies. This review discusses iodine supplementation in pregnancy. Based on current evidence, the recommendations given by WHO/UNICEF/ICCIDD in 2007 provide a valid guidance on the use of iodine supplements in pregnant...... women. Women living in a population with a median urinary iodine concentration (UIC) at or above 100 µg/l are not in need of iodine supplementation in pregnancy. On the other hand, if the population median UIC is below 100 µg/l, pregnant women should take iodine-containing supplements until...

  11. OXIDATIVE STRESS IN HUMAN THYROID GLAND UNDER IODINE DEFICIENCY NODULAR GOITER: FROM HARMLESSNESS TO HAZARD DEPENDING ON COPPER AND IODINE SUBCELLULAR DISTRIBUTION

    Directory of Open Access Journals (Sweden)

    H. Falfushynska

    2014-12-01

    Conclusions. Excess of copper unbound to metallothionein in goitrous-changed tissue and high level of inorganic iodine could be the reason for elevated DNA fragmentation and increased lysosomal membrane permeability and activation of antioxidant defense. The main criterions of goiter formation were represented by low level of organificated iodine and high level of DNA damage in thyroid gland. KEY WORDS: iodine deficiency nodular colloidal goiter, iodine, copper, metallothioneins, oxidative stress, cytotoxicity

  12. SUFFICIENT IODINE INTAKE IN SCHOOLCHILDREN FROM THE ZAGREB AREA: ASSESSMENT WITH DRIED BLOD SPOT THYROGLOBULIN AS A NEW FUNCTIONAL BIOMARKER FOR IODINE DEFICIENCY.

    Science.gov (United States)

    Jukić, Tomislav; Zimmermann, Michael Bruce; Granić, Roko; Prpić, Marin; Krilić, Drazena; Juresa, Vesna; Katalenić, Marijan; Kusić, Zvonko

    2015-12-01

    Current methods for assessment of iodine intake in a population comprise measurements of urinary iodine concentration (UIC), thyroid volume by ultrasound (US-Tvol), and newborn TSH. Serum or dried blood spot thyroglobulin (DBS-Tg) is a new promising functional iodine status biomarker in children. In 1996, a new act on universal salt iodination was introduced in Croatia with 25 mg of potassium iodideper kg of salt. In 2002, Croatia finally reached iodine sufficiency. However, in 2009, median UIC in 101 schoolchildren from Zagreb, the capital of Croatia, was 288 µg/L, posing to be excessive. The aim of the study was to assess iodine intake in schoolchildren from the Zagreb area and to evaluate the value of DBS-Tg in schoolchildren as a new functional biomarker of iodine deficiency (and iodine excess). The study was part of a large international study in 6- to 12-year-old children supported by UNICEF, the Swiss Federal Institute of Technology (ETH Zurich) and the International Council for the Control of Iodine Deficiency Disorders (ICCIDD). According to international study results, the median cut-off Tg 40 µg/L indicate iodine sufficiency. The study included 159 schoolchildren (median age 9.1 ± 1.4 years) from Zagreb and a nearby small town of Jastrebarsko with measurements of UIC, US-Tvol, DBS-Tg, T4, TSH and iodine content in salt from households of schoolchildren (KI/kg of salt). Overall median UIC was 205 µg/L (range 1-505 µg/L). Thyroid volumes in schoolchildren measured by US were within the normal range according to reference values. Median DBS-Tg in schoolchildren was 12.1 µg/L with 3% of Tg values > 40 µg/L. High Tg values were in the UIC range 300 µg/L (U-shaped curve of Tg plotted against UIC). All children were euthyroid with geometric mean TSH 0.7 ± 0.3 mU/L and arithmetic mean T4 62 ± 12.5 nmol/L. The mean KI content per kg of salt was 24.9 ± 3.1 mg/kg (range 19-36 mg/kg). Study results indicated iodine sufficiency in schoolchildren from the

  13. Salivary gland dysfunction following radioactive iodine therapy

    International Nuclear Information System (INIS)

    Wiesenfeld, D.; Webster, G.; Cameron, F.; Ferguson, M.M.; MacFadyen, E.E.; MacFarlane, T.W.

    1983-01-01

    Radioactive iodine is used extensively for the treatment of thyrotoxicosis and thyroid carcinoma. Iodine is actively taken up by the salivary glands and, following its use, salivary dysfunction may result as a consequence of radiation damage. The literature is reviewed and a case is reported in which a patient presented with a significant increase in caries rate attributed to salivary dysfunction following radioactive iodine therapy for a thyroid carcinoma

  14. Radiolytical oxidation of gaseous iodine by beta radiation

    International Nuclear Information System (INIS)

    Kaerkelae, Teemu; Auvinen, Ari; Kekki, Tommi; Kotiluoto, Petri; Lyyraenen, Jussi; Jokiniemi, Jorma

    2015-01-01

    Iodine is one of the most radiotoxic fission product released from fuel during a severe nuclear power plant accident. Within the containment building, iodine compounds can react e.g. on the painted surfaces and form gaseous organic iodides. In this study, it was found out that gaseous methyl iodide (CH 3 I) is oxidised when exposed to beta radiation in an oxygen containing atmosphere. As a result, nucleation of aerosol particles takes place and the formation of iodine oxide particles is suggested. These particles are highly hygroscopic. They take up water from the air humidity and iodine oxides dissolve within the droplets. In order to mitigate the possible source term, it is of interest to understand the effect of beta radiation on the speciation of iodine.

  15. Radiolytical oxidation of gaseous iodine by beta radiation

    Energy Technology Data Exchange (ETDEWEB)

    Kaerkelae, Teemu; Auvinen, Ari; Kekki, Tommi; Kotiluoto, Petri; Lyyraenen, Jussi [VTT Technical Research Centre of Finland, Espoo (Finland); Jokiniemi, Jorma [VTT Technical Research Centre of Finland, Espoo (Finland); Eastern Finland Univ., Kuopio (Finland)

    2015-07-01

    Iodine is one of the most radiotoxic fission product released from fuel during a severe nuclear power plant accident. Within the containment building, iodine compounds can react e.g. on the painted surfaces and form gaseous organic iodides. In this study, it was found out that gaseous methyl iodide (CH{sub 3}I) is oxidised when exposed to beta radiation in an oxygen containing atmosphere. As a result, nucleation of aerosol particles takes place and the formation of iodine oxide particles is suggested. These particles are highly hygroscopic. They take up water from the air humidity and iodine oxides dissolve within the droplets. In order to mitigate the possible source term, it is of interest to understand the effect of beta radiation on the speciation of iodine.

  16. 38 CFR 4.126 - Evaluation of disability from mental disorders.

    Science.gov (United States)

    2010-07-01

    ... from mental disorders. 4.126 Section 4.126 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS SCHEDULE FOR RATING DISABILITIES Disability Ratings Mental Disorders § 4.126 Evaluation of disability from mental disorders. (a) When evaluating a mental disorder, the rating agency shall consider the...

  17. Permeation of iodide from iodine-enriched yeast through porcine intestine.

    Science.gov (United States)

    Ryszka, Florian; Dolińska, Barbara; Zieliński, Michał; Chyra, Dagmara; Dobrzański, Zbigniew

    2013-01-01

    Iodine deficiency is a common phenomenon, threatening the whole global human population. Recommended daily intake of iodine is 150 μg for adults and 250 μg for pregnant and breastfeeding women. About 50% of human population can be at risk of moderate iodine deficiency. Due to this fact, increased iodine supplementation is recommended, through intake of iodized mineral water and salt iodization. The aim of this study was to investigate permeation and absorption of iodide from iodine bioplex (experimental group) in comparison with potassium iodide (controls). Permeation and absorption processes were investigated in vitro using a porcine intestine. The experimental model was based on a standard Franz diffusion cell (FD-Cell). The iodine bioplex was produced using Saccharomyces cerevisiae yeast and whey powder: iodine content - 388 μg/g, total protein - 28.5%, total fat - 0.9%., glutamic acid - 41.2%, asparaginic acid - 29.4%, lysine - 24.8%; purchased from: F.Z.N.P. Biochefa, Sosnowiec, Poland. Potassium iodide was used as controls, at 388 μg iodine concentration, which was the same as in iodine-enriched yeast bioplex. A statistically significant increase in iodide permeation was observed for iodine-enriched yeast bioplex in comparison with controls - potassium iodide. After 5h the total amount of permeated iodide from iodine-enriched yeast bioplex was 85%, which is ~ 2-fold higher than controls - 37%. Iodide absorption was by contrast statistically significantly higher in controls - 7.3%, in comparison with 4.5% in experimental group with iodine-enriched yeast bioplex. Presented results show that iodide permeation process dominates over absorption in case of iodine-enriched yeast bioplex.

  18. Role of iodine in pathogenesis of thyroid disease - is induction of apoptosis consequence of iodine cytotoxicity?

    Directory of Open Access Journals (Sweden)

    Marković Ljiljana

    2017-01-01

    Full Text Available Iodine is one of the best-characterized environmental factors associated with autoimmune thyroid disease (ATD. Epidemiological studies have shown that ATD incidence has increased following the introduction of salt iodination in the 1920s; in addition, ATD patients can improve upon iodine restriction. In animal models such as BioBreeding/Worcester and Buffalo rats, obese chicken strain, and non-obese diabetic H-2h4 mice, excess iodine is associated with autoimmunity. Analyses of Hashimoto thyroiditis (HT have shown enlarged number of apoptotic follicular cells, and the destruction is an effect of death receptormediated apoptosis. Excess of iodine induces rapid apoptosis of goitrogen Wistar pretreated rats, possibly connected with inhibition of polyamine synthesis, inhibitors of DNA fragmentation. Percentage of apoptotic cells was statistically higher in patients with HT than in those with euthyroid goiter, with significant increase of caspase 32. Genes for Bcl-2 and Bax proteins are under the transcriptional control of p53. In TAD-2 cell cultures, apoptosis is p53-independed, suggesting that DNA damage is not primarily evoked by potassium iodide (KI. High concentrations of NaI increase the proportion of apoptotic cells in FTRL5 thyroid cell line. Iodide cytotoxicity is inhibited by a TPO inhibitor and is relieved with an anti-oxidant agent. Chronic iodine excess induces apoptosis and necrosis of thyroid follicular and endothelial cells, leading to thyroglobulin accumulation in connective tissue. Iodide excess requires peroxidase enzymatic activity to induce apoptosis. Ionic iodide is not directly toxic, whereas its molecular form I2 mediates the apoptotic effect of KI. [Project of the Serbian Ministry of Education, Science and Technological Development, Grant no. OI-175059

  19. Assessment of Dietary Supplement from Iodine by Milk Intake

    International Nuclear Information System (INIS)

    Labib, A.A.; Labib, A.A.; Challan, B.M.; Challan, B.M.

    2015-01-01

    Low level concentration of iodine was determined in various milk products for adult and baby milk powders by Inductively Coupled Plasma Mass Spectrometry (ICP-MS) method. It is a reliable method for the determination of iodine in milk samples, using alkaline digestion with potassium hydroxide KOH solution in an oven. After digestion, a stabilizer is added and the solution is taken to volume , then filtered and analysed by ICP-MS either directly or after dilution. Samples for investigation were collected from domestic market of Egypt. The detection limits of current Iodine are not affected by interfering from milk gradient. The minimum detection limit (MDL) of about 10 ppb Iodine was achieved. This method showed excellent results for aqueous iodide solutions, although the complex milk digest matrix made the method unsuitable for such samples. So, investigation of the iodine species is achieved through the oxidation and extraction of iodine milk sample s, the digest ion was carried out to control the iodine chemistry. Iodine concentrations ranged from 0.1 7 to 5 .1 mg / kg for various samples , The accuracy of the method ranged from 95 to 100%

  20. Performance of an iodine-fueled radio-frequency ion-thruster

    Science.gov (United States)

    Holste, Kristof; Gärtner, Waldemar; Zschätzsch, Daniel; Scharmann, Steffen; Köhler, Peter; Dietz, Patrick; Klar, Peter J.

    2018-01-01

    Two sets of performance data of the same radio-frequency ion-thruster (RIT) have been recorded using iodine and xenon, respectively, as propellant. To characterize the thruster's performance, we have recorded the radio-frequency DC-power, required for yielding preset values of the extracted ion-beam currents, as a function of mass flow. For that purpose, an iodine mass flow system had to be developed, calibrated, and integrated into a newly-built test facility for studying corrosive propellants. The performance mappings for iodine and xenon differ significantly despite comparable operation conditions. At low mass flows, iodine exhibits the better performance. The situation changes at higher mass flows where the performance of iodine is significantly poorer than that of xenon. The reason is very likely related to the molecular nature of iodine. Our results show that iodine as propellant is compatible with RIT technology. Furthermore, it is a viable alternative as propellant for dedicated space missions. In particular, when taking into account additional benefits such as possible storage as a solid and its low price the use of iodine as propellant in ion thrusters is competitive.

  1. The iodine reactivity; La reactivite de l'iode

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2003-07-01

    The iodine is an important element because it has long life isotopes (such as iodine 129) and a great mobility in natural media. Iodine presents a complex chemistry because of its volatility and its strong redox reactivity. The S.E.C.R. works to better understand the reactivity of this element in different natural, industrial or biological environments. It plays a part in thermochemical sites as a possible way of hydrogen formation. This seminar gives some aspects relative to the chemical reactivity of iodine, since its thermochemistry in the I/S cycles to produce hydrogen to its reactivity in the natural medium and its potential radiological impact. This document includes 4 presentations transparencies dealing with: the {sup 129}I cycle rejected in the low radioactive gaseous and liquid effluents of the La Hague reprocessing plant (C. Frechou); a bibliographic review of iodine retention in soils (F. Bazer-Bachi); the hydrogen production and the iodine/sulfur thermochemical cycle (role of iodine in the process); and the direct characterization by electro-spray ionization mass spectroscopy of iodine fixation by fulvic acids (P. Reiller, B. Amekraz, C. Moulin, V. Moulin)

  2. Iodine Replete among Populations in Nigeria: Is the Population Tending Towards the Development of Iodine Induced Hyperthyroidism (IIH?

    Directory of Open Access Journals (Sweden)

    Onyeaghala A. Augustine

    2017-01-01

    Full Text Available Iodine is a micronutrient which is required for normal thyroid function. The recommended daily intake for iodine is 150 µg, however in pregnant women; higher levels up to 250 µg could be required. Deficiency of iodine in any given population results in iodine deficiency disorder (IDD. Researchers in Nigeria as far back as 1967 had reported the existence of IDD. To combat this public health problem with its associated medical consequences, a policy to ensure salt iodization was enacted. The Nation’s consistent approach to combat IDD was globally recognized and it was adjudged as the only country in Africa that had achieved the goals of sustained elimination of IDD. Although the health benefits derivable from salt iodization seem to outweigh its risk, yet recent epidemiological data are pointing that populations within the country could be tending toward the development of Iodine Induced Hyperthyroidism (IIH, a common disorder associated with salt iodization following chronic iodine deficiency. The need therefore to use evidence based approach to re-examine the County’s iodization policy as well as investigate the impact of salt iodization on thyroid hormone formation, metabolism and associated pathologies becomes very imperative. This could be very helpful in order to prevent the burden of non- communicable disease in a nation already battling with epidemics of various infectious diseases.

  3. Knowledge, attitudes and practices regarding iodine among patients ...

    African Journals Online (AJOL)

    Keywords: hyperthyroidism; iodine; iodised salt; knowledge-attitude-practice study; South Africa ... While iodine deficiency has been reported to facilitate the development ... the health of children if they did not get enough iodine, almost all of the .... in South Africa. The use of local mass media could be considered during the.

  4. Ultrahigh iodine adsorption in porous organic frameworks

    KAUST Repository

    Pei, Cuiying

    2014-01-01

    We present two porous organic frameworks (POFs), PAF-1 and JUC-Z2, with ultrahigh iodine capture capacity. The iodine vapor uptake of PAF-1 and JUC-Z2 were 1.86 g g-1 and 1.44 g g-1 respectively at 298 K per 40 Pa, which is extremely high for such low pressure sorption conditions. In addition, PAF-1 and JUC-Z2 could adsorb iodine over water with the selectivity of 5.1 and 6.5 respectively. The isosteric enthalpy at zero surface coverage, calculated by a virial equation with the iodine vapor sorption isotherms at 298 K and 313 K of JUC-Z2, reached -51.1 kJ mol-1, which was much higher than the coverage of PAF-1 (-14.9 kJ mol-1). Raman measurement confirmed the polyiodide to be I5 - in POFs. Furthermore, solvents with different polarities, such as n-hexane, chloroform, and methanol, were chosen to conduct iodine binding measurements on PAF-1 and JUC-Z2. The formation constant Kf for POFs in n-hexane, chloroform and methanol drastically decreased with the increase in polarity, thus illustrating the important role of solvents in iodine binding. © the Partner Organisations 2014.

  5. Prostate biopsy after definitive treatment by interstitial iodine 125 implant or external beam radiation therapy

    International Nuclear Information System (INIS)

    Schellhammer, P.F.; el-Mahdi, A.M.; Higgins, E.M.; Schultheiss, T.E.; Ladaga, L.E.; Babb, T.J.

    1987-01-01

    The response to definitive radiation therapy of localized carcinoma of the prostate by iodine 125 implantation or external beam radiotherapy was monitored by examining specimens from biopsies performed after treatment. We analyzed 126 biopsy specimens obtained 18 months or more after treatment: 71 were obtained from 109 patients treated by iodine 125 and 55 from 197 patients treated by external beam radiotherapy. Thereafter, the disease status of these patients was examined at minimum 3-year intervals. No significant statistical difference was found between the negative specimen rates of the 2 treatment modalities: 46 of 71 (65 per cent) after iodine 125 implantation and 39 of 55 (71 per cent) after external beam radiotherapy were negative. To analyze the predictive value of biopsy results 103 patients whose prostatic examination results were normal at biopsy or who showed regression of tumor size and tumor induration after radiation were evaluated. The biopsy results from all patients were combined for analysis. Of 77 patients with negative biopsy specimens 16 (21 per cent) have had recurrent disease, compared to 17 of 26 (65 per cent) with positive biopsy specimens (p equals 0.00005). Of the 77 patients with negative biopsy specimens 7 (9 per cent) had local disease recurrence, compared to 12 of 26 (46 per cent) with a positive biopsy specimen (p equals 0.0001). The value of a positive specimen to predict failure remained significant with patients stratified by pre-treatment clinical stage and grade of the disease. Our results show that patients with positive specimens from the prostate who had been judged clinically by rectal examination to have responded to radiation therapy had a significantly increased incidence of local and distant failure compared to patients who had negative biopsy specimens

  6. Predictive modelling of interventions to improve iodine intake in New Zealand.

    Science.gov (United States)

    Schiess, Sonja; Cressey, Peter J; Thomson, Barbara M

    2012-10-01

    The potential effects of four interventions to improve iodine intakes of six New Zealand population groups are assessed. A model was developed to estimate iodine intake when (i) bread is manufactured with or without iodized salt, (ii) recommended foods are consumed to augment iodine intake, (iii) iodine supplementation as recommended for pregnant women is taken and (iv) the level of iodization for use in bread manufacture is doubled from 25-65 mg to 100 mg iodine/kg salt. New Zealanders have low and decreasing iodine intakes and low iodine status. Predictive modelling is a useful tool to assess the likely impact, and potential risk, of nutrition interventions. Food consumption information was sourced from 24 h diet recall records for 4576 New Zealanders aged over 5 years. Most consumers (73-100 %) are predicted to achieve an adequate iodine intake when salt iodized at 25-65 mg iodine/kg salt is used in bread manufacture, except in pregnant females of whom 37 % are likely to meet the estimated average requirement. Current dietary advice to achieve estimated average requirements is challenging for some consumers. Pregnant women are predicted to achieve adequate but not excessive iodine intakes when 150 μg of supplemental iodine is taken daily, assuming iodized salt in bread. The manufacture of bread with iodized salt and supplemental iodine for pregnant women are predicted to be effective interventions to lift iodine intakes in New Zealand. Current estimations of iodine intake will be improved with information on discretionary salt and supplemental iodine usage.

  7. Severe Hypothyroidism From Iodine Deficiency Associated With Parenteral Nutrition.

    Science.gov (United States)

    Golekoh, Marjorie C; Cole, Conrad R; Jones, Nana-Hawa Yayah

    2016-11-01

    Parenteral nutrition is crucial for supply of nutrients in children who cannot tolerate a full enteral diet. In the United States, it is not standard of care to give iodine to children dependent on parenteral nutrition, hence iodine is not routinely included in the micronutrient package. Herein, we present a case of a boy with hypothyroidism secondary to iodine deficiency after prolonged exclusive use of parenteral nutrition. Our case highlights the importance of screening for iodine deficiency and administering timely iodine supplementation in these at-risk children to prevent iatrogenic hypothyroidism. © 2015 American Society for Parenteral and Enteral Nutrition.

  8. Progress towards eliminating iodine deficiency in South Africa

    NARCIS (Netherlands)

    Jooste, P.; Zimmermann, M.B.

    2009-01-01

    Before the introduction of salt iodisation in 1954, South Africa was one of the many countries of the world with a lack of iodine in most of its territory and hence there was a need for a salt iodisation programme. The understanding of the iodine situation in South Africa, the basics of iodine

  9. Active molecular iodine photochemistry in the Arctic.

    Science.gov (United States)

    Raso, Angela R W; Custard, Kyle D; May, Nathaniel W; Tanner, David; Newburn, Matt K; Walker, Lawrence; Moore, Ronald J; Huey, L G; Alexander, Liz; Shepson, Paul B; Pratt, Kerri A

    2017-09-19

    During springtime, the Arctic atmospheric boundary layer undergoes frequent rapid depletions in ozone and gaseous elemental mercury due to reactions with halogen atoms, influencing atmospheric composition and pollutant fate. Although bromine chemistry has been shown to initiate ozone depletion events, and it has long been hypothesized that iodine chemistry may contribute, no previous measurements of molecular iodine (I 2 ) have been reported in the Arctic. Iodine chemistry also contributes to atmospheric new particle formation and therefore cloud properties and radiative forcing. Here we present Arctic atmospheric I 2 and snowpack iodide (I - ) measurements, which were conducted near Utqiaġvik, AK, in February 2014. Using chemical ionization mass spectrometry, I 2 was observed in the atmosphere at mole ratios of 0.3-1.0 ppt, and in the snowpack interstitial air at mole ratios up to 22 ppt under natural sunlit conditions and up to 35 ppt when the snowpack surface was artificially irradiated, suggesting a photochemical production mechanism. Further, snow meltwater I - measurements showed enrichments of up to ∼1,900 times above the seawater ratio of I - /Na + , consistent with iodine activation and recycling. Modeling shows that observed I 2 levels are able to significantly increase ozone depletion rates, while also producing iodine monoxide (IO) at levels recently observed in the Arctic. These results emphasize the significance of iodine chemistry and the role of snowpack photochemistry in Arctic atmospheric composition, and imply that I 2 is likely a dominant source of iodine atoms in the Arctic.

  10. Active molecular iodine photochemistry in the Arctic

    Energy Technology Data Exchange (ETDEWEB)

    Raso, Angela R.; Custard, Kyle D.; May, Nathaniel W.; Tanner, David; Newburn, Matthew K.; Walker, Lawrence R.; Moore, Ronald J.; Huey, L. G.; Alexander, Lizabeth; Shepson, Paul B.; Pratt, Kerri A.

    2017-09-05

    During springtime, the Arctic atmospheric boundary layer undergoes frequent rapid depletions in ozone and gaseous elemental mercury due to reactions with halogen atoms, influencing atmospheric composition and pollutant fate. Although bromine chemistry has been shown to initiate ozone depletion events, and it has long been hypothesized that iodine chemistry may contribute, no previous measurements of molecular iodine (I2) have been reported in the Arctic. Iodine chemistry also contributes to atmospheric new particle formation and therefore cloud properties and radiative forcing. Here we present Arctic atmospheric I2 and snowpack iodide (I-) measurements, which were conducted near Utqiagvik, AK, in February 2014. Using chemical ionization mass spectrometry, I2 was observed in the atmosphere at mole ratios of 0.3–1.0 ppt, and in the snowpack interstitial air at mole ratios up to 22 ppt under natural sunlit conditions and up to 35 ppt when the snowpack surface was artificially irradiated, suggesting a photochemical production mechanism. Further, snow meltwater I-measurements showed enrichments of up to ~1,900 times above the seawater ratio of I-/Na+, consistent with iodine activation and recycling. Modeling shows that observed I2 levels are able to significantly increase ozone depletion rates, while also producing iodine monoxide (IO) at levels recently observed in the Arctic. These results emphasize the significance of iodine chemistry and the role of snowpack photochemistry in Arctic atmospheric composition, and imply that I2 is likely a dominant source of iodine atoms in the Arctic.

  11. Absorption of gaseous iodine by water droplets

    International Nuclear Information System (INIS)

    Albert, M.F.

    1985-07-01

    A new model has been developed for predicting the rate at which gaseous molecular iodine is absorbed by water sprays. The model is a quasi-steady state mass transfer model that includes the iodine hydrolysis reactions. The parameters of the model are spray drop size, initial concentration of the gas and liquid phases, temperature, pressure, buffered or unbuffered spray solution, spray flow rate, containment diameter and drop fall height. The results of the model were studied under many values of these parameters. Plots of concentration of iodine species in the drop versus time have been produced by varying the initial gas phase concentration of molecular iodine over the range of 1 x 10 -5 moles/liter to 1 x 10 -10 moles/liter and a drop size of 1000 microns. Results from the model are compared to results available from Containment Systems Experiments at Pacific Northwest Laboratory. The difference between the model predictions and the experimental data ranges from -120.5% to 68.0% with the closest agreement 7.7%. The new spray model is also compared to previously existing spray models. At high concentrations of gaseous molecular iodine, the new spray model is considered to be less accurate but at low concentrations, the new model predicts results that are closer to the experimental data than the model called the realistic model from WASH-1329. Inclusion of the iodine hydrolysis reaction is shown to be a feature important to a model intended for determining the removal of molecular iodine over a wide range of conditions

  12. Primary circuit iodine model addition to IMPAIR-3

    Energy Technology Data Exchange (ETDEWEB)

    Osetek, D J; Louie, D L.Y. [Los Alamos Technical Associates, Inc., Albuquerque, NM (United States); Guntay, S; Cripps, R [Paul Scherrer Inst. (PSI), Villigen (Switzerland)

    1996-12-01

    As part of a continuing effort to provide the U.S. Department of Energy (DOE) Advanced Reactor Severe Accident Program (ARSAP) with complete iodine analysis capability, a task was undertaken to expand the modeling of IMPAIR-3, an iodine chemistry code. The expanded code will enable the DOE to include detailed iodine behavior in the assessment of severe accident source terms used in the licensing of U.S. Advanced Light Water Reactors (ALWRs). IMPAIR-3 was developed at the Paul Scherrer Institute (PSI), Switzerland, and has been used by ARSAP for the past two years to analyze containment iodine chemistry for ALWR source term analyses. IMPAIR-3 is primarily a containment code but the iodine chemistry inside the primary circuit (the Reactor Coolant System or RCS) may influence the iodine species released into the the containment; therefore, a RCS iodine chemistry model must be implemented in IMPAIR-3 to ensure thorough source term analysis. The ARSAP source term team and the PSI IMPAIR-3 developers are working together to accomplish this task. This cooperation is divided into two phases. Phase I, taking place in 1996, involves developing a stand-alone RCS iodine chemistry program called IMPRCS (IMPAIR -Reactor Coolant System). This program models a number of the chemical and physical processes of iodine that are thought to be important at conditions of high temperature and pressure in the RCS. In Phase II, which is tentatively scheduled for 1997, IMPRCS will be implemented as a subroutine in IMPAIR-3. To ensure an efficient calculation, an interface/tracking system will be developed to control the use of the RCS model from the containment model. These two models will be interfaced in such a way that once the iodine is released from the RCS, it will no longer be tracked by the RCS model but will be tracked by the containment model. All RCS thermal-hydraulic parameters will be provided by other codes. (author) figs., tabs., refs.

  13. Immobilisation of fission iodine by reaction with insoluble natural organic matter

    International Nuclear Information System (INIS)

    Schmett, G.T.; Kimble, G.M.; Steinberg, S.M.; Emerson, D.W.; Cerefice, G.S.

    2005-01-01

    Commercial nuclear power plants produce Iodine-129 ( 129 I) as a fission by-product. Iodine-129, along with other stable isotopes of iodine, is released during the reprocessing of nuclear fuel. Silver-impregnated activated carbon, activated carbon, cinnabar and chalcocite have been used in the past to remove iodide and iodine from waste streams. There is environmental and geological evidence that iodine can become associated with natural organic matter (NOM). For example, a number of previous studies have shown that iodine (including 129 I) can be strongly retained in organic-rich surface soils and humic material. This research explores the use of NOM (sphagnum peat) to sequester iodine from acid vapour and aqueous solution. NOM may be stable for geological storage or the sequestered iodine can be recovered to prepare target materials for transmutation. The nature of the sphagnum iodine association has been explored as well as method that can be used to concentrate and recover sequestered iodine from the peat moss. (authors)

  14. 12 CFR 225.126 - Activities not closely related to banking.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Activities not closely related to banking. 225.126 Section 225.126 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE... Financial Holding Companies Interpretations § 225.126 Activities not closely related to banking. Pursuant to...

  15. Iodine status in the Nordic countries – past and present

    Directory of Open Access Journals (Sweden)

    Helena Filipsson Nyström

    2016-06-01

    Full Text Available Background: Adequate iodine nutrition is dependent on ground water content, seafood, and, as many countries use iodized cow fodder, dairy products. In most countries, salt fortification programs are needed to assure adequate iodine intake. Objectives: The objectives are threefold: 1 to describe the past and present iodine situation in the Nordic countries, 2 to identify important gaps of knowledge, and 3 to highlight differences among the Nordic countries’ iodine biomonitoring and fortification policies. Design: Historical data are compared with the current situation. The Nordic countries’ strategies to achieve recommended intake and urine iodine levels and their respective success rates are evaluated. Results: In the past, the iodine situation ranged from excellent in Iceland to widespread goiter and cretinism in large areas of Sweden. The situation was less severe in Norway and Finland. According to a 1960 World Health Organization (WHO report, there were then no observations of iodine deficiency in Denmark. In Sweden and Finland, the fortification of table salt was introduced 50–75 years ago, and in Norway and Finland, the fortification of cow fodder starting in the 1950s helped improve the population's iodine status due to the high intake of milk. In Denmark, iodine has been added to household salt and salt in bread for the past 15 years. The Nordic countries differ with regard to regulations and degree of governmental involvement. There are indications that pregnant and lactating women, the two most vulnerable groups, are mildly deficient in iodine in several of the Nordic countries. Conclusion: The Nordic countries employ different strategies to attain adequate iodine nutrition. The situation is not optimal and is in need of re-evaluation. Iodine researchers, Nordic national food administrations, and Nordic governmental institutions would benefit from collaboration to attain a broader approach and guarantee good iodine health for all.

  16. Iodine status in the Nordic countries – past and present

    Science.gov (United States)

    Nyström, Helena Filipsson; Brantsæter, Anne Lise; Erlund, Iris; Gunnarsdottir, Ingibjörg; Hulthén, Lena; Laurberg, Peter; Mattisson, Irene; Rasmussen, Lone Banke; Virtanen, Suvi; Meltzer, Helle Margrete

    2016-01-01

    Background Adequate iodine nutrition is dependent on ground water content, seafood, and, as many countries use iodized cow fodder, dairy products. In most countries, salt fortification programs are needed to assure adequate iodine intake. Objectives The objectives are threefold: 1) to describe the past and present iodine situation in the Nordic countries, 2) to identify important gaps of knowledge, and 3) to highlight differences among the Nordic countries’ iodine biomonitoring and fortification policies. Design Historical data are compared with the current situation. The Nordic countries’ strategies to achieve recommended intake and urine iodine levels and their respective success rates are evaluated. Results In the past, the iodine situation ranged from excellent in Iceland to widespread goiter and cretinism in large areas of Sweden. The situation was less severe in Norway and Finland. According to a 1960 World Health Organization (WHO) report, there were then no observations of iodine deficiency in Denmark. In Sweden and Finland, the fortification of table salt was introduced 50–75 years ago, and in Norway and Finland, the fortification of cow fodder starting in the 1950s helped improve the population's iodine status due to the high intake of milk. In Denmark, iodine has been added to household salt and salt in bread for the past 15 years. The Nordic countries differ with regard to regulations and degree of governmental involvement. There are indications that pregnant and lactating women, the two most vulnerable groups, are mildly deficient in iodine in several of the Nordic countries. Conclusion The Nordic countries employ different strategies to attain adequate iodine nutrition. The situation is not optimal and is in need of re-evaluation. Iodine researchers, Nordic national food administrations, and Nordic governmental institutions would benefit from collaboration to attain a broader approach and guarantee good iodine health for all. PMID:27283870

  17. Method of extracting iodine from liquid mixtures of iodine, water and hydrogen iodide

    Science.gov (United States)

    Mysels, Karol J.

    1979-01-01

    The components of a liquid mixture consisting essentially of HI, water and at least about 50 w/o iodine are separated in a countercurrent extraction zone by treating with phosphoric acid containing at least about 90 w/o H.sub.3 PO.sub.4. The bottom stream from the extraction zone is substantially completely molten iodine, and the overhead stream contains water, HI, H.sub.3 PO.sub.4 and a small fraction of the amount of original iodine. When the water and HI are present in near-azeotropic proportions, there is particular advantage in feeding the overhead stream to an extractive distillation zone wherein it is treated with additional concentrated phosphoric acid to create an anhydrous HI vapor stream and bottoms which contain at least about 85 w/o H.sub.3 PO.sub.4. Concentration of these bottoms provides phosphoric acid infeed for both the countercurrent extraction zone and for the extractive distillation zone.

  18. Evaluation of Iodine Bioavailability in Seaweed Using in Vitro Methods.

    Science.gov (United States)

    Domínguez-González, M Raquel; Chiocchetti, Gabriela M; Herbello-Hermelo, Paloma; Vélez, Dinoraz; Devesa, Vicenta; Bermejo-Barrera, Pilar

    2017-09-27

    Due to the high levels of iodine present in seaweed, the ingestion of a large amount of this type of food can produce excessive intake of iodine. However, the food after ingestion undergoes different chemistry and physical processes that can modify the amount of iodine that reaches the systemic circulation (bioavailability). Studies on the bioavailability of iodine from food are scarce and indicate that the bioavailable amount is generally lower than ingested. Iodine in vitro bioavailability estimation from different commercialized seaweed has been studied using different in vitro approaches (solubility, dialyzability, and transport and uptake by intestinal cells). Results indicate that iodine is available after gastrointestinal digestion for absorption (bioaccessibility: 49-82%), kombu being the seaweed with the highest bioaccessibility. The incorporation of dialysis cell cultures to elucidate bioavailability modifies the estimation of the amount of iodine that may reach the systemic circulation (dialysis, 5-28%; cell culture, ≤3%). The paper discusses advantages and drawbacks of these methodologies for iodine bioavailability in seaweed.

  19. Uptake and distribution of organo-iodine in deep-sea corals.

    Science.gov (United States)

    Prouty, Nancy G; Roark, E Brendan; Mohon, Leslye M; Chang, Ching-Chih

    2018-07-01

    Understanding iodine concentration, transport, and bioavailability is essential in evaluating iodine's impact to the environment and its effectiveness as an environmental biogeotracer. While iodine and its radionuclides have proven to be important tracers in geologic and biologic studies, little is known about transport of this element to the deep sea and subsequent uptake in deep-sea coral habitats. Results presented here on deep-sea black coral iodine speciation and iodine isotope variability provides key information on iodine behavior in natural and anthropogenic environments, and its geochemical pathway in the Gulf of Mexico. Organo-iodine is the dominant iodine species in the black corals, demonstrating that binding of iodine to organic matter plays an important role in the transport and transfer of iodine to the deep-sea corals. The identification of growth bands captured in high-resolution scanning electron images (SEM) with synchronous peaks in iodine variability suggest that riverine delivery of terrestrial-derived organo-iodine is the most plausible explanation to account for annual periodicity in the deep-sea coral geochemistry. Whereas previous studies have suggested the presence of annual growth rings in deep-sea corals, this present study provides a mechanism to explain the formation of annual growth bands. Furthermore, deep-sea coral ages based on iodine peak counts agree well with those ages derived from radiocarbon ( 14 C) measurements. These results hold promise for developing chronologies independent of 14 C dating, which is an essential component in constraining reservoir ages and using radiocarbon as a tracer of ocean circulation. Furthermore, the presence of enriched 129 I/ 127 I ratios during the most recent period of skeleton growth is linked to nuclear weapons testing during the 1960s. The sensitivity of the coral skeleton to record changes in surface water 129 I composition provides further evidence that iodine composition and isotope

  20. Uptake and distribution of organo-iodine in deep-sea corals

    Science.gov (United States)

    Prouty, Nancy G.; Roark, E. Brendan; Mohon, Leslye M.; Chang, Ching-Chih

    2018-01-01

    Understanding iodine concentration, transport, and bioavailability is essential in evaluating iodine's impact to the environment and its effectiveness as an environmental biogeotracer. While iodine and its radionuclides have proven to be important tracers in geologic and biologic studies, little is known about transport of this element to the deep sea and subsequent uptake in deep-sea coral habitats. Results presented here on deep-sea black coral iodine speciation and iodine isotope variability provides key information on iodine behavior in natural and anthropogenic environments, and its geochemical pathway in the Gulf of Mexico. Organo-iodine is the dominant iodine species in the black corals, demonstrating that binding of iodine to organic matter plays an important role in the transport and transfer of iodine to the deep-sea corals. The identification of growth bands captured in high-resolution scanning electron images (SEM) with synchronous peaks in iodine variability suggest that riverine delivery of terrestrial-derived organo-iodine is the most plausible explanation to account for annual periodicity in the deep-sea coral geochemistry. Whereas previous studies have suggested the presence of annual growth rings in deep-sea corals, this present study provides a mechanism to explain the formation of annual growth bands. Furthermore, deep-sea coral ages based on iodine peak counts agree well with those ages derived from radiocarbon (14C) measurements. These results hold promise for developing chronologies independent of 14C dating, which is an essential component in constraining reservoir ages and using radiocarbon as a tracer of ocean circulation. Furthermore, the presence of enriched 129I/127I ratios during the most recent period of skeleton growth is linked to nuclear weapons testing during the 1960s. The sensitivity of the coral skeleton to record changes in surface water 129I composition provides further evidence that iodine composition and isotope

  1. Volatile suppressing method for radioactive iodine

    International Nuclear Information System (INIS)

    Ohara, Atsushi; Haruguchi, Keiko.

    1997-01-01

    In the present invention, a metal plate is disposed above the pool water surface of a suppression chamber disposed to a reactor container in order to reduce evaporation of radioactive iodine released from a suppression pool. A metal plate is disposed above the pool water surface of the suppression chamber disposed to the reactor container. In addition, a metal plate is disposed around the space connecting a bent tube extending from a dry well to underwater of suppression pool water and a gas bent tube extending from the suppression chamber to an emergency gas processing system. Spray water is supplied for cooling the suppression chamber d as a means for cooling the metal plate. Then, among iodine released to the suppression chamber, elemental iodine liberated from the pool water is deposited on the surface of the metal plate, and the amount of iodine to be flown into and processed by an emergency gas processing system or a filter bent system can be reduced. (T.M.)

  2. Transmutation of 126Sn in spallation targets of accelerator-driven systems

    International Nuclear Information System (INIS)

    Han, Chi Young; Saito, Masaki; Sagara, Hiroshi

    2009-01-01

    The practical feasibility of 126 Sn transmutation in spallation targets of accelerator-driven systems was evaluated from the viewpoints of accumulation of radioactive spallation products and neutron production as well as transmutation amount of 126 Sn. A cylindrical liquid 126 Sn target whose length depends on proton beam energy was described, based on a Pb-Bi target design of accelerator-driven system being developed in JAEA. A proton beam of 1.5 GeV-20 mA was estimated to give the transmutation rate of 126 Sn 6.4 kg/yr, which corresponds to the amount of 126 Sn annually discharged in 27 LWRs of 1 GWt and 33 GWd/THM. The equilibrium radioactivity of spallation products would reach 9% of that of 126 Sn transmuted in the spallation target, and the equilibrium toxicity would be just 3%. Some parametric analyses showed that the effective half-life of 126 Sn could be reduced through a proper reduction of the target size. The 126 Sn target was calculated to produce 40 neutrons per proton of 1.5 GeV and give a neutron spectrum very similar to that of the reference Pb-Bi target. As a result, the transmutation of 126 Sn in the spallation target has a high feasibility in terms of better transmutation performance and comparable target performance. (author)

  3. Equine goiter associated with excess dietary iodine.

    Science.gov (United States)

    Eroksuz, H; Eroksuz, Y; Ozer, H; Ceribasi, A O; Yaman, I; Ilhan, N

    2004-06-01

    Naturally occurring goiter cases are described in 2 newborn Arabian foals whose mares were supplemented with excess iodine during the final 24 w of the pregnancy. Six nursing foals and 2 mares were also affected clinically with thyroid hypertrophy. At least 12 times the maximum tolerable level of iodine supplementation was given, as the daily iodine intake for each mare was 299 mg. The prevalence of goiter cases was 2 and 9% in the mares and foals, respectively.

  4. A Universal Aptamer Chimera for the Delivery of Functional microRNA-126.

    Science.gov (United States)

    Rohde, Jan-H; Weigand, Julia E; Suess, Beatrix; Dimmeler, Stefanie

    2015-06-01

    microRNAs (miRs) regulate vascular diseases such as atherosclerosis and cancer. miR-126 is important for endothelial cell signaling and promotes angiogenesis, protects against atherosclerosis, and reduces breast cancer cell growth and metastasis. The overexpression of miR-126, therefore, may be an attractive therapeutic strategy for the treatment of cardiovascular disease or cancer. Here we report a novel strategy to deliver miR-126 to endothelial and breast cancer cells. We tested three different strategies to deliver miR-126 by linking the miR to an aptamer for the ubiquitously expressed transferrin receptor (transferrin receptor aptamer, TRA). Linking the precursor of miR-126 (pre-miR-126) to the TRA by annealing of a complementary stick led to efficient uptake and processing of miR-126, resulting in the delivery of 1.6×10(6)±0.3×10(6) copies miR-126-3p per ng RNA in human endothelial cells and 7.4×10(5)±2×10(5) copies miR-126-3p per ng in MCF7 breast cancer cells. The functionality of the active TRA-miR-126 chimera was further demonstrated by showing that the chimera represses the known miR-126 target VCAM-1 and improved endothelial cell sprouting in a spheroid assay. Moreover, the TRA-miR-126 chimera reduced proliferation and paracrine endothelial cell recruitment of breast cancer cells to a similar extent as miR-126-3p mimics introduced by conventional liposome-based transfection. Together, this data demonstrates that pre-miR-126 can be delivered by a non-specific aptamer to exert biological functions in two different cell models. The use of the TRA-miR-126 chimera or the combination of the delivery strategy with other endothelial or tumor specific aptamers may provide an interesting therapeutic option to treat vascular disease or cancers.

  5. Iodination of the humic samples from Hupa project

    International Nuclear Information System (INIS)

    Reiller, P.; Mercier-Bion, F.; Barre, N.; Gimenez, N.; Miserque, F.

    2005-01-01

    Full text of publication follows: Iodine radioactive isotopes, such as 129 I, are important radionuclides due to their significant impact in geological disposal: in the conditions of natural reducing groundwaters, iodine would essentially be present in the form of highly mobile iodide anion. But in shallow waters the presence of molecular iodine is to be taken into account. The interaction of iodine with natural organic matter in general and with humic substances (HS) in particular, has been the subject of numerous studies. It has been shown that in some cases, organically bound iodine can dominate the speciation either as methyl iodide or bound to humic substances [1, 2]. It is now also clear that this reactivity is closely related to the occurrence of molecular iodine I 2 (aq). The reaction scheme can be viewed as an electrophilic substitution of a hydrogen atom by an iodine atom on a phenolic ring. Nevertheless, in some of the latter studies, the characterization of the final reaction products did not satisfy the authors completely as total separation from I - produced during the iodination could not be achieved. Thus, further studies were led using samples from the CCE HUPA project: natural humic and fulvic extract from Gorleben [3] and synthetic samples obtained from FZ Rossendorf [4]. Dialysis procedures were envisaged to improve the incomplete separation between the colloidal humic matter and the iodide ions either unreacted or produced by the reaction [2]. The iodination of these samples were monitored using UV-Visible spectrophotometry. As in previous studies [2], the kinetics could not be linearized in simple order but the trends were conform to simple phenolic patterns. The apparent rates could nevertheless be correlated to the aromaticity (H/C ratio) of the samples. After dialysis, the iodine humic/fulvic interaction was characterised to occur as a carbon-iodine covalent bonding by X-ray photoelectron spectroscopy (XPS) [5]. Electro-spray ionisation

  6. Iodine: It's Important in Patients that Require Parenteral Nutrition

    NARCIS (Netherlands)

    Zimmermann, M.B.

    2009-01-01

    Iodine deficiency has multiple adverse effects on growth and development because of inadequate thyroid hormone production. Four methods are generally recommended for assessment of iodine nutrition: urinary iodine concentration, thyroid size, and blood concentrations of thyroid-stimulating hormone

  7. Studies in iodine metabolism. Progress report, April 1975-- March 1976

    International Nuclear Information System (INIS)

    Van Middlesworth, L.

    1976-01-01

    Investigations during the past twelve months have included the following subjects: factors which influence release of radioiodine from thyroid glands; contamination of commercially available low-iodine diets; effects of hypoxia on release of iodine from thyroid glands of rats and mice; development of practical tests for available iodine in low-iodine diets; reproduction and abnormal thyroglobulin of rats maintained on low-iodine diets; observations on radioactivity in animal thyroids; collaboration with other laboratories regarding radium in bovine thyroids

  8. Acetylcholinesterase triggers the aggregation of PrP 106-126

    International Nuclear Information System (INIS)

    Pera, M.; Roman, S.; Ratia, M.; Camps, P.; Munoz-Torrero, D.; Colombo, L.; Manzoni, C.; Salmona, M.; Badia, A.; Clos, M.V.

    2006-01-01

    Acetylcholinesterase (AChE), a senile plaque component, promotes amyloid-β-protein (Aβ) fibril formation in vitro. The presence of prion protein (PrP) in Alzheimer's disease (AD) senile plaques prompted us to assess if AChE could trigger the PrP peptides aggregation as well. Consequently, the efficacy of AChE on the PrP peptide spanning-residues 106-126 aggregation containing a coumarin fluorescence probe (coumarin-PrP 106-126) was studied. Kinetics of coumarin-PrP 106-126 aggregation showed a significant increase of maximum size of aggregates (MSA), which was dependent on AChE concentration. AChE-PrP 106-126 aggregates showed the tinctorial and optical amyloid properties as determined by polarized light and electronic microscopy analysis. A remarkable inhibition of MSA was obtained with propidium iodide, suggesting that AChE triggers PrP 106-126 and Aβ aggregation through a similar mechanism. Huprines (AChE inhibitors) also significantly decreased MSA induced by AChE as well, unveiling the potential interest for some AChE inhibitors as a novel class of potential anti-prion drugs

  9. SmallSats, Iodine Propulsion Technology, Applications to Low-Cost Lunar Missions, and the Iodine Satellite (iSAT) Project

    Science.gov (United States)

    Dankanich, John W.

    2014-01-01

    Closing Remarks: ?(1) SmallSats hold significant potential for future low cost high value missions; (2) Propulsion remains a key limiting capability for SmallSats that Iodine can address: High ISP * Density for volume constrained spacecraft; Indefinite quiescence, unpressurized and non-hazardous as a secondary payload; (3) Iodine enables MicroSat and SmallSat maneuverability: Enables transfer into high value orbits, constellation deployment and deorbit; (4) Iodine may enable a new class of planetary and exploration class missions: Enables GTO launched secondary spacecraft to transit to the moon, asteroids, and other interplanetary destinations for approximately 150 million dollars full life cycle cost including the launch; (5) ESPA based OTVs are also volume constrained and a shift from xenon to iodine can significantly increase the transfer vehicle change in volume capability including transfers from GTO to a range of Lunar Orbits; (6) The iSAT project is a fast pace high value iodine Hall technology demonstration mission: Partnership with NASA GRC and NASA MSFC with industry partner - Busek; (7) The iSAT mission is an approved project with PDR in November of 2014 and is targeting a flight opportunity in FY17.

  10. Iodine Gas Trapping using Granular Porous Bismuth

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Jae Hwan; Shin, Jin Myeong; Park, Jang Jin; Park, Geun Il [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Yim, Mansung [Korea Advanced Institute of Science and Technology, Daejeon (Korea, Republic of)

    2014-05-15

    {sup 129}I is a radionuclide with a very long half-life of 1.57 Χ 10{sup 7} years and has negative health effects to the human body. Therefore, the emission of {sup 129}I into the air is closely regulated by the Environmental Protection Agency (EPA). Many methods for trapping gaseous {sup 129}I have been developed thus far, including wet scrubbing and adsorption using silver loaded zeolites. Although wet scrubbing can effectively remove iodine, it suffers from corrosion of the vessel due to high concentration of the scrubbing solution. Silver loaded zeolites also show effectiveness in capturing {sup 129}I gas, yet weak thermal stability of physisorbed iodine remains a challenge. We studied a novel and facile method to trap iodine gas using bismuth. Granular bismuth having many pores was synthesized using bismuth nitrate and polyvinyl alcohol as a bismuth precursor and pore forming agent, respectively. Reaction of iodine and our samples resulted in an iodine capturing capacity of more than 2 times that of the commercial grade silver exchanged zeolite (AgX). Granular porous bismuths synthesized using bismuth nitrate and PVA show a promising performance in capturing iodine gas. The use of bismuth in trapping {sup 129}I gas can reduce the process cost as bismuth is cheap. Further study is going on to improve the mechanical property of granular porous bismuths for their easy handling.

  11. Iodine Gas Trapping using Granular Porous Bismuth

    International Nuclear Information System (INIS)

    Yang, Jae Hwan; Shin, Jin Myeong; Park, Jang Jin; Park, Geun Il; Yim, Mansung

    2014-01-01

    129 I is a radionuclide with a very long half-life of 1.57 Χ 10 7 years and has negative health effects to the human body. Therefore, the emission of 129 I into the air is closely regulated by the Environmental Protection Agency (EPA). Many methods for trapping gaseous 129 I have been developed thus far, including wet scrubbing and adsorption using silver loaded zeolites. Although wet scrubbing can effectively remove iodine, it suffers from corrosion of the vessel due to high concentration of the scrubbing solution. Silver loaded zeolites also show effectiveness in capturing 129 I gas, yet weak thermal stability of physisorbed iodine remains a challenge. We studied a novel and facile method to trap iodine gas using bismuth. Granular bismuth having many pores was synthesized using bismuth nitrate and polyvinyl alcohol as a bismuth precursor and pore forming agent, respectively. Reaction of iodine and our samples resulted in an iodine capturing capacity of more than 2 times that of the commercial grade silver exchanged zeolite (AgX). Granular porous bismuths synthesized using bismuth nitrate and PVA show a promising performance in capturing iodine gas. The use of bismuth in trapping 129 I gas can reduce the process cost as bismuth is cheap. Further study is going on to improve the mechanical property of granular porous bismuths for their easy handling

  12. Hyperparathyroidism after radioactive iodine therapy for Graves disease

    International Nuclear Information System (INIS)

    Esselstyn, C.B. Jr.; Schumacher, O.P.; Eversman, J.; Sheeler, L.; Levy, W.J.

    1982-01-01

    The association of external ionizing radiation to the head and neck and the subsequent development of hyperfunctioning parathyroid glands has been documented in recent years. This also has been demonstrated experimentally in animals. Despite the numbers of patients with Graves disease who have been treated with radioactive iodine, there are no reports in the literature of parathyroid surgery for hyperparathyroidism secondary to earlier treatment with radioactive iodine for Graves disease. This report describes the operative and pathologic findings in four patients with hyperparathyroidism. These patients had previously been treated with radioactive iodine for Graves disease. The pathologic findings at surgery included in three cases a single enlarged hyperplastic gland consistent with a parathyroid adenoma. One patient had hyperplasia of all four glands. The two largest glands and halves of the two remaining glands were removed. In a long-term follow-up of children and adolescents treated with radioactive iodine for Graves disease, Levy and Schumacher found calcium elevations in 10 of 159 patients. The increased incidence of hyperparathyroidism following radioactive iodine treatment for Graves disease in children and adolescents would seem several times higher than normal. Whether adults who have radioactive iodine treatment for Graves disease have a similar increase incidence is not known. Meanwhile it would seem reasonable to suggest that patients whose hyperthyroidism is treated with radioactive iodine should have their serum calcium levels determined at 5-year intervals

  13. Testing Iodine as a New Fuel for Cathodes

    Science.gov (United States)

    Glad, Harley; Branam, Richard; Rogers, Jim; Warren, Matthew; Burleson, Connor; Siy, Grace

    2017-11-01

    The objective of this research is to demonstrate the viability of using iodine as an alternative space propulsion propellant. The demonstration requires the testing of a cathode with xenon and then the desired element iodine. Currently, cathodes run on noble gases such as xenon which must be stored in high pressure canisters and is very expensive. These shortcomings have led to researching possible substitutes. Iodine was decided as a suitable candidate because it's cheaper, can be stored as a solid, and has similar mass properties as xenon. In this research, cathodes will be placed in a vacuum chamber and operated on both gases to observe their performance, allowing us to gain a better understanding of iodine's behavior. Several planned projects depend on the knowledge gained from this project, such as larger scaled tests and iodine fed hall thrusters. The tasks of this project included protecting the stainless-steel vacuum chamber by gold plating and Teflon® coating, building a stand to hold the cathode, creating an anode resistant to iodine, and testing the cathode once setup was complete. The successful operation of the cathode was demonstrated. However, the experimental setup proved ineffective at controlling the iodine flow. Current efforts are focused on this problem. REU Site: Fluid Mechanics with Analysis using Computations and Experiments NSF Grant EEC 1659710.

  14. Method of removing iodine and compounds thereof from gaseous effluents

    International Nuclear Information System (INIS)

    Keener, R.L.; Kittle, P.A.

    1976-01-01

    Anion exchange resins including an acrylic backbone formed by the suspension polymerization of a mixture of an acrylic and a crosslinking monomer are useful in the removal of iodine and iodine compounds from gaseous effluents. Removal of radioactive iodine contaminants, particularly alkyl iodine compounds or hydrogen iodine, under extreme conditions, namely temperatures up to 180 0 C and humidities up to 100 percent, from effluents resulting from a major nuclear accident could probably be adsorbed by these resins described herein

  15. Enhanced delivery of iodine for synchrotron stereotactic radiotherapy by means of intracarotid injection and blood-brain barrier disruption: Quantitative iodine biodistribution studies and associated dosimetry

    International Nuclear Information System (INIS)

    Adam, Jean-Francois; Biston, Marie-Claude; Joubert, Aurelie; Charvet, Anne-Marie; Le Bas, Jean-Francois; Esteve, Francois; Elleaume, Helene

    2005-01-01

    Purpose: Synchrotron stereotactic radiotherapy (SSR) is a binary cancer treatment modality that involves the selective accumulation of a high Z element, such as iodine, in tumors, followed by stereotactic irradiation with kilovoltage X-rays from a synchrotron source. The success of SSR is directly related to the absolute amount of iodine achievable in the tumor. The purposes of this preclinical study were to determine whether the delivery of iodine to brain tumor models in rats could be enhanced by the means of its intracarotid injection with or without a hyperosmotic solution and to evaluate corresponding absorbed X-ray doses. Methods and materials: Experiments were performed on four groups of F98 glioma-bearing rats, which received either intracarotid (IC) or intravenous (IV) infusions of a mixture (6 mL in 12 min) of an iodinated contrast agent associated or not with a transient blood-brain barrier opener (mannitol). The mixture volumetric proportions were 8/13 of Iomeron (C = 350 mg/mL) for 5/13 of mannitol or saline, respectively. Absolute iodine concentration kinetic was measured in vivo in the tumor, blood, contralateral and ipsilateral brain, and muscle by monochromatic computed tomography. Associated dosimetry was performed by computing the iodine dose enhancement factor (DEF) in each region and building dose distribution maps by analytical simulations. Results: Infusion of mannitol significantly enhanced iodine tumor uptake compared with the control values (p < 0.0001 and p = 0.0138, for IC and IV protocols, respectively). The mean iodine concentrations (C) reached 20.5 ± 0.98 mg/mL (DEF = 4.1) after administration of iodine and mannitol vs. 4.1 ± 1.2 mg/mL i.c. with serum (DEF = 1.6). The tumor iodine uptakes after jugular injection with mannitol (C = 4.4 ± 2.1 mg/mL, DEF = 1.7) were not significantly different from IC injection of iodine without mannitol (p = 0.8142). The IV injection of iodine with saline led to an iodine concentration in the tumor

  16. Revisiting History: Encountering Iodine Then and Now--A General Chemistry Laboratory to Observe Iodine from Seaweed

    Science.gov (United States)

    Wahab, M. Farooq

    2009-01-01

    The history of the discovery of iodine is retold using brown-colored seaweed found commonly along the ocean shore. The seaweed is ashed at a low temperature and the iodides are extracted into boiling water. The iodides are oxidized in acidic medium. Solvent extraction of iodine by oxidation of iodides as well as simple aqueous extraction of iodide…

  17. Iodine stress corrosion cracking in Zircaloy

    International Nuclear Information System (INIS)

    Andrade, A.H.P. de; Pelloux, R.M.N.

    1983-01-01

    The subcritical growth of iodine-induced cracks in unirradiated Zircaloy plates is investigated as a function of the stress intensity factor K. The testing variables are: crystallographic texture (f-Number), microstructure (grain directionaly), heat treatment (stress relieved vs recrystallized plate), and temperature. The iodine partial pressure is 40Pa. (author) [pt

  18. Thyroid volumes and urinary iodine in German school children.

    Science.gov (United States)

    Rendl, J; Juhran, N; Reiners, C

    2001-01-01

    Several recently published investigations showed a significant improvement in the iodine supply of the German population, but so far Germany is still considered an iodine deficient country. However most of the studies presented do not meet the epidemiological criteria established by WHO, UNICEF and ICCIDD and may therefore suffer from a selection bias with respect to goiter prevalence estimates. School children, owing to their easy recruitment, representativeness of different socio-economic classes and high vulnerability of Iodine deficiency disorders (IDD), are one of the best target groups for surveillance of IDD. In this field study a total of 591 children were investigated. The total sample included 268 females and 323 males aged 7-17 years. The following data were collected: thyroid size by ultrasound, urinary iodine concentration in a first-morning spot urine, weight, height, sex and age. The median urinary iodine concentration of the children was 183 microg/L. The proportion of samples with concentrations below 100 microg/L or below 50 microg/L was 15.4% and 4.3% respectively. Urine samples with high iodine concentrations were also found amounting to 17.3%. Almost all families (97%) declared to use iodized kitchen salt and 19.6% of all children are taking regularly iodine tablets. Application of the WHO/ICCIDD thyroid volume references to the German children resulted in a goiter prevalence of 0.2%, using either age/sex-specific or body surface area (BSA)/sex-specific cut-off values. Comparison with the P97 values of the original normative data of Gutekunst and Martin-Teichert however gives a goiter prevalence of 3% as expected. The thyroid volumes of the children in our study appear comparable with those reported recently for iodine sufficient children from Switzerland and for iodine replete Berlin children and for children with sufficient iodine supply in the region of Leipzig, so that Germany probably has no longer to be considered an iodine deficient

  19. Immobilization of fission iodine by reaction with insoluble natural organic matter

    International Nuclear Information System (INIS)

    Steinberg, S.M.; Schmett, G.T.; Kimble, G.; Emerson, D.W.; Turner, M.F.; Rudin, M.

    2008-01-01

    Iodine-129 is a fission product and highly mobile in the environment. Along with other stable isotopes of iodine, 129 I is released during reprocessing of nuclear fuel and must be trapped to prevent the release of radioactivity to the environment. Past studies have provided evidence that iodine can become associated with natural organic matter (NOM). This research explores the use of NOM (sphagnum peat and humic acid) to sequester iodine from the vapor and aqueous phases. NOM-associated iodine may be stable for geological storage. NOM-sequestered iodine can be recovered by pyrolysis to prepare target materials for transmutation. The nature of the NOM-iodine association has been explored. (author)

  20. Estimation of iodine in soils by neutron activation analysis

    International Nuclear Information System (INIS)

    Krishnamoorthy, K.R.; Iyer, R.K.

    1982-01-01

    This paper reports the determination of the iodine content of soils by neutron activation analysis. The irradiated sample is fused with alkali in presence of 131 I tracer. From the aqueous extract, iodine activity is extracted into carbon tetrachloride and stripped back to aqueous phase with a high selectivity for iodine. 131 I tracer is used to measure chemical yield. Iodine contents in the range 1 to 20 ppm. have been determined by this technique. (author)

  1. Iodine excretion during stimulation with rhTSH in differentiated thyroid carcinoma

    International Nuclear Information System (INIS)

    Loeffler, M.; Weckesser, M.; Franzius, C.; Kies, P.; Schober, O.

    2003-01-01

    Aim: Elevated iodine intake is a serious problem in the diagnostic and therapeutic application of 131 iodine in patients with differentiated thyroid cancer. Therefore, iodine avoidance is necessary 3 months in advance. Additionally, endogenous stimulation requires withdrawal of thyroid hormone substitution for 4 weeks. Exogenous stimulation using recombinant human TSH (rhTSH) enables the continuous substitution of levothyroxine, which contains 65.4% of its molecular weight in iodine. Thus, a substantial source of iodine intake is maintained during exogenous stimulation. Although this amount of stable iodine is comparable to the iodine intake in regions of normal iodine supply, it may reduce the accumulation of radioiodine in thyroid carcinoma tissue. The aim of this study was to assess the iodine excretion depending on different ways of stimulation. Methods: Iodine excretion was measured in 146 patients in the long term follow up after differentiated thyroid carcinoma. Patients were separated into 2 groups, those on hormone withdrawal (G I) and rhTSH-stimulated patients on hormone substitution (G II). Results: Iodine excretion was significantly lower in hypothyroid patients (G I, median 50 μg/l, range: 25-600 μg/l) than in those under levothyroxine medication (G II, median 75 μg/l, 25-600 μg/l, p [de

  2. Iodine intake in human nutrition: a systematic literature review

    Directory of Open Access Journals (Sweden)

    Ingibjörg Gunnarsdottir

    2012-10-01

    Full Text Available The present literature review is a part of the NNR5 project with the aim of reviewing and updating the scientific basis of the 4th edition of the Nordic Nutrition Recommendations (NNR issued in 2004. The main objective of the review is to assess the influence of different intakes of iodine at different life stages (infants, children, adolescents, adults, elderly, and during pregnancy and lactation in order to estimate the requirement for adequate growth, development, and maintenance of health. The literature search resulted in 1,504 abstracts. Out of those, 168 papers were identified as potentially relevant. Full paper selection resulted in 40 papers that were quality assessed (A, B, or C. The grade of evidence was classified as convincing, probable, suggestive, and no conclusion. We found suggestive evidence for improved maternal iodine status and thyroid function by iodine supplementation during pregnancy. Suggestive evidence was found for the relationship between improved thyroid function (used as an indicator of iodine status during pregnancy and cognitive function in the offspring up to 18 months of age. Moderately to severely iodine-deficient children will probably benefit from iodine supplementation or improved iodine status in order to improve their cognitive function, while only one study showed improved cognitive function following iodine supplementation in children from a mildly iodine-deficient area (no conclusion. No conclusions can be drawn related to other outcomes included in our review. There are no new data supporting changes in dietary reference values for children or adults. The rationale for increasing the dietary reference values for pregnant and lactating women in the NNR5 needs to be discussed in a broader perspective, taking iodine status of pregnant women in the Nordic countries into account.

  3. Transport of Iodine Species in the Terrestrial Environment

    International Nuclear Information System (INIS)

    Hu, Q; Moran, J E; Zhao, P

    2003-01-01

    The fate and transport of iodine in the environment is of interest because of the large production and release of 129 I from anthropogenic sources. 129 I has a long half-life (1.57 x 10 7 years) and exhibits complex geochemical behavior. The main source of 129 I in the environment is from nuclear fuel reprocessing facilities; about 2,600 kg from facilities in England and France. During 1944-1972, the Hanford Site in Washington state released about 260 kg 129 I. Iodine has a unique and complex chemistry in the environment, and its fate and transport in aqueous environments is dictated by its chemical speciation. In reducing environments, aqueous iodine usually occurs as the highly mobile iodide anion (I - ). Under more oxidizing conditions, iodine may be present as the more reactive iodate anion (IO 3 - ), which could lead to retarded transport through interaction with clays and organic matter. Co-existing iodine species (I - , IO 3 - , I 2 , and organoiodine compounds), in different proportions, has been reported in various terrestrial environments. However, there are conflicting reports regarding the environmental behavior of the different types of inorganic iodine and few publications on organic iodine compounds. This work examines the sorption and transport behavior of both inorganic and organic iodine species in geological samples from several complexes of the U.S. Department of Energy, where transport of radionuclides, including 129 I, may occur. Experiments on soils and sediments from the Savannah River Site in South Carolina, Oak Ridge Site in Tennessee, Hanford Site in Washington, Livermore Site 300 in California, and a surface soil from Santa Fe in New Mexico near Los Alamos were carried out. Samples from Savannah River Site and Livermore Site 300 are available from different depths. In addition, a surface soil of Wisconsin with a high amount of organic matter is utilized. This wide variety of sample types provides opportunities to examine the influence of

  4. Povidone-Iodine-Based Polymeric Nanoparticles for Antibacterial Applications.

    Science.gov (United States)

    Gao, Tianyi; Fan, Hongbo; Wang, Xinjie; Gao, Yangyang; Liu, Wenxin; Chen, Wanjun; Dong, Alideertu; Wang, Yan-Jie

    2017-08-09

    As microbial contamination is becoming more and more serious, antibacterial agents play an important role in preventing and removing bacterial pathogens from microbial pollution in our daily life. To solve the issues with water solubility and antibacterial stability of PVP-I 2 (povidone-iodine) as a strong antibacterial agent, we successfully obtain hydrophobic povidone-iodine nanoparticles (povidone-iodine NPs) by a two-step method related to the advantage of nanotechnology. First, the synthesis of poly(N-vinyl-2-pyrrolidone-co-methyl methacrylate) nanoparticles, i.e., P(NVP-MMA) NPs, was controlled by tuning a feed ratio of NVP to MMA. Then, the products P(NVP-MMA) NPs were allowed to undergo a complexation reaction with iodine, resulting in the formation of a water-insoluble antibacterial material, povidone-iodine NPs. It is found that the feed ratio of NVP to MMA has an active effect on morphology, chemical composition, molecular weight, and hydrophilic-hydrophobic properties of the P(NVP-MMA) copolymer after some technologies, such as SEM, DLS, elemental analysis, 1 H NMR, GPC, and the contact angle test, were used in the characterizations. The antibacterial property of povidone-iodine NPs was investigated by using Escherichia coli (E. coli), Staphylococcus aureus (S. aureus), and Pseudomonas aeruginosa (P. aeruginosa) as model bacteria with the colony count method. Interestingly, three products, such as glue, ink, and dye, after the incorporation of povidone-iodine NPs, show significant antibacterial properties. It is believed that, with the advantage of nanoscale morphology, the final povidone-iodine NPs should have great potential for utilization in various fields where antifouling and antibacterial properties are highly required.

  5. Evaluation method of iodine re-evolution from an in-containment water pool after a loss of coolant accident, Part II: Evaluation of pH and iodine re-evolution

    International Nuclear Information System (INIS)

    Kim, Tae Hyeon; Jeong, Ji Hwan

    2016-01-01

    Highlights: • It is required to evaluate re-evolved iodine from sump water after LOCA. • Transport of iodine and chemicals influencing pH were analyzed using CFD. • Chemical conditions of the iodine-rich region suppress iodine re-evolution. • The current evaluation method for I 2 re-evolution is excessively conservative. - Abstract: Radioactive iodine that is released during a postulated loss of coolant accident is dissolved into the containment spray water and transported into the in-containment refueling water storage tank (IRWST). The re-evolution of iodine from the water is a safety concern. In this study, three-dimensional computational fluid dynamics (CFD) analyses are conducted in order to analyze the transport of chemical species including iodine in the IRWST and to calculate the amount of iodine that re-evolves from the IRWST water. The CFD analyses demonstrate that the pH of water is high where the iodine concentration is high. Considering that the creation rate of molecular iodine declines as the pH increases, it can be understood that the iodine re-evolution is not so strong in practical situations because the chemical conditions of the iodine-rich region suppress the re-evolution of the iodine. In addition, four different methods for evaluating the amount of re-evolved iodine are examined. The amount of re-evolved iodine calculated using the total-volume-average values, which are currently used for safety analyses, appear to be significantly higher than those determined using other methods. The amount of re-evolved iodine estimated using a realistic method with a conservative assumption of volatilization appears to be approximately one thousandth of that evaluated using the current method. This implies that the current method is very conservative.

  6. The study of iodine in Chinese total diets

    International Nuclear Information System (INIS)

    Hou, Xiaolin; Chai, Chifang; Qian, Qinfang; Liu, Guodong; Zhang, Yongbao; Wang, Ke

    1997-01-01

    In this work, China was divided into four area groups according to their geographical positions and dietary habits. All foods were divided into 12 types and the iodine contents in various diets were determined using epithermal neutron activation analysis (NAA). The intakes for China were evaluated. The results indicate that the intakes of iodine in northern areas are slightly higher and in south areas lower than the lowest recommended intake, and the average intake in China is 166 μg/person per day, which is within the recommended range. In addition, one province was chosen from each area groups. The dietary intakes of iodine were investigated in different ages and sex using total mixed diet method. Our results indicate that the average iodine intake of four provinces was lower than the recommended value, which suggests that it is necessary to supplement iodine in foods in China

  7. The iodized salt programme in Bangalore, India provides adequate iodine intakes in pregnant women and more-than-adequate iodine intakes in their children

    NARCIS (Netherlands)

    Jaiswal, N.; Boonstra, A.; Sharma, S.K.; Srinivasan, K.; Zimmerman, M.B.

    2015-01-01

    Objective To compare the iodine status of pregnant women and their children who were sharing all meals in Bangalore, India. Design A cross-sectional study evaluating demographic characteristics, household salt iodine concentration and salt usage patterns, urinary iodine concentrations (UIC) in women

  8. Deep Bed Iodine Sorbent Testing FY 2011 Report

    International Nuclear Information System (INIS)

    Soelberg, Nick; Watson, Tony

    2011-01-01

    Nuclear fission results in the production of fission products (FPs) and activation products that increasingly interfere with the fission process as their concentrations increase. Some of these fission and activation products tend to evolve in gaseous species during used nuclear fuel reprocessing. Analyses have shown that I129, due to its radioactivity, high potential mobility in the environment, and high longevity (half life of 15.7 million years), can require control efficiencies of up to 1,000x or higher to meet regulatory emission limits. Deep-bed iodine sorption testing has been done to evaluate the performance of solid sorbents for capturing iodine in off-gas streams from nuclear fuel reprocessing plants. The objectives of the FY 2011 deep bed iodine sorbent testing are: (1) Evaluate sorbents for iodine capture under various conditions of gas compositions and operating temperature (determine sorption efficiencies, capacities, and mass transfer zone depths); and (2) Generate data for dynamic iodine sorption modeling. Three tests performed this fiscal year on silver zeolite light phase (AgZ-LP) sorbent are reported here. Additional tests are still in progress and can be reported in a revision of this report or a future report. Testing was somewhat delayed and limited this year due to initial activities to address some questions of prior testing, and due to a period of maintenance for the on-line GC. Each test consisted of (a) flowing a synthetic blend of gases designed to be similar to an aqueous dissolver off-gas stream over the sorbent contained in three separate bed segments in series, (b) measuring each bed inlet and outlet gas concentrations of iodine and methyl iodide (the two surrogates of iodine gas species considered most representative of iodine species expected in dissolver off-gas), (c) operating for a long enough time to achieve breakthrough of the iodine species from at least one (preferably the first two) bed segments, and (d) post-test purging

  9. Recovery and storage method for radioactive iodine by vacuum freeze-drying

    International Nuclear Information System (INIS)

    Otsuka, Katsuyuki; Ouchi, Hitoshi; Suzuki, Toru.

    1990-01-01

    After scrubbing off-gas formed in a re-processing process for spent nuclear fuels, scrubbing liquids after use are subjected, as they are or with addition of additives, to a precipitating treatment. Then, liquid wastes containing radioactive iodine was subjected to freeze-drying treatment by freeze-drying under vacuum to recover radioactive iodine as iodine compounds. Off-gas scrubbing is conducted by using a sodium hydroxide solution and copper or silver ions may be added as additives in the precipitating treatment. Recovered iodine compounds containing radioactive iodine are solidified, either directly or after formulating into a composition of naturally existing iodine-containing ores by means of high pressure pressing into ores. This can prevent radioactive iodine 1 29I of long half-decay time from diffusing into the circumference and store the radioactive iodine stably for a long period of time. (T.M.)

  10. Study of iodine removal efficiency in self-priming venturi scrubber

    International Nuclear Information System (INIS)

    Ali, Majid; Yan, Changqi; Sun, Zhongning; Gu, Haifeng; Wang, Junlong

    2013-01-01

    Highlights: ► Study of iodine removal efficiency in a self-priming venturi scrubber. ► Investigation of iodine removal efficiency at different gas and liquid flow rates. ► Investigation of different inlet concentrations of iodine. ► Mathematical model based on mass transfer. - Abstract: Venturi scrubber is used in filtered vented containment system of nuclear power plants to remove the gaseous pollutants from contaminated gas during severe accidents. In this research, an experimental and theoretical investigation has been carried out to study the iodine removal efficiency in a self-priming venturi scrubber. The aqueous solution is prepared by adding weight percentage of sodium hydroxide 0.5% and sodium thiosulphate 0.2% in scrubbing water to increase the absorbance of inorganic iodine (I 2 ) from the contaminated gas during emission. The iodine removal efficiency is investigated at various gas and liquid flow rates, and iodine inlet concentrations. The iodine removal efficiency is measured experimentally by measuring the inlet and outlet concentration of iodine at sampling ports. The petite droplets are formed in a venturi scrubber to absorb the iodine through the mass transfer phenomenon. A mathematical model for mass transfer based on a gas liquid interface is employed for the verification of experimental results. The contact time between iodine and scrubbing solution depends on the total volumetric flow of gas and liquid, and volume of throat and diffuser of the venturi scrubber. Sauter mean diameter is calculated from the Nukiyama and Tanasawa correlation. Steinberger and Treybal’s correlation is used to measure the mass transfer coefficient for the gas phase. The results calculated from the model under predict the experimental data

  11. Investigations concerning the exchange of iodine from non-volatile organic iodine compounds

    International Nuclear Information System (INIS)

    Psarros, N.; Duschner, H.; Molzahn, D.; Schmidt, L.; Heise, S.; Jungclas, H.; Brandt, R.; Patzelt, P.

    1990-10-01

    The iodine produced by nuclear fission is removed during the reprocessing of exhausted nuclear fuel elements by desorption achieving good decontamination factors. Nevertheless the further optimization of the process requires detailed information about the iodine speciation during fuel reprocessing, and about possible reactions. For the study of decomposition reactions of iodo-alcanes, which are built up during the fuel recycling process, we developed a method for the synthesis of labelled iodo-dodecane, which was used as tracer. In order to identify the iodo species in the organic phase of the reprocessing cycle we applied plasma desorption time-of-flight mass spectroscopy. The problem of the volatility of the iodo-compounds in the ultra vacuum of the mass spectrometer was overcome by derivatization of the iodo-alcanes with dithizon, which yielded non-volatile ionic alcyltetrazolium iodides. Beta-spectrometric analysis of the exhaust condensates collected from the organic phase of the WAK reprocessing cycle revealed beside iodine-129 the existence of a low-energetic beta emitter, which has yet to be identified. A literature survey on the topic was also performed. (orig.) With 42 refs., 9 figs [de

  12. Low cost iodine intercalated graphene for fuel cells electrodes

    Science.gov (United States)

    Marinoiu, Adriana; Raceanu, Mircea; Carcadea, Elena; Varlam, Mihai; Stefanescu, Ioan

    2017-12-01

    On the theoretical predictions, we report the synthesis of iodine intercalated graphene for proton exchange membrane fuel cells (PEMFCs) applications. The structure and morphology of the samples were characterized by X-ray photoelectron spectroscopy (XPS) analysis, specific surface area by BET method, Raman investigations. The presence of elemental iodine in the form of triiodide and pentaiodide was validated, suggesting that iodine was trapped between graphene layers, leading to interactions with C atoms. The electrochemical performances of iodinated graphenes were tested and compared with a typical PEMFC configuration, containing different Pt/C loading (0.4 and 0.2 mg cm-2). If iodinated graphene is included as microporous layer, the electrochemical performances of the fuel cell are higher in terms of power density than the typical fuel cell. Iodine-doped graphenes have been successfully obtained by simple and cost effective synthetic strategy and demonstrated new insights for designing of a high performance metal-free ORR catalyst by a scalable technique.

  13. Photostop of iodine atoms from electrically oriented ICl molecules

    International Nuclear Information System (INIS)

    Bao Da-Xiao; Lian-Zhong Deng; Xu Liang; Yin Jian-Ping

    2015-01-01

    The dynamics of photostopping iodine atoms from electrically oriented ICl molecules was numerically studied based on their orientational probability distribution functions. Velocity distributions of the iodine atoms and their production rates were investigated for orienting electrical fields of various intensities. For the ICl precursor beams with an initial rotational temperature of ∼ 1 K, the production of the iodine atoms near zero speed will be improved by about ∼ 5 times when an orienting electrical field of ∼ 200 kV/cm is present. A production rate of ∼ 0.5‰ is obtained for photostopped iodine atoms with speeds less than 10 m/s, which are suitable for magnetic trapping. The electrical orientation of ICl precursors and magnetic trapping of photostopped iodine atoms in situ can be conveniently realized with a pair of charged ring magnets. With the maximal value of the trapping field being ∼ 0.28 T, the largest trapping speed is ∼ 7.0 m/s for the iodine atom. (paper)

  14. QUALIMETRIC QUALITY ASSESSMENT OF IODINE SUPPLEMENTS

    Directory of Open Access Journals (Sweden)

    F. S. Bazrova

    2015-01-01

    Full Text Available The article discusses the new iodine-containing supplements (ID derived from organic media collagenous animal protein (pork rind, carpatina and collagen and protein concentrates brands SCANGEN and PROMIL C95. It is shown that the use of these proteins as carriers of iodine is due to the high content of the amino acids glycine and alanine, which correlates with the degree of binding of iodine objects. New additives in addition to the special focus improve rheological properties of foods, including texture, appearance and functional properties. To assess the quality'ID and selection of preferred option the proposed qualitative assessment and a systematic approach to consider all'ID as a system to allocate its elements, to justify the principles of its construction and the requirements imposed on it, to build a General decision tree. For the construction of complex criterion for assessing the quality'ID proposed procedure formalization based on selection and evaluation of individual indicators, the definition of the laws of their change, depending on the dose, duration and temperature of exposure, and functional efficiency. For comparative evaluation of single and calculation of group indicators all of them were reduced to a single dimension by introducing the dimensionless coefficients of adequately describing the analyzed indicators. The article presents the calculated values of single and group of indicators characterizing technological properties 'ID: the degree of binding of iodine, the binding rate of iodine, heat losses of iodine and basic functional and technological properties of meat stuffing systems (water-binding, moisture-holding, emulsifying capacity and emulsion stability, obtained by the introduction of stuffing in the system studied'ID. At the final stage is the selection of the best 'ID, on the basis of an assessment of group performance.

  15. 21 CFR 558.295 - Iodinated casein.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Iodinated casein. 558.295 Section 558.295 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL DRUGS... in Animal Feeds § 558.295 Iodinated casein. (a) Approvals. See 017762 in § 510.600(c) of this chapter...

  16. Seaweed tablet: a natural source of iodine

    International Nuclear Information System (INIS)

    Briones, Annabelle V.; Ambal, Wilhelmina O.; Monroyo, Evangelina C.; Bonifacio, Teresita S.; Sison, Fe M.

    1997-01-01

    Species of seaweeds namely: Halymenia durvillaei, Laurencia flexilis and Sargassum gigantifolium were processed into dried form and formulated as tablet. Prior to tablet formulation, the seaweeds were assayed for iodine and trace elements. The seaweeds that exhibited significance values of iodine and trace elements were further analyzed for the presence of heavy metals followed by acute oral toxicity test (LD 50 ). Among the seaweeds evaluated, H. durvilaei was found to contain high level of iodine (0.255% w/w) and magnesium (1.65% w/w) with sufficient amount of zinc (25.69 ppm) and phosporous (11.68 ppm). Analysis of heavy metals showed minute amount of mercury (0.0055 ppm), cadmium (0.67 ppm) and lead (1.80 ppm). The median lethal dose (LD 50 ) of H. durvillaei administered orally in Swiss male mice is 119.1489 ± 4.9873 g/kg. Tablet formulation was based on the U.S. recommended daily allowance of 0.15 mg. of iodine per adult and children. The final product was comparable to imported Kelp pills (available in the local market) in terms of physical properties and iodine content. (Author)

  17. Spectroscopic study of 126I via incomplete fusion reaction

    International Nuclear Information System (INIS)

    Kanagalekar, B.A.; Das, Pragya; Kumar, Vinod; Kumar, R.; Singh, R.P.; Muralithar, S.; Bhowmik, R.K.

    2006-01-01

    The experiment at Inter University Accelerator Centre consisted of identifying the yrast high-spin states of 126 I using the incomplete fusion reaction 124 Sn ( 10 B, α4n) 126 I at beam energy of 70 MeV

  18. Experimental study of iodine removal efficiency in self-priming venturi scrubber

    International Nuclear Information System (INIS)

    Gulhane, N.P.; Landge, A.D.; Shukla, D.S.; Kale, S.S.

    2015-01-01

    Highlights: • Fabrication, erection of experimental set up and carrying out experimentation with self priming venturi scrubber. • Predicting solubility of iodine in water and its pH dependency. • Increasing pH of water increases iodine removal efficiency. • Maximum iodine removal efficiency is obtained at 10 pH of water using sodium thiosulphate. - Abstract: The objective of present experimental study is to examine the iodine removal efficiency of a self-priming venturi scrubber for submerged operating condition. The venturi scrubber is used in Containment Filtered Venting System of nuclear power plants to remove the gaseous pollutants from contaminated gas during severe accidents. The experiment consists of mixing the iodine vapours with the air using suction venturi and pressure cooker system. The purpose of iodine mixing with air is to examine scrubbing performance of the designed venturi scrubber with water as scrubbing liquid. The performance parameters of venturi scrubber are expressed mainly in terms of pressure drop and iodine removal efficiency. The iodine removal efficiency of venturi scrubber is estimated for a series of two experiments by measuring the quantity of iodine in water from iodometric titration with four distinct pH of water. It has been experimentally observed that iodine removal efficiency is improved by using higher pH value of scrubbing liquid since solubility of iodine gets improved at higher pH

  19. Prophylactic iodine in two Tasmanian cultures in an otherwise moderately iodine-deficient environment

    International Nuclear Information System (INIS)

    Richards, P.A.C.

    1998-01-01

    Full text: The incidence of goitre in two separate cultural groups in Tasmania, the island State of Australia, is discussed, firstly on the basis of serendipitous iodine prophylaxis by a ''primitive race'' (Tasmanian Aborigine), and secondly the deliberate dietary supplementation by European occupation in the 20th Century. The Tasmanian Aborigine did not suffer from goitre. Cultural habits that included diet and craft enabled them to avoid this disease in an otherwise moderately iodine-deficient environment. Following an extended occupation since 1803, and with an eventual change in dietary habit, loss of traditional craft and culture, the population that survived both the introduction of European diseases and incarceration succumbed to goitre that was evidenced in the last half of the 19th Century. This paper explores the reasons why the Tasmanian Aborigines did not develop goitre until after European occupation. It also highlights the fortuitious introduction of iodine as a prophylactic measure in the prevention of goitre in the State of Tasmania during the second half of the 20th Century

  20. 17 CFR 1.26 - Deposit of instruments purchased with customer funds.

    Science.gov (United States)

    2010-04-01

    ... purchased with customer funds. 1.26 Section 1.26 Commodity and Securities Exchanges COMMODITY FUTURES TRADING COMMISSION GENERAL REGULATIONS UNDER THE COMMODITY EXCHANGE ACT Customers' Money, Securities, and Property § 1.26 Deposit of instruments purchased with customer funds. (a) Each futures commission merchant...

  1. 22 CFR 126.2 - Temporary suspension or modification of this subchapter.

    Science.gov (United States)

    2010-04-01

    ... subchapter. 126.2 Section 126.2 Foreign Relations DEPARTMENT OF STATE INTERNATIONAL TRAFFIC IN ARMS REGULATIONS GENERAL POLICIES AND PROVISIONS § 126.2 Temporary suspension or modification of this subchapter. The Deputy Assistant Secretary for Defense Trade Controls or the Managing Director, Directorate of...

  2. Iodine. Do we need an enrichment program in Denmark?

    DEFF Research Database (Denmark)

    Rasmussen, Lone Banke; Andersson, G.; Haraldsdottir, J.

    1996-01-01

    A working group was established to evaluate the need for iodine enrichment in Denmark. Judged from studies of urinary iodine excretion and one dietary survey the intake of iodine in Denmark is low compared with recommended intakes. The occurrence of non-toxic goitre is relatively high; between 9...

  3. Rapid-micro-determination of iodine in water

    International Nuclear Information System (INIS)

    Godin, J.M.; Archimbaud, M.

    1967-03-01

    A method is described for detecting one microgram of iodine per litre of water. After having tested manually volumetric and colorimetric methods, the authors chose a kinetic method. Reduction of arsenious oxide by ceric sulphate is catalyzed by the presence of small quantities of iodine. Failure of manual tests led to the adoption of a Technicon auto-analyzer for carrying out the determination; this improves the reproducibility of the method and gives a sensitivity of about 1 microgram of iodine per litre with an accuracy of ±15 per cent. (authors) [fr

  4. INFLUENCE OF IODINATED OIL AND MARGARINE ON THE THYROID SYSTEM OF RATS

    Directory of Open Access Journals (Sweden)

    Rodica A. Sturza

    2008-06-01

    Full Text Available Iodine deficiency is the most prevalent micronutrient deficiency in the world today. Food fortification is an important compliment to food-based approaches, and iodine fortification of foods as one of the strategies for the control of iodine deficiency. Manufacturing and consumption of sunflower oil fortified with iodine as well as derivative products on it basis is a perspective direction for elimination of alimentary dependent iodine deficiency disorders. The present work examines morphological changes in the thyroid system of rats at the experimental mercatholile-induced hypothyroidism. As well it determines the influence of iodinated oil and margarine on the thyroid system of rats. It specifies the safe value of iodinated oil and margarine for rats. In-vivo study demonstrated the efficacy of fortification of lipid products with iodine under iodine deficiency status.

  5. Iodine and human health, the role of environmental geochemistry and diet, a review

    International Nuclear Information System (INIS)

    Fuge, Ron; Johnson, Christopher C.

    2015-01-01

    Iodine is an essential element in the human diet and a deficiency can lead to a number of health outcomes collectively termed iodine deficiency disorders (IDD). The geochemistry of iodine is dominated by its volatility with volatilisation of organo-iodine compounds and elemental iodine from biological and non-biological sources in the oceans being a major component of its global cycle. As a result of the dominant oceanic source, iodine is strongly enriched in near-coastal soils, however, the major zone of marine influence generally stretches to only 50–80 km inland and terrestrial sources of volatilised iodine, from wetlands, soils and plants are also an important aspect of its global geochemical cycle. Iodine in soils is strongly bound with transfer factors from soil to plants being generally small and as a consequence there is only limited uptake of iodine through the plant root system. It is likely that uptake of atmospheric iodine by the aerial parts of plants is an essential process and, along with iodine deposited on plant surfaces, is a major source for grazing animals. Human intake of iodine is mainly from food with some populations also obtaining appreciable quantities of iodine from drinking water. Plant-derived dietary iodine is generally insufficient as evidenced from the low dietary iodine of strict vegan diets. Seafood provides major iodine-rich dietary items but other inputs are mainly from adventitious sources, such as the use of iodised salt and from dairy produce, which is a rich source mainly due to cattle-feed being fortified with iodine, and to the use of iodine-containing sterilants in the dairy industry. While the distribution and geochemistry of iodine are reflected in the global distribution of IDD, the recent upsurge of IDD in developed countries would seem to reflect changes in diet. - Highlights: • Iodine is an ultra-trace element in the lithosphere. • Volatilisation from marine and terrestrial sources is vital in iodine's global

  6. Iodine in different food articles and standard reference materials

    International Nuclear Information System (INIS)

    Dermelj, M.; Slejkovec, Z.; Byrne, A.R.; Stegnar, P.; Stibilj, V.; Rossbach, M.

    1990-01-01

    The greater part of essential iodine enters living organisms via the food chain. Nevertheless, quantitative data on its concentration in diets, food articles and also in available SRMs are very poor and scarce. This and WHO recommendations on daily allowances of iodine for man via food articles caused an added demand for accurate and reliable determination of iodine in these samples. From this point of view the purpose of the present was to analyse and to establish the concentration levels of total iodine in some food articles, diets, SRMs and candidate reference materials by the use of rapid radiochemical separation, developed in our laboratory. The results were checked by the analysis of SRMs with available certified values for iodine and good agreement is evident. (orig.)

  7. Co-60 gamma radiation assisted diffusion of iodine in polypropylene

    Energy Technology Data Exchange (ETDEWEB)

    Mathakari, N.L.; Bhoraskar, V.N. [Microtron Accelerator Laboratory, Department of Physics, University of Pune, Pune, Maharashtra 411007 (India); Dhole, S.D., E-mail: sanjay@physics.unipune.ernet.i [Microtron Accelerator Laboratory, Department of Physics, University of Pune, Pune, Maharashtra 411007 (India)

    2010-09-15

    Thin films of polypropylene having dimensions 50 mm x 15 mm x 350 {mu}m were immersed in 1 N iodine solution and then irradiated with Co-60 gamma radiation for the periods of 48, 96 and 144 h at the doses varying from 14.4 to 43.2 kGy. The films were also kept immersed in iodine solution for similar periods but without irradiation. Furthermore, the films were also directly-irradiated with Co-60 gamma radiation for similar periods and doses. The radiation-iodinated, plain-iodinated and directly-irradiated samples were characterized by using various techniques such as weight gain EDS, SEM, FTIR, UV-visible spectroscopy, contact angle and XRD. Weight gain, EDS and SEM collectively reveal that gamma irradiation enhances iodine intake in polypropylene. FTIR, EDS and contact angle measurements indicate that presence of iodine during irradiation resists radiation induced carbonylation of polypropylene. FTIR also shows presence of HOI (Hypoiodous acid) species instead of expected C-I bonds. UV-visible analysis unambiguously shows that presence of iodine enhances radiation induced band gap reduction process of polypropylene. XRD indicates that iodine decreases the crystallinity of polypropylene.

  8. Iodine Supplementation for Pediatric Patients Receiving Long-Term Parenteral Nutrition.

    Science.gov (United States)

    Santoro, Jonathan D; Nespor, Colleen; Poole, Robert L; Kerner, John A

    2016-04-01

    Patients dependent on parenteral nutrition (PN) are among a group at risk of developing iodine deficiency. Supplementation with iodine in this population has been debated in a number of studies, resulting in variable clinical practices. The Committee on Clinical Practice Issues of the American Society for Clinical Nutrition recommends a dose of 1 mcg/kg/d of parenteral iodine for patients receiving PN. At our institution, PN trace elements do not include iodine, although this is not the case internationally. Our study sought to assess iodine levels and thyroid function in a cohort of PN-dependent pediatric patients. A retrospective analysis studied 32 pediatric patients with a variety of medical diagnoses who received PN as a primary means of nutrition for 6 months or longer. Patients received variable proportions of their total caloric intake as PN, which ranged from 14%-100%. Iodine and thyroid function levels were obtained by serum sampling. No patient in our cohort of 32 demonstrated thyroid dysfunction or developed iodine deficiency. The length of time on PN and the percentage of total nutrition intake as PN were not associated with iodine levels (P Parenteral and Enteral Nutrition.

  9. Iodine uptake by spinach (Spinacia oleracea L.) plants grown in solution culture: effects of iodine species and solution concentrations.

    Science.gov (United States)

    Zhu, Y-G; Huang, Y-Z; Hu, Y; Liu, Y-X

    2003-04-01

    A hydroponic experiment was carried out to investigate the effects of iodine species and solution concentrations on iodine uptake by spinach (Spinacia oleracea L.). Five iodine concentrations (0, 1, 10, 50 and 100 microM) for iodate (IO(3)(-)) and iodide (I(-)) were used. Results show that higher concentrations of I(-) (> or =10 microM) had some detrimental effect on plant growth, while IO(3)(-) had little effect on the biomass production of spinach plants. Increases in iodine concentration in the growth solution significantly enhanced I concentrations in plant tissues. The detrimental effect of I(-) on plant growth was probably due to the excessively high accumulation of I in plant tissues. The solution-to-spinach leaf transfer factors (TF(leaf), fresh weight basis) for plants treated with iodide were between 14.2 and 20.7 at different solution concentrations of iodide; TF(leaf) for plants treated with iodate decreased gradually from 23.7 to 2.2 with increasing solution concentrations of iodate. The distribution coefficients (DCs) of I between leaves and roots were constantly higher for plants treated with iodate than those treated with iodide. DCs for plants treated with iodide increased with increasing solution concentrations of iodide, while DCs for plants treated with iodate (around 5.5) were similar across the range of solution concentrations of iodate used in this experiment. The implications of iodine accumulation in leafy vegetables in human iodine nutrition are also discussed. Copyright 2002 Elsevier Science Ltd.

  10. Method and composition for removing iodine from gases

    International Nuclear Information System (INIS)

    French, J.A.; O'Hara, D.K.; Pasha, M.

    1980-01-01

    A method and composition for removing iodine and organic iodides from an iodine-containing off-gas stream is provided. The composition for the removal is a ceramic material impregnated with a mixture of a metallic salt with a water-soluble secondary amine. The method for removing the iodine and iodide is accomplished by passing the off-gas stream over the ceramic impregnated with the metallic salt-amine mixture

  11. Investigation of alumino-phosphate glasses for iodine conditioning

    International Nuclear Information System (INIS)

    Lemesle, T.

    2013-01-01

    Iodine 129 is a long-lived intermediate level radioactive waste, which is currently managed by isotopic dilution. In view of an alternative management by geological disposal, we aimed at developing phosphate glasses of the AgI-Ag 2 O-P 2 O 5 -Al 2 O 3 system, elaborated at low temperature and without iodine volatilization. Alumina is expected to induce crosslinking of the phosphate network and thus to improve the thermal and chemical properties. To define a glass composition that meets the specifications, we varied the level of iodine, the Ag 2 O/P 2 O 5 ratio and alumina content. For 1 g.cm -3 of iodine, SEM-EDS observations indicate that alumina solubility is limited to 0.5% mol., independently of Ag 2 O/P 2 O 5 ratio. The structural study by 31 P, 27 Al and 109 Ag MAS NMR, shows that aluminum adopts an octahedral coordination that effectively contributes to the crosslinking of the glassy network and iodine is incorporated without clustering. 31 P- 27 Al NMR correlations confirmed the presence of an alumino-phosphate network, and 31 P- 31 P correlations indicate that iodine does not change the connectivity of the glass network. The glass composition 28,8AgI-44,2Ag 2 O-26,5P 2 O 5 -0,5Al 2 O 3 presents the best compromise between the level of incorporation of iodine and the chemical durability, has a glass transition temperature of 123 C and an initial alteration rate in pure water at 50 C of 6 g.m -2 .d -1 . The long-term behavior of this glass is controlled by a post-alteration structure based on pyrophosphate, which holds nearly 80% of the initial iodine. (author) [fr

  12. Process for removing a mixture containing iodine and alkyl iodine compounds from a gas phase or aqueous solution with ion-exchange resins

    Energy Technology Data Exchange (ETDEWEB)

    Shimizu, H; Mizuuchi, A; Yokoyama, F

    1968-10-04

    Iodine and alkyl iodine compounds are removed from a gas phase or aqueous solution containing salts, iodine and iodine compounds, such as the ambient gas in a reactor, if an accident should occur. The process comprises contacting the phase or solution: (a) with a hydrogen type strongly acidic cationic exchange resin, (b) with an anionic exchange resin containing quarternary ammonium and (c) with an anionic exchange resin containing free basic type tertiary amine, in this order or by reversing the order of the two anionic exchange resins. Although no problems arise in the liquid phase reaction, the ion-exchange resins in the gas phase reaction are desired in the moist state in order to stable maintain the migration speed of the materials to be removed regardless of the relative humidity of the amibent gas. In example I, Amberlite IRA-900 of 200 mm thickness as the lowermost bed, Amberlite IRA93 of 200 mm thickness as the middle bed and Amberlite 200 of 200 mm thickness as the uppermost bed were filled respectively, in a methacrylate resin cylinder with an inner diameter of 25 mm. A solution containing 15.9 mg/1 of iodine, 41.2 mg/1 of methyl iodide and 550 mg/1 of sodium carbonate flows at a rate of 15 liter/hr downward through the beds. As a result of testing, no iodine, iodine ions, iodic acid ions and methyl iodine were detected. The amount of water the beds could treat was 60 times the total quantity of the filled resins.

  13. The Standard, Intervention Measures and Health Risk for High Water Iodine Areas

    Science.gov (United States)

    Liu, Peng; Liu, Lixiang; Shen, Hongmei; Jia, Qingzhen; Wang, Jinbiao; Zheng, Heming; Ma, Jing; Zhou, Dan; Liu, Shoujun; Su, Xiaohui

    2014-01-01

    Our study aims to clarify the population nutrient status in locations with different levels of iodine in the water in China; to choose effective measurements of water improvement(finding other drinking water source of iodine not excess) or non-iodised salt supply or combinations thereof; to classify the areas of elevated water iodine levels and the areas with endemic goiter; and to evaluate the risk factors of water iodine excess on pregnant women, lactating women and the overall population of women. From Henan, Hebei, Shandong and Shanxi province of China, for each of 50∼99 µg/L, 100∼149 µg/L, 150∼299 µg/L, and ≥300 µg/L water iodine level, three villages were selected respectively. Students of 6–12 years old and pregnant were sampled from villages of each water-iodine level of each province, excluded iodized salt consumer. Then the children's goiter volume, the children and pregnant's urinary iodine and water iodine were tested. In addition, blood samples were collected from pregnant women, lactating women and other women of reproductive age for each water iodine level in the Shanxi Province for thyroid function tests. These indicators should be matched for each person. When the water iodine exceeds 100 µg/L; the iodine nutrient of children are iodine excessive, and are adequate or more than adequate for the pregnant women. It is reasonable to define elevated water iodine areas as locations where the water iodine levels exceed 100 µg/L. The supply of non-iodised salt alone cannot ensure adequate iodine nutrition of the residents, and water improvement must be adopted, as well. Iodine excess increases the risk of certain thyroid diseases in women from one- to eightfold. PMID:24586909

  14. CFD Analyses of Re-Evolved Iodine from an In-containment Water Pool

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Tae Hyeon [KHNP CRI, Daejeon (Korea, Republic of); Yoon, Woo Sung; Jung, Ji Hwan [Pusan National University, Busan (Korea, Republic of)

    2016-10-15

    A good understanding of the behavior of iodine is required to evaluate the safety and emergency procedures after a LOCA. The quantity of re-evolved iodine is related to pH level, temperature, and iodine concentration of water pool. In the calculation of pH for water pool, sequence calculations must consider this variable if any aqueous iodine is present, even if it is initially present in stable forms. The present study consists of two parts: the pH evaluation and the evaluation of the iodine re-evolution. The current paper focuses on the pH evaluation method, the development of a user-defined function (UDF) and the iodine re-evolution from the water pool. CFD that incorporates the UDF was used in this study to calculate the local pH level in the transient condition. The amount of re-evolved iodine was calculated based on the iodine concentration, temperature, and pH. The transportation and resulting distribution of the iodine concentration, temperature, and pH were calculated using transient analyses with CFD. The quantity of reevolved iodine was obtained with several assumptions. The quantitative evaluation of re-evolved iodine during a LOCA in a commercial nuclear power plants is done in two stages. The first stage is to calculate the pH in the water pool, and the second stage is to calculate the quantity of re-evolved iodine. Evaporated iodine, from the water pool water to the containment atmosphere, can be estimated from characteristic iodine behaviors and pH calculations. The 3D CFD analysis results show that the pH reached 7.0 after 149.5 minutes. Near the spillway, the change in averaged pH was faster than the change in wholevolume averaged pH. Evaluating the amount of reevolved iodine were examined using four different methods. As a result of our evaluation of iodine reevolution, the initial molecular iodine concentration of a water pool has a significant impact on the amount of gaseous iodine, more so than the pH or temperature, due to the locally similar

  15. CFD Analyses of Re-Evolved Iodine from an In-containment Water Pool

    International Nuclear Information System (INIS)

    Kim, Tae Hyeon; Yoon, Woo Sung; Jung, Ji Hwan

    2016-01-01

    A good understanding of the behavior of iodine is required to evaluate the safety and emergency procedures after a LOCA. The quantity of re-evolved iodine is related to pH level, temperature, and iodine concentration of water pool. In the calculation of pH for water pool, sequence calculations must consider this variable if any aqueous iodine is present, even if it is initially present in stable forms. The present study consists of two parts: the pH evaluation and the evaluation of the iodine re-evolution. The current paper focuses on the pH evaluation method, the development of a user-defined function (UDF) and the iodine re-evolution from the water pool. CFD that incorporates the UDF was used in this study to calculate the local pH level in the transient condition. The amount of re-evolved iodine was calculated based on the iodine concentration, temperature, and pH. The transportation and resulting distribution of the iodine concentration, temperature, and pH were calculated using transient analyses with CFD. The quantity of reevolved iodine was obtained with several assumptions. The quantitative evaluation of re-evolved iodine during a LOCA in a commercial nuclear power plants is done in two stages. The first stage is to calculate the pH in the water pool, and the second stage is to calculate the quantity of re-evolved iodine. Evaporated iodine, from the water pool water to the containment atmosphere, can be estimated from characteristic iodine behaviors and pH calculations. The 3D CFD analysis results show that the pH reached 7.0 after 149.5 minutes. Near the spillway, the change in averaged pH was faster than the change in wholevolume averaged pH. Evaluating the amount of reevolved iodine were examined using four different methods. As a result of our evaluation of iodine reevolution, the initial molecular iodine concentration of a water pool has a significant impact on the amount of gaseous iodine, more so than the pH or temperature, due to the locally similar

  16. Iodine deficiency status and iodised salt consumption in Malaysia: findings from a national iodine deficiency disorders survey.

    Science.gov (United States)

    Selamat, Rusidah; Mohamud, Wan Nazaimoon Wan; Zainuddin, Ahmad Ali; Rahim, Nor Syamlina Che Abdul; Ghaffar, Suhaila Abdul; Aris, Tahir

    2010-01-01

    A nationwide cross-sectional school-based survey was undertaken among children aged 8-10 years old to determine the current iodine deficiency status in the country. Determination of urinary iodine (UI) and palpation of the thyroid gland were carried out among 18,012 and 18,078 children respectively while iodine test of the salt samples was done using Rapid Test Kits and the iodometric method. The results showed that based on WHO/ ICCIDD/UNICEF criteria, the national median UI was 109 μg/L [25th, 75th percentile (67, 166)] showing borderline adequacy. The overall national prevalence of iodine deficiency disorders (IDD) with UIMalaysia using adequately iodised salt as recommended by Malaysian Food Act 1983 of 20-30 ppm was only 6.8% (95% CI: 5.1, 9.0). In conclusion, although a goitre endemic was not present in Malaysia, almost half of the states in Peninsular Malaysia still have large proportion of UI level review on the current approach of the national IDD prevention and control programme.

  17. An estimation of the risk for the use of stable iodine in radiation protection in an iodine deficient population

    International Nuclear Information System (INIS)

    Gloebel, B.; Gloebel, H.; Muth, H.; Andres, C.

    1982-01-01

    The radiation risk of the thyroid is estimated by use of data from the literature and our investigations. Comparing these results with the statistical incidence of radiation evoked diseases the risk of a patient to develop thyroid carcinoma receiving 50 μCi 131 I for thyroid diagnostics is about tenfold compared to the spontaneous risk with a twofold risk to develop hypothyroidism. Using sup(99m)Tc or 123 I these risks are minimized to a small percentage. For technicians in the RIA lab or during labelling of proteins the thyroid's radiation risk can be diminished by ingestion of inactive iodine, however, this procedure includes new risks of iodine side-effects. Comparing the pharmacological risks of iodine intake and the radiation risk it seems to be useful to suggest iodine prophylaxis when the expected radiation dose exceeds 10 rad in the thyroid. (author)

  18. Improved iodine and tritium control in reprocessing plants

    International Nuclear Information System (INIS)

    Henrich, E.; Schmieder, H.; Roesch, W.; Weirich, F.

    1981-01-01

    During spent fuel processing, iodine and tritium are distributed in many aqueous, organic and gaseous process streams, which complicates their control. Small modifications of conventional purex flow sheets, compatible with processing in the headend and the first extraction cycle are necessary to confine the iodine and the tritium to smaller plant areas. The plant area connected to the dissolver off-gas (DOG) system is suited to confine the iodine and the plant area connected to the first aqueous cycle is suited to confine the tritium. A more clear and convenient iodine and tritium control will be achieved. Relevant process steps have been studied on a lab or a pilot plant scale using I-123 and H-3 tracer

  19. Contamination of pasture by iodine 131

    International Nuclear Information System (INIS)

    Angeletti, Livio

    1980-08-01

    The reassessment of the experimental data on the transfer of iodine to aerial parts of rye-gras leads to the following significant findings: 1 - Water content of herbage depending markedly on time and location, the contamination of the vegetals has to be expressed on a dry weight basis. 2 - The value of the geometrical mean of the deposition velocity of iodine vapour as derived from 19 experiments carried out over 4 years is 0.76 cm/s. This value agrees very well with the value of V(d)=0.80 obtained in the USA during experiments comparable as to the number of tests and their duration. Consequently we propose a value of V(d)=0.76 cm/s for the evaluation of pasture land contamination by iodine resulting from routine releases. For accidental releases, however, we propose a value of V(d)=2 cm/s, which was the upper limit in about 90% of our experimental results. 3 - The analysis of data on wet deposition of iodine on the aerial parts of rye-grass shows that the initial retention when expressed as percent of the total deposit decreases with aspersion intensities. If expressed as retention factor, the initial retention is constant, for all aspersion intensities. The average initial iodine retention being lower by a factor of 2.3 than water retention the value of the latter will therefore be the upper limit for this radionuclide [fr

  20. Iodine intake as a determinant of thyroid disorders in populations

    DEFF Research Database (Denmark)

    Laurberg, Peter; Cerqueira, Charlotte; Ovesen, Lars

    2010-01-01

    Depending on the availability of iodine, the thyroid gland is able to enhance or limit the use of iodine for thyroid hormone production. When compensation fails, as in severely iodine-deficient populations, hypothyroidism and developmental brain damage will be the dominating disorders. This is, out...... of all comparison, the most serious association between disease and the level of iodine intake in a population. In less severe iodine deficiency, the normal thyroid gland is able to adapt and keep thyroid hormone production within the normal range. However, the prolonged thyroid hyperactivity associated...... with such adaptation leads to thyroid growth, and during follicular cell proliferation there is a tendency to mutations leading to multifocal autonomous growth and function. In populations with mild and moderate iodine deficiency, such multifocal autonomous thyroid function is a common cause of hyperthyroidism...

  1. Capacity and degree of iodine absorbed and enriched by vegetable from soil.

    Science.gov (United States)

    Weng, Huan-Xin; Weng, Jing-Ke; Yong, Wen-Bin; Sun, Xiang-Wu; Zhong, Hang

    2003-01-01

    To understand the biogeochemical transfer of iodine, the absorbability and bioaccumulation of iodine in tested vegetables (radish, spinach and Chinese cabbage) are examined by applying iodic fertilizer composed of kelp and diatomaceous earth. The experimental results show that when iodine in soil is not excessive, the concentrations of iodine in tested vegetables increase as the content of iodine in soil increases. The absorbability and enrichment degree of iodine in various vegetables and in various parts of the same vegetable a redifferent, which explains that the concentration of iodine in plant is determined by the plant type and the physiological action of plant. The patience order of tested vegetables to excessive iodine is Chinese cabbage > spinach > radish. These results have theoretical and practical significance in opening up a new way for ameliorating poor iodine environment with artificial means.

  2. 13 CFR 126.204 - May a qualified HUBZone SBC have affiliates?

    Science.gov (United States)

    2010-01-01

    ... affiliates? 126.204 Section 126.204 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION HUBZONE PROGRAM Requirements to be a Qualified HUBZone SBC § 126.204 May a qualified HUBZone SBC have affiliates? A concern may have affiliates provided that the aggregate size of the concern and all of its...

  3. Introduction to Test Facility for Iodine Retention in Filtered Containment Venting System

    Energy Technology Data Exchange (ETDEWEB)

    Jung, Jaehoon; An, Sang Mo; Ha, Kwang Soon; Kim, Hwan Yeol [KAERI, Daejeon (Korea, Republic of)

    2015-05-15

    In many countries the implementation of FCVS's is under discussion to mitigate fission product release not only in the short-term but also in the long-term view. To verify the performance of FCVS, the large-scaled tests have been performed such as advanced containment experiments (ACE), the iodine and aerosol retention rate test facility (JAVA), etc. The elemental and organic iodides are the main gaseous iodine species in the containment atmosphere. For the iodine retention, experimental programs have confirmed the existence of gaseous organic iodine in some cases in higher concentrations than for gaseous molecular iodine (I{sub 2}). The Reaction of Methyl iodide (CH{sub 3}I) with surfaces and the removal by containment filters and scrubbers is less efficient in comparison to molecular iodine. In the recent years, an experimental and analytical work has been conducted at the Paul Scherrer Institute (PSI) to develop a process leading to a fast, comprehensive and reliable retention of volatile iodine species in aqueous solutions. New FCVS test facility to verify the performance of FCVS is designed and under construction. The iodine retention tests are planned with elemental iodine or with organic iodide loaded carrier gas consisting of pure non-condensable gas, pure steam and of typical mixtures of non-condensable gas/steam. This paper introduces the iodine generation and measurement system for the iodine retention test of FCVS. In severe accidents elemental and organic iodides are the main gaseous iodine species in the containment atmosphere. Release of the gaseous species in sufficient quantities from containment to environment generates a risk for public health. The filtered containment venting systems (FCVS) can considerably reduce the leakage of radioactive materials to the environment. New integral test facility is prepared to verify a performance of the FCVS. The test facility consists of a test vessel, thermal-hydraulic, and aerosol/iodine generation and

  4. Sensitive determination of iodine species, including organo-iodine, for freshwater and seawater samples using high performance liquid chromatography and spectrophotometric detection

    International Nuclear Information System (INIS)

    Schwehr, Kathleen A.; Santschi, Peter H.

    2003-01-01

    In order to more effectively use iodine isotope ratios, 129 I/ 127 I, as hydrological and geochemical tracers in aquatic systems, a new high performance liquid chromatography (HPLC) method was developed for the determination of iodine speciation. The dissolved iodine species that dominate natural water systems are iodide, iodate, and organic iodine. Using this new method, iodide was determined directly by combining anion exchange chromatography and spectrophotometry. Iodate and the total of organic iodine species are determined as iodide, with minimal sample preparation, compared to existing methods. The method has been applied to quantitatively determine iodide, iodate as the difference of total inorganic iodide and iodide after reduction of the sample by NaHSO 3 , and organic iodine as the difference of total iodide (after organic decomposition by dehydrohalogenation and reduction by NaHSO 3 ) and total inorganic iodide. Analytical accuracy was tested: (1) against certified reference material, SRM 1549, powdered milk (NIST); (2) through the method of standard additions; and (3) by comparison to values of environmental waters measured independently by inductively coupled plasma mass spectrometry (ICP-MS). The method has been successfully applied to measure the concentrations of iodide species in rain, surface and ground water, estuarine and seawater samples. The detection limit was ∼1 nM (0.2 ppb), with less than 3% relative standard deviation (R.S.D.) for samples determined by standard additions to an iodide solution of 20 nM in 0.1 M NaCl. This technique is one of the few methods sensitive enough to accurately quantify stable iodine species at nanomolar concentrations in aquatic systems across a range of matrices, and to quantitatively measure organic iodine. Additionally, this method makes use of a very dilute mobile phase, and may be applied to small sample volumes without pre-column concentration or post-column reactions

  5. Assessment of iodine deficiency in school going children in Abbottabad - Pakistan

    International Nuclear Information System (INIS)

    Iqbal, N.; Shah, S.M.; Bano, S.

    1999-01-01

    A bout 1628 school going children were surveyed for the assessment of iodine deficiency in school going children in Abbottabad city, The purpose of this survey was to find out prevalence of goiter, severity of iodine deficiency and iodine content of the salts used by the people of the area. It was found that total goiter rate (TGR) was 23.9%. Among males 176 (23.1%) and among females 214 (24.7) were suffering from goiter, On the basis of urinary iodine (UI) 5.2% children were facing severe. Analysis of salts provided by students showed that 58.8% families were using salts with recommended level of iodine while the remaining 41-2% families were using salts with inadequate quantity of iodine. It is clear iodine deficiency is still a major public health problem in the area and most of the people in the area do not use iodized salt with recommended level of iodine. (A.B.)

  6. Measurements and Modelling of Reactive Iodine Oxides in the Coastal MBL

    Science.gov (United States)

    Najera, J. J.; Bloss, W. J.

    2012-04-01

    The release of iodine compounds into the marine atmosphere can affect a number of aspects of atmospheric composition: Iodine species can participate in catalytic ozone destruction cycles, which may be augmented by bromine species; reactions of iodine compounds can perturb the OH:HO2 and NO:NO2 ratios, heterogeneous loss of reservoir compounds such as HOI and INO3 can lead to removal of HOx and NOx, and higher iodine oxides can contribute to the formation and/or growth of aerosol particles. In this work, we focus upon understanding the effect of the spatial distribution of iodine emissions upon local HOx and NOx levels in the immediate vicinity of a coastal sites, using new observations to re-evaluate previous field campaign data. We present an analysis of results from a new instruments which measures point inorganic iodine species concentrations. The technique of resonance fluorescence (RF) is employed for the detection of iodine atoms, and the total photolabile iodine content. Measurements made at Mace Head, Ireland during July-August 2007 and May 2011 are presented. A detailed 1-dimensional photochemical box model is employed in a lagrangian sense to simulate the evolving chemical composition of an air column advected across the coastal margin. The model is compared with the observed iodine species, and then used to explore the transient response of the NOx and HOx families at the Mace Head site to heterogeneous iodine emissions: The transit time between the intertidal iodine emission zone and the shoreline site where previous measurements of HOx, NOx etc. have been made is insufficient for steady-state to become established, although this assumption has been used in earlier model studies of such data. Finally, we consider the limitations in our ability to quantify the impacts of iodine chemistry, which arise from uncertainties in the iodine kinetics and photochemistry - for example, what is the atmospheric lifetime of inorganic iodine ? - and explore their

  7. [Field study on the change of urinary iodine levels among family members with iodine content of 5 - 150 microg/L in drinking water before and after non-iodized salt intervention].

    Science.gov (United States)

    Li, Su-mei; Zhang, Gen-hong; Sun, Fan; Wang, Pei-hua; Zhang, Zhi-zhong; Li, Xiu-wei; Li, Shu-hua

    2008-08-01

    To compare the changes of urinary iodine levels among the family members with iodine content of 5 - 150 microg/L in drinking water, before and after non-iodized salt intervention through a field trail study. Family members who routinely drank water with iodine content 5 - 150 microg/L were chosen to substitute non-iodized salt for their current iodized salt for 2 months, and urine samples of the family members were collected for determination of iodine change before and after intervention was carried out. Median urinary iodine of school children, women with productive age and male adults exceeding 370 microg/L before intervention and the frequency distribution of urinary iodine were all above 70%. Our results revealed that iodine excess exited in three groups of family members. After intervention, all median urinary iodine level seemed to have decreased significantly, and groups with drinking water iodine 5.0 - 99.9 microg/L reduced to adequate or close to adequate while the group that drinking water iodine was 100 - 150 microg/L reached the cut-off point of excessive iodine level (300 microg/L). Results from your study posed the idea that the iodine adequate areas should be defined as the areas with iodine content of 5.0 - 100 microg/L in drinking water, and edible salt not be iodized in these areas. Areas with iodine content of 100 - 150 microg/L in drinking water should be classified as iodine excessive.

  8. Iodine deficiency status of school going children in coastal region of bangladesh

    International Nuclear Information System (INIS)

    Sayedur Rahman Miah; Chowdhury Habibur Rasul; Ashoke Kumar Paul

    2004-01-01

    Objective: Bangladesh is an iodine deficient zone, affected mainly in the northern part i.e., in Himalayan belt along Brahmaputra and Jamuna River. Severity of' iodine deficiency can be assessed by prevalence of goitre and urinary iodine excretion. The latest nationwide survey of Iodine Deficiency Disorders of' Bangladesh in 1993 showed prevalence of goitre 47.1% in all age and sex group and 69% of the population had urinary iodine excretion 100 mcg/L. Conclusion: On the basis of goitre prevalence and urinary iodine excretion, coastal region of Bangladesh is a mild iodine deficient zone. (authors)

  9. Mercury and Iodine systematics of volcanic arc fluids

    Science.gov (United States)

    Varekamp, J. C.; Kading, T.; Fehn, U.; Lu, Z.

    2008-12-01

    The mantle has low Mercury and Iodine concentrations, but these elements occur in volcanic gases and hydrothermal fluids at ppb (Hg) and ppm (Iodine) levels. Possibly, the Hg and Iodine concentrations in volcanic fluids reflect subducted sediment sources in arc magmas. Iodine is a biophilic element, and I129/I values indicate that subducted sediment (especially organic matter) is an important Iodine source for arc magmas. It is uncertain if this is true for Hg as well, although in the surface environment Hg is commonly associated with organic matter. We present 60 new analyses of Hg and I in fluids from volcanoes in Central America, New Zealand, Japan, and the Cascades. A first assessment suggests that Iodine is released to some degree in the early stage of subduction in the forearc, whereas Hg may be released largely below the main volcanic arc. Isotope and trace element signatures of volcanic rocks of the investigated volcanoes show no simple correlation with Hg or Iodine abundances. The acid hot spring fluids of Copahue volcano (Argentina) carried ~ 200 ppt Hg in January 1999, ~80 ppt Hg in March 2008, and 90 ppt Hg in the crater lake in March 1997. The dissolved Hg fluxes from the Copahue hydrothermal system are ~300 gr Hg/year in 1999 and ~130 gr Hg/year in 2008. The bulk hydrothermal Hg flux (particle bound+dissolved) in 2008 was ~ 350 gr Hg/year. The potential Mercury evasion from these hydrothermal spring fluids into the air has not yet been incorporated in these estimates.

  10. Studies of iodine adsorption and desorption on HTGR coolant circuit materials

    International Nuclear Information System (INIS)

    Osborne, M.F.; Compere, E.L.; de Nordwall, H.J.

    1976-04-01

    Safety studies of the HTGR system indicate that radioactive iodine, released from the fuel to the helium coolant, may pose a problem of concern if no attenuation of the amount of iodine released occurs in the coolant circuit. Since information on iodine behavior in this system was incomplete, iodine adsorption on HTGR materials was studied in vacuum as a function of iodine pressure and of adsorber temperature. Iodine coverages on Fe 3 O 4 and Cr 2 O 3 approached maxima of about 2 x 10 14 and 1 x 10 14 atoms/cm 2 , respectively, whereas the iodine coverage on graphite under similar conditions was found to be less by a factor of about 100. Iodine desorption from the same materials into vacuum or flowing helium was investigated, on a limited basis, as a function of iodine coverage, of adsorber temperature, and of dry vs wet helium. The rate of vacuum desorption from Fe 3 O 4 was related to the spectrum of energies of the adsorption sites. A small amount of water vapor in the helium enhanced desorption from iron powder but appeared to have less effect on desorption from the metal oxides

  11. Fortified Iodine Milk Improves Iodine Status and Cognitive Abilities in Schoolchildren Aged 7-9 Years Living in a Rural Mountainous Area of Morocco.

    Science.gov (United States)

    Zahrou, Fatima Ezzahra; Azlaf, Mehdi; El Menchawy, Imane; El Mzibri, Mohamed; El Kari, Khalid; El Hamdouchi, Asmaa; Mouzouni, Fatima-Zahra; Barkat, Amina; Aguenaou, Hassan

    2016-01-01

    Iodine is required for the production of the thyroid hormones essential for the growth and development of the brain. All forms of iodine deficiency (ID) affect the mental development of the child. Our study aims to assess the impact of ID on the intellectual development of Moroccan schoolchildren and to evaluate the effect of consumption of fortified milk on reducing ID. In a double-blind controlled trial conducted on schoolchildren, children were divided into two groups to receive fortified milk (30% of cover of RDI iodine) or nonfortified milk for 9 months. Urinary iodine was analyzed using the Sandell-Kolthoff reaction, a dynamic cognitive test using Raven's Standard Progressive Matrices to assess learning potential was performed at baseline and end line, and anthropometric assessment was done only at baseline. The study included schoolchildren who were severely iodine deficient. The prevalence of malnutrition was high in both groups; in this study, we found improvements in iodine status and in cognitive abilities among Moroccan schoolchildren. Our study showed that the consumption of fortified milk led to a clear improvement in iodine status and also appeared to have a favorable effect on the cognitive ability of Moroccan schoolchildren in a rural mountainous region.

  12. Micromethod of Iodine Measurement in Vrine

    Directory of Open Access Journals (Sweden)

    M Arbuzova

    2007-06-01

    Full Text Available Iodine concentration in urine is the direct quantity indicator of the current consumption of iodine in the population. The most widespread method of determination of iodine in urine is cerium-arsenic method with preliminary processing samples of urine using the solution ammonium persulfate. The purpose of work was to develop updating of the given method for reduction of the formation of toxic products of the reaction. Described method has good characteristics (the limit of the detection of this method 11 ug/l, CV < 10 %, the coefficient of the correlation with reference method 0.99, the amount of toxic substances formed during reaction decreases in 3 times, the cost price of research is reduced owing to reduction of the volume of reagents and water.

  13. Reaction rate of hydrolysis of iodine

    International Nuclear Information System (INIS)

    Miyake, Yoshikazu; Eguchi, Wataru; Adachi, Motonari

    1979-01-01

    Absorption rates of dilute iodine vapor contained in air by aqueous mixtures of sodium hydroxide and boric acid were measured using a laminar liquid jet column absorber at 298 K. Absorption rates in this system are controlled by a series of complex reactions taking place in the liquid phase. The reaction rate constant of iodine hydrolysis in the aqueous phase was determined from the absorption rates observed under the conditions that the base-catalytic hydrolysis reaction of iodine can be considered to be irreversible and that other reactions can be neglected. The absorption rates calculated theoretically with the rate constant value obtained above were in good accordance with the whole experimental data observed for a wide range of experimental conditions. (author)

  14. Assessment of Nutritional Status of Iodine Through Urinary Iodine Screening Among Local Children and Adolescents After the Fukushima Daiichi Nuclear Power Plant Accident.

    Science.gov (United States)

    Tsubokura, Masaharu; Nomura, Shuhei; Watanobe, Hajime; Nishikawa, Yoshitaka; Suzuki, Chiaki; Ochi, Sae; Leppold, Claire; Kinoshita, Hirokatsu; Kato, Shigeaki; Saito, Yasutoshi

    2016-12-01

    Iodine deficiency is an important modifier of the risk of thyroid cancer following irradiation. However, little information is available on the prevalence of iodine deficiency in Fukushima and its surroundings after the Fukushima Daiichi nuclear power plant accident that occurred in March 2011. In order to assess urinary iodine concentrations (UIC) and the prevalence of iodine deficiency and to elucidate any associations between demographic characteristics and UIC levels among children and adolescents aged ≤18 years at the time of the accident in Fukushima Prefecture and its surroundings, the data on voluntary UIC testing conducted by Hirata Central Hospital, Fukushima, were evaluated. A total of 4410 children and adolescents with a median age of 10 years at examination underwent UIC testing between October 2012 and October 2015. Calculated for all the participants, the median UIC level was 204 μg/L (range 25-21,100 μg/L). There were 133 (3.0%), 732 (16.6%), and 1472 (33.4%) participants with UIC levels of nutritional iodine status, no participants were severely iodine deficient (<20 μg/L), but 16.6% of the population were mildly (50-100 μg/L) or moderately (20-50 μg/L) iodine deficient. While no significant difference in UIC was noted between those who did and did not increase dietary iodine intake after the accident (p = 0.93), there were significant differences by year (p < 0.01), school level (p < 0.001), and residential area at the time of the accident (p < 0.001). This study demonstrates that the children and adolescents examined had a sufficient amount of iodine during the period 1.5-4.5 years after the nuclear accident. In addition to the differences in the scale and the countermeasures undertaken between the Fukushima and Chernobyl accidents, differences in dietary iodine intake might have played an additional role in resulting in the reportedly different radiation doses to the thyroid between the two nuclear accidents.

  15. Iodine-123 program at the TRIUMF laboratory

    International Nuclear Information System (INIS)

    Vincent, J.S.

    1985-01-01

    A research program for the production and utilization of iodine-123 is described. From 1979 to 1982 the spallation of elemental cesium by 500-MeV protons was used to provide 100 mCi/hr at the end of bombardment (EOB). Contaminants were 3% iodine-125 and 0.15% tellurium-121 at EOB + 36 hr. The material from weekly runs was used by remote clinics in Canada for evaluation as a radiochemical and for labeling studies. A new facility at TRIUMF will be operational in 1983 to produce iodine-123 by the (p,5n) reaction

  16. Evaluation of "instant" preparation of the colon with povidone-iodine.

    Science.gov (United States)

    Jones, F E; DeCosse, J J; Condon, R E

    1976-01-01

    The antimicrobial effect of 20 minutes exposure to 10% povidone-iodine solution and to 5% neomycin-erythromycin solution was evaluated in vitro in 6 suspensions of dog feces. Povidone-iodine eliminated aerobic growth (P less than 0.001) and reduced anaerobes 4.01 +/- 1.06 (P less than 0.02); C. perfringens was the only anaerobic organism grown. Forty unprepared dogs underwent resection of the sigmoid colon and primary anastomosis. Twenty received normal saline and 20 povidone-iodine injected intraluminally immediately before resection. The colon contents of povidone-iodine treated dogs grew only 0.07 +/- 0.07 aerobes and 3.74 +/- 0.49 anaerobes (all Clostridia) (log10/ml colon contents) (P less than 0.001). All povidone-iodine dogs survived 3 weeks with no anastomotic leaks; three controls died from anastomotic leak within the first week (P = 0.12). Reexploration of survivors revealed less perianastomotic reaction in the povidone-iodine group. Twenty minutes exposure to povidone-iodine produced a significant decrease in bacterial counts in vitro and in unprepared sigmoid colon. No adverse effects were demonstrated. Images Fig. 4. PMID:180916

  17. Some methods of detection of atmospheric contamination by iodine 131

    International Nuclear Information System (INIS)

    Billard, Francois; Chevalier, Gerard; Gaillard, Pierre; Pradel, Jacques

    1964-01-01

    Due to the extensive use of iodine, risks of contamination by iodine 131 are increasing. Moreover, the increase of reactor power requires venting installations equipped with efficient safety filters which must be tested. The authors thus report the study of iodine trapping in filters, and its atmospheric detection and measurement. They report studies and achievements in the field of measurement of atmospheric pollution, and tests performed on iodine trapping by activated coals. After having outlined key qualities of an apparatus for atmospheric control, the authors indicate the various sampling methods. They discuss the method and calibration for the measurement of radioactivity of filters and coal which have trapped iodine 131. They discuss measurement sensitivity. They report how the efficiency of coals has been checked. They describe the experimental installation, and report the tests of some detectors of atmospheric contamination: sampling cartridges full of activated coal, gas mask cartridge, continuous control apparatus ('coffee machine' type), and detector of gaseous iodine. Appendices indicate the calculation of error on a cartridge counting rate, iodine generation methods (discontinuous method, continuous method) [fr

  18. Iodine nutrition in elementary state schools of Queretaro, Mexico: correlations between urinary iodine concentration with global nutrition status and social gap index.

    Science.gov (United States)

    García-Solís, Pablo; Solís-S, Juan Carlos; García-Gaytán, Ana Cristina; Reyes-Mendoza, Vanessa A; Robles-Osorio, Ludivina; Villarreal-Ríos, Enrique; Leal-García, Luisa; Hernández-Montiel, Hebert Luis

    2013-08-01

    To estimate median urinary iodine concentration (UIC), and to correlate it with global nutrition indicators and social gap index (SGI) in 50 elementary state schools from 10 municipalities in the State of Queretaro, Mexico. 1,544 students were enrolled and an above of requirements of iodine intake was found (median UIC of 297 µg/L). Iodine status was found as deficient, adequate, more than adequate and excessive in 2, 4, 19 and 25 schools, respectively. Seventy seven percent of table salt samples showed adequate iodine content (20-40 ppm), while 9.6% of the samples had low iodine content (school were positively correlated with medians of body mass index (BMI) by using the standard deviation score (SDS) (r = 0.47; p school were negatively correlated with stunting prevalence (r = -0.39; p = 005) and social gap index (r = -0.36; p coexistence between the two extremes of iodine intake (insufficient and excessive). To our knowledge, the observed positive correlation between UIC and overweight and obesity has not been described before, and could be explained by the availability and consumption of snack food rich in energy and iodized salt.

  19. Human pancreas scintigraphy using iodine-123-labeled HIPDM and SPECT

    International Nuclear Information System (INIS)

    Yamamoto, K.; Shibata, T.; Saji, H.; Kubo, S.; Aoki, E.; Fujita, T.; Yonekura, Y.; Konishi, J.; Yokoyama, A.

    1990-01-01

    The pancreatic affinity of iodine-123-labeled HIPDM (N,N,N'-trimethyl-N'-(2-hydroxy-3-methyl-5-iodobenzyl)-1,3-propane diamine) ([ 123 I]HIPDM) was studied in 18 cases (5 normal volunteers, 7 cases with pancreas cancer, and 6 with chronic pancreatitis). In the normal cases, the pancreas was visualized in the planar images as early as 3 hr, and again at 20 hr postinjection. Single-photon emission computed tomography (SPECT) performed following 3-hr planar scintigraphy, provided excellent pancreas images without an overlap of activity in the liver or spleen. The mean pancreas-to-liver (P/L) ratio was 1.26 +/- 0.22 in normal controls. With the exception of one case of massive calcification in the pancreas, the entire pancreas could be observed in the cases with chronic pancreatitis, but the P/L ratio was 0.74 +/- 0.15, significantly lower than that of normal cases. Defective areas of the distal portion of the pancreas were clearly seen in those with cancer of the pancreas. The results of our study indicate that [ 123 I] HIPDM may have clinical potential as a human pancreas imaging agent

  20. 29 CFR 780.126 - Contract arrangements for raising poultry.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Contract arrangements for raising poultry. 780.126 Section... General Scope of Agriculture Raising of Livestock, Bees, Fur-Bearing Animals, Or Poultry § 780.126 Contract arrangements for raising poultry. Feed dealers and processors sometimes enter into contractual...

  1. Evaluating iodine deficiency in pregnant women and young infants

    DEFF Research Database (Denmark)

    Laurberg, Peter; Andersen, S.; Bjarnadottir, R. I.

    2007-01-01

    pregnancy is not a sign of maternal iodine deficiency; 5) a higher concentration of TSH and Tg in cord blood than in maternal blood is not a sign of iodine deficiency in the mother or neonate; and 6) thyroid function in a full-term foetus, a neonate or a small child is not more sensitive to a mild iodine...

  2. Study on gold concentrate leaching by iodine-iodide

    Science.gov (United States)

    Wang, Hai-xia; Sun, Chun-bao; Li, Shao-ying; Fu, Ping-feng; Song, Yu-guo; Li, Liang; Xie, Wen-qing

    2013-04-01

    Gold extraction by iodine-iodide solution is an effective and environment-friendly method. In this study, the method using iodine-iodide for gold leaching is proved feasible through thermodynamic calculation. At the same time, experiments on flotation gold concentrates were carried out and encouraging results were obtained. Through optimizing the technological conditions, the attained high gold leaching rate is more than 85%. The optimum process conditions at 25°C are shown as follows: the initial iodine concentration is 1.0%, the iodine-to-iodide mole ratio is 1:8, the solution pH value is 7, the liquid-to-solid mass ratio is 4:1, the leaching time is 4 h, the stirring intensity is 200 r/mim, and the hydrogen peroxide consumption is 1%.

  3. The development of 126Sn separation procedure by means of TBP resin

    International Nuclear Information System (INIS)

    Andris, Boris; Bena, Jozef

    2016-01-01

    Separation possibilities of 126 Sn with a new extraction-chromatographic material TBP Resin were studied. Suitable conditions for tin separation were determined in hydrochloric acid medium. 126 Sn was concentrated on TBP resin from 6 mol L -1 HCl and was eluted with 0.1 mol L -1 HCl. A purification step to remove 137 Cs with AMP-PAN column was necessary to obtain sufficiently purified samples which were directly measured with gamma spectrometry for 126 Sn activity. Separation of 126 Sn from a raw sludge sample was done according to proposed procedure, 126 Sn was detected and its activity was determined. (author)

  4. Iodine deficiency in pregnancy is prevalent in vulnerable groups in Denmark

    DEFF Research Database (Denmark)

    Kirkegaard-Klitbo, Ditte Marie; Perslev, Kathrine; Andersen, Stine Linding

    2016-01-01

    INTRODUCTION: Iodine is essential for the production of thyroid hormones. In pregnancy, physiological changes occur that can lead to iodine deficiency and impairment of fetal neurological development. We aimed to assess the iodine intake in pregnant women in Eastern Denmark, compare iodine levels...... in Eastern and Western Denmark and to identify potentially vulnerable groups. METHODS: This was a cross-sectional cohort study of pregnant Danish women (n = 240). Questionnaires and urine samples were collected at the Ultrasound Clinic, Hvidovre Hospital, Denmark, and urinary iodine concentrations (UIC) (µg....../l) were measured. Predictors of iodine supplement use were examined by multivariate logistic regression models. RESULTS: The pregnant women from Eastern Denmark had a median age of 30 years and the median gestational week at which they were included in the study was week 19. The majority took iodine...

  5. Iodine Absorption Cells Purity Testing

    Directory of Open Access Journals (Sweden)

    Jan Hrabina

    2017-01-01

    Full Text Available This article deals with the evaluation of the chemical purity of iodine-filled absorption cells and the optical frequency references used for the frequency locking of laser standards. We summarize the recent trends and progress in absorption cell technology and we focus on methods for iodine cell purity testing. We compare two independent experimental systems based on the laser-induced fluorescence method, showing an improvement of measurement uncertainty by introducing a compensation system reducing unwanted influences. We show the advantages of this technique, which is relatively simple and does not require extensive hardware equipment. As an alternative to the traditionally used methods we propose an approach of hyperfine transitions’ spectral linewidth measurement. The key characteristic of this method is demonstrated on a set of testing iodine cells. The relationship between laser-induced fluorescence and transition linewidth methods will be presented as well as a summary of the advantages and disadvantages of the proposed technique (in comparison with traditional measurement approaches.

  6. Iodine supplementation in pregnancy and its effest on child cognition

    NARCIS (Netherlands)

    Boonstra, A.; Gowachirapant, S.; Jaiswal, A.K.; Winichagoon, P.; Srinivasan, K.; Zimmerman, M.B.

    2012-01-01

    Maternal hypothyroidism and hypothyroxenemia due to iodine deficiency have been shown to affect development of the newborn negatively. Maternal iodine supplementation may therefore improve cognitive performance of the offspring, even in areas of mild-to-moderate iodine deficiency (ID). Several

  7. Iodine insufficiency: a global health problem?

    Science.gov (United States)

    Swanson, Christine A; Pearce, Elizabeth N

    2013-09-01

    As a result of collaborative efforts with international organizations and the salt industry, many developing and developed countries practice universal salt iodization (USI) or have mandatory salt fortification programs. As a consequence, the prevalence of iodine deficiency decreased dramatically. The United States and Canada are among the few developed countries that do not practice USI. Such an undertaking would require evidence of deficiency among vulnerable population groups, including pregnant women, newborns, and developing infants. Government agencies in the United States rely heavily on data from NHANES to assess the iodine status of the general population and pregnant women in particular. NHANES data suggest that pregnant women in the United States remain mildly deficient. This is important, because the developing fetus is dependent on maternal iodine intake for normal brain development throughout pregnancy. Professional societies have recommended that pregnant and lactating women, or those considering pregnancy, consume a supplement providing 150 μg iodine daily. The United States and Canada collaborate on the daily recommended intake and are also confronted with the challenge of identifying the studies needed to determine if USI is likely to be beneficial to vulnerable population groups without exposing them to harm.

  8. Food Group Intakes as Determinants of Iodine Status among US Adult Population

    Directory of Open Access Journals (Sweden)

    Kyung Won Lee

    2016-05-01

    Full Text Available Adequate intake of iodine is essential for proper thyroid function. Although dietary reference intakes for iodine have been established, iodine intake cannot be estimated due to the lack of data on iodine contents in foods. We aimed to determine if food group intakes can predict iodine status assessed by urinary iodine concentration (UIC from spot urine samples of 5967 US adults in the National Health and Nutrition Examination Survey (NHANES 2007–2012. From an in-person 24-h dietary recall, all foods consumed were aggregated into 12 main food groups using the individual food code of the US Department of Agriculture (USDA; dairy products, meat/poultry, fish/seaweed, eggs, legumes/nuts/seeds, breads, other grain products, fruits, vegetables, fats/oils, sugars/sweets, and beverages. Chi-square test, Spearman correlation, and multiple linear regression analyses were conducted to investigate the predictability of food group intakes in iodine status assessed by UIC. From the multiple linear regressions, the consumption of dairy products, eggs, and breads, and iodine-containing supplement use were positively associated with UIC, whereas beverage consumption was negatively associated with UIC. Among various food group intakes, dairy product intake was the most important determinant of iodine status in both US men and women. Subpopulation groups with a high risk of iodine deficiency may need nutritional education regarding the consumption of dairy products, eggs, and breads to maintain an adequate iodine status. Efforts toward a better understanding of iodine content in each food and a continued monitoring of iodine status within US adults are both warranted.

  9. Method for solidification of radioactive iodine-containing solid wastes

    International Nuclear Information System (INIS)

    Ozawa, Yoshihiro; Funabashi, Kiyomi; Uetake, Naoto.

    1987-01-01

    Purpose: To process radioactive iodine containing solid wastes as non-leaching solidified wastes with no risk of iodine release. Method: It has been known for the thermal stability of CuI, PbI 2 or adsorbents containing the same that they do not release iodine in an inert gas atmosphere or in a reducing atmosphere at a temperature lower than 480 deg C. In view of the above, adsorbents containing iodine in the chemical form of CuI or PbI 2 , or CuI or powdery PbI 2 per se are sealed and solidified into low melting glass at a temperature of lower than 480 deg C at which no iodine release occurs in a non-oxidative atmosphere. Since the products are vitrified wastes, they scarcely show leaching property and are excellent in durability and stability. (Takahashi, M.)

  10. The behavior of gaseous iodine in sand

    International Nuclear Information System (INIS)

    Takahashi, Kanji

    1974-01-01

    Radioactive iodine gas was passed through 10 different sands collected at rivers and hills. The relation between the amount of the loaded gas and the amount of adsorbed gas was determined at room temperature, 50 -- 60 0 C, and 90 -- 100 0 C under humidity of 2 sand. This amount was about 1 -- 3 times as much as that of monomolecular membrane adsorption, 0.2 -- 0.3 μg/cm 2 . The decrease of adsorption amount that accompanies the increase of humidity is attributable to the decrease of effective surface area of sand due to the presence of water. The transport of iodine in sand was studied by passing gaseous iodine through a glass tubing packed with sand. The distribution in the flow direction of iodine indicated that the ease of desorption depends upon the situation of adsorption. Easily desorbed case was named Henry type adsorption. Hardly desorbed case was named absorption type. Discussion is made on experimental results. (Fukutomi, T.)

  11. Iodine behaviour in the SLOWPOKE nuclear reactor

    Energy Technology Data Exchange (ETDEWEB)

    Bekeris, P A; Evans, G J [Toronto Univ., ON (Canada). Dept. of Chemical Engineering and Applied Chemistry

    1994-12-31

    The purpose of this project is to measure and attempt to explain the presence and volatility of iodine isotopes present as fission products in the SLOWPOKE-2 reactor. Liquid sampling and extraction procedures developed indicated that approximately 40% of the reactor iodine is in the form of iodate (IO{sub 3}{sup -}), and 60% is in the form of iodide (I{sup -}). No appreciable amount in non-polar forms such as molecular iodine (I{sub 2}) or organic iodides (RI) were detected. This goes contrary to past expectations that all of the iodine in the liquid phase would be in the form of I{sup -}. In addition partition coefficients for I-131 were determined as 2-6x10{sup 6} at a neutral pH. Kr-88 is suspected as a possible interfering isotope in the measurement of I-131 in the liquid and gas phases. (author). 9 refs., 2 tabs., 2 figs.

  12. Multi-compartment iodine calculations with FIPLOC/IMPAIR

    Energy Technology Data Exchange (ETDEWEB)

    Ewig, F; Allelein, H J [Gesellschaft fuer Anlagen- und Reaktorsicherheit mbH (GRS), Koeln (Germany); Schwarz, S; Weber, G [Gesellschaft fuer Anlagen- und Reaktorsicherheit (GRS) mbH, Garching (Germany)

    1996-12-01

    The multi-compartment containment code FIPLOC for the simulation of severe accidents in LWR plants was extended by the integration of the iodine model IMPAIR-3. The iodine model was changed for arbitrary compartment configurations and tightly coupled to the thermal hydraulic part. A main progress with the coupled version FIPLOC-3.0 is the sophisticated modelling of the aerosol iodine behaviour. In a PWR accident the mass of iodine is mainly released in form of CsI aerosol from the primary circuit. In IMPAIR-3 the aerosol behaviour of the species CsI, AgI and IO{sub 3}{sup -} is modelled in a very simplified way causing large uncertainties in the calculated distributions. The behaviour of these three aerosol species is treated by the aerosol model MAEROS/MGA. Agglomeration, particle growth by condensation and all deposition processes are calculated. The solubility effect for the hygroscopic species CsI and IO{sub 3}{sup -} are comprehended. Furthermore the impact of the iodine decay heat on the thermal hydraulic behaviour is considered. In order to test the code development a preliminary FIPLOC-3.0 calculation was done simulating a German PWR containment for the core melt scenario ND* according to the German risk study phase B. IN the calculation a contact of the core melt with the sump water was assumed and the containment vent line was opened after 70 hours. The result show that the different iodine species are distributed inhomogeneously within the containment. The CsI-aerosol concentrations differ by two orders of magnitude and the I{sub 2}-concentration even by three orders of magnitude. Most of the iodine is assumed to be released as CsI aerosol out of the primary circuit. Since it fastly deposits its contribution to the release into the environment is minor. CsI is however dissolved in the sump, where mainly the gaseous I{sub 2} is created which can react in the containment atmosphere to IO{sub 3}{sup -}. (author) 11 figs., 3 tabs., 12 refs.

  13. Multi-compartment iodine calculations with FIPLOC/IMPAIR

    International Nuclear Information System (INIS)

    Ewig, F.; Allelein, H.J.; Schwarz, S.; Weber, G.

    1996-01-01

    The multi-compartment containment code FIPLOC for the simulation of severe accidents in LWR plants was extended by the integration of the iodine model IMPAIR-3. The iodine model which originally was only drafted for chains of compartments was changed for arbitrary compartment configurations and tightly coupled to the thermal hydraulic part. A main progress with the coupled version FIPLOC-3.0 is the sophisticated modelling of the aerosol iodine behaviour. In a PWR accident the mass of iodine is mainly released in form of CsI aerosol from the primary circuit. In IMPAIR-3 the aerosol behaviour of the species CsI, AgI and IO 3 - is modelled in a very simplified way causing large uncertainties in the calculated distributions. The behaviour of these three aerosol species is treated by the aerosol model MAEROS/MGA. Agglomeration, particle growth by condensation and all deposition processes are calculated. The solubility effect for the hygroscopic species CsI and IO 3 - are comprehended. Furthermore the impact of the iodine decay heat on the thermal hydraulic behaviour is considered. In order to test the code development a preliminary FIPLOC-3.0 calculation was done simulating a German PWR containment for the core melt scenario ND* according to the German risk study phase B. IN the calculation a contact of the core melt with the sump water was assumed and the containment vent line was opened after 70 hours. The result show that the different iodine species are distributed inhomogeneously within the containment. The CsI-aerosol concentrations differ by two orders of magnitude and the I 2 -concentration even by three orders of magnitude. Most of the iodine is assumed to be released as CsI aerosol out of the primary circuit. Since it fastly deposits its contribution to the release into the environment is minor. CsI is however dissolved in the sump, where mainly the gaseous I 2 is created which can react in the containment atmosphere to IO 3 - . (author) 11 figs., 3 tabs., 12

  14. Excessive iodine intake during pregnancy in Somali refugees.

    Science.gov (United States)

    Kassim, Ismail A R; Ruth, Laird J; Creeke, Paul I; Gnat, Danielle; Abdalla, Fathia; Seal, Andrew J

    2012-01-01

    Iodine deficiency and excess are both associated with adverse health consequences, with fetuses, children and pregnant women being most vulnerable to the devastating effects of severe deficiency. It is often assumed that the iodine status of a population if displaced or in a remote or emergency situation is low. However, there is little evidence available to support this assumption, especially among long-term food-aid-dependent pregnant women. An effectiveness trial of a prenatal multiple-micronutrient supplement that contained 150 µg day(-1) iodine was conducted in two refugee camps in the North Eastern Province of Kenya in 2002. Urinary iodine concentration (UIC) was measured in a subsample of pregnant women attending antenatal care in Dagahaley (control camp) (n = 74) and Ifo (intervention camp) (n = 63). There was no significant difference in median UIC between the two camps (P = 0.118). The combined median UIC was 730 µg L(-1) (interquartile range, 780) (5.77 µmol L(-1)) and exceeded the upper safe limit of 500 µg L(-1) (3.95 µmol L(-1)) for pregnant women (P refugee camps. Further research needs to be conducted to investigate the source of excess iodine, to determine the measures needed to address excessive iodine intake and to reconsider the World Health Organization/World Food Programme/United Nations Children's Fund guidance on supplementation of vulnerable groups in emergencies.

  15. Knowledge about Iodine in Pregnant and Lactating Women in the Oslo Area, Norway.

    Science.gov (United States)

    Garnweidner-Holme, Lisa; Aakre, Inger; Lilleengen, Anne Marie; Brantsæter, Anne Lise; Henjum, Sigrun

    2017-05-13

    Lack of knowledge about iodine may be a risk factor for iodine deficiency in pregnant and lactating women. The aim of this study was to assess knowledge about iodine and predictors of iodine knowledge scores among pregnant and lactating women. The study also examined whether iodine knowledge scores were associated with iodine status. A cross-sectional study was performed on 804 pregnant women and 175 lactating women from 18 to 44 years of age in 2016 in the Oslo area, Norway. Knowledge about iodine was collected through a self-administered, paper-based questionnaire. Iodine concentrations in urine and breast milk were measured using an inductively coupled plasma mass spectrometer (ICPMS). 74% of the pregnant women and 55% of the lactating women achieved none to low iodine knowledge scores. Higher educated pregnant women and those who had received information about iodine had significantly higher knowledge scores. In lactating women, increased age was associated with higher knowledge scores. Knowledge scores were not associated with participants' iodine status. This study revealed a lack of knowledge about the importance of iodine in pregnant and lactating women, as well as about the most important dietary sources. Public education initiatives are required to increase the awareness about iodine in these population groups.

  16. The determination of iodine in biological media using radioactivation analysis (1962)

    International Nuclear Information System (INIS)

    Comar, D.

    1962-06-01

    The object of this study is to show that the application of radioactivation analysis to the determination of iodine in biological media makes it possible to measure iodine concentrations of the order of 0.0001 μg. After a review of the chemical methods with a mention of the difficulties they present, the optimum conditions for the determination of iodine in biological liquids are given. Three methods are described: - the first consists of a chemical treatment which liberates the protein bound iodine in an inorganic form. After distillation this iodine is irradiated in a flux of thermal neutrons. The induced radioactivity is compared to that of a standard sample irradiated in the same conditions by γ spectrometry. - the second method which is of more general application consists in irradiating the sample and then extracting the iodine; its induced radio-activity is then measured by β-counting. - the third method measures the iodine directly in the thyroid tissue by anti-compton spectrometry. The sensitivity, the reproducibility and the accuracy are discussed. Some applications are described: determination of iodine in its various organic forms in serum, determination of iodine in urines, in food-stuffs, etc., in the thyroid tissue, etc. (author) [fr

  17. The importance of prevention with iodine after nuclear accidents

    International Nuclear Information System (INIS)

    Mornealo, Elena; Chirca, Lucia

    2011-01-01

    Medical negative consequences of the disastrous accident from the Chernobyl are tangible till present and the thyroid pathology has a special place among them. It is caused by the actions of radioactive iodine and can be greatly minimized by the implementation of prophylaxis with stable iodine. The basic principles, benefits and risks of iodine prophylaxis are reported in this article. (authors)

  18. A comparison of the effect of alcohol and povidone-iodine mixture with alcohol after povidon-iodine in prevention of vascular access inflammation in patients undergoing hemodialysis

    Directory of Open Access Journals (Sweden)

    Bazzi A

    2014-11-01

    Full Text Available Background and Objective: The quality of hemodialysis can be promoted through reducing vascular access complications in these patients. One of the crucial roles of nurses in hemodialysis wards is reducing inflammation and infection of the vascular access. This study was conducted to compare the incidence of inflammation around the vascular access area in patients undergoing hemodialysis between two antiseptic methods of alcohol after povidone-iodine and the combination of alcohol and povidone-iodine. Materials and Method: This clinical trial was performed under the supervision of Mashhad University of Medical Sciences, Iran, after gaining ethical committee approval in 2014. In the present study, 100 participants were selected by convenience sampling method and randomly divided into three groups of combination of alcohol and povidone-iodine (n = 37, alcohol after using povidone-iodine (n = 32, and control group (n = 31. In the intervention groups 1 and 2, vascular access was disinfected using a combination of alcohol and povidone-iodine and alcohol after povidone-iodine, respectively. In the control group, vascular access was disinfected using the method of the related ward. Patients were fully observed for phlebitis occurrence for 12 hemodialysis sessions (1 month. Vascular access was controlled using the Iranian Nurses Association's phlebitis criteria. Data were analyzed using chi-square, ANOVA test, and Fisher's exact test in SPSS version 16. Results: The incidence rate of inflammation in the combination of alcohol and povidone-iodine, alcohol after povidone-iodine, and control groups, respectively, were 46%, 87.9%, and 100%. The incidence rate of inflammation was significantly lower in the combination of alcohol and povidone-iodine compared to the alcohol after povidone-iodine group (P < 0.001. However, no significant differences existed between the alcohol after povidone-iodine and control group. Conclusion: The combination of alcohol and

  19. Anaphylactic reaction to iodinated contrast media. Review the relevant loterature

    International Nuclear Information System (INIS)

    Kuwashima, Shigeko; Kitajima, Kazuhiro; Kohno, Tatsuo; Kaji, Yasushi; Takahashi, Tetuya; Seki, Masaya; Sakamoto, Tomoyuki

    2007-01-01

    Recently, iodinated contrast media are necessary for CT examinations and they occupy an important position in the radiological diagnosis. Nonionic contrast media significantly reduce the prevalence of all degree of adverse reaction to contrast media rather than ionic contrast media. So, generally, iodinated contrast media are safe and widely used, but adverse reaction after intravenous iodinated contrast media are not uncommon. Severe and potentially life-threatening reaction occur by using the iodinated contrast media practically. Patients at risk must be identified before the contrast media study, and all possible measures must be taken to deal effectively with spontaneous anaphylactic reactions. We report three cases of anaphylactic reactions by iodinated contrast media on CT. (author)

  20. Combination of ozone feed and wet electrostatic precipitator. Experimental study of an innovative system to filter gaseous iodine and iodine containing particles

    International Nuclear Information System (INIS)

    Gouëllo, Mélany; Hokkinen, Jouni; Kärkelä, Teemu; Auvinen, Ari

    2017-01-01

    Efficient mitigation systems capable of reducing as much as possible the radioactive discharge to the environment in a severe Nuclear Power Plant (NPP) accident are a necessity. Nuclear Power Plants are equipped with filtration systems which have been characterized for aerosol retention in a short term, but to a far lesser extent for the retention of volatile iodine or for the long-term behaviour of the system. After the Fukushima accident, one of the main concerns of the nuclear industry has been to verify the ability of filtration systems to mitigate the possible source term to the environment. Radiotoxic iodine has a significant contribution to a possible source term in a severe NPP accident. An innovative system has been developed at VTT Technical Research Centre of Finland Ltd. to filter gaseous iodine and iodine containing particles (e.g. I x O y ). The system consists of a combination of an ozone feed and a modern wet electrostatic precipitator (WESP). The electrostatic precipitation (ESP) technique is widely used in the industry to filter out impurities (i.e. particles) in gases. The advantage of a WESP is that the impurities are removed from the system with a solution. They can thus directly be transported to a water container, such as the sump in a nuclear power plant. The addition of ozone feed at the inlet of the WESP allows the oxidation of gaseous iodine into particles. The efficiency of the system for the filtration of gaseous molecular iodine and methyl iodine has been tested and the subsequent observations are further discussed in this paper. The results showed that the combination of WESP together with ozone feed results in a good filtering efficiency against molecular iodine under air atmosphere and air/steam atmosphere. (author)

  1. Thyroid cancer in South Africa - an indicator of regional iodine ...

    African Journals Online (AJOL)

    Objective. Because follicular thyroid cancers predominate in iodine-deficient and papillary cancers predominate in iodine·replete populations. we have analysed national and regional (former Transvaal) incidences of these cancer types as a surrogate measure of the population iodine nutritional status in South Africa.

  2. Thyroid Function among Breastfed Children with Chronically Excessive Iodine Intakes

    Directory of Open Access Journals (Sweden)

    Inger Aakre

    2016-06-01

    Full Text Available Iodine excess may impair thyroid function and trigger adverse health consequences for children. This study aims to describe iodine status among breastfed infants with high iodine exposure in the Saharawi refugee camps Algeria, and further assess thyroid function and iodine status among the children three years later. In 2010, a cross-sectional study among 111 breastfed children aged 0–6 months was performed (baseline study. In 2013, a second cross-sectional study (follow-up study was conducted among 289 children; 213 newly selected and 76 children retrieved from baseline. Urinary iodine concentration (UIC and breast milk iodine concentration (BMIC were measured at baseline. UIC, thyroid hormones and serum thyroglobulin (Tg were measured at follow-up. At baseline and follow-up, 88% and 72% had excessive iodine intakes (UIC ≥ 300 µg/L, respectively. At follow-up, 24% had a thyroid hormone disturbance and/or elevated serum Tg, including 9% with subclinical hypothyroidism (SCH, 4% with elevated fT3 and 14% with elevated Tg. Children with SCH had poorer linear growth and were more likely to be underweight than the children without SCH. Excessive iodine intakes and thyroid disturbances were common among children below four years of age in our study. Further, SCH seemed to be associated with poor growth and weight.

  3. Variation in the iodine concentrations of foods: considerations for dietary assessment1234

    Science.gov (United States)

    Carriquiry, Alicia L; Spungen, Judith H; Murphy, Suzanne P; Pehrsson, Pamela R; Dwyer, Johanna T; Juan, WenYen; Wirtz, Mark S

    2016-01-01

    Background: Food-composition tables typically give measured nutrient concentrations in foods as a single summary value, often the mean, without providing information as to the shape of the distribution. Objective: Our objective was to explore how the statistical approach chosen to describe the iodine concentrations of foods affects the proportion of the population identified as having either insufficient or excessive iodine intakes. Design: We used food intake data reported by the 2009−2010 NHANES and measured iodine concentrations of Total Diet Study (TDS) foods from 4 US regions sampled in 2004–2011. We created 4 data sets, each by using a different summary statistic (median, mean, and 10th and 90th percentiles), to represent the iodine concentration distribution of each TDS food. We estimated the iodine concentration distribution of each food consumed by NHANES participants as the 4 iodine concentration summary statistics of a similar TDS food and used these, along with NHANES food intake data, to develop 4 estimates of each participant’s iodine intake on each survey day. Using the 4 estimates in turn, we calculated 4 usual iodine intakes for each sex- and age-specific subgroup. We then compared these to guideline values and developed 4 estimates of the proportions of each subgroup with deficient and excessive usual iodine intakes. Results: In general, the distribution of iodine intakes was poorly characterized when food iodine concentrations were expressed as mean values. In addition, mean values predicted lower prevalences of iodine deficiency than did median values. For example, in women aged 19–50 y, the estimated prevalence of iodine deficiency was 25% when based on median food iodine concentrations but only 5.8% when based on mean values. Conclusion: For nutrients such as iodine with highly variable concentrations in important food sources, we recommend that food-composition tables provide useful variability information, including the mean, SD, and

  4. Chemistry and mass transport of iodine in containment

    International Nuclear Information System (INIS)

    Beahm, E.C.; Weber, C.F.; Kress, T.S.; Shockley, W.E.; Daish, S.R.

    1988-01-01

    TRENDS is a computer code for modeling behavior of iodine in containment. It tracks both chemical and physical changes and features such as calculation of radiation dose rates in water pools , radiolysis effects, hydrolysis, and deposition/revaporization on aerosols and structural surfaces. Every attempt has been made to account for all significant processes. Reaction rate constants for iodine hydrolysis and radiolysis were obtained by a variable algorithm that gives values closely modeling experimental data. TRENDS output provides the distribution of iodine in containment and release from containment as a function of time during a severe accident sequence. Initial calculations with TRENDS have shown that the amount of volatile iodine released from containment is sensitive to the value of the liquid-gas (evaporation) mass transport coefficient for I 2 . 7 refs., 4 figs., 3 tabs

  5. Radioactive iodine releases from nuclear power plant, (2)

    International Nuclear Information System (INIS)

    Naritomi, Mitsuo

    1974-01-01

    Internal radiation dose through the respiratory intake of fission products is predominantly due to radioactive iodine not only at the time of reactor accidents but also in normal operation of nuclear facilities. Technological studies in this field have thus been quite active to this day. With the rapid advance of nuclear power generation in recent years, the efforts to reduce environmental release of radioactive iodine and to enhance environmental safety are all the more emphasized. Experiences in the Japan Atomic Energy Research Institute during past about six years are described concerning the radioactive iodine release to the atmosphere in 131 I production and the measures taken to reduce the release. Then, problems are expounded regarding the radioactive iodine release at the time of reactor accidents and in spent fuel reprocessing. (Mori, K.)

  6. Mechanisms of iodine release from iodoapatite in aqueous solution

    Science.gov (United States)

    Zhang, Z.; Wang, J.

    2017-12-01

    Immobilization of iodine-129 with waste forms in geological setting is challenging due to its extremely long half-life and high volatility in the environment. To evaluate the long-term performance of waste form, it is imperative to determine the release mechanism of iodine hosted in the waste form materials. This study investigated the iodine released from apatite structured waste form Pb9.85 (VO4)6 I1.7 to understand how diffusion and dissolution control the durability of apatite waste form. A standard semi-dynamic leach test was adopted in this study. Samples were exposed in fresh leachant periodically and the leachant was replaced after each interval. Each experiment was carried out in cap-sealed Teflon vessels under constant temperature (e.g. 90 °C). ICP-MS analysis on the reacted leachates shows that Pb and V were released constantly and congruently with the stoichiometric ratio of Pb/V. However, iodine release is incongruent and time dependent. The iodine release rate starts significantly higher than the corresponding stoichiometric value and gradually decreases, approaching the stoichiometric value. Therefore, a dual-mode mechanism is proposed to account for the iodine release from apatite, which is dominated by short-term diffusion and long-term dissolution processes. Additional tests show that the element release rates depend on a number of test parameters, including sample surface to solution volume ratio (m-1), interval (day), temperature (°C), and solution pH. This study provides a quantitative characterization of iodine release mechanism. The activation energy of iodine leaching 21±1.6 kJ/mol was obtained by varying the test temperature. At the test conditions of to neutral pH and 90 °C, the long-term iodine release rate 3.3 mg/(m2 • day) is projected by normalizing sample surface area to solution volume ratio (S/V) to 1.0 m-1 and interval to 1 day. These findings demonstrate i) the feasibility of our approach to quantify the release mechanism

  7. Iodine Adsorption by Ag-Aerogel under Prototypical Vessel Off-Gas Conditions

    Energy Technology Data Exchange (ETDEWEB)

    Bruffey, Stephanie H. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Jubin, Robert Thomas [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2016-08-01

    U.S. regulations will require the removal of 129I from the off-gas streams of any used nuclear fuel (UNF) reprocessing plant prior to discharge of the off-gas to the environment. The required plant decontamination factor for iodine will vary based on fuel burnup, cooling time, and other factors but is very likely to be >1000 and could be as high as 8000. Multiple off-gas streams within a UNF reprocessing plant combine prior to environmental release, and each of these streams contains some amount of iodine. To achieve the decontamination factors (DFs) that are likely to be required by regulations, iodine removal from the vessel off-gas will be necessary. The vessel off-gas contains iodine at very dilute concentrations (ppb levels), and will also contain water vapor. Iodine species present are likely to include both elemental and organic iodides. There will also be solvent vapors and volatile radiolysis products. The United States has considered the use of silver-based sorbents for removal of iodine from UNF off-gas streams, but little is known about the behavior of those sorbents at very dilute iodine concentrations. The purpose of this study was to expose silver-functionalized silica aerogel (AgAerogel) to a prototypical vessel off-gas stream containing 40 ppb methyl iodide to obtain information about organic iodine capture by silver-sorbents at very low iodine concentrations. The design of this extended duration testing was such that information about the rate of adsorption, the penetration of the iodine species, and the overall system DF could be obtained. Results show that CH3I penetrates into a AgAerogel sorbent bed to a depth of 3.9 cm under prototypical vessel off-gas conditions. An iodine loading of 22 mg I/g AgAerogel was observed in the first 0.3 cm of the bed. Of the iodine delivered to the system, 48% could not be accounted for, and future efforts will investigate this concern. Direct calculation of the decontamination factor is not

  8. Sandia high-power atomic iodine photodissociation laser

    International Nuclear Information System (INIS)

    Palmer, R.E.; Padrick, T.D.

    1975-01-01

    One of the more promising candidates for a laser to demonstrate the feasibility of laser fusion is the 1.315 μ atomic iodine laser. In a relatively short time it has been developed into a viable subnanosecond, high energy laser. Although at present the iodine laser cannot equal the output capabilities of a large Nd:glass laser system, there are no foreseeable obstacles in the construction of a 100 psec, 10 KJ or greater atomic iodine laser system. A 100 joule system being constructed at Sandia to investigate many of the scaling parameters essential to the design of a 10 KJ or greater system is described. (U.S.)

  9. Ensuring effective prevention of iodine-deficiency disorders

    DEFF Research Database (Denmark)

    Völzke, Henry; Caron, Philippe Jean; Dahl, Lisbeth

    2016-01-01

    BACKGROUND: Programs initiated to prevent iodine deficiency disorders (IDD) may not remain effective due to changes in government policies, commercial factors, and human behavior that may affect the efficacy of IDD prevention programs in unpredictable directions. Monitoring and outcome studies...... by the lack of centralized standardization procedures. In addition, data on outcomes and the cost of achieving them are needed in order to provide evidence of the beneficial effects of IDD prevention in countries with mild iodine deficiency. CONCLUSION: Monitoring studies can be optimized by including...... in mildly iodine-deficient areas and that it should include populations from regions with different environmental, ethnic, and cultural backgrounds....

  10. Stress corrosion cracking behavior of zircaloy-2 in iodine environment

    International Nuclear Information System (INIS)

    Ikeda, Seiichi

    1983-01-01

    The effects of strain rates, iodine partial pressure and testing temperature on SCC behavior of zircaloy-2 in iodine environment were studied by means of slow strain rate technique (SSRT). SCC behavior of recrystallized specimens in iodine environment was remarkably influenced by the testing temperatures, and the susceptibility to SCC of specimens tested at 623 K was higher than that at 573 K. The susceptibility to SCC of recrystallized specimens increased with increasing iodine partial pressure at the lower strain rates of 4.2 x 10 -6 s -1 and 8.3 x 10 -7 s -1 . Cold worked specimens indicate no SCC failure in iodine environment regardless of strain rates, although those were tested only at 573 K. Fractographic observation revealed that SCC features of recrystallized specimens can be classified into two groups. One group, mostly specimens tested at 573 K, are characterized by the fact that cracks are initiated from corrosion pits. The other group are characterized by transgranuler SCC in the absence of pitting. This type of crack is found on specimens tested in environments containing more than 570 Pa iodine and seems to be produced by iodine embrittlement. (author)

  11. Effect of iodinated contrast media on thyroid: a brief review

    Directory of Open Access Journals (Sweden)

    Şerife Mehlika Kuşkonmaz

    2016-04-01

    Full Text Available In parallel to the increased use of computed tomography, iodinated contrast agents are increasingly becoming a source of excess iodide. Iodinated contrast agents may induce thyroid dysfunction in exposed patients, especially in the presence of an underlying thyroid disease. Thus, an ordinary dose of the contrast used for the imaging, can induce hyper or hypothyroidism in a patient with subtle thyroid disease. This review will briefly discuss the physiology of iodine and the clinical evaluation of iodine induced thyroid dysfunction.

  12. Improved iodine status is associated with improved mental performance of schoolchildren in Benin.

    Science.gov (United States)

    van den Briel, T; West, C E; Bleichrodt, N; van de Vijver, F J; Ategbo, E A; Hautvast, J G

    2000-11-01

    An adequate iodine supply in utero and shortly after birth is known to be crucial to an individual's physical and mental development. The question of whether iodine supplementation later in life can exert a favorable influence on the mental performance of iodine-deficient populations was addressed in various studies, but with contradictory results. The aim of this study was to examine the effect of an improvement in iodine status on mental and psychomotor performance of schoolchildren (7-11 y) who were moderately to severely iodine deficient. The study, which was originally planned as a double-blind, randomized, placebo-controlled intervention, was carried out in an iodine-deficient population of schoolchildren (n = 196) in northern Benin. As the population began to have access to iodized salt during the 1-y intervention period, the study population was split post hoc-on the basis of urinary iodine concentrations-into a group with improved iodine status and a group with unchanged iodine status. Changes in mental and psychomotor performance over the intervention period were compared. Children with increased urinary iodine concentrations had a significantly greater increase in performance on the combination of mental tests than did the group with no change in urinary iodine concentrations. An improvement in iodine status, rather than iodine status itself, determined mental performance in this population, which was initially iodine deficient. These findings suggest a "catch-up" effect in terms of mental performance.

  13. Study of Iodine Behavior in the Gas Phase during a Severe Accident

    International Nuclear Information System (INIS)

    Kim, Hanchul; Cho, Yeonghun; Ryu, Myunghyun

    2014-01-01

    Among the iodine species, the organic iodides produced from the reaction between iodine and organics such as paint, are not easily trapped by the filters during the containment venting following a severe accident. Korea Institute of Nuclear Safety (KINS) has been studying this issue, joining international research programs such as ISTP-EPICUR, OECDBIP and OECD-STEM. In the course of this study, a simple iodine model, RAIM (Radio-Active Iodine chemistry Model) has been developed (Oh et al., 2011), based on the IMOD methodology, and other previous studies. This paper deals with our recent activities on this study, including the development of the model for the iodine reactions in gas phase. Iodine reactions in gas phase were modeled and added to the RAIM code, taking into account several relevant reactions such as formation of ARP, iodine oxide, and organic iodides in gas phase. RAIM was then applied to analyze the S2-6-5-2 test for which iodine-loaded coupons were tested in gas phase. The analysis results show a reasonable estimation of volatile iodine concentration with the desorption rate constant of about 10 -6 s -1 , while those of the other iodine species overestimated for the whole period of the test. It reveals the need to determine appropriate values for the rate constants for formation of iodine oxides and organic iodides

  14. Fortified Iodine Milk Improves Iodine Status and Cognitive Abilities in Schoolchildren Aged 7–9 Years Living in a Rural Mountainous Area of Morocco

    Directory of Open Access Journals (Sweden)

    Fatima Ezzahra Zahrou

    2016-01-01

    Full Text Available Iodine is required for the production of the thyroid hormones essential for the growth and development of the brain. All forms of iodine deficiency (ID affect the mental development of the child. Our study aims to assess the impact of ID on the intellectual development of Moroccan schoolchildren and to evaluate the effect of consumption of fortified milk on reducing ID. In a double-blind controlled trial conducted on schoolchildren, children were divided into two groups to receive fortified milk (30% of cover of RDI iodine or nonfortified milk for 9 months. Urinary iodine was analyzed using the Sandell-Kolthoff reaction, a dynamic cognitive test using Raven’s Standard Progressive Matrices to assess learning potential was performed at baseline and end line, and anthropometric assessment was done only at baseline. The study included schoolchildren who were severely iodine deficient. The prevalence of malnutrition was high in both groups; in this study, we found improvements in iodine status and in cognitive abilities among Moroccan schoolchildren. Our study showed that the consumption of fortified milk led to a clear improvement in iodine status and also appeared to have a favorable effect on the cognitive ability of Moroccan schoolchildren in a rural mountainous region.

  15. Two-layer type filter for removal of radioactive iodine

    Energy Technology Data Exchange (ETDEWEB)

    Taoki, M

    1976-04-16

    The object is to provide a filter for removing radioactive iodine, which is used for disposal of gaseous waste in an atomic power plant, to particularly hold a pressure loss lower. The filter according to the present invention comprises two layers, which are filled at a front stage with active carbon, which is small in pressure loss and has a good collective efficiency relative to iodine, and at a rear stage with silver zeolite, which has a good collective efficiency relative to both iodine and methyl iodine, whereby respective adsorbent are effectively utilized to minimize pressure loss even if a large quantity of air.

  16. Two-layer type filter for removal of radioactive iodine

    International Nuclear Information System (INIS)

    Taoki, Masafumi.

    1976-01-01

    Object: To provide a filter for removing radioactive iodine, which is used for disposal of gaseous waste in an atomic power plant, to particularly hold a pressure loss lower. Structure: The filter according to the present invention comprises two layers, which are filled at a front stage with active carbon, which is small in pressure loss and has a good collective efficiency relative to iodine, and at a rear stage with silver zeolite, which has a good collective efficiency relative to both iodine and methyl iodine, whereby respective adsorbent are effectively utilized to minimize pressure loss even if a large quantity of air. (Kamimura, M.)

  17. Iodine content in drinking water and other beverages in Denmark

    DEFF Research Database (Denmark)

    Rasmussen, Lone Banke; Larsen, Erik Huusfeldt; Ovesen, L.

    2000-01-01

    Objective: To investigate the variation in iodine content in drinking water in Denmark and to determine the difference in iodine content between organic and non-organic milk. Further, to analyse the iodine content in other beverages. Design and setting: Tap water samples were collected from 41 ev...

  18. Development of Databases with Iodine in Foods and Dietary Supplements

    Science.gov (United States)

    Iodine is an essential micronutrient required for normal growth and development, thus an adequate intake of iodine is particularly important in pregnant and lactating women, and throughout childhood. Low levels of iodine in the soil and groundwater are common in many parts of the world, often leadi...

  19. [Repeated cross-sectional studies on urinary iodine and iodine content of salt among school-aged children from 2012 to 2014 in Yuhuan County, Zhejiang Province].

    Science.gov (United States)

    Su, Meifang; Wang, Congyun; Li, Songtao; Ying, Xuhua; Zhao, Qi; Fu, Chaowei; Jiang, Qingwu

    2016-01-01

    To investigate the iodine status and its change among school-aged children in their morning urine and eating salt from 2012 to 2014 in Yuhuan County, Zhejiang Province, China. Three repeated cross-sectional studies were carried out at a same primary school in 2012, 2013 and 2014, respectively. Three classes were randomly selected from each of 3 to 5 grade by the cluster-stratified sampling every year. Totally, 1343 out of 1350 eligible children aged 8 to 10 years old were involved into this study. Their morning urine and salt eating at home were collected and tested. The overall median of urine iodine was 116.0 μg/L, and no significant change was found over year. The overall proportions of subjects with urine iodine iodine from 1343 salt samples was 0.0 mg/kg and no year difference was statistically observed. The proportions of subjects consumed iodized salt significantly decreased from 25.1% in 2012 to 21.8% in 2013 and to 14.2% in 2014. There was a significant difference in urine iodine between subjects taken iodized salt or not and also a weak positive correlation between salt iodine and urine iodine. The nutritional status of iodine is overall stable, proper and safety in recent 3 years among school children in Yuhuan County. The coverage rate of iodized salt is very low.

  20. CD36 participates in PrP(106-126-induced activation of microglia.

    Directory of Open Access Journals (Sweden)

    Mohammed Kouadir

    Full Text Available Microglial activation is a characteristic feature of the pathogenesis of prion diseases. The molecular mechanisms that underlie prion-induced microglial activation are not very well understood. In the present study, we investigated the role of the class B scavenger receptor CD36 in microglial activation induced by neurotoxic prion protein (PrP fragment 106-126 (PrP(106-126. We first examined the time course of CD36 mRNA expression upon exposure to PrP(106-126 in BV2 microglia. We then analyzed different parameters of microglial activation in PrP(106-126-treated cells in the presence or not of anti-CD36 monoclonal antibody (mAb. The cells were first incubated for 1 h with CD36 monoclonal antibody to block the CD36 receptor, and were then treated with neurotoxic prion peptides PrP(106-126. The results showed that PrP(106-126 treatment led to a rapid yet transitory increase in the mRNA expression of CD36, upregulated mRNA and protein levels of proinflammatory cytokines (IL-1β, IL-6 and TNF-α, increased iNOS expression and nitric oxide (NO production, stimulated the activation of NF-κB and caspase-1, and elevated Fyn activity. The blockade of CD36 had no effect on PrP(106-126-stimulated NF-κB activation and TNF-α protein release, abrogated the PrP(106-126-induced iNOS stimulation, downregulated IL-1β and IL-6 expression at both mRNA and protein levels as well as TNF-α mRNA expression, decreased NO production and Fyn phosphorylation, reduced caspase-1 cleavage induced by moderate PrP(106-126-treatment, but had no effect on caspase-1 activation after treatment with a high concentration of PrP(106-126. Together, these results suggest that CD36 is involved in PrP(106-126-induced microglial activation and that the participation of CD36 in the interaction between PrP(106-126 and microglia may be mediated by Src tyrosine kinases. Our findings provide new insights into the mechanisms underlying the activation of microglia by neurotoxic prion peptides

  1. Dissociation kinetics of iodine in oxygen-containing electrical discharge plasmas

    International Nuclear Information System (INIS)

    Zakharov, A.I.; Klopovskii, K.S.; Rakhimova, T.V.; Samorodov, V.A.

    1993-01-01

    Studies of the kinetics of gaseous media containing oxygen and iodine molecules have been stimulated to a substantial degree by the search for ways of improving iodine-oxygen lasers and by the need for information on loss processes for atmospheric ozone. Results are presented from an experimental study and numerical simulations of the kinetics of the dissociation of iodine in self-sustained volume discharges in high-pressure O 2 :Ar:I 2 mixtures. It is shown that the well-studied mechanism for dissociation based on excitation of iodine molecules in successive collisions with singlet oxygen and excited iodine atoms is supplanted by a substantially different mechanism involving the creation and loss of 10 radicals when the densities of atomic oxygen and ozone are high enough. It is also shown that iodine fractions as low as ∼10 -3 in the mixture lead to rapid loss of ozone molecules while less than 18% of the discharge energy is expended in the production of singlet oxygen

  2. Challenges in the evaluation of urinary iodine status in pregnancy

    DEFF Research Database (Denmark)

    Andersen, Stine Linding; Sørensen, Louise Kolding; Motavaf, Anne Krejbjerg

    2014-01-01

    Objectives: Median urinary iodine concentration (UIC) is the recommended method to evaluate iodine status in pregnancy, but several factors may challenge the interpretation of the results. We evaluated UIC in pregnant women according to (1) sampling in the hospital versus at home, (2) time...... of the most recent iodine supplement intake prior to sampling, and (3) members of their household. Study Design: Danish crosssectional study in the year 2012. Pregnant women (n = 158), their male partners (n = 157) and children (n = 51) provided a questionnaire with detailed information on iodine supplement.......042), but not estimated 24-hour urinary iodine excretion (p = 0.79), were higher when sampling was at home. Median UIC was dependent on the time of the most recent iodine supplement intake prior to sampling [same day (n = 79): 150 μg/l (95% CI 131-181 μg/l), the day before (n = 51): 105 μg/l (78-131 μg/l), several days...

  3. Preventive distribution and plans of iodine tablets stocks management

    International Nuclear Information System (INIS)

    2002-01-01

    This official note includes two parts: one concerns the new preventive distribution of iodine tablets on the areas defined by the Particular Intervention Plans (P.P.I.) around nuclear facilities and the other one the setting up of iodine tablets stocks beyond the P.P.I. areas. In annexe is a guide for the elaboration of stocks management plans for steady iodine tablets. (N.C.)

  4. Sources of dietary iodine: bread, cows' milk, and infant formula in the Boston area.

    Science.gov (United States)

    Pearce, Elizabeth N; Pino, Sam; He, Xuemei; Bazrafshan, Hamid R; Lee, Stephanie L; Braverman, Lewis E

    2004-07-01

    Dietary iodine is essential for thyroid hormone production. Although U.S. dietary iodine is generally adequate, some groups, especially women of childbearing age, are at risk for mild iodine deficiency. Children's average urinary iodine is higher than that of adults. U.S. dietary iodine sources have not been assessed recently. A survey of iodine content in 20 brands of bread, 18 brands of cows' milk, and eight infant formulae was performed between 2001 and 2002. Three bread varieties contained more than 300 microg iodine per slice. Iodine content in other brands was far lower (mean +/- sd, 10.1 +/- 13.2 microg iodine/slice). All cows' milk samples had at least 88 microg iodine/250 ml, ranging from 88-168 microg (116.0 +/- 22.1 microg/250 ml). Infant formulae values ranged from 16.2 to 56.8 microg iodine/5 oz (23.5 +/- 13.78 microg/5 oz). The public should be aware of the need for adequate dietary iodine intake and should be aware that ingredient lists do not reflect the iodine content of foods.

  5. X-ray fluorescence camera for imaging of iodine media in vivo.

    Science.gov (United States)

    Matsukiyo, Hiroshi; Watanabe, Manabu; Sato, Eiichi; Osawa, Akihiro; Enomoto, Toshiyuki; Nagao, Jiro; Abderyim, Purkhet; Aizawa, Katsuo; Tanaka, Etsuro; Mori, Hidezo; Kawai, Toshiaki; Ehara, Shigeru; Sato, Shigehiro; Ogawa, Akira; Onagawa, Jun

    2009-01-01

    X-ray fluorescence (XRF) analysis is useful for measuring density distributions of contrast media in vivo. An XRF camera was developed for carrying out mapping for iodine-based contrast media used in medical angiography. Objects are exposed by an X-ray beam from a cerium target. Cerium K-series X-rays are absorbed effectively by iodine media in objects, and iodine fluorescence is produced from the objects. Next, iodine Kalpha fluorescence is selected out by use of a 58-microm-thick stannum filter and is detected by a cadmium telluride (CdTe) detector. The Kalpha rays are discriminated out by a multichannel analyzer, and the number of photons is counted by a counter card. The objects are moved and scanned by an x-y stage in conjunction with a two-stage controller, and X-ray images obtained by iodine mapping are shown on a personal computer monitor. The scan pitch of the x and y axes was 2.5 mm, and the photon counting time per mapping point was 2.0 s. We carried out iodine mapping of non-living animals (phantoms), and iodine Kalpha fluorescence was produced from weakly remaining iodine elements in a rabbit skin cancer.

  6. Iodine intake before and after mandatory iodization in Denmark: results from the Danish Investigation of Iodine Intake and Thyroid Diseases (DanThyr) study

    DEFF Research Database (Denmark)

    Rasmussen, Lone Banke; Carle, Allan; Jørgensen, Torben Walther

    2008-01-01

    determinants of iodine intake after fortification. Iodine excretion in casual urine samples was assessed in 4649 subjects in 1997-8 and in 3570 comparable subjects in 2004-5 in women 18-22, 25-30, 40-45 and 60-65 years of age and in men 60-65 years of age living in Aalborg (western part of Denmark...... concentration, increased significantly in all age and sex groups. However, the iodine intake was still below the recommended in the youngest age groups in both cities and in women 40-45 years of age living in Aalborg. Intake of milk and salt had strong significant direct associations with iodine excretion (P...

  7. Fatty acids labelled in the. omega. -position with iodine isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Mathieu, J.P.; Busquet, G.; Comet, M. (Universite Scientifique et Medicale de Grenoble, 38 - La Tronche (France)); Riche, F.; Vidal, M. (Laboratoire d' Etudes Dynamiques et Structurales de la Selectivite, 38 - Grenoble (France)); Coornaert, S.; Bardy, A. (CEA, Centre de Saclay, 91 - Gif-sur-Yvette (France)); Godart, J. (Institut des Sciences Nucleaires, 38 - Grenoble (France))

    1982-01-01

    The synthesis of saturated acetylenic and olefinic (Z or E) ..omega..-iodinated fatty acids has been carried out and their labelling with iodine-131 or 123 by exchange I/sup -/, *I/sup -/ has been studied. The influence of several parameters -water and fatty acid concentrations, specific activity, labelling solution acidity, iodine carrier presence- on this exchange reaction has been noted, enabling experimental conditions to be defined that produce labelling yields of greater than 95%. These results should lead to widespread clinical use of iodine labelled fatty acids.

  8. RAIM-A model for iodine behavior in containment under severe accident condition

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Han Chul; Cho, Yeong Hun [Korea Institute of Nuclear Safety, Daejeon (Korea, Republic of)

    2015-12-15

    Following a severe accident in a nuclear power plant, iodine is a major contributor to the potential health risks for the public. Because the amount of iodine released largely depends on its volatility, iodine's behavior in containment has been extensively studied in international programs such as International Source Term Programme-Experimental Program on Iodine Chemistry under Radiation (EPICUR), Organization for Economic Co-operation and Development (OECD)-Behaviour of Iodine Project, and OECD-Source Term Evaluation and Mitigation. Korea Institute of Nuclear Safety (KINS) has joined these programs and is developing a simplified, stand-alone iodine chemistry model, RAIM (Radio-Active Iodine chemistry Model), based on the IMOD methodology and other previous studies. This model deals with chemical reactions associated with the formation and destruction of iodine species and surface reactions in the containment atmosphere and the sump in a simple manner. RAIM was applied to a simulation of four EPICUR tests and one Radioiodine Test Facility test, which were carried out in aqueous or gaseous phases. After analysis, the results show a trend of underestimation of organic and molecular iodine for the gas-phase experiments, the opposite of that for the aqueous-phase ones, whereas the total amount of volatile iodine species agrees well between the experiment and the analysis result.

  9. Pressurized water reactor iodine spiking behavior under power transient conditions

    International Nuclear Information System (INIS)

    Ho, J.C.

    1992-01-01

    The most accepted theory explaining the cause of pressurized water reactor iodine spiking is steam formation and condensation in damaged fuel rods. The phase transformation of the primary coolant from water to steam and back again is believed to cause the iodine spiking phenomenon. But due to the complex nature of the phenomenon, a comprehensive model of the behavior has not yet been successfully developed. This paper presents a new model based on an empirical approach, which gives a first-order estimation of the peak iodine spiking magnitude. Based on the proposed iodine spiking model, it is apparent that it is feasible to derive a correlation using the plant operating data base to monitor and control the peak iodine spiking magnitude

  10. Epidemiological trends of iodine-related thyroid disorders: an example from Slovenia.

    Science.gov (United States)

    Gaberšček, Simona; Zaletel, Katja

    2016-06-01

    The epidemiology of thyroid disorders is significantly associated with iodine supply. In 1999, Slovenia increased iodine content in kitchen salt from 10 mg to 25 mg of potassium iodide per kg of salt. According to the WHO criteria, Slovenia shifted from a mildly iodine-deficient country to a country with adequate iodine intake. Ten years after the increase in iodine intake, the incidence of diffuse goitre and thyroid autonomy decreased. Now patients with diffuse goitre and thyroid autonomy reach older age than the patients before the increase in iodine intake. In addition, patients with thyroid autonomy are less frequently hyperthyroid than ten years ago and iodine-induced hyperthyroidism is less severe. The incidence of highly malignant thyroid carcinoma has also dropped. However, the incidence of Hashimoto's thyroiditis increased, most probably in genetically predisposed individuals. Over the last ten years, many animal and in vitro studies evaluated the effects of endocrine disrupting chemicals (EDC) on various aspects of the thyroid function. They mostly studied the effects of polychlorinated biphenyls (PCBs) and dioxins, brominated flame retardants, phthalates, bisphenol A, perfluorinated chemicals, and perchlorate. However, human studies on the effects of EDCs on the thyroid function are very scarce, especially the long-term ones. What they do suggest is that PCBs and dioxins interfere with the transport of thyroid hormones and adversely affect the thyroid function. Many authors agree that iodine deficiency predisposes the thyroid gland to harmful effects of EDCs. Therefore the effects of EDCs in iodine-deficient areas could be more severe than in areas with adequate iodine intake.

  11. State of the art report on iodine chemistry

    International Nuclear Information System (INIS)

    Clement, B.; Cantrel, L.; Ducros, G.; Funke, F.; Herranz, L.; Rydl, A.; Weber, G.; Wren, C.

    2007-01-01

    An accident in which the normal core cooling is lost could lead to fuel elements melting and fission product release beyond the plant limits. Nuclear power plants are designed with engineering systems and associated operational procedures which provide an in-depth defence against such accidents. Iodine is a major contributor to the potential source term to the environment, thus a good understanding of its behaviour and validated calculation tools are required to perform meaningful risk analyses and make decisions in the field of accident management, mitigation measures and emergency procedures. A number of experimental programmes, involving separate-effect and integral tests have been carried out during the last decade, providing new and valuable results that have improved our understanding of iodine phenomena. A modelling effort has also been pursued in order to encapsulate the acquired knowledge in the calculation tools prepared for predicting the iodine behaviour under severe accident conditions. In view of the progress made, the Working Group on Analysis and Management of Accidents (GAMA) considered the necessity of producing a status paper on iodine chemistry, with the following objectives: - to review insights gained and evaluate the progress made during the last 10 years on the understanding of phenomena governing iodine chemistry and release in the case of a reactor severe accident, - to evaluate the current status of iodine chemistry knowledge and tools used for source term prediction in connection with accident management and emergency planning, under various reactor conditions, to identify the remaining weaknesses, discuss the reactor safety relevance of these issues and make recommendations as necessary. This paper aims at shedding light on the present situation, helping end-users and decision makers to adequately address questions related to iodine behaviour under severe accident conditions, and to essential programmes of work in this area

  12. Phebus FPT-O. Exploratory containment iodine chemistry calculations

    International Nuclear Information System (INIS)

    Fermandjian, J.; Dickinson, S.; Edward, J.B.; Ewig, F.J.; Funke, F.; Hueber, C.; Rodriguez-Maroto, J.J.; Sims, H.E.

    1994-01-01

    The results of the exploratory containment iodine chemistry calculations related to the first Phebus-FP test (benchmark exercise for explaining the reasons for code inconsistencies and realistic calculation for test preparation) are reported. Calculations have been performed by CEA/IPSN/DRS/SEMAR-Cadarache (France), CIEMAT-Madrid (Spain), GRS-Koeln and SIEMENS/KWU, Erlangen (Germany), AEA-Harwell (UK), Ontario Hydro-Toronto, University of Toronto and AECL-Whiteshell (Canada). The code benchmark results show that mechanistic codes (INSPECT and LIRIC) are in agreement for molecular iodine concentration in the gaseous phase, whereas empirical codes (IODE and IMPAIR) are in disagreement because they model differently HOI disproportionation and use different radiolytic constant values (iodide/iodate radiolysis). Furthermore, the molecular iodine concentrations in the gaseous phase are 10 to 100 times higher at acid pH (pH - 5) than at neutral pH (pH - 7), and the presence of organic radicals in water does not change the concentrations of inorganic iodine species. Concerning the realistic calculation, the iodine mass distribution in the containment differ from one code to another, but all codes predict that the iodine concentration in the gaseous phase is high enough to be detected by foreseen instrumentation (as was verified during the test). FPT-0 test has been performed in December 1993. Analysis of experimental results is underway and result interpretation will be available at the beginning of 1995. (author). 11 refs., 1 tab., 5 figs

  13. Radioactive iodine and environmental and sanitary effects - bibliographic study and quantification

    International Nuclear Information System (INIS)

    Guetat, Ph.; Armand, P.; Monfort, M.; Fritsch, P.; Flury Herard, A.; Menetrier, F.; Bion, L.; Schoech, C.; Masset, S.

    2004-01-01

    This document is intended to a large public. It reviews the different parameters needed to evaluate the potential act o radioactive releases from the emission to public. Its objectives are to evaluate the importance of different exposure pathways and to assess efficiency of the possible interventions for large public. The main conclusions are summarised hereafter: The radioactive decay chains have to be taken into account to evaluate the iodine source term in the nuclear plants in the case of fission accidents. The physico-chemical forms of iodine are important in order to determine the released activity and deposited activity on the soil. The isotopes to be taken into account are mainly iodine 131 for radiological assessments and also iodine 133 for the nuclear reactor accidents, and the chain Tellurium-Iodine 132 when no particulate filtration exists. Iodine 129 in French reprocessing plant cannot lead to significant accidents. The dominant exposure pathways are related to the consumption of contaminated food products (vegetable, milk) for the inorganic iodine. The iodine transfer to goat and sheep milk is greater than the one to cow milk. The meat production of herbivores at field is the most sensitive. The interest to remove rapidly herbivore from pasture appears relatively clearly. The banning of consumption of local contaminated food products (vegetables and meats) may reduce by about a factor of thirteen the impact due to iodine 131. The youngest the population is, the greatest are the thyroid radiosensitivity and variability within the population. Oral administration of stable iodine limits transfers to maternal milk and foetal thyroid. Ingestion of stable iodine is complementary to consumption banning of local contaminated food products. The earliest the ingestion is, the greatest is the efficiency. 0,1 TBq of 131 iodine released at a low height involves only limited and local actions whereas the release of 10 TBq involves direct and immediate protection

  14. Iodine sorption of bentonite - radiometric and polarographic study

    International Nuclear Information System (INIS)

    Konirova, R.; Vinsova, H.; Koudelkova, M.; Ernestova, M.; Jedinakova-Krizova, V.

    2003-01-01

    The experiments focused on kinetics of iodine retardation on bentonite, influence of aqueous phase pH, buffering properties of bentonite, etc. were carried out by batch method. Distribution coefficient KD was the criterion applied for evaluation of iodine interaction with solid phase. High sorption potential of bentonite to cationic forms of various radionuclides, resulting from relatively high cation exchange capacity, is generally known. On the other hand the inorganic anions are not adsorbed strongly to mineral surface of clays thus uptake of iodine (occurring mainly at iodide (I - ) or iodate (IO 3 - ) form under oxoic conditions) is limited. The distribution coefficients of iodine anions' sorption on bentonite R reach order of magnitude 10 -1 mL/g. In order to increase the sorption capacity of the solid phase, several additives were added to bentonite. Most of them didn't provide satisfactory results except of the addition of activated carbon, which has high surface area. Electromigration and polarographic methods were used for investigation of the redox state of iodine in aqueous phase and determination of KD values as well. Acquired results were compared with data obtained by radiometric measurements. (authors)

  15. Direct solar-pumped iodine laser amplifier

    Science.gov (United States)

    Han, Kwang S.; Hwang, In Heon

    1990-01-01

    The optimum conditions of a solar pumped iodine laser are found in this research for the case of a continuous wave operation and a pulsed operation. The optimum product of the pressure(p) inside the laser tube and the tube diameter(d) was pd=40 approx. 50 torr-cm on the contrary to the case of a high intensity flashlamp pumped iodine laser where the optimum value of the product is known to be pd=150 torr-cm. The pressure-diameter product is less than 1/3 of that of the high power iodine laser. During the research period, various laser materials were also studied for solar pumping. Among the laser materials, Nd:YAG is found to have the lowest laser threshold pumping intensity of about 200 solar constant. The Rhodamine 6G was also tested as the solar pumped laser material. The threshold pumping power was measured to be about 20,000 solar constant. The amplification experiment for a continuously pumped iodine laser amplifier was performed using Vortek solar simulator and the amplification factors were measured for single pass amplification and triple pass amplification of the 15 cm long amplifier tube. The amplification of 5 was obtained for the triple pass amplification.

  16. Iodine-125 seeds for cancer treatment

    Energy Technology Data Exchange (ETDEWEB)

    Rostelato, Maria E.C.M.; Zeituni, Carlos A.; Feher, Anselmo; Moura, Joao A.; Moura, Eduardo S.; Nagatomi, Helio R.; Manzoli, Jose E.; Souza, Carla D., E-mail: elisaros@ipen.b, E-mail: czeituni@pobox.co, E-mail: afeher@ipen.b, E-mail: jmoura31@yahoo.com.b, E-mail: esmoura@ipen.b, E-mail: hrnagato@ipen.b, E-mail: jemanzoli@ipen.b, E-mail: cdsouza@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Karam, Dib, E-mail: dib.karan@usp.b [Universidade de Sao Paulo (USP), SP (Brazil). Escola de Artes, Ciencias e Humanidades

    2009-07-01

    In Brazil, cancer has become one of the major public health problems. An estimate by the Health Ministry showed that 466,430 people had the disease in the country in 2008. The prostate cancer is the second largest death cause among men. The National Institute of Cancer estimated the occurrence of 50,000 new cases for 2009. Some of these patients are treated with Brachytherapy, using Iodine-125 seeds. By this technique, small seeds with Iodine-125, a radioactive material, are implanted in the prostate. The advantages of radioactive seed implants are the preservation of healthy tissues and organs near the prostate, besides the low rate of impotence and urinary incontinence. The Energy and Nuclear Research Institute - IPEN, which belongs to the Nuclear Energy National Commission - CNEN, established a program for the development of the technique and production of Iodine-125 seeds in Brazil. The estimate for the 125-Iodine seeds demand is of 8,000 seeds/month and the laboratory to be implanted will need this production capacity. The purpose of this paper is to explain the project status and show some data about the seeds used in the country. The project will be divided in two phases: technological development of a prototype and a laboratory implementation for the seeds production. (author)

  17. Iodine immobilization in apatites

    International Nuclear Information System (INIS)

    Audubert, F.; Lartigue, J.E.

    2000-01-01

    In the context of a scientific program on long-lived radionuclide conditioning, a matrix for iodine 129 immobilization has been studied. A lead vanado-phosphate apatite was prepared from the melt of lead vanado-phosphate Pb 3 (VO 4 ) 1.6 (PO 4 ) 0.4 and lead iodide PbI 2 in stoichiometric proportions by calcination at 700 deg. C during 3 hours. Natural sintering of this apatite is not possible because the product decomposition occurs at 400 deg. C. Reactive sintering is the solution. The principle depends on the coating of lead iodide with lead vanado-phosphate. Lead vanado-phosphate coating is used as iodo-apatite reactant and as dense covering to confine iodine during synthesis. So the best condition to immobilize iodine during iodo-apatite synthesis is a reactive sintering at 700 deg. C under 25 MPa. We obtained an iodo-apatite surrounded with dense lead vanadate. Leaching behaviour of the matrix synthesized by solid-solid reaction is under progress in order to determine chemical durability, basic mechanisms of the iodo-apatite alteration and kinetic rate law. Iodo-apatite dissolution rates were pH and temperature dependent. We obtained a rate of 2.5 10 -3 g.m -2 .d -1 at 90 deg. C in initially de-ionised water. (authors)

  18. Review of Iodine Nutrition in Iranian Population in the Past Quarter of Century.

    Science.gov (United States)

    Delshad, Hossein; Azizi, Fereidoun

    2017-10-01

    Iodine deficiency is one of the most important health problems worldwide. The overall aim of this study was a narrative review of the past and present status of iodine nutrition in the Iranian population to gather and provide valuable background data in this field for future studies. For this narrative literature review study, published internal (SID, Iran doc, Iran medex) and international (Web of knowledge, Pubmed, SCOPUS) source studies were searched using the following medical subject heading terms: Iodine, IDD (iodine deficiency disorders), UIC (urinary iodine concentration), Goiter, IQ (intelligence quotient), thyroid hormone, Iodine and pregnancy, Iodine and breast feeding, as well as Iodized salt, reporting the prevalence of iodine deficiency and iodine nutrition status of different target populations in Iran over 25 years, between 1988 - 2014, were assessed. We found 185 abstracts by literature search, of which, 161 papers that were as case reports, animal study, with lack of regional or national data were excluded after full text evaluation. Finally 24 full papers covering regional or national data on iodine nutrition of the study population were eligible for our review. Iodine deficiency, as a nutritional problem, had been identified in Iran since 1968. In the years 1987 - 1989, a few studies were done to define the prevalence of iodine deficiency in the country. The first nation-wide survey was performed in 14 provinces. Based on this survey all provinces were suffering of endemic goiter. In 1989, iodine deficiency was recognized as a major problem for community health. In 1990, salt factories began to produce iodized salt and in 1996, the second national survey was performed in 26 provinces. This survey indicated that 40% of boys and 50% of girls have goiter, with a median urinary iodine excretion of 205 µg/L. The 3rd national survey in 2001 showed that the total goiter rate is 9.8% and median UIC of 165 μg/L. In 2007, the 3th national survey was

  19. The main outcomes of the OECD Behaviour of Iodine (BIP) Project

    International Nuclear Information System (INIS)

    Glowa, Glenn A.; Moore, Chris J.; Ball, Joanne M.

    2013-01-01

    Highlights: • Moisture affects the rate of iodine adsorption on paint. • Irradiation of iodine-loaded paint yields methyl iodide. • The BIP project is complimentary to the EPICUR project. • BIP results help with the interpretation of Phébus FP results. - Abstract: An Organisation for Economic Co-operation and Development (OECD) status report on iodine behaviour published in February 2007 concluded that although the understanding of iodine behaviour in containment had advanced considerably over the past several decades, there were still areas where further investigation was warranted. The OECD initiated the Behaviour of Iodine Project (BIP) to investigate two of these areas: • The interaction of iodine with painted surfaces: adsorption of iodine from the gas phase to several containment surfaces was investigated under a variety of conditions, with focus on the role of water on the adsorption of iodine onto epoxy paints. The results show that the relative humidity is very important to the deposition velocity of iodine on paint; higher humidity caused faster deposition. Adsorption parameters are a critical input for containment codes. • The formation of organic iodide from painted surfaces: gas chromatography was used to monitor the evolution of CH 3 I during the irradiation of epoxy coupons pre-loaded with iodine. The results showed that organic iodide formation is greater, and has a different temporal behaviour, when the iodine is absorbed by the paint from the aqueous phase as opposed to from the gas phase. The results also highlighted the importance of destruction of organic iodides by gas phase radiolysis to the concentration of CH 3 I. The BIP organic iodide production experiments were different, but complementary, to the experiments performed in the EPICUR (Experimental Program for Iodine Chemistry Under Radiation) facility. However, both projects share an objective of supporting the explanation of iodine behaviour in the Phébus Fission Product

  20. The behaviour of iodine in the compartments soil, plant and air

    International Nuclear Information System (INIS)

    Pel, E.

    1993-02-01

    Within the framework of this study, several investigations were carried out into the behaviour of iodine in the soil-plant-air system. Particular attention was given to the mechanisms determining iodine transfer from soil to plant. Measurements of iodine contents in the soil, plants and individual parts of plants were as important an aim of this study as was the identification of factors possibly contributing to an abundant iodine uptake into plants. In view of iodine's role as an element essential to the health of both humans and animals, widely cultured forage crops and useful plants were investigated in this connection. As the relevant literature quotes unusually high contents of the substance for a number of foodstuffs based on plants, these were included in the studies for iodine contents. (orig.) [de

  1. 27 CFR 24.126 - Change in proprietorship involving a bonded wine warehouse.

    Science.gov (United States)

    2010-04-01

    ... involving a bonded wine warehouse. 24.126 Section 24.126 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Establishment and Operations Changes Subsequent to Original Establishment § 24.126 Change in proprietorship involving a bonded wine warehouse...

  2. Radio-iodine therapy and Helicobacter pylori infection

    International Nuclear Information System (INIS)

    Gholamrezanezhad, A.; Mirpour, S.; Saghari, M.; Abdollahzadeh, J.; Pourmoslemi, A.; Yarmand, S.

    2008-01-01

    Helicobacter pylori is the most important cause of gastritis and related morbidities. Following consumption, radioactive iodine accumulates considerably in the stomach. On the basis of this observation, we decided to determine whether the high radiation induced by radio-iodine in the stomach is effective in the eradication of this infection. All consecutive patients with differentiated thyroid carcinoma, who were referred for radio-iodine therapy [dose 117.1±24.4 mCi (4.3±0.9 GBq), range 100-200 mCi (3.7-7.4 GBq)], were enrolled. To detect H. pylori infection, the urease breath test (UBT) was performed 1-2 h before radio-iodine consumption and the test was repeated 2 months later. Of 88 patients, 71 had pre-treatment positive UBT. Of these, 23 patients had negative post-treatment result, which means a significant reduction (26.1%, 95% confidence interval (CI) 16.8-35.5%) in the number of positive UBT results in our treated population (32.4% of UBT-positive cases became UBT-negative). Considering the high prevalence of reinfection in developing countries, the therapeutic benefit would have been more considerable if the second UBT had been done with a lag time of less than 2 months. Although radio-iodine therapy is not a logical method for the treatment of patients suffering from H. pylori, our finding provides indirect evidence about the radiosensitivity of bacteria, the future clinical applications of which need to be further evaluated. Also this finding can be useful for the food industry, where radiation is used widely to sterilize food. Regarding the possibility of H. pylori suppression, we recommend not using UBT for screening for the infection for at least within 2 months following radio-iodine therapy. (author)

  3. Iodine environmental availability and human intake in oceanic islands: Azores as a case-study

    International Nuclear Information System (INIS)

    Linhares, Diana Paula Silva; Garcia, Patrícia Ventura; Almada, Alexandra; Ferreira, Teresa; Queiroz, Gabriela; Cruz, José Virgílio; Rodrigues, Armindo dos Santos

    2015-01-01

    Iodine deficiency is the most common cause of preventable mental impairment. Although several studies have established an association between ocean proximity and iodine environmental availability, recent studies revealed an inadequate iodine intake in the Azorean islands. In this study, we aim to understand the underlying causes of iodine environmental availability in oceanic islands and its association with iodine intake in schoolchildren, using the Azores as case-study. Iodine concentration in soil and grass pasture was measured by INAA and in drinking water by spectrophotometry. Urinary iodine concentration (UIC) in schoolchildren was assessed by ICP-MS in a randomized cross-sectional survey with 315 participants from S. Miguel (study group) and Sta. Maria islands (reference group). A validated diet questionnaire assessing sources of iodine was recorded. The iodine concentration in soils of the reference group was significantly higher than in the study group (58.1 ppm vs. 14.5 ppm, respectively; p = 0.001). The prevalence of schoolchildren with inadequate UIC was significantly higher in the study group than in the reference one (63.0% vs. 37.8%, respectively; p < 0.001). Chronic exposure to low iodine environmental availability was significantly associated with the exacerbation in iodine deficiency, with a risk 4.94 times higher in the study group. The differences observed in the studied islands are related with each island geomorphology (soil properties and orography) and climate, which can promote or inhibit iodine environmental availability, contributing distinctively to iodine bioavailability and human intake. These findings draw attention to an urgent need for a full investigation of Azores iodine status to apply evidence-based recommendations for iodine supplementation. - Highlights: • Iodine intake in schoolchildren differs between islands of the Azorean archipelago. • Island geomorphology and climate modulate iodine environmental availability. • In

  4. Iodine environmental availability and human intake in oceanic islands: Azores as a case-study

    Energy Technology Data Exchange (ETDEWEB)

    Linhares, Diana Paula Silva, E-mail: dlinhares@uac.pt [Department of Biology, University of the Azores, 9501-801 Ponta Delgada, Azores (Portugal); CVARG, Center for Volcanology and Geological Risks Assessment, University of the Azores, 9501-801 Ponta Delgada, Azores (Portugal); Garcia, Patrícia Ventura, E-mail: patriciag@uac.pt [Department of Biology, University of the Azores, 9501-801 Ponta Delgada, Azores (Portugal); CE3C, Centre for Ecology, Evolution and Environmental Changes/Azorean Biodiversity Group, University of the Azores, 9501-801 Ponta Delgada, Azores (Portugal); Almada, Alexandra, E-mail: alexandra_almada@hotmail.com [Department of Biology, University of the Azores, 9501-801 Ponta Delgada, Azores (Portugal); Ferreira, Teresa, E-mail: teresa.jl.ferreira@azores.gov.pt [Department of Geosciences, University of the Azores, 9501-801 Ponta Delgada, Azores (Portugal); CVARG, Center for Volcanology and Geological Risks Assessment, University of the Azores, 9501-801 Ponta Delgada, Azores (Portugal); Queiroz, Gabriela, E-mail: maria.gp.queiroz@azores.gov.pt [Department of Geosciences, University of the Azores, 9501-801 Ponta Delgada, Azores (Portugal); CVARG, Center for Volcanology and Geological Risks Assessment, University of the Azores, 9501-801 Ponta Delgada, Azores (Portugal); Cruz, José Virgílio, E-mail: jvc@uac.pt [Department of Geosciences, University of the Azores, 9501-801 Ponta Delgada, Azores (Portugal); CVARG, Center for Volcanology and Geological Risks Assessment, University of the Azores, 9501-801 Ponta Delgada, Azores (Portugal); Rodrigues, Armindo dos Santos, E-mail: rodrigues@uac.pt [Department of Biology, University of the Azores, 9501-801 Ponta Delgada, Azores (Portugal); CVARG, Center for Volcanology and Geological Risks Assessment, University of the Azores, 9501-801 Ponta Delgada, Azores (Portugal)

    2015-12-15

    Iodine deficiency is the most common cause of preventable mental impairment. Although several studies have established an association between ocean proximity and iodine environmental availability, recent studies revealed an inadequate iodine intake in the Azorean islands. In this study, we aim to understand the underlying causes of iodine environmental availability in oceanic islands and its association with iodine intake in schoolchildren, using the Azores as case-study. Iodine concentration in soil and grass pasture was measured by INAA and in drinking water by spectrophotometry. Urinary iodine concentration (UIC) in schoolchildren was assessed by ICP-MS in a randomized cross-sectional survey with 315 participants from S. Miguel (study group) and Sta. Maria islands (reference group). A validated diet questionnaire assessing sources of iodine was recorded. The iodine concentration in soils of the reference group was significantly higher than in the study group (58.1 ppm vs. 14.5 ppm, respectively; p = 0.001). The prevalence of schoolchildren with inadequate UIC was significantly higher in the study group than in the reference one (63.0% vs. 37.8%, respectively; p < 0.001). Chronic exposure to low iodine environmental availability was significantly associated with the exacerbation in iodine deficiency, with a risk 4.94 times higher in the study group. The differences observed in the studied islands are related with each island geomorphology (soil properties and orography) and climate, which can promote or inhibit iodine environmental availability, contributing distinctively to iodine bioavailability and human intake. These findings draw attention to an urgent need for a full investigation of Azores iodine status to apply evidence-based recommendations for iodine supplementation. - Highlights: • Iodine intake in schoolchildren differs between islands of the Azorean archipelago. • Island geomorphology and climate modulate iodine environmental availability. • In

  5. Iodine neutron capture therapy

    Science.gov (United States)

    Ahmed, Kazi Fariduddin

    A new technique, Iodine Neutron Capture Therapy (INCT) is proposed to treat hyperthyroidism in people. Present thyroid therapies, surgical removal and 131I treatment, result in hypothyroidism and, for 131I, involve protracted treatment times and excessive whole-body radiation doses. The new technique involves using a low energy neutron beam to convert a fraction of the natural iodine stored in the thyroid to radioactive 128I, which has a 24-minute half-life and decays by emitting 2.12-MeV beta particles. The beta particles are absorbed in and damage some thyroid tissue cells and consequently reduce the production and release of thyroid hormones to the blood stream. Treatment times and whole-body radiation doses are thus reduced substantially. This dissertation addresses the first of the several steps needed to obtain medical profession acceptance and regulatory approval to implement this therapy. As with other such programs, initial feasibility is established by performing experiments on suitable small mammals. Laboratory rats were used and their thyroids were exposed to the beta particles coming from small encapsulated amounts of 128I. Masses of 89.0 mg reagent-grade elemental iodine crystals have been activated in the ISU AGN-201 reactor to provide 0.033 mBq of 128I. This activity delivers 0.2 Gy to the thyroid gland of 300-g male rats having fresh thyroid tissue masses of ˜20 mg. Larger iodine masses are used to provide greater doses. The activated iodine is encapsulated to form a thin (0.16 cm 2/mg) patch that is then applied directly to the surgically exposed thyroid of an anesthetized rat. Direct neutron irradiation of a rat's thyroid was not possible due to its small size. Direct in-vivo exposure of the thyroid of the rat to the emitted radiation from 128I is allowed to continue for 2.5 hours (6 half-lives). Pre- and post-exposure blood samples are taken to quantify thyroid hormone levels. The serum T4 concentration is measured by radioimmunoassay at

  6. The method of quantitative determination of iodine in acetic acid

    International Nuclear Information System (INIS)

    Sukhomlinov, A.B.; Kalinchenko, N.B.

    1988-01-01

    Method for separate determination of J 2 and J - concentrations in acetic acid is suggested. Iodine concentration in acetic acid is determined by measuring potential of iodine-selective electrode first in the initial solution of acetic acid, where molecular iodine dissociation equals 0.5, and then in acetic acid, with alkali (NaOH) addition up to pH > 3, where molecular iodine dissociation equals 1. Determination is conducted in 5x10 -7 -5x10 -6 mol/l concentration range with relative standard deviation not more than 0.1. 1 fig

  7. No impact of dietary iodine restriction in short term development of hypothyroidism following fixed dose radioactive iodine therapy for Graves' disease.

    Science.gov (United States)

    Jacob, Jubbin Jagan; Stephen, Charles; Paul, Thomas V; Thomas, Nihal; Oommen, Regi; Seshadri, Mandalam S

    2015-01-01

    The increased incidence of autoimmune thyroid disease with increasing dietary iodine intake has been demonstrated both epidemiologically and experimentally. The hypothyroidism that occurs in the first year following radioactive iodine therapy is probably related to the destructive effects of the radiation and underlying ongoing autoimmunity. To study the outcomes at the end of six months after fixed dose I, (131)therapy for Graves' disease followed by an iodine restricted diet for a period of six months. Consecutive adult patients with Graves' disease planned for I(131) therapy were randomized either to receive instructions regarding dietary iodine restriction or no advice prior to fixed dose (5mCi) I(131) administration. Thyroid functions and urinary iodine indices were evaluated at 3(rd) and 6(th) month subsequently. Forty seven patients (13M and 34F) were assessed, 2 were excluded, 45 were randomized (Cases 24 and Controls 21) and 39 patients completed the study. Baseline data was comparable. Median urinary iodine concentration was 115 and 273 μg/gm creat (p = 0.00) among cases and controls respectively. Outcomes at the 3(rd) month were as follows (cases and controls); Euthyroid (10 and 6: P = 0.24), Hypothyroid (3 and 5: P = 0.38) and Hyperthyroid (7 and 8: P = 0.64). Outcomes at the end of six months were as follows (cases and controls); Euthyroid (10 and 5: P = 0.12), Hypothyroid (3 and 5: P = 0.38) and Hyperthyroid (7 and 9: P = 0.43). Of the hypothyroid patients 5 (cases 1 and controls 4: P = 0.13) required thyroxine replacement. There was no statistical significant difference in the outcome of patients with dietary iodine restriction following I(131) therapy for Graves' disease.

  8. Effect of a Low Iodine Diet vs. Restricted Iodine Diet on Postsurgical Preparation for Radioiodine Ablation Therapy in Thyroid Carcinoma Patients.

    Science.gov (United States)

    Lim, Chi Young; Kim, Jung-Yeon; Yoon, Mi-Jin; Chang, Hang Seok; Park, Cheong Soo; Chung, Woong Youn

    2015-07-01

    The radioiodine ablation therapy is required for patients who underwent a total thyroidectomy. Through a comparative review of a low iodine diet (LID) and a restricted iodine diet (RID), the study aims to suggest guidelines that are suitable for the conditions of Korea. The study was conducted with 101 patients. With 24-hour urine samples from the patients after a 2-week restricted diet and after a 4-week restricted diet, the amount of iodine in the urine was estimated. The consumed radioiodine amounts for 2 hours and 24 hours were calculated. This study was conducted with 47 LID patients and 54 RID patients. The amounts of iodine in urine, the 2-week case and 4-week case for each group showed no significant differences. The amounts of iodine in urine between the two groups were both included in the range of the criteria for radioiodine ablation therapy. Also, 2 hours and 24 hours radioiodine consumption measured after 4-week restrictive diet did not show statistical differences between two groups. A 2-week RID can be considered as a type of radioiodine ablation therapy after patients undergo a total thyroidectomy.

  9. Anemia, Iron Deficiency and Iodine Deficiency among Nepalese School Children.

    Science.gov (United States)

    Khatiwada, Saroj; Lamsal, Madhab; Gelal, Basanta; Gautam, Sharad; Nepal, Ashwini Kumar; Brodie, David; Baral, Nirmal

    2016-07-01

    To assess iodine and iron nutritional status among Nepalese school children. A cross-sectional, community based study was conducted in the two districts, Ilam (hilly region) and Udayapur (plain region) of eastern Nepal. A total of 759 school children aged 6-13 y from different schools within the study areas were randomly enrolled. A total of 759 urine samples and 316 blood samples were collected. Blood hemoglobin level, serum iron, total iron binding capacity and urinary iodine concentration was measured. Percentage of transferrin saturation was calculated using serum iron and total iron binding capacity values. The mean level of hemoglobin, serum iron, total iron binding capacity, transferrin saturation and median urinary iodine excretion were 12.29 ± 1.85 g/dl, 70.45 ± 34.46 μg/dl, 386.48 ± 62.48 μg/dl, 19.94 ± 12.07 % and 274.67 μg/L respectively. Anemia, iron deficiency and iodine deficiency (urinary iodine excretion iron deficient children. Iron deficiency and anemia are common in Nepalese children, whereas, iodine nutrition is more than adequate. Low urinary iodine excretion was common in iron deficiency and anemia.

  10. Effect of Co-Contaminants Uranium and Nitrate on Iodine Remediation

    Energy Technology Data Exchange (ETDEWEB)

    Szecsody, James E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Lee, Brady D. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Lawter, Amanda R. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Qafoku, Nikolla [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Resch, Charles T. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Baum, Steven R. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Leavy, Ian I. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Freedman, Vicky L. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

    2017-09-01

    The objective of this study is to evaluate the significance of co-contaminants on the migration and transformation of iodine species in the Hanford subsurface environment. These impacts are relevant because remedies that target individual contaminants like iodine, may not only impact the fate and transport of other contaminants in the subsurface, but also inhibit the effectiveness of a targeted remedy. For example, iodine (as iodate) co-precipitates with calcite, and has been identified as a potential remedy because it immobilizes iodine. Since uranium also co-precipitates with calcite in field sediments, the presence of uranium may also inhibit iodine co-precipitation. Another potentially significant impact from co-existing contaminants is iodine and nitrate. The presence of nitrate has been shown to promote biogeochemical reduction of iodate to iodide, thereby increasing iodine species subsurface mobility (as iodide exhibits less sorption). Hence, this study reports on both laboratory batch and column experiments that investigated a) the change in iodate uptake mass and rate of uptake into precipitating calcite due to the presence of differing amounts of uranium, b) the amount of change of the iodate bio-reduction rate due to the presence of differing nitrate concentrations, and c) whether nitrite can reduce iodate in the presence of microbes and/or minerals acting as catalysts.

  11. Iodide Residues in Milk Vary between Iodine-Based Teat Disinfectants

    NARCIS (Netherlands)

    French, Elizabeth A; Mukai, Motoko; Zurakowski, Michael; Rauch, Bradley; Gioia, Gloria; Hillebrandt, Joseph R; Henderson, Mark; Schukken, Ynte H; Hemling, Thomas C

    Majority of iodine found in dairy milk comes from the diet and teat disinfection products used during milking process. The objective of this study was to evaluate the effects of 4 iodine-based teat dips on milk iodide concentrations varying in iodine level (0.25% vs. 0.5%, w/w), normal low viscosity

  12. 40 CFR Appendix C to Part 97 - Final Section 126 Rule: Trading Budget

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Final Section 126 Rule: Trading Budget... PROGRAMS (CONTINUED) FEDERAL NOX BUDGET TRADING PROGRAM AND CAIR NOX AND SO2 TRADING PROGRAMS Pt. 97, App. C Appendix C to Part 97—Final Section 126 Rule: Trading Budget ST F126-EGU F126-NEGU Total DC 207 26...

  13. Successful efforts toward elimination iodine deficiency disorders in India

    Directory of Open Access Journals (Sweden)

    Kapil Umesh

    2010-01-01

    Full Text Available Iodine deficiency (ID is the world′s single most important preventable cause of brain damage and mental retardation. Iodine deficiency disorders (IDDs is a public health problem in 130 countries, affecting 13% of the world population. The simplest solution to prevent the IDD is to consume iodized common salt every day. In India, significant progress has been achieved toward elimination of IDD, in the last 30 years. Satisfactory levels of urinary iodine excretion and iodine content of salt have been documented by the research surveys conducted by research scientists. The results indicate that we are progressing toward elimination of IDD. IDD is due to a nutritional deficiency, which is prima-rily that of iodine, in soil and water. IDD is known to re-appear if the IDD Control Program is not sustained. To ensure that the population continues to have intake of adequate amount of iodine, there is a need of i periodic surveys to assess the magnitude of the IDD with respect to impact of iodized salt (IS intervention; ii strengthening the health and nutrition education activities to create demand for IS and iii development of a monitoring information system (MIS for ensuring that the adequately IS is available to the beneficiaries.

  14. Low Urinary Iodine Concentration among Mothers and Children in Cambodia.

    Science.gov (United States)

    Laillou, Arnaud; Sophonneary, Prak; Kuong, Khov; Hong, Rathavuth; Un, Samoeurn; Chamnan, Chhoun; Poirot, Etienne; Berger, Jacques; Wieringa, Frank

    2016-04-05

    A 2014 national assessment of salt iodization coverage in Cambodia found that 62% of samples were non-iodized, suggesting a significant decline in daily iodine intakes. The Cambodian Micronutrient Survey conducted in 2014 (CMNS-2014) permitted obtaining national data on urinary iodine concentrations (UIC) to assess iodine status and whether iodized salt use had an impact. Urine samples were collected from mothers (n = 736) and children (n = 950). The median UIC was 63 µg/L and 72 µg/L in mothers and children respectively. More than 60% of mothers and their children had a UIC Cambodia. It is essential for the government to enhance enforcement of the iodized salt legislation, and implement short term strategies, such as iodine supplementation, to prevent an increase of severe complications due to iodine deficiency in the Cambodian population.

  15. Simulation of Iodine Behavior by Coupling of a Standalone Model with MELCOR

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Han Chul; Cho, Song Won [Korea Institute of Nuclear Safety, Daejeon (Korea, Republic of)

    2012-05-15

    During a severe accident, a large fraction of iodine in the core can be released into the containment. Iodine is important in terms of its high activity in the early phase after a core-melt accident due to its short half-life isotopes and its serious effect on the public health, especially on the thyroid. Therefore, iodine behavior has been extensively studied through the international research programs. Major research areas are iodine chemistry, surface reactions, mass transfer, modeling of iodine chemistry and its applications to severe accident assessment, and accident management. Advanced tools for modeling these phenomena have been developed and validated by several experiments such as ISTP-EPICUR (International Source Term Program - Experimental Program on Iodine Chemistry under Radiation) and PARIS, and OECD-BIP (Behavior of Iodine Project) in which Korea Institute of Nuclear Safety (KINS) has been participating. As a result, a simple iodine model, RAIM (Radio-Active Iodine chemistry Model) was developed, based on the IMOD methodology in order to deal with organic iodides conveniently. RAIM has been also coupled with MELCOR, replacing the pool chemistry model (PCM). This coupling model, MELCOR-RAIM, will be used for an integrated severe accident assessment that takes into account the organic iodine behavior. This model is described herein, and representative simulation results of the model are presented

  16. Iodine Deficiency in Pregnancy: The Effect on Neurodevelopment in the Child

    Directory of Open Access Journals (Sweden)

    Sheila A. Skeaff

    2011-02-01

    Full Text Available Iodine is an integral part of the thyroid hormones, thyroxine (T4 and tri-iodothyronine (T3, necessary for normal growth and development. An adequate supply of cerebral T3, generated in the fetal brain from maternal free T4 (fT4, is needed by the fetus for thyroid hormone dependent neurodevelopment, which begins in the second half of the first trimester of pregnancy. Around the beginning of the second trimester the fetal thyroid also begins to produce hormones but the reserves of the fetal gland are low, thus maternal thyroid hormones contribute to total fetal thyroid hormone concentrations until birth. In order for pregnant women to produce enough thyroid hormones to meet both her own and her baby’s requirements, a 50% increase in iodine intake is recommended. A lack of iodine in the diet may result in the mother becoming iodine deficient, and subsequently the fetus. In iodine deficiency, hypothyroxinemia (i.e., low maternal fT4 results in damage to the developing brain, which is further aggravated by hypothyroidism in the fetus. The most serious consequence of iodine deficiency is cretinism, characterised by profound mental retardation. There is unequivocal evidence that severe iodine deficiency in pregnancy impairs brain development in the child. However, only two intervention trials have assessed neurodevelopment in children of moderately iodine deficient mothers finding improved neurodevelopment in children of mothers supplemented earlier rather than later in pregnancy; both studies were not randomised and were uncontrolled. Thus, there is a need for well-designed trials to determine the effect of iodine supplementation in moderate to mildly iodine deficient pregnant women on neurodevelopment in the child.

  17. Behavior of radioactive products in the containment. Behavior of iodine in accidental situation

    International Nuclear Information System (INIS)

    Lucas, M.; Fermandjian, J.

    1984-12-01

    The aim of studies on iodine is to demonstrate that in the case of failure in the containment occuring after more than one day, the total quantity of iodine released would be lower or equal to 1% of the inventory of the core at the moment of the begining of the accident. The first part describes the behavior of iodine in the containment of a PWR, in the case of an important accident. The second part deals with a synthesis of the knowledge about iodine. The third part presents the inventory of the main problems not resolved concerning the chemistry of iodine and the radiolysis of iodine. Finally, the program of studies on iodine is briefly presented; its aim is to develop the knowledge about iodine in accidental situations [fr

  18. Influence of dietary iodine on drug-induced hypothyrodism in the rat.

    Science.gov (United States)

    Beyssen, M L; Lagorce, J F; Cledat, D; Buxeraud, J

    1999-06-01

    Several compounds of pharmaceutical importance from a variety of chemical families, for example chlorpromazine and clomipramine, have been found to form charge-transfer complexes with iodine. We have investigated the influence of dietary iodine on thyroid-gland dysfunction induced by clomipramine, chlorpromazine or 2-thiazoline-2-thiol. We suggest that iodine is partly diverted from its metabolic pathway by complexation with drugs, and so the urinary concentration of iodide is increased. Both chlorpromazine and clomipramine, at doses which do not inhibit thyroperoxidase, enhanced urinary iodine excretion when dietary iodine was restricted (3.944+/-0.96 microg/day for chlorpromazine-tested rats, 3.43+/-1.33 microg/day for clomipramine-tested rats, compared with 2.34+/-0.11 microg/day in control rats). Concurrently, these pharmaceutical compounds increased the level of free thyroid-stimulating hormone (TSH) in comparison with controls and induced histological modifications in, and enlargement of, the thyroid gland. We have demonstrated that drug-induced loss of iodine in the urine was associated with antithyroid action when iodine intake was limited.

  19. Preparation of directly iodinated steroid hormones and related directly halogenated compounds

    International Nuclear Information System (INIS)

    Sahadevan, V.

    1981-01-01

    The preparation of directly iodinated radioactive steroid hormones is described for use in radioimmunoassays or radiolocalization and treatment of human breast tumours. The radioactive iodinated steroid hormone is prepared by reacting a parent steroid hormone with an alkali metal iodide containing radioactive 123 I, 125 I, 130 I or 131 I in the presence of hydrogen peroxide or chloramine-T. The parent steroid hormones include the adrenal corticosteroids, the estrogens, the progestogens, the progestins and the diuretic and antidiuretic agents. The radioactive iodinated steroid hormone is prepared by iodinating the parent steroid hormone directly on the cyclopentanophenanthrene nucleus. The radioactive iodinated steroid hormones have the same antigenicity and receptor site specificity as the parent steroid hormone. The invention is illustrated by 1) the method of iodination of estradiol-17β, 2) results for the percentage labelling of several steroids and steroid hormones, 3) results for the radioimmunoassay of 125 I-estradiol and 4) results for the binding of directly iodinated estradiol-17β in an estrogen receptor assay of human breast cancer. (U.K.)

  20. Nighttime atmospheric chemistry of iodine

    Science.gov (United States)

    Saiz-Lopez, Alfonso; Plane, John M. C.; Cuevas, Carlos A.; Mahajan, Anoop S.; Lamarque, Jean-François; Kinnison, Douglas E.

    2016-12-01

    Little attention has so far been paid to the nighttime atmospheric chemistry of iodine species. Current atmospheric models predict a buildup of HOI and I2 during the night that leads to a spike of IO at sunrise, which is not observed by measurements. In this work, electronic structure calculations are used to survey possible reactions that HOI and I2 could undergo at night in the lower troposphere, and hence reduce their nighttime accumulation. The new reaction NO3+ HOI → IO + HNO3 is proposed, with a rate coefficient calculated from statistical rate theory over the temperature range 260-300 K and at a pressure of 1000 hPa to be k(T) = 2.7 × 10-12 (300 K/T)2.66 cm3 molecule-1 s-1. This reaction is included in two atmospheric models, along with the known reaction between I2 and NO3, to explore a new nocturnal iodine radical activation mechanism. The results show that this iodine scheme leads to a considerable reduction of nighttime HOI and I2, which results in the enhancement of more than 25 % of nighttime ocean emissions of HOI + I2 and the removal of the anomalous spike of IO at sunrise. We suggest that active nighttime iodine can also have a considerable, so far unrecognized, impact on the reduction of the NO3 radical levels in the marine boundary layer (MBL) and hence upon the nocturnal oxidizing capacity of the marine atmosphere. The effect of this is exemplified by the indirect effect on dimethyl sulfide (DMS) oxidation.

  1. Speciation of iodine (I-127 and I-129) in lake sediments

    DEFF Research Database (Denmark)

    Englund, E.; Aldahan, A.; Hou, Xiaolin

    2010-01-01

    Fallout of anthropogenic 129I at northern Europe has been occurring since the early 1950. Nevertheless, it is still unclear where and how this radioactive iodine is incorporated in the surface environment. In order to elucidate part of this problem, we here present an investigation of the occurre......Fallout of anthropogenic 129I at northern Europe has been occurring since the early 1950. Nevertheless, it is still unclear where and how this radioactive iodine is incorporated in the surface environment. In order to elucidate part of this problem, we here present an investigation...... the sediment. Organic bound iodine was the dominant form over other fractions, while iodine bound to metal oxides was negligible. The leachable part constituted 5–6% of the iodine. Diagenetic influence seems to exert a limited effect on distribution of iodine in the examined sediment section....

  2. Determination of iodine 129 in vegetables using neutron activation analysis

    International Nuclear Information System (INIS)

    Quintana, Eduardo E.; Thyssen, Sandra M.; Bruno, Hector A.

    1999-01-01

    The developed methodology allows the determination of iodine 129 in vegetables, using neutron activation analysis. The chemical treatment removes the interferences present in these matrixes, as well as the bromine 82 originated in the activation process. The experimental method for the determination of iodine 129 by neutron activation analysis involves five steps: 1- digestion by alkaline fusion; 2- pre-irradiation purification of iodine 129 by distillation followed by solvent extraction, and adsorption on activated charcoal by distillation; 3- neutron irradiation; 4- post-irradiation purification of iodine 130 by distillation followed by solvent extraction; 5- gamma spectrometry. A chemical recovery of 95 % is obtained in the distillations, measured using iodine 131 as tracer. The whole process recovery is within 70 % and 85 %. The detection limit is 2 mBq/kg of sample, but several factors affect this value, such as type of vegetable, natural iodine concentration, irradiation time and neutron flux. The methodology developed is applied at environmental surveillance with safeguards proposes, in the detection of undeclared reprocessing of irradiated fuel. (authors)

  3. Stimulation of granulocytic cell iodination by pine cone antitumor substances

    International Nuclear Information System (INIS)

    Unten, S.; Sakagami, H.; Konno, K.

    1989-01-01

    Antitumor substances (Fractions VI and VII) prepared from the NaOH extract of pine cone significantly stimulated the iodination (incorporation of radioactive iodine into an acid-insoluble fraction) of human peripheral blood adherent mononuclear cells, polymorphonuclear cells (PMN), and human promyelocytic leukemic HL-60 cells. In contrast, these fractions did not significantly increase the iodination of nonadherent mononuclear cells, red blood cells, other human leukemic cell lines (U-937, THP-1, K-562), human diploid fibroblast (UT20Lu), or mouse cell lines (L-929, J774.1). Iodination of HL-60 cells, which were induced to differentiate by treatment with either retinoic acid or tumor necrosis factor, were stimulated less than untreated cells. The stimulation of iodination of both PMN and HL-60 cells required the continuous presence of these fractions and was almost completely abolished by the presence of myeloperoxidase inhibitors. The stimulation activity of these fractions was generally higher than that of various other immunopotentiators. Possible mechanisms of extract stimulation of myeloperoxidase-containing cell iodination are discussed

  4. Mobile Iodine Mineralization Based on Malachite Transformation

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Seung Yeop; Baik, Min Hoon [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2016-10-15

    Our new method that is proposed here, however, offer drastic cost cutting by using copper. Moreover, the selectivity of iodine in anion-rich water is advantage to lower the disposal cost by reducing the radioactive waste volume. Iodide (I{sup -}) is soluble and mobile in water, so it is very difficult to capture and precipitate it with common adsorbents. Until now, various exchanger and getter materials have been developed to capture radioactive iodine in wastewater. The materials developed generally showed a good performance under acidic conditions. However, the adsorption amounts were not relatively large in neutral and high pH conditions. Furthermore, the capacity to capture iodine is limited by their properties, such as the specific surface area and adsorbing affinity. Recently, Ag-coated materials have attracted attention as adsorbents. They have shown higher uptake for I- compared to other substances, but they are costly. Our new method that is proposed here, however, offer drastic cost cutting by using copper. Moreover, the selectivity of iodine in anion-rich water is advantage to lower the disposal cost by reducing the radioactive waste volume. Radioactive iodine isotopes are characterized as volatile and mobile species that are difficult to capture by adsorbents. In our study, we developed a new way to uptake and crystallize the mobile iodide as cuprous iodide (CuI). This method will be a promising way to simply stabilize iodide in a solid form with compacted volume.

  5. Which Iodine concentration in chest CT? - A prospective study in 300 patients

    Energy Technology Data Exchange (ETDEWEB)

    Muehlenbruch, Georg [RWTH Aachen University Hospital, Department of Diagnostic and Interventional Radiology, Aachen (Germany); University Hospital, RWTH Aachen University, Aachen (Germany); Behrendt, Florian F.; Eddahabi, Mohammed A.; Das, Marco; Guenther, Rolf W.; Mahnken, Andreas H. [RWTH Aachen University Hospital, Department of Diagnostic and Interventional Radiology, Aachen (Germany); Knackstedt, Christian [RWTH Aachen University Hospital, Department of Cardiology, Pulmonology and Angiology, Aachen (Germany); Stanzel, Sven [RWTH Aachen University Hospital, Institute of Medical Statistics, Aachen (Germany); Seidensticker, Peter [Bayer Schering Pharma AG, Berlin (Germany); Wildberger, Joachim E. [University Hospital Maastricht, Department of Radiology, Maastricht (Netherlands)

    2008-12-15

    In computed tomography(CT) several contrast media with different iodine concentrations are available. The aim of this study is to prospectively compare contrast media with iodine concentrations of 300, 370 and 400 mg iodine/ml for chest- CT. 300 consecutive patients were prospectively enrolled, under a waiver of the local ethics committee. The first (second, third) 100 patients, received contrast medium with 300(370, 400)mg iodine/ml. Injection protocols were adapted for an identical iodine delivery rate(1.3 mg/s) and total iodine load(33 g) for all three groups. Standardized MDCT of the chest (16 x 0.75 mm, 120 kVp, 100 mAseff.) was performed. Intravascular attenuation values were measured in the pulmonary trunk and the ascending aorta; subjective image quality was rated on a 3-point-scale. Discomfort during and after injection was evaluated. There were no statistically significant differences in contrast enhancement comparing the three contrast media at the pulmonary trunk(p = 0.3198) and at the ascending aorta(p = 0.0840). Image quality(p = 0.0176) and discomfort during injection(p = 0.7034) were comparable for all groups. General discomfort after injection of contrast media with 300 mg iodine/ml was statistically significant higher compared to 370 mg iodine/ml(p = 0.00019). Given identical iodine delivery rates of 1.3 g/s and iodine loads of 33 g, contrast media with concentrations of 300, 370 and 400 mg iodine/ml do not result in different intravascular enhancement in chest-CT. (orig.)

  6. Thyroid iodide compartments and their implication in the rat thyroid iodine organification

    International Nuclear Information System (INIS)

    Bastiani, P.; Simon, C.

    1982-01-01

    To estimate the relative participation of transported and intrathyroidally generated iodide (internal iodide) in the iodination of newly synthesized and preexisting thyroglobulin (Tg) in the rat thyroid, the specific radioactivities (SRAs) of thyroid iodide, Tg, lysosomal iodine, and plasma hormones were followed for 92 h after radioactive iodide injection in intact or hypophysectomized rats. In control rats, the SRA of Tg and lysosomal iodine reached a maximum at 12 h. However, the SRA of lysosomal iodide was always smaller than that of Tg. In contrast, the SRA of hormonal iodide attained a maximum at 48 h. Thus, newly labeled iodine is endocytosed and mixed inside the lysosomes with older previously iodinated molecules; hormone secretion is mainly due to old labeled iodine (i.e. iodine with a high SRA from 48-96 h). These results are consistent with the presence of least two Tg compartments, with different turnover rates and hormone contents. On the other hand, in hypophysectomized rats, the SRA of Tg, lysosomes, and hormones showed only one maximum, at 24 h. Furthermore, the SRAs of Tg and lysosomes were similar at each time interval. It is inferred that in such rats, the old labeled iodine compartment is strongly reduced, and that inside the lysosomes, newly labeled iodine is predominant. Since in hypophysectomized rats, the recycling of iodide is abolished, it is concluded that in normal rats: 1) transported iodide is organified mainly by direct iodination of newly synthesized Tg, independently of TSH, and 2) internal iodide is organified mainly by delayed iodination of preexisting Tg, this process being TSH dependent

  7. Radioanalytical studies of iodine behaviour in the environment

    International Nuclear Information System (INIS)

    Evans, G.J.; Hammad, K.A.

    1995-01-01

    The behaviour of iodine in the environment is of interest both in relation to radioecology and human nutrition. Radiochemical techniques were used to evaluate various aspects of the behaviour of iodine in the environment. The natural iodine content of plant, water and soil samples collected from three sites was determined using preconcentration neutron activation analysis (PNAA). The effect of initial chemical speciation on the distribution of iodine between various soils, sediments and waters was evaluated using I-131 tracer. Iodide was found to adsorb more extensively than iodate, although four most of the solid/water systems examined, a substantial portion of the iodate was slowly reduced to iodide. Experiments involving gamma irradiation suggest that much of the sorption of iodide and reduction of iodate involved microbial processes. Distribution coefficients measured using I-131 were comparable with values based on the natural I-127 content. (author) 18 refs.; 5 tabs

  8. Status of thyroidal radioiodine (I-131) uptake and urinary iodine in Bangladesh population: A re-look following implementation of universal iodination of salt

    International Nuclear Information System (INIS)

    Alam, F.; Sultana Haque, F.; Karim, M.A.; Faruque, O.; Ali, L.; Azad Khan, A.K.

    2007-01-01

    Iodide plays a central role in thyroid physiology and in the production of thyroid hormones, which are essential for normal vertebrate growth and development. Radioiodine uptake test is one of the oldest radionuclide investigations for evaluation of thyroid function. On the other hand useful information about the nutritional status of a population can be obtained by measuring the prevalence of deficiency in a population. The main aim of this study was to find out the present status of urinary iodine and thyroid uptake status of people living in and around Dhaka City (Bangladesh). The present study was carried out over a period of three years from 1999 to 2002 involving 300 subjects inclusive of 216 females and 84 males. Efforts were made to randomly include people from a broad spectrum of social and economic strata, starting from people belonging to the lowest to the highest income groups; as well as people representing the urban, rural and suburban populations. Urinary iodine levels and 24 hour percentage radioiodine uptake by the thyroid were estimated in all subjects included in this study. Subsequently patients were grouped into four categories based on the values of their percentage 24-hour radioiodine uptake; e.g., Group-A (N-99) with lowest uptake (0-5%), Group-B (N=100) with uptake ranging between 5-10%, Group-C (N=73) with uptake ranging between 10-30% and Group D (N=28) with uptake above 30%. The median 24 hours RAIU values in groups A, B, C and D were 3, 7, 23 and 34% respectively. The corresponding mean urinary iodine levels in the four groups were 43.31, 33.95, 12.97 and 9.35μgm/dl respectively. The results have shown that 1.04, 3.48, 16.72 and 78.74% people studied had levels of urinary iodine indicating severe, moderate, mild or no iodine deficiency respectively as per the WHO Criteria (Severe: <2 μgm /dl, Moderate: 2-4.9 μgm /dl, mild: 5.0-9.9μgm /dl, normal: ≥ 10 μgm /dl). It may be noted that the normal values of Thyroidal I-131 uptake were

  9. Apparatus for eliminating radioactive iodine from off-gases in a nuclear fuel reprocessing plant

    International Nuclear Information System (INIS)

    Kondo, Yoshikazu; Kurihara, Koichi.

    1983-01-01

    Purpose: To improve the eliminating efficiency of an iodine eliminating apparatus using a dry process. Constitution: A hydrogen iodide conversion device and an organic iodine decomposing device are disposed prior to and subsequent to an adsorption tower using adsorbents for the removal of the iodine in a processing gas line through which radioactive iodine containing gases are passed. Elementary iodine and organic iodine can be eliminated by such simple devices. In the case of the dry processing by using the adsorbents, those adsorbents incorporated with inexpensive metal such as lead and copper can be used for the removal of the organic iodine and the radioactive iodine-adsorbing material can be processed as wastes, whereby iodine can effectively be eliminated at a reduced cost. (Moriyama, K.)

  10. 40 CFR 68.126 - Exclusion.

    Science.gov (United States)

    2010-07-01

    ... ACCIDENT PREVENTION PROVISIONS Regulated Substances for Accidental Release Prevention § 68.126 Exclusion. Flammable Substances Used as Fuel or Held for Sale as Fuel at Retail Facilities. A flammable substance... substance is used as a fuel or held for sale as a fuel at a retail facility. [65 FR 13250, Mar. 13, 2000] ...

  11. 13 CFR 126.801 - How does one file a HUBZone status protest?

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false How does one file a HUBZone status protest? 126.801 Section 126.801 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION HUBZONE PROGRAM Protests § 126.801 How does one file a HUBZone status protest? (a) General. The protest procedures...

  12. The story of iodine deficiency: An international challenge in nutrition

    International Nuclear Information System (INIS)

    Hetzel, B.S.

    1989-01-01

    Iodine deficiency is a risk factor for the growth and development of up to 800 million people living in iodine deficient environments throughout the world. The effects on growth and development, called the iodine deficiency disorders (IDD), comprise goiter, stillbirths and miscarriages, neonatal and juvenile thyroid deficiency, dwarfism, mental defects, deaf mutism, and spastic weakness and paralysis, as well as lesser degrees of loss of physical and mental function. All these effects are due to inadequate thyroid hormone production because iodine is an essential constituent of the thyroid hormone. In the West, IDD has been largely eliminated by the addition of iodine to the diet through iodized salt or through changes in food distribution and technology. IDD still persists in certain areas of Europe where these dietary changes have not occurred. In the Third World, IDD is a major problem in many countries with large populations, such as China, India, Indonesia, Nigeria, and Zaire. In these and other Third World countries, IDD is a significant barrier to social and economic progress which can be removed by correction of the deficiency. This book shows that elimination of iodine deficiency is feasible within the next decade, only requiring a modest financial and technical effort from the West. Part 1 reviews IDD in man and animals. Part 2 discusses the control of iodine deficiency disorders through iodine supplementation, and considers action at the national and international level. Part 3 presents a global review of the status of IDD control. There is a brief conclusion on the way forward to successful control programs

  13. The story of iodine deficiency: An international challenge in nutrition

    Energy Technology Data Exchange (ETDEWEB)

    Hetzel, B.S.

    1989-01-01

    Iodine deficiency is a risk factor for the growth and development of up to 800 million people living in iodine deficient environments throughout the world. The effects on growth and development, called the iodine deficiency disorders (IDD), comprise goiter, stillbirths and miscarriages, neonatal and juvenile thyroid deficiency, dwarfism, mental defects, deaf mutism, and spastic weakness and paralysis, as well as lesser degrees of loss of physical and mental function. All these effects are due to inadequate thyroid hormone production because iodine is an essential constituent of the thyroid hormone. In the West, IDD has been largely eliminated by the addition of iodine to the diet through iodized salt or through changes in food distribution and technology. IDD still persists in certain areas of Europe where these dietary changes have not occurred. In the Third World, IDD is a major problem in many countries with large populations, such as China, India, Indonesia, Nigeria, and Zaire. In these and other Third World countries, IDD is a significant barrier to social and economic progress which can be removed by correction of the deficiency. This book shows that elimination of iodine deficiency is feasible within the next decade, only requiring a modest financial and technical effort from the West. Part 1 reviews IDD in man and animals. Part 2 discusses the control of iodine deficiency disorders through iodine supplementation, and considers action at the national and international level. Part 3 presents a global review of the status of IDD control. There is a brief conclusion on the way forward to successful control programs.

  14. Characterization of iodinated adrenomedullin derivatives suitable for lung nuclear medicine

    Energy Technology Data Exchange (ETDEWEB)

    Fu Yan; Letourneau, Myriam; Chatenet, David [Laboratoire d' etudes moleculaires et pharmacologiques des peptides, INRS-Institut Armand-Frappier, Ville de Laval, Qc, H7V 1B7 (Canada); Dupuis, Jocelyn [Research Center, Montreal Heart Institute, Montreal, Qc (Canada); Department of Medicine, University of Montreal, Montreal, Qc (Canada); Fournier, Alain, E-mail: alain.fournier@iaf.inrs.ca [Laboratoire d' etudes moleculaires et pharmacologiques des peptides, INRS-Institut Armand-Frappier, Ville de Laval, Qc, H7V 1B7 (Canada)

    2011-08-15

    Introduction: We have recently demonstrated the effectiveness of 99m-technetium adrenomedullin (AM) as a new molecular lung imaging agent that could provide significant advantages for the diagnosis and follow-up of disorders affecting the pulmonary circulation such as pulmonary embolism and pulmonary hypertension. Having the possibility to conjugate the targeting molecule with different radionuclides would offer more flexibility and potential advantages depending on clinical situations. Since various iodine isotopes are currently used in nuclear medicine and in pharmacological studies, we have evaluated which iodination method should be privileged in order to produce a good iodinated AM-derived nuclear medicine agent. Methods: Synthetic AM was labeled with iodine through chemical and lactoperoxidase oxidation methods. Position of the iodine atom on the peptide was determined by MALDI-TOF mass spectrometry analysis following cyanogen bromide cleavage and carboxypeptidase Y digestion. Binding affinity of iodinated AM analogues was evaluated by competition and saturation binding experiments on dog lung preparations. Results: In this study, we demonstrated that, upon lactoperoxidase oxidation, iodination occurred at Tyr{sup 1} and that this radioligand retained higher binding affinity and specificity over preparations obtained through chemical oxidation. Conclusions: These results emphasize the fact that even a small chemical modification, i.e. iodination, might deeply modify the pharmacological profile of a compound and support observations that the C-terminal tail of human AM plays an important role in the AM receptor binding process. Consequently, incorporation of a radionuclide to produce an AM-based nuclear medicine agent should privilege the N-terminus of the molecule.

  15. Efficacy and toxicity of iodine disinfection of Atlantic salmon eggs

    Science.gov (United States)

    Chalupnicki, M.A.; Ketola, H.G.; Starliper, C.E.; Gallagher, D.

    2011-01-01

    Recent interest in the restoration of Atlantic salmon Salmo salar in the Great Lakes has given rise to new culture techniques and management programs designed to reduce pathogen transmission while stabilizing and enhancing wild populations. We examined the toxicity of iodine to Atlantic salmon eggs and its effectiveness as a disinfectant against bacteria on egg surfaces. We spawned and fertilized eight gravid Atlantic salmon from Cayuga Lake, New York, and exposed their eggs to 10 concentrations of iodine (5, 10, 50, 75, 100, 500, 750, 1,000, 5,000, and 7,500 mg/L) for 30 min during water hardening. An additional subsample of unfertilized eggs was also exposed to some of the same concentrations of iodine (5, 10, 50, 75, and 100 mg/L) to determine the efficiency of disinfection. Viable eggs were only obtained from four females. Survival of eggs to the eyed stage and hatch tended to be reduced at iodine concentrations of 50 and 75 mg/L and was significantly reduced at concentrations of 100 mg/L iodine or more. We calculated the concentrations of iodine that killed 50% of the Atlantic salmon eggs at eye-up and hatch to be 175 and 85 mg/L, respectively. Aeromonas veronii, A. schubertii, A. hydrophila, A. caviae, Plesiomonas shiggeloides, and Citrobacter spp. were the predominant bacteria present on the surface of green eggs and were significantly reduced by an iodine immersion. The use of iodine as a disinfectant on Atlantic salmon eggs was effective at low concentrations (50–75 mg/L), for which toxicity to Atlantic salmon was minimal.

  16. Iodine kinetics and effectiveness of stable iodine prophylaxis after intake of radioiodine: a review; Pharmacocinetique de l'iode: revue des connaissances utiles en radioprotection accidentelle

    Energy Technology Data Exchange (ETDEWEB)

    Geoffroy, B.; Verger, P.; Le Guen, B. [CEA/Fontenay-aux-Roses, Inst. de Protection et de Surete Nucleaire, IPSN, 92 (France)

    2000-06-01

    Ingestion of stable iodine (potassium iodide) offers an efficient protection against the irradiation of the thyroid when an accidental exposure to radioiodine occurs. This prophylaxis aims at obtaining a rapid and maximum thyroid protection without antithyroid effects. This article reviews studies on iodine kinetics in the human and on stable iodine effectiveness to protect the thyroid. In adults with a normal thyroid function, ingestion of 100 mg of iodide just before exposure to radioiodine allows a percentage of thyroid averted dose equal or greater than 95%. If the exposure persists after iodide ingestion (100 mg), the percentage of averted dose may decrease significantly. Repeated ingestion of daily amounts of 15 mg of stable iodine would then allow to maintain a 90% effectiveness. Iodide effectiveness and antithyroid effects also depend on external and individual factors such as iodine amounts in the diet, thyroid function and age. It is recommended to adapt the amount of ingested stable iodine according to age at the time of exposure. (author)

  17. Iodine adsorption on ion-exchange resins and activated carbons: batch testing

    Energy Technology Data Exchange (ETDEWEB)

    Parker, Kent E.; Golovich, Elizabeth C.; Wellman, Dawn M.

    2014-09-30

    Iodine sorption onto seven resins and six carbon materials was evaluated using water from well 299-W19-36 on the Hanford Site. These materials were tested using a range of solution-to-solid ratios. The test results are as follows. The efficacy of the resin and granular activated carbon materials was less than predicted based on manufacturers’ performance data. It is hypothesized that this is due to the differences in speciation previously determined for Hanford groundwater. The sorption of iodine is affected by the iodine species in the source water. Iodine loading on resins using source water ranged from 1.47 to 1.70 µg/g with the corresponding Kd values from 189.9 to 227.0 mL/g. The sorption values when the iodine is converted to iodide ranged from 2.75 to 5.90 µg/g with the corresponding Kd values from 536.3 to 2979.6 mL/g. It is recommended that methods to convert iodine to iodide be investigated in fiscal year (FY) 2015. The chemicals used to convert iodine to iodate adversely affected the sorption of iodine onto the carbon materials. Using as-received source water, loading and Kd values ranged from 1.47 to 1.70 µg/g and 189.8 to 226.3 mL/g respectively. After treatment, loading and Kd values could not be calculated because there was little change between the initial and final iodine concentration. It is recommended the cause of the decrease in iodine sorption be investigated in FY15. In direct support of CH2M HILL Plateau Remediation Company, Pacific Northwest National Laboratory has evaluated samples from within the 200W pump and treat bioreactors. As part of this analysis, pictures taken within the bioreactor reveal a precipitate that, based on physical properties and known aqueous chemistry, is hypothesized to be iron pyrite or chalcopyrite, which could affect iodine adsorption. It is recommended these materials be tested at different solution-to-solid ratios in FY15 to determine their effect on iodine

  18. Iodine adsorption on ion-exchange resins and activated carbons: batch testing

    International Nuclear Information System (INIS)

    Parker, Kent E.; Golovich, Elizabeth C.; Wellman, Dawn M.

    2014-01-01

    Iodine sorption onto seven resins and six carbon materials was evaluated using water from well 299-W19-36 on the Hanford Site. These materials were tested using a range of solution-to-solid ratios. The test results are as follows. The efficacy of the resin and granular activated carbon materials was less than predicted based on manufacturers' performance data. It is hypothesized that this is due to the differences in speciation previously determined for Hanford groundwater. The sorption of iodine is affected by the iodine species in the source water. Iodine loading on resins using source water ranged from 1.47 to 1.70 µg/g with the corresponding K d values from 189.9 to 227.0 mL/g. The sorption values when the iodine is converted to iodide ranged from 2.75 to 5.90 µg/g with the corresponding K d values from 536.3 to 2979.6 mL/g. It is recommended that methods to convert iodine to iodide be investigated in fiscal year (FY) 2015. The chemicals used to convert iodine to iodate adversely affected the sorption of iodine onto the carbon materials. Using as-received source water, loading and K d values ranged from 1.47 to 1.70 µg/g and 189.8 to 226.3 mL/g respectively. After treatment, loading and K d values could not be calculated because there was little change between the initial and final iodine concentration. It is recommended the cause of the decrease in iodine sorption be investigated in FY15. In direct support of CH2M HILL Plateau Remediation Company, Pacific Northwest National Laboratory has evaluated samples from within the 200W pump and treat bioreactors. As part of this analysis, pictures taken within the bioreactor reveal a precipitate that, based on physical properties and known aqueous chemistry, is hypothesized to be iron pyrite or chalcopyrite, which could affect iodine adsorption. It is recommended these materials be tested at different solution-to-solid ratios in FY15 to determine their effect on iodine sorption.

  19. Method for determination of radioactive iodine isotopes in environmental objects and biologic materials

    International Nuclear Information System (INIS)

    Dubynin, O.D.; Pogodin, R.I.

    1981-01-01

    The method proposed for determination of radioactive iodine isotopes content in environmental objects and biologic materials is based on the extraction of iodine with carbon tetrachloride and subsequent precipitation of bismuthyl iodine (BiOI) in perchloric medium. Sample preparation for analysis is carried out using conventional alkaline ashing methods. Quantitative iodine separation is hampered if macroquantities of Cl - , Br - , SO 4 2 - , SO 8 2 - , Cr 2 O 7 2 - and other ions are present in the solution. Iodine extraction is carried out before its precipitation. Separated iodine preparation activity is measured using scintillation (NaI) Tl gamma spectrometer. The method's sensitivity when measuring iodine-131 preparations makes up 0.07 Bq per 1 sample with the error +-25 %

  20. Investigation on efficiency of stable iodine distribution around Golfech nuclear power station

    International Nuclear Information System (INIS)

    Payoux, P.; Simon, J.; Campana Briault, H.; Fenolland, J.L.

    2003-01-01

    Background. In order to prevent thyroid cancer radio induced during civil nuclear accident french regulations plan stable iodine distribution for populations living near nuclear power stations. We evaluate availability of stable iodine and understanding of such measure with investigation around Golfech nuclear power station. Methods. In 2001, 1148 families living in a 10 km perimeter around power station were questioned through their schooled child. Our anonymous questionnaire (22 questions, 91 items) was linked with stable iodine availability, organ protection, most exposed persons, dosage and time of stable iodine ingestion. Results. 72,1 % families replied. Among them, 60,8% could easily and quickly find stable iodine in case of emergency, 87,8% know that such measure is to protect thyroid, 80,5% know that children and pregnant women (62,7%) are the most exposed people, 82,3% know that such ingestion is allowed by Prefect order. Conclusion. Answer rate and stable iodine prophylaxis knowledge are satisfactory. On the other hand, in case of necessity about 40% of the concerned families don't have a rapid access to stable iodine, which will forced authorities to distribute as a matter of urgency supplementary stable iodine. Statistical analysis of the answers demonstrate that the most iodine prophylaxis ignorant people are the most refractory to this approach. (author)