WorldWideScience

Sample records for interrogans serogrupo ballum

  1. Medio EMJH modificado para el cultivo de Leptospira interrogans serogrupo Ballum Modified EMJH medium for cultivation of Leptospira interrogans serogroup Ballum

    Directory of Open Access Journals (Sweden)

    A. González

    2006-04-01

    Full Text Available El serogrupo Ballum agrupa cepas de crecimiento fastidioso, con requerimientos nutricionales más exigentes que otras cepas patógenas de Leptospira. Fue evaluada la influencia de 37 compuestos nutricionales sobre el crecimiento de Leptospira interrogans serogrupo Ballum, tomando como base para el estudio al medio sintético EMJH. El crecimiento microbiano fue estimado espectrofotométricamente y por conteo directo en cámara de Petroff-Hausser. La estabilidad de la virulencia fue evaluada en hamsters mediante el cálculo de la dosis letal media. La estabilidad de la antigenicidad fue evaluada mediante Western blotting con antisuero policlonal específico. Bajo condiciones de cultivo controladas se logró triplicar los rendimientos de biomasa comúnmente obtenidos en el medio EMJH sin afectación de la virulencia y antigenicidad tras el incremento de la concentración de Tween 80 y la incorporación de acetato de sodio y extracto de carne. El incremento de la concentración de al menos 6 componentes del EMJH o la incorporación de una variedad de nuevos nutrientes no estimularon apreciablemente los rendimientos de biomasa o la velocidad específica de crecimiento del microorganismo. Los resultados obtenidos permiten disponer de un medio de cultivo enriquecido capaz de sustentar elevados rendimientos de biomasa de este serogrupo exigente de mayor circulación en humanos en Cuba.Strains within the Ballum serogroup of spirochete Leptospira show fastidious growth with more exigent nutritional requirements than those of other Leptospira pathogenic strains. The influence of 37 nutritional compounds on the growth of Leptospira interrogans serogroup Ballum was investigated employing the synthetic EMJH medium as the base for the study. Microbial growth was estimated spectrophotometrically and direct counts were performed with a Petroff-Hausser counting chamber. Virulence stability was evaluated by calculating the mean lethal dose in hamsters

  2. Discriminación genotípica de serovariedades del serogrupo Icterohaemorrhagiae pertenecientes a Leptospira interrogans (Spirochaetales: Leptospiraceae y el análisis de distancias génicas mediante coordenadas principales

    Directory of Open Access Journals (Sweden)

    Sylvia GRUNE LOFFLER

    2017-01-01

    Full Text Available La leptospirosis es una zoonosis de amplia distribución mundial y de importancia en salud pública y veterinaria. El serogrupo Icterohaemorrhagiae toma importancia, ya que ha sido aislado con frecuencia en roedores y en casos clínicos de humanos, caninos, bovinos y porcinos; y se ha logrado aislar a partir de agua del rio Reconquista, provincia de Buenos Aires, Argentina. El objetivo de este estudio fue discriminar molecularmente entre las serovariedades Copenhageni e Icterohaemorrhagiae del serogrupo Icterohaemorrhagiae de importancia en Argentina, utilizando la técnica del análisis de repeticiones en tándem en múltiples locus (MLVA y analizar las distancias génicas entre los genotipos determinados a partir de cepas aisladas de animales. Para ello, geno-tipificamos las 4 cepas referenciales del serogrupo Icterohaemorrhagiae de la especie Leptospira interrogans serovariedad Copenhageni cepa M20 y cepa Ictero I y de la serovariedad Copenhageni cepa RGA y cepa Fiocruz L1-130. Para este estudio se incluyeron 24 cepas aisladas de animales domésticos como silvestres. Logramos mediante esta técnica determinar un código numérico para cada serovariedad y así pudimos discriminar entre las serovariedades de este serogrupo. El análisis de coordenadas principales (PCoA demostró la variabilidad génica existente entre las 4 cepas referenciales pertenecientes al serogrupo Icterohaemorrhagiae, el genotipo con mayor representación fue el serovar Copenhageni cepa Fiocruz L1-130 con un total de 13 cepas aisladas con ese perfil genético. Discriminar las serovariedades de este importante serogrupo nos permitirá en un futuro investigar si existen diferencias entre la sintomatología clínica y/o respuesta al tratamiento en los casos clínicos producidos por las distintas serovariedades del serogrupo Icterohaemorrhagiae discriminadas en este trabajo. SUMMARY. Genotypic discrimination of serovars belonging to the serogroup Icterohaemorrhagiae of

  3. Meningitis neonatal por Neisseria meningitidis serogrupo B

    Directory of Open Access Journals (Sweden)

    Manuel Díaz Álvarez

    Full Text Available La meningitis meningocóccica es una infección poco frecuente en el período neonatal internacionalmente, y solo hay una publicación previa en la literatura médica cubana hace 25 años atrás, de recién nacidos con meningitis bacteriana causada por Neisseria meningitidis. Se presenta el caso de un recién nacido febril, con manifestaciones de toxicidad, fontanela abombada, y cuando se realizó punción lumbar, se encontró pleocitosis del líquido cefalorraquídeo y se aisló N. meningitidis serogrupo B, por lo que se diagnostica meningitis meningocóccica neonatal. Tuvo evolución favorable. Se describen algunas características de la infección meningocócica, y se destaca el diagnóstico y tratamiento recomendado para este tipo de infección, así como se hace referencia a reportes de casos publicados en la literatura internacional.

  4. Continuous Excretion of Leptospira borgpetersenii Ballum in Mice Assessed by Viability Quantitative Polymerase Chain Reaction.

    Science.gov (United States)

    Soupé-Gilbert, Marie-Estelle; Bierque, Emilie; Geroult, Sophie; Teurlai, Magali; Goarant, Cyrille

    2017-10-01

    Rodents are the main reservoir animals of leptospirosis. In this study, we characterized and quantified the urinary excretion dynamics of Leptospira by Mus musculus infected with 2 × 10 8 virulent Leptospira borgpetersenii serogroup Ballum. Each micturition was collected separately in metabolic cages, at 12 time points from 7 to 117 days post-infection (dpi). We detected Leptospira in all urine samples collected (up to 8 per time point per mouse) proving that Leptospira excretion is continuous with ca. 90% live L. borgpetersenii Ballum, revealed by viability quantitative polymerase chain reaction. Microscopic visualization by Live/Dead fluorescence confirmed this high proportion of live bacteria and demonstrated that L. borgpetersenii Ballum are excreted, at least partly, as bacterial aggregates. We observed two distinct phases in the excretion dynamics, first an increase in Leptospira concentration shed in the urine between 7 and 63 dpi followed by a plateau phase from 63 dpi onward, with up to 3 × 10 7 Leptospira per mL of urine. These two phases seem to correspond to progressive colonization of renal tubules first, then to stable cell survival and maintenance in kidneys. Therefore, chronically infected adult mice are able to contaminate the environment via urine at each micturition event throughout their lifetime. Because Leptospira excretion reached its maximum 2 months after infection, older rodents have a greater risk of contaminating their surrounding environment.

  5. Identificación de serogrupos patogenos de leptospira spp. en caninos domésticos

    OpenAIRE

    Siuce Moreno, Juan José

    2014-01-01

    La leptospirosis es una zoonosis bacteriana de gran impacto en la salud pública a nivel mundial. Los perros y otros animales, pueden infectarse, sufrir la enfermedad, constituyendo así, un factor importante en la diseminación de la bacteria hacia humanos. La infección es causada por cualquiera de los 250 serovares patógenos, de los 25 serogrupos de Leptospira spp. El estudio tuvo como objetivo identificar a los serogrupos de Leptospira spp. presentes en caninos domésticos. Para ello, se obtuv...

  6. Global Proteome Analysis of Leptospira interrogans

    Science.gov (United States)

    Comparative global proteome analyses were performed on Leptospira interrogans serovar Copenhageni grown under conventional in vitro conditions and those mimicking in vivo conditions (iron limitation and serum presence). Proteomic analyses were conducted using iTRAQ and LC-ESI-tandem mass spectrometr...

  7. La ecología de Vibrio cholerae serogrupo 01 en ambientes acuáticos

    OpenAIRE

    Borroto René J.

    1997-01-01

    El carácter endémico y estacional del cólera depende de la supervivencia de Vibrio cholerae serogrupo 01 en estado viable, pero no necesariamente cultivable, en nichos ecológicos localizados en ambientes acuáticos durante períodos interepidémicos. Para comprender la ecología de V. cholerae es preciso conocer los ecosistemas acuáticos que pudieran albergarlo y contribuir a la presencia endémica del cólera en América Latina. El presente artículo tiene por objetivo presentar, en términos resumid...

  8. The passive diffusion of Leptospira interrogans

    International Nuclear Information System (INIS)

    Koens, Lyndon; Lauga, Eric

    2014-01-01

    Motivated by recent experimental measurements, the passive diffusion of the bacterium Leptospira interrogans is investigated theoretically. By approximating the cell shape as a straight helix and using the slender-body-theory approximation of Stokesian hydrodynamics, the resistance matrix of Leptospira is first determined numerically. The passive diffusion of the helical cell is then obtained computationally using a Langevin formulation which is sampled in time in a manner consistent with the experimental procedure. Our results are in excellent quantitative agreement with the experimental results with no adjustable parameters. (paper)

  9. The passive diffusion of Leptospira interrogans

    Science.gov (United States)

    Koens, Lyndon; Lauga, Eric

    2014-12-01

    Motivated by recent experimental measurements, the passive diffusion of the bacterium Leptospira interrogans is investigated theoretically. By approximating the cell shape as a straight helix and using the slender-body-theory approximation of Stokesian hydrodynamics, the resistance matrix of Leptospira is first determined numerically. The passive diffusion of the helical cell is then obtained computationally using a Langevin formulation which is sampled in time in a manner consistent with the experimental procedure. Our results are in excellent quantitative agreement with the experimental results with no adjustable parameters.

  10. Isolation of Leptospira interrogans from suburban rats in Tandil, Buenos Aires, Argentina Aislamiento de Leptospira interrogans de ratas suburbanas de Tandil, Buenos Aires, Argentina

    Directory of Open Access Journals (Sweden)

    E. Scialfa

    2010-06-01

    arroyo durante dos noches, con una alta tasa de captura (70%. En las 42 ratas atrapadas se examinó la serología por el test de microaglutinación (TMA; 22 de ellas (52,3% reaccionaron con los serovares castellonis, canicola, grippotyphosa, icterohaemorrhagiae y hebdomadis, a títulos de 1:50. El cultivo de tejido renal de 25 animales permitió obtener 24 aislamientos de L. interrogans (96%. Las cepas aisladas fueron identificadas como serogrupo Icterohaemorrhagiae mediante TMA utilizando suero hiperinmune de conejo. Estos hallazgos muestran una elevada densidad de roedores infectados con leptospiras patógenas en el área suburbana de la ciudad de Tandil, en estrecho contacto con población humana con evidencia de leptospirosis.

  11. Serogrupos y susceptibilidad antimicrobiana en cepas de Shigella Serogroups and antimicrobial susceptibility in Shigella strains

    Directory of Open Access Journals (Sweden)

    Leonor Díaz Rigau

    2009-03-01

    Full Text Available INTRODUCCIÓN. Shigella spp. es uno de los agentes causales más importantes de diarrea aguda en los niños. La presente investigación tuvo como objetivo conocer la frecuencia de serogrupos y la susceptibilidad antimicrobiana a los fármacos de elección y a los alternativos. MÉTODOS. Se realizó un estudio descriptivo y retrospectivo entre enero de 2004 y diciembre de 2006 a partir de 34 cepas de Shigella spp. aisladas en heces de niños menores de 5 años ingresados en el Hospital «Aleida Fernández Chardiet» (Municipio Güines a causa de enfermedad diarreica aguda. RESULTADOS. Los serogrupos encontrados fueron S. sonnei (70,5 % y S. flexneri (29,5 %. Ambos serogrupos mostraron altos niveles de resistencia al trimetoprim-sulfametoxazol y a la ampicilina, además en las cepas de S. sonnei se encontró resistencia al ácido nalidíxico y en las de S. flexneri al cloranfenicol. Todas las cepas mostraron altos porcentajes de sensibilidad a la ceftriaxona, norfloxacina y ciprofloxacina. El 70 % de las cepas de S. sonnei fueron multirresistentes. El patrón de multirresistencia (ampicilina, trimetoprim-sulfamtetoxazol y ácido nalidíxico se encontró en ambos serogrupos. CONCLUSIONES. La determinación y vigilancia de los patrones de resistencia facilita el control de la política de uso de antibióticos en la región estudiada y previene el surgimiento de cepas resistentes a fármacos de nueva generación.INTRODUCTION: Shigella ssp. is one of the more important causal agents of acute diarrhea in children. Present research has as aim to know serogroups frequency and antimicrobial susceptibility to choice drugs, and to its alternatives. METHODS: A descriptive retrospective study was carried out between January 2004 and December 2006 of 34 strains of Shigella isolated from children lower than 5 years admitted in "Aleida Fernández Chardiet" Hospital in Güines Municipality by acute diarrheic disease. RESULTS: Serogroups included S. sonnei (70

  12. Genome features of Leptospira interrogans serovar Copenhageni

    Directory of Open Access Journals (Sweden)

    A.L.T.O. Nascimento

    2004-04-01

    Full Text Available We report novel features of the genome sequence of Leptospira interrogans serovar Copenhageni, a highly invasive spirochete. Leptospira species colonize a significant proportion of rodent populations worldwide and produce life-threatening infections in mammals. Genomic sequence analysis reveals the presence of a competent transport system with 13 families of genes encoding for major transporters including a three-member component efflux system compatible with the long-term survival of this organism. The leptospiral genome contains a broad array of genes encoding regulatory system, signal transduction and methyl-accepting chemotaxis proteins, reflecting the organism's ability to respond to diverse environmental stimuli. The identification of a complete set of genes encoding the enzymes for the cobalamin biosynthetic pathway and the novel coding genes related to lipopolysaccharide biosynthesis should bring new light to the study of Leptospira physiology. Genes related to toxins, lipoproteins and several surface-exposed proteins may facilitate a better understanding of the Leptospira pathogenesis and may serve as potential candidates for vaccine.

  13. La ecología de Vibrio cholerae serogrupo 01 en ambientes acuáticos

    Directory of Open Access Journals (Sweden)

    Borroto René J.

    1997-01-01

    Full Text Available El carácter endémico y estacional del cólera depende de la supervivencia de Vibrio cholerae serogrupo 01 en estado viable, pero no necesariamente cultivable, en nichos ecológicos localizados en ambientes acuáticos durante períodos interepidémicos. Para comprender la ecología de V. cholerae es preciso conocer los ecosistemas acuáticos que pudieran albergarlo y contribuir a la presencia endémica del cólera en América Latina. El presente artículo tiene por objetivo presentar, en términos resumidos, la ecología de V. cholerae 01 organizada según los factores abióticos y bióticos que desempeñan funciones relevantes en la supervivencia del microbio en ambientes acuáticos. Este agente patógeno encuentra condiciones favorables en aguas caracterizadas por niveles moderados de salinidad, un alto contenido de nutrientes, temperaturas cálidas, un pH neutro o ligeramente alcalino y la presencia de macrófitas acuáticas, fitoplancton, zooplancton, peces, moluscos y crustáceos. Estas condiciones ecológicas son propias de los ecosistemas acuáticos de estuarios y pantanos costeros, de cuya flora microbiana V. cholerae 01 toxígeno se considera actualmente un miembro autóctono. Este microorganismo también se ha mostrado capaz de colonizar ecosistemas de agua dulce en su forma viable, aunque no necesariamente cultivable, si encuentra sustratos orgánicos e inorgánicos que favorezcan su supervivencia.

  14. NEW WILDLIFE HOSTS OF Leptospira interrogans IN CAMPECHE, MEXICO

    Directory of Open Access Journals (Sweden)

    Deborah V. ESPINOSA-MARTÍNEZ

    2015-04-01

    Full Text Available Leptospira interrogans has been identified to cause leptospirosis, a widespread zoonotic disease that has been identified in domestic and wild animals. This work analyzed kidneys from two species of wild rodents from the state of Campeche, Mexico. Analyses were made by PCR using specific primers for detection of Leptospira interrogans DNA. The rodent species that tested positive were Heteromys gaumeri and Ototylomys phyllotis, both of which are new hosts for the bacteria in Southeastern Mexico. These records provide new insights into the disease’s transmission that should be studied carefully in order to identify other potential host species, including humans, which are at risk of becoming infected if they are in contact with infected wildlife.

  15. Multilocus Sequence Analysis for Typing Leptospira interrogans and Leptospira kirschneri▿ †

    Science.gov (United States)

    Leon, Albertine; Pronost, Stéphane; Fortier, Guillaume; Andre-Fontaine, Geneviève; Leclercq, Roland

    2010-01-01

    Fifty-three strains belonging to the pathogenic species Leptospira interrogans and Leptospira kirschneri were analyzed by multilocus sequence analysis. The species formed two distinct branches. In the L. interrogans branch, the phylogenetic tree clustered the strains into three subgroups. Genogroups and serogroups were superimposed but not strictly. PMID:19955271

  16. Multilocus Sequence Analysis for Typing Leptospira interrogans and Leptospira kirschneri▿ †

    OpenAIRE

    Leon, Albertine; Pronost, Stéphane; Fortier, Guillaume; Andre-Fontaine, Geneviève; Leclercq, Roland

    2009-01-01

    Fifty-three strains belonging to the pathogenic species Leptospira interrogans and Leptospira kirschneri were analyzed by multilocus sequence analysis. The species formed two distinct branches. In the L. interrogans branch, the phylogenetic tree clustered the strains into three subgroups. Genogroups and serogroups were superimposed but not strictly.

  17. Characterization of the Leptospira interrogans S10-spc-alpha operon

    NARCIS (Netherlands)

    Zuerner, R. L.; Hartskeerl, R. A.; van de Kemp, H.; Bal, A. E.

    2000-01-01

    A ribosomal protein gene cluster from the spirochaete Leptospira interrogans was characterized. This locus is homologous to the Escherichia coli S10, spc, and alpha operons. Analysis of L. interrogans RNA showed that the ribosomal protein genes within this cluster are co-transcribed, thus forming an

  18. Efectividad y duración de la inmunidad de la vacuna frente al meningococo serogrupo A y C

    OpenAIRE

    García Comas Luis; Ramírez Fernández Rosa; Castañeda López Rosario; Sanz Moreno Juan Carlos; Vázquez Moreno Julio; Lasheras Carbajo Mª Dolores; Barranco Ordoñez Dolores; Ruiz Contreras Jesús; Jover Ibarra José

    2000-01-01

    FUNDAMENTO: La Comunidad de Madrid detectó a partir de 1995 un incremento del número de casos de enfermedad meningocócica por serogrupo C. En 1997 se realizó una campaña de inmunización masiva sobre la población de 18 meses a 19 años. El objetivo de este estudio es conocer la respuesta inmunitaria producida por la vacuna y su relación con la edad. MÉTODOS: Se seleccionó una muestra de 1.003 niños vacunados durante la campaña. Se extrajo una muestra de sangre antes de la vacunación y tras uno,...

  19. Fragmentación del polisacárido de Neisseria meningitidis serogrupo C para su uso en vacunas conjugadas

    Directory of Open Access Journals (Sweden)

    Osmir Cabrera

    2001-12-01

    Full Text Available Las infecciones meningocócicas son una causa importante de morbilidad y mortalidad en el mundo. Los serogrupos B y C son los responsables de la mayoría de los casos reportados en muchos países e incluso en países desarrollados. Las vacunas meningocócicas que contienen al polisacárido capsular purificado del meningococo C inducen en adultos protección por la presencia de anticuerpos bactericidas en sueros, pero son pobremente inmunogénicos en niños pequeños y pueden inducir tolerancia. La inmunogenicidad de los polisacáridos o sus fragmentos puede ser mejorada por la conjugación a proteínas transportadoras. El objetivo de este estudio fue obtener oligosacáridos C (Os-C a partir de la depolimerización del polisacárido de Neisseria meningitidis serogrupo C (Ps-C por hidrólisis ácida, calor y peryodato de sodio y evaluar la conservación de sus propiedades antigénicas mediante un ELISA de inhibición. Se determinó la pérdida de grupos O-acetilos, así como, la talla molecular relativa por filtración en gel y se observaron diferencias significativas entre los OS-C obtenidos en cada método. Las propiedades antigénicas fueron dependientes del tamaño molecular de los Os-C, así como de la presencia de los grupos O-acetilos en los oligosacáridos. Los Os-C obtenidos por la hidrólisis ácida mostraron similares propiedades antigénicas a las del polisacárido.

  20. Crystallization and preliminary X-ray diffraction studies of ferredoxin reductase from Leptospira interrogans

    International Nuclear Information System (INIS)

    Nascimento, Alessandro S.; Ferrarezi, Thiago; Catalano-Dupuy, Daniela L.; Ceccarelli, Eduardo A.; Polikarpov, Igor

    2006-01-01

    Crystals adequate for X-ray diffraction analysis have been prepared from L. interrogans ferredoxin-NADP + reductase. Ferredoxin-NADP + reductase (FNR) is an FAD-containing enzyme that catalyzes electron transfer between NADP(H) and ferredoxin. Here, results are reported of the recombinant expression, purification and crystallization of FNR from Leptospira interrogans, a parasitic bacterium of animals and humans. The L. interrogans FNR crystals belong to a primitive monoclinic space group and diffract to 2.4 Å resolution at a synchrotron source

  1. Crystallization and preliminary X-ray diffraction studies of ferredoxin reductase from Leptospira interrogans

    Energy Technology Data Exchange (ETDEWEB)

    Nascimento, Alessandro S.; Ferrarezi, Thiago [Instituto de Física de São Carlos, Universidade de São Paulo, Av. Trabalhador Saocarlense 400, São Carlos, SP, 13560-970 (Brazil); Catalano-Dupuy, Daniela L.; Ceccarelli, Eduardo A. [Facultad de Ciencias Bioquímicas y Farmacéuticas, Molecular Biology Division, Instituto de Biología Molecular y Celular de Rosario (IBR), CONICET, Universidad Nacional de Rosario, Suipacha 531, S2002LRK Rosario (Argentina); Polikarpov, Igor, E-mail: ipolikarpov@if.sc.usp.br [Instituto de Física de São Carlos, Universidade de São Paulo, Av. Trabalhador Saocarlense 400, São Carlos, SP, 13560-970 (Brazil)

    2006-07-01

    Crystals adequate for X-ray diffraction analysis have been prepared from L. interrogans ferredoxin-NADP{sup +} reductase. Ferredoxin-NADP{sup +} reductase (FNR) is an FAD-containing enzyme that catalyzes electron transfer between NADP(H) and ferredoxin. Here, results are reported of the recombinant expression, purification and crystallization of FNR from Leptospira interrogans, a parasitic bacterium of animals and humans. The L. interrogans FNR crystals belong to a primitive monoclinic space group and diffract to 2.4 Å resolution at a synchrotron source.

  2. Complete genome sequence of Leptospira interrogans serovar Bratislava, strain PigK151

    Science.gov (United States)

    The genus Leptospira contains pathogens serologically classified into over 250 serovars, intermediate pathogens and saprophytes with genetic classification into 21 different species. Worldwide, leptospirosis is one of the most widespread zoonoses. L. interrogans serovar Bratislava has been isolated ...

  3. Crystal structure of homoserine O-acetyltransferase from Leptospira interrogans

    International Nuclear Information System (INIS)

    Wang Mingzhu; Liu Lin; Wang Yanli; Wei Zhiyi; Zhang Ping; Li Yikun; Jiang Xiaohua; Xu Hang; Gong Weimin

    2007-01-01

    Homoserine O-acetyltransferase (HTA, EC 2.3.1.31) initiates methionine biosynthesis pathway by catalyzing the transfer of acetyl group from acetyl-CoA to homoserine. This study reports the crystal structure of HTA from Leptospira interrogans determined at 2.2 A resolution using selenomethionyl single-wavelength anomalous diffraction method. HTA is modular and consists of two structurally distinct domains-a core α/β domain containing the catalytic site and a helical bundle called the lid domain. Overall, the structure fold belongs to α/β hydrolase superfamily with the characteristic 'catalytic triad' residues in the active site. Detailed structure analysis showed that the catalytic histidine and serine are both present in two conformations, which may be involved in the catalytic mechanism for acetyl transfer

  4. Comparison of Leptospira interrogans and Leptospira biflexa genomes: analysis of potential leptospiral-host interactions.

    Science.gov (United States)

    Mehrotra, Prachi; Ramakrishnan, Gayatri; Dhandapani, Gunasekaran; Srinivasan, Narayanaswamy; Madanan, Madathiparambil G

    2017-05-02

    Leptospirosis, a potentially life-threatening disease, remains the most widespread zoonosis caused by pathogenic species of Leptospira. The pathogenic spirochaete, Leptospira interrogans, is characterized by its ability to permeate human host tissues rapidly and colonize multiple organs in the host. In spite of the efforts taken to comprehend the pathophysiology of the pathogen and the heterogeneity posed by L. interrogans, the current knowledge on the mechanism of pathogenesis is modest. In an attempt to contribute towards the same, we demonstrate the use of an established structure-based protocol coupled with information on subcellular localization of proteins and their tissue-specificity, in recognizing a set of 49 biologically feasible interactions potentially mediated by proteins of L. interrogans in humans. We have also presented means to adjudge the physicochemical viability of the predicted host-pathogen interactions, for selected cases, in terms of interaction energies and geometric shape complementarity of the interacting proteins. Comparative analyses of proteins of L. interrogans and the saprophytic spirochaete, Leptospira biflexa, and their predicted involvement in interactions with human hosts, aided in underpinning the functional relevance of leptospiral-host protein-protein interactions specific to L. interrogans as well as those specific to L. biflexa. Our study presents characteristics of the pathogenic L. interrogans that are predicted to facilitate its ability to persist in human hosts.

  5. Protein and antigen profiles of Leptospira interrogans serovar Hardjo Perfil proteico e antigênico da Leptospira interrogans sorovariedade Hardjo

    Directory of Open Access Journals (Sweden)

    Bárbara Nobre Lafetá

    2009-12-01

    Full Text Available The protein profile of the outer membrane of Leptospira interrogans serovar Hardjo subtype hardjoprajitno associated with the bovine natural immune response was investigated. The outer membrane proteins were extracted utilizing Triton X114 and precipitated with acetone. The protein sample was then resolved by SDS-PAGE and reacted in western blot against sera from a hyperimmune rabbit and from naturally infected bovines. In silver stained gels, 14 protein bands were observed, among which four proteins, with 22, 29, 47 and 63kDa, appeared as major constituents. Western blot tests with hyperimmune rabbit antiserum detected bands corresponding to proteins with 35; 27; 24; 21; 17 and 14kDa, while 32kDa and 45kDa proteins were the most immunoreactive with sera from naturally infected bovines.Estudou-se o perfil proteico da membrana externa da Leptospira interrogans sorovariedade Hardjo, amostra hardjoprajitno, associado à resposta imune natural de bovinos infectados. Foram utilizados Triton X114 para a extração das proteínas de membrana externa e acetona para precipitá-las. As proteínas extraídas foram analisadas por SDS-PAGE e western blot contra soro de coelhos hiperimunes e de bovinos naturalmente infectados. Em géis corados com nitrato de prata, 14 bandas proteicas foram identificadas, e quatro dessas bandas, com 22, 29, 47 e 63kDa, foram as mais proeminentes. Os western blots com soro hiperimune de coelho detectaram bandas correspondentes a proteínas com pesos moleculares de 35, 27, 24, 21, 17 e 14kDa, e bandas de 32 e 45kDa destacaram-se nos testes com soros de bovinos naturalmente infectados.

  6. La ecología de Vibrio cholerae serogrupo 01 en ambientes acuáticos Ecology of Vibrio cholerae serogroup 01 in aquatic environments

    OpenAIRE

    René J. Borroto

    1997-01-01

    El carácter endémico y estacional del cólera depende de la supervivencia de Vibrio cholerae serogrupo 01 en estado viable, pero no necesariamente cultivable, en nichos ecológicos localizados en ambientes acuáticos durante períodos interepidémicos. Para comprender la ecología de V. cholerae es preciso conocer los ecosistemas acuáticos que pudieran albergarlo y contribuir a la presencia endémica del cólera en América Latina. El presente artículo tiene por objetivo presentar, en términos resumid...

  7. Draft Genome Sequence of Leptospira interrogans Serovar Bataviae Strain LepIMR 22 Isolated from a Rodent in Johor, Malaysia

    NARCIS (Netherlands)

    Amran, Fairuz; Mohd Khalid, Mohd Khairul Nizam; Mohamad, Saharuddin; Mat Ripen, Adiratna; Ahmad, Norazah; Goris, Marga G. A.; Muhammad, Ayu Haslin; Noor Halim, Nurul Atiqah

    2016-01-01

    Leptospira interrogans serovar Bataviae was recently identified as one of the persistent Leptospira serovars in Malaysia. Here, we report the draft genome sequence of the L. interrogans serovar Bataviae strain LepIMR 22 isolated from kidney of a rodent in Johor, Malaysia

  8. Draft Genome Sequence of Leptospira interrogans Serovar Bataviae Strain LepIMR 22 Isolated from a Rodent in Johor, Malaysia.

    Science.gov (United States)

    Amran, Fairuz; Mohd Khalid, Mohd Khairul Nizam; Mohamad, Saharuddin; Mat Ripen, Adiratna; Ahmad, Norazah; Goris, Marga G A; Muhammad, Ayu Haslin; Noor Halim, Nurul Atiqah

    2016-09-08

    Leptospira interrogans serovar Bataviae was recently identified as one of the persistent Leptospira serovars in Malaysia. Here, we report the draft genome sequence of the L. interrogans serovar Bataviae strain LepIMR 22 isolated from kidney of a rodent in Johor, Malaysia. Copyright © 2016 Amran et al.

  9. Characterization of a virulent Leptospira interrogans strain isolated from an abandoned swimming pool.

    Science.gov (United States)

    Forster, Karine M; Hartwig, Daiane D; Seixas, Fabiana K; McBride, Alan J A; Monte, Leonardo G; Recuero, Ana Lúcia C; Brod, Claudiomar S; Hartleben, Cláudia P; Amaral, Marta; Dellagostin, Odir A

    2013-01-01

    Pathogenic Leptospira spp. are the etiological agents of leptospirosis, an important disease of both humans and animals. In urban settings, L. interrogans serovars are the predominant cause of disease in humans. The purpose of this study was to characterize a novel Leptospira isolate recovered from an abandoned swimming pool. Molecular characterization through sequencing of the rpoB gene revealed 100% identity with L. interrogans and variable-number tandem-repeat (VNTR) analysis resulted in a banding pattern identical to L. interrogans serogroup Icterohaemorrhagiae, serovar Copenhageni or Icterohaemorrhagiae. The virulence of the strain was determined in a hamster model of lethal leptospirosis. The lethal dose 50% (LD50) was calculated to be two leptospires in female hamsters and a histopathological examination of infected animals found typical lesions associated with severe leptospirosis, including renal epithelium degeneration, hepatic karyomegaly, liver-plate disarray and lymphocyte infiltration. This highly virulent strain is now available for use in further studies, especially evaluation of vaccine candidates.

  10. Cloning, high-level expression, purification and crystallization of peptide deformylase from Leptospira interrogans.

    Science.gov (United States)

    Li, Yikun; Ren, Shuangxi; Gong, Weimin

    2002-05-01

    A new peptide deformylase (PDF; EC 3.5.1.27) gene from Leptospira interrogans was identified and cloned into expression plasmid pET22b(+) and was highly expressed in Escherichia coli BL21(DE3). With DEAE-Sepharose anion-exchange chromatography followed by Superdex G-75 size-exclusion chromatography, 60 mg of PDF from L. interrogans was purified from 1 l of cell culture. Crystallization screening of the purified enzyme resulted in two crystal forms, from one of which a 3 A resolution X-ray diffraction data set has been collected.

  11. Genetic diversity among major endemic strains of Leptospira interrogans in China

    Directory of Open Access Journals (Sweden)

    Zhang Zhi-Ming

    2007-07-01

    Full Text Available Abstract Background Leptospirosis is a world-widely distributed zoonosis. Humans become infected via exposure to pathogenic Leptospira spp. from contaminated water or soil. The availability of genomic sequences of Leptospira interrogans serovar Lai and serovar Copenhageni opened up opportunities to identify genetic diversity among different pathogenic strains of L. interrogans representing various kinds of serotypes (serogroups and serovars. Results Comparative genomic hybridization (CGH analysis was used to compare the gene content of L. interrogans serovar Lai strain Lai with that of other 10 L. interrogans strains prevailed in China and one identified from Brazil using a microarray spotted with 3,528 protein coding sequences (CDSs of strain Lai. The cutoff ratio of sample/reference (S/R hybridization for detecting the absence of genes from one tested strain was set by comparing the ratio of S/R hybridization and the in silico sequence similarities of strain Lai and serovar Copenhageni strain Fiocruz L1-130. Among the 11 strains tested, 275 CDSs were found absent from at least one strain. The common backbone of the L. interrogans genome was estimated to contain about 2,917 CDSs. The genes encoding fundamental cellular functions such as translation, energy production and conversion were conserved. While strain-specific genes include those that encode proteins related to either cell surface structures or carbohydrate transport and metabolism. We also found two genomic islands (GIs in strain Lai containing genes divergently absent in other strains. Because genes encoding proteins with potential pathogenic functions are located within GIs, these elements might contribute to the variations in disease manifestation. Differences in genes involved in O-antigen biosynthesis were also identified for strains belonging to different serogroups, which offers an opportunity for future development of genomic typing tools for serological classification

  12. Desarrollo y validación de una reacción en cadena de la polimerasa múltiple para la identificación de los serogrupos B, C2, D y E de Salmonella enterica

    Directory of Open Access Journals (Sweden)

    Nora Cardona-Castro

    2009-06-01

    Conclusiones. El polimorfismo de los genes rfbJ y wzx permitió desarrollar un método de tipificación molecular sensible, específico y reproducible, que podría servir de apoyo a la serotipificación para identificar serogrupos de Salmonella.

  13. Efectividad y duración de la inmunidad de la vacuna frente al meningococo serogrupo A y C

    Directory of Open Access Journals (Sweden)

    Luis García Comas

    2000-01-01

    Full Text Available FUNDAMENTO: La Comunidad de Madrid detectó a partir de 1995 un incremento del número de casos de enfermedad meningocócica por serogrupo C. En 1997 se realizó una campaña de inmunización masiva sobre la población de 18 meses a 19 años. El objetivo de este estudio es conocer la respuesta inmunitaria producida por la vacuna y su relación con la edad. MÉTODOS: Se seleccionó una muestra de 1.003 niños vacunados durante la campaña. Se extrajo una muestra de sangre antes de la vacunación y tras uno, seis (solo <5a y doce meses. Para valorar la respuesta inmune se midieron niveles de anticuerpos bactericidas y totales. RESULTADOS: La prevalencia de seroconversión medida por anticuerpos bactericidas es 89,6%. La respuesta es baja en menores de 3 años (34,8%, aumenta con la edad y a partir de los 7 años supera el 90%. A los 6 meses, la prevalencia de niveles protectores en menores de 5 años desciende notablemente (31,3%. Al año, la prevalencia desciende notablemente, especialmente en menores de 7 años. La proporción de individuos con respuesta de anticuerpos totales al mes supera el 90% y se mantiene elevada al año en todos los grupos edad (97,5%. CONCLUSIONES: La respuesta medida mediante anticuerpos totales entra en contradicción con la respuesta clínica a la vacunación y la medida mediante anticuerpos bactericidas infraestima la protección si se compara con los resultados de efectividad vacunal, por lo que es necesario buscar indicadores biológicos que se correlacionen de manera adecuada con la respuesta clínica tras la vacunación.

  14. Comparison of the effects of UV-A radiation on Leptospira interrogan ...

    African Journals Online (AJOL)

    USER

    2010-05-24

    May 24, 2010 ... comparatively studied the effects of UV-A radiation on the Leptospira interrogans serovar Bataviae,. Canicola and Pomona. The main .... were determined by ultraviolet-visible (UV-VIS) spectro- photometry and ... survival. The cell density of leptospira was determined by UV-VIS spectrometer. (Listgarten and ...

  15. The classification of Sejroe group serovars of Leptospira interrogans with monoclonal antibodies

    NARCIS (Netherlands)

    Terpstra, W. J.; Korver, H.; van Leeuwen, J.; Klatser, P. R.; Kolk, A. H.

    1985-01-01

    Using the hybridoma technique we produced monoclonal antibodies to serovars of Leptospira interrogans. We focussed on serovar hardjo which is an important pathogen for humans and animals, and on other serovars of the Sejroe group. With combinations of monoclonals, characteristic patterns of

  16. Interleukin 12 in part regulates gamma interferon release in human whole blood stimulated with Leptospira interrogans

    NARCIS (Netherlands)

    de Fost, Maaike; Hartskeerl, Rudy A.; Groenendijk, Martijn R.; van der Poll, Tom

    2003-01-01

    Heat-killed pathogenic Leptospira interrogans serovar rachmati induced the production of gamma interferon (IFN-gamma) and the IFN-gamma-inducing cytokines interleukin-12p40 (IL-12p40) and tumor necrosis factor alpha in human whole blood in vitro. The production of IFN-gamma was largely dependent on

  17. Transcriptional response of Leptospira interrogans to iron limitation and characterization of a PerR homolog

    Science.gov (United States)

    Leptospira interrogans is the causative agent of leptospirosis, a zoonosis of global significance. Iron is essential for growth of most bacterial species. Since availability of iron is low in the host, pathogens have evolved complex iron acquisition mechanisms to survive and establish infection. In ...

  18. Comparison of the effects of UV-A radiation on Leptospira interrogan ...

    African Journals Online (AJOL)

    USER

    2010-05-24

    May 24, 2010 ... Full Length Research Paper. Comparison of the effects of UV-A radiation on. Leptospira interrogan serovar Bataviae, Canicola and. Pomona. Sudarat Chadsuthi1, Jirasak Wong-ekkabut1,2, Wannapong Triampo1,3,6*, Galayanee. Doungchawee4 and Darapond Triampo1,3,5,6. 1Group of Biological and ...

  19. Resultados del estudio serológico tras la vacunación frente a Neisseria meningitidis serogrupo C en niños

    OpenAIRE

    María Isabel Espín Ríos

    2000-01-01

    BACKGROUND: El aumento de incidencia de enfermedad meningocócica en la Región de Murcia en la temporada 1996/97 motivó que la Dirección General de Salud desarrollara en septiembre-octubre de 1997 una Campaña de Vacunación frente al meningococo serogrupo C. El objetivo de este trabajo fue conocer el porcentaje de niños menores de 5 años de edad que mostraban seroconversión postvacunal al mes de la vacunación y el porcentaje de los mismos que conservaban inmunidad al año de la vacunación. MÉTOD...

  20. Leptospira interrogans serovar copenhageni harbors two lexA genes involved in SOS response.

    Directory of Open Access Journals (Sweden)

    Luciane S Fonseca

    Full Text Available Bacteria activate a regulatory network in response to the challenges imposed by DNA damage to genetic material, known as the SOS response. This system is regulated by the RecA recombinase and by the transcriptional repressor lexA. Leptospira interrogans is a pathogen capable of surviving in the environment for weeks, being exposed to a great variety of stress agents and yet retaining its ability to infect the host. This study aims to investigate the behavior of L. interrogans serovar Copenhageni after the stress induced by DNA damage. We show that L. interrogans serovar Copenhageni genome contains two genes encoding putative LexA proteins (lexA1 and lexA2 one of them being potentially acquired by lateral gene transfer. Both genes are induced after DNA damage, but the steady state levels of both LexA proteins drop, probably due to auto-proteolytic activity triggered in this condition. In addition, seven other genes were up-regulated following UV-C irradiation, recA, recN, dinP, and four genes encoding hypothetical proteins. This set of genes is potentially regulated by LexA1, as it showed binding to their promoter regions. All these regions contain degenerated sequences in relation to the previously described SOS box, TTTGN 5CAAA. On the other hand, LexA2 was able to bind to the palindrome TTGTAN10TACAA, found in its own promoter region, but not in the others. Therefore, the L. interrogans serovar Copenhageni SOS regulon may be even more complex, as a result of LexA1 and LexA2 binding to divergent motifs. New possibilities for DNA damage response in Leptospira are expected, with potential influence in other biological responses such as virulence.

  1. Characterization of a virulent Leptospira interrogans strain isolated from an abandoned swimming pool

    Directory of Open Access Journals (Sweden)

    Karine M. Forster

    2013-01-01

    Full Text Available Pathogenic Leptospira spp. are the etiological agents of leptospirosis, an important disease of both humans and animals. In urban settings, L. interrogans serovars are the predominant cause of disease in humans. The purpose of this study was to characterize a novel Leptospira isolate recovered from an abandoned swimming pool. Molecular characterization through sequencing of the rpoB gene revealed 100% identity with L. interrogans and variable-number tandem-repeat (VNTR analysis resulted in a banding pattern identical to L. interrogans serogroup Icterohaemorrhagiae, serovar Copenhageni or Icterohaemorrhagiae. The virulence of the strain was determined in a hamster model of lethal leptospirosis. The lethal dose 50% (LD50 was calculated to be two leptospires in female hamsters and a histopathological examination of infected animals found typical lesions associated with severe leptospirosis, including renal epithelium degeneration, hepatic karyomegaly, liver-plate disarray and lymphocyte infiltration. This highly virulent strain is now available for use in further studies, especially evaluation of vaccine candidates.

  2. Data on Leptospira interrogans sv Pomona infection in Meat Workers in New Zealand

    Directory of Open Access Journals (Sweden)

    M. Pittavino

    2017-08-01

    A prospective cohort study was conducted in four sheep slaughtering abattoirs in New Zealand (NZ (Dreyfus et al., 2015 [1]. Sera were collected twice a year from 384 meat workers and tested by Microscopic Agglutination for Leptospira interrogans sv Pomona (Pomona infection, one of the most common Leptospira serovars in humans in NZ. This article provides an extended analysis of the data, illustrating the different steps of a multivariable (i.e. generalized linear model and especially a multivariate tool based on additive Bayesian networks (ABN modelling.

  3. A LigA three-domain region protects hamsters from lethal infection by Leptospira interrogans.

    Directory of Open Access Journals (Sweden)

    Mariana L Coutinho

    2011-12-01

    Full Text Available The leptospiral LigA protein consists of 13 bacterial immunoglobulin-like (Big domains and is the only purified recombinant subunit vaccine that has been demonstrated to protect against lethal challenge by a clinical isolate of Leptospira interrogans in the hamster model of leptospirosis. We determined the minimum number and location of LigA domains required for immunoprotection. Immunization with domains 11 and 12 was found to be required but insufficient for protection. Inclusion of a third domain, either 10 or 13, was required for 100% survival after intraperitoneal challenge with Leptospira interrogans serovar Copenhageni strain Fiocruz L1-130. As in previous studies, survivors had renal colonization; here, we quantitated the leptospiral burden by qPCR to be 1.2×10(3 to 8×10(5 copies of leptospiral DNA per microgram of kidney DNA. Although renal histopathology in survivors revealed tubulointerstitial changes indicating an inflammatory response to the infection, blood chemistry analysis indicated that renal function was normal. These studies define the Big domains of LigA that account for its vaccine efficacy and highlight the need for additional strategies to achieve sterilizing immunity to protect the mammalian host from leptospiral infection and its consequences.

  4. Purification, crystallization and preliminary crystallographic studies on 2-dehydro-3-deoxygalactarate aldolase from Leptospira interrogans

    International Nuclear Information System (INIS)

    Li, Xu; Huang, Hua; Song, Xiaomin; Wang, Yanli; Xu, Hang; Teng, Maikun; Gong, Weimin

    2006-01-01

    Preliminary crystallographic studies on 2-dehydro-3-deoxygalactarate aldolase from L. interrogans. 2-Dehydro-3-deoxygalactarate (DDG) aldolase is a member of the class II aldolase family and plays an important role in the pyruvate-metabolism pathway, catalyzing the reversible aldol cleavage of DDG to pyruvate and tartronic semialdehyde. As it is a potential novel antibiotic target, it is necessary to elucidate the catalytic mechanism of DDG aldolase. To determine the crystal structure, crystals of DDG aldolase from Leptospira interrogans were obtained by the hanging-drop vapour-diffusion method. The crystals diffracted to 2.2 Å resolution using a Cu Kα rotating-anode X-ray source. The crystal belonged to space group C2, with unit-cell parameters a = 293.5, b = 125.6, c = 87.6 Å, β = 100.9°. The V M is calculated to be 2.4 Å 3 Da −1 , assuming there to be 12 protein molecules in the asymmetric unit

  5. Comparative genomics of pathogenic Leptospira interrogans serovar Canicola isolated from swine and human in Brazil

    Directory of Open Access Journals (Sweden)

    Luisa Z Moreno

    Full Text Available Leptospira interrogans serovar Canicola is one of the most important pathogenic serovars for the maintenance of urban leptospirosis. Even though it is considered highly adapted to dogs, serovar Canicola infection has already been described in other animals and even a few human cases. Here, we present the genomic characterisation of two Brazilian L. interrogans serovar Canicola strains isolated from slaughtered sows (L0-3 and L0-4 and their comparison with human strain Fiocruz LV133. It was observed that the porcine serovar Canicola strains present the genetic machinery to cause human infection and, therefore, represent a higher risk to public health. Both human and porcine serovar Canicola isolates also presented sequences with high identity to the Chinese serovar Canicola published plasmids pGui1 and pGui2. The plasmids identification in the Brazilian and Chinese serovar Canicola strains suggest that extra-chromosomal elements are one more feature of this serovar that was previously unnoticed.

  6. Purification, crystallization and preliminary crystallographic studies on 2-dehydro-3-deoxygalactarate aldolase from Leptospira interrogans

    Energy Technology Data Exchange (ETDEWEB)

    Li, Xu; Huang, Hua [Hefei National Laboratory for Physical Sciences at Microscale and School of Life Sciences, University of Science and Technology of China, Hefei, Anhui 230027 (China); Song, Xiaomin [Hefei National Laboratory for Physical Sciences at Microscale and School of Life Sciences, University of Science and Technology of China, Hefei, Anhui 230027 (China); National Laboratory of Biomacromolecules, Institute of Biophysics, Chinese Academy of Sciences, Beijing 100101 (China); Wang, Yanli; Xu, Hang [National Laboratory of Biomacromolecules, Institute of Biophysics, Chinese Academy of Sciences, Beijing 100101 (China); Teng, Maikun [Hefei National Laboratory for Physical Sciences at Microscale and School of Life Sciences, University of Science and Technology of China, Hefei, Anhui 230027 (China); Gong, Weimin, E-mail: wgong@sun5.ibp.ac.cn [Hefei National Laboratory for Physical Sciences at Microscale and School of Life Sciences, University of Science and Technology of China, Hefei, Anhui 230027 (China); National Laboratory of Biomacromolecules, Institute of Biophysics, Chinese Academy of Sciences, Beijing 100101 (China)

    2006-12-01

    Preliminary crystallographic studies on 2-dehydro-3-deoxygalactarate aldolase from L. interrogans. 2-Dehydro-3-deoxygalactarate (DDG) aldolase is a member of the class II aldolase family and plays an important role in the pyruvate-metabolism pathway, catalyzing the reversible aldol cleavage of DDG to pyruvate and tartronic semialdehyde. As it is a potential novel antibiotic target, it is necessary to elucidate the catalytic mechanism of DDG aldolase. To determine the crystal structure, crystals of DDG aldolase from Leptospira interrogans were obtained by the hanging-drop vapour-diffusion method. The crystals diffracted to 2.2 Å resolution using a Cu Kα rotating-anode X-ray source. The crystal belonged to space group C2, with unit-cell parameters a = 293.5, b = 125.6, c = 87.6 Å, β = 100.9°. The V{sub M} is calculated to be 2.4 Å{sup 3} Da{sup −1}, assuming there to be 12 protein molecules in the asymmetric unit.

  7. Generation of mammalian host-adapted Leptospira interrogans by cultivation in peritoneal dialysis membrane chamber implantation in rats

    Science.gov (United States)

    Leptospira interrogans can infect a myriad of mammalian hosts, including humans (Bharti, Nally et al. 2003, Ko, Goarant et al. 2009). Following acquisition by a suitable host, leptospires disseminate via the bloodstream to multiple tissues, including the kidneys, where they adhere to and colonize th...

  8. Leptospira Interrogans Induces Fibrosis in the Mouse Kidney through Inos-Dependent, TLR- and NLR-Independent Signaling Pathways

    Science.gov (United States)

    Fanton d'Andon, Martine; Quellard, Nathalie; Fernandez, Béatrice; Ratet, Gwenn; Lacroix-Lamandé, Sonia; Vandewalle, Alain; Boneca, Ivo G.; Goujon, Jean-Michel; Werts, Catherine

    2014-01-01

    Background Leptospira (L.) interrogans are bacteria responsible for a worldwide reemerging zoonosis. Rodents carry L. interrogans asymptomatically in their kidneys and excrete bacteria in the urine, contaminating the environment. Humans get infected through skin contact and develop a mild or severe leptospirosis that may lead to renal failure and fibrosis. L. interrogans provoke an interstitial nephritis, but the induction of fibrosis caused by L. interrogans has not been studied in murine models. Innate immune receptors from the TLR and NLR families have recently been shown to play a role in the development and progression of tissue fibrosis in the lung, liver and kidneys under different pathophysiological situations. We recently showed that TLR2, TLR4, and NLRP3 receptors were crucial in the defense against leptospirosis. Moreover, infection of a human cell line with L. interrogans was shown to induce TLR2-dependent production of fibronectin, a component of the extracellular matrix. Therefore, we thought to assess the presence of renal fibrosis in L. interrogans infected mice and to analyze the contribution of some innate immune pathways in this process. Methodology/principal findings Here, we characterized by immunohistochemical studies and quantitative real-time PCR, a model of Leptospira-infected C57BL/6J mice, with chronic carriage of L. interrogans inducing mild renal fibrosis. Using various strains of transgenic mice, we determined that the renal infiltrates of T cells and, unexpectedly, TLR and NLR receptors, are not required to generate Leptospira-induced renal fibrosis. We also show that the iNOS enzyme, known to play a role in Leptospira-induced interstitial nephritis, also plays a role in the induction of renal fibrosis. Conclusion/significance To our knowledge, this work provides the first experimental murine model of sustained renal fibrosis induced by a chronic bacterial infection that may be peculiar, since it does not rely on TLR or NLR receptors

  9. Resultados del estudio serológico tras la vacunación frente a Neisseria meningitidis serogrupo C en niños

    Directory of Open Access Journals (Sweden)

    Espín Ríos María Isabel

    2000-01-01

    Full Text Available BACKGROUND: El aumento de incidencia de enfermedad meningocócica en la Región de Murcia en la temporada 1996/97 motivó que la Dirección General de Salud desarrollara en septiembre-octubre de 1997 una Campaña de Vacunación frente al meningococo serogrupo C. El objetivo de este trabajo fue conocer el porcentaje de niños menores de 5 años de edad que mostraban seroconversión postvacunal al mes de la vacunación y el porcentaje de los mismos que conservaban inmunidad al año de la vacunación. MÉTODO: Estudio de seguimiento de 296 niños entre 18 y 59 meses de edad. Las determinaciones serológicas ser realizaron antes de la vacunación, al mes y al año de la vacunación. La titulación de anticuerpos se determinó según el "ensayo bactericida" de los Centers for Disease Control. RESULTADOS: De los 296 niños estudiados únicamente 11 (3,7% mostraron títulos de anticuerpos bactericidas antes de la vacunación. Al mes, de los niños que no mostraban anticuerpos antes de la vacunación, 167 (63,7% seroconvirtieron. Se observó una tendencia lineal estadísticamente significativa (p<0.001 de aumento del porcentaje de seroconversión con la edad de vacunación. Al año de la vacunación, de entre los niños seroconvertidos al mes de la vacunación, únicamente 6 (4,3% mostraban anticuerpos bactericidas. CONCLUSIÓN: El porcentaje de seroconversión en menores de 5 años de edad, tras la administración de la vacuna de polisacárido capsular C, presentó un claro incremento con la edad. La seroprotección adquirida en niños vacunados declina rápidamente en el año siguiente a la vacunación.

  10. First isolation of Leptospira interrogans from Lycalopex griseus (South American gray fox) in Argentina shows new MLVA genotype.

    Science.gov (United States)

    Scialfa, Exequiel; Brihuega, Bibiana; Venzano, Agustín; Morris, Winston Eduardo; Bolpe, Jorge; Schettino, Mateo

    2013-01-01

    To identify carriers of Leptospira spp. in Argentina, wild animals were trapped in Buenos Aires Province during three nights, capturing 12 Didelphis albiventris (white-eared opossum), six Chaetophractus villosus (big hairy armadillo), five Lycalopex griseus (South American gray fox), and two Conepatus chinga (Molina's hog-nosed skunk). All were tested by microscopic agglutination test, and five (two gray foxes, two armadillos, and one skunk) were positive for Leptospira interrogans serovars Canicola and Icterohaemorrhagiae, L. borgpetersenii serovar Castellonis, and L. kirschneri serovar Grippotyphosa, at titers of 1:50 and 1:100. Kidney tissue from all animals was cultured, and one isolate of L. interrogans from a gray fox was obtained. Hamsters inoculated with the isolate died after 6 days with no macroscopic lesions at necropsy. However, histologic examination revealed glomerulonephritis, interstitial nephritis, and pneumonia. The Leptospira strain from the South American gray fox was analyzed serologically and its pathogenicity was established. Genotyping through multiple-locus variable-number tandem repeat analysis showed that the strain was a new genotype related to the L. interrogans serogroup Icterohaemorrhagiae.

  11. Post-translational modification of LipL32 during Leptospira interrogans infection.

    Directory of Open Access Journals (Sweden)

    Timothy D Witchell

    2014-10-01

    Full Text Available Leptospirosis, a re-emerging disease of global importance caused by pathogenic Leptospira spp., is considered the world's most widespread zoonotic disease. Rats serve as asymptomatic carriers of pathogenic Leptospira and are critical for disease spread. In such reservoir hosts, leptospires colonize the kidney, are shed in the urine, persist in fresh water and gain access to a new mammalian host through breaches in the skin.Previous studies have provided evidence for post-translational modification (PTM of leptospiral proteins. In the current study, we used proteomic analyses to determine the presence of PTMs on the highly abundant leptospiral protein, LipL32, from rat urine-isolated L. interrogans serovar Copenhageni compared to in vitro-grown organisms. We observed either acetylation or tri-methylation of lysine residues within multiple LipL32 peptides, including peptides corresponding to regions of LipL32 previously identified as epitopes. Intriguingly, the PTMs were unique to the LipL32 peptides originating from in vivo relative to in vitro grown leptospires. The identity of each modified lysine residue was confirmed by fragmentation pattern analysis of the peptide mass spectra. A synthetic peptide containing an identified tri-methylated lysine, which corresponds to a previously identified LipL32 epitope, demonstrated significantly reduced immunoreactivity with serum collected from leptospirosis patients compared to the peptide version lacking the tri-methylation. Further, a subset of the identified PTMs are in close proximity to the established calcium-binding and putative collagen-binding sites that have been identified within LipL32.The exclusive detection of PTMs on lysine residues within LipL32 from in vivo-isolated L. interrogans implies that infection-generated modification of leptospiral proteins may have a biologically relevant function during the course of infection. Although definitive determination of the role of these PTMs must

  12. Ecology of Vibrio cholerae serogroup 01 in aquatic environments La ecología de Vibrio cholerae serogrupo 01 en ambientes acúaticos

    Directory of Open Access Journals (Sweden)

    René J. Borroto

    1997-01-01

    Full Text Available The endemic and seasonal nature of cholera depends upon the survival of Vibrio cholerae 01 in a viable but not necessarily culturable state in ecologic niches in aquatic environments during interepidemic periods. To understand the ecology of V. cholerae it is necessary to know which aquatic ecosystems can harbor it and thus contribute to the endemic presence of cholera in Latin America. This article summarizes knowledge about the ecology of V. cholerae 01, specifically, the abiotic and biotic factors that are relevant to the microbe’s survival in aquatic environments. This pathogen finds favorable conditions in waters characterized by moderate salinity, high nutrient content, warm temperature, neutral or slightly alkaline pH, and the presence of aquatic macrophytes, phytoplankton, zooplankton, fish, mollusks, and crusta ceans. These ecologic conditions are typical of estuaries and coastal swamps, and toxigenic V. cholerae 01 is now considered an autochthonous member of the microbial flora of these environments. The microorganism has also shown the ability to colonize freshwater ecosystems in its viable but not necessarily culturable form, if organic or inorganic substrates that favor its survival are available.El carácter endémico y estacional del cólera depende de la supervivencia de Vibrio cholerae serogrupo 01 en estado viable, pero no necesariamente cultivable, en nichos ecológicos localizados en ambientes acuáticos durante períodos interepidémicos. Para comprender la ecología de V. cholerae es preciso conocer los ecosistemas acuáticos que pudieran albergarlo y contribuir a la presencia endémica del cólera en América Latina. El presente artículo tiene por objetivo presentar, en términos resumidos, la ecología de V. cholerae 01 organizada según los factores abióticos y bióticos que inciden en la supervivencia del microbio en ambientes acuáticos. Este agente patógeno encuentra condiciones favorables en aguas caracterizadas

  13. Three case studies involving Leptospira interrogans serovar pomona infection in mixed farming units : case report

    Directory of Open Access Journals (Sweden)

    B. Gummow

    1999-07-01

    Full Text Available Three case studies involving Leptospira interrogans serovar pomona outbreaks within mixed farming systems in South Africa are described. On 2 farms, pigs constituted the main enterprise with cattle and sheep of secondary importance. On each of these 2 farms, abortion due to L. pomona in sows was confirmed by culture, and antibody titres to pomona were detected in cattle, sheep, horses and dogs. On the 3rd farm, a piggery was ofsecondary importance to cattle farming. Abortion and death in cows occurred on this farmand serology showed titres to various serovars, including pomona. L. pomona was also isolated from bovine urine, an aborted bovine foetus and kidneys from slaughtered pigs. This particular case study was regarded as clinically atypical in that adult Jersey cattle died of acute leptospirosis in a semiarid region of South Africa. In all 3 case studies, the poor management of pig effluent and of the drinking water and its sources played a pivotal role in the transmission of the disease. Inadequate vaccination of animals against Leptospira and poor record-keeping within the secondary farming enterprises were also contributing factors to the spread of leptospirosis.

  14. Cholinesterases as markers of the inflammatory process in rats infected with Leptospira interrogans serovar Icterohaemorrhagiae.

    Science.gov (United States)

    da Silva, Cássia B; Wolkmer, Patrícia; Da Silva, Aleksandro S; Paim, Francine C; Tonin, Alexandre A; Castro, Verônica S P; Felin, Diandra V; Schmatz, Roberta; Gonçalves, Jamile F; Badke, Manoel R T; Morsch, Vera M; Mazzanti, Cinthia M; Lopes, Sonia T A

    2012-02-01

    The aim of this study was evaluate changes in the cholinesterase activity in blood, lymphocytes and serum of rats infected with Leptospira interrogans serovar Icterohaemorrhagiae ('L. icterohaemorrhagiae'). Sixty adult Wistar rats were divided into six groups of 10 animals: three control groups and three test groups. The animals from the test groups were intraperitoneally inoculated with 1 ml medium containing 1 × 10(8) leptospires. The activity of acetylcholinesterase in blood and butyrylcholinesterase in serum increased on days 5 (P<0.05) and 30 (P<0.021) post-infection, respectively. A decrease in lymphocyte count was observed on days 15 (P<0.01) and 30 post-infection (P<0.05). On day 15 post-infection, acetylcholinesterase activity (P<0.001) in lymphocytes decreased in infected rats. However, on day 30 post-infection there was an increase in acetylcholinesterase activity in lymphocytes. In conclusion, our results showed that the activity of enzymes of the cholinergic system in the total blood, lymphocytes and serum is altered as a result of inflammation caused by infection with L. icterohaemorrhagiae. The possible causes of these alterations will be discussed in this paper.

  15. Management practices as risk factors for the presence of bulk milk antibodies to Salmonella, Neospora caninum and Leptospira interrogans serovar hardjo in Irish dairy herds.

    Science.gov (United States)

    O' Doherty, E; Berry, D P; O' Grady, L; Sayers, R

    2014-06-01

    A survey of management practices in 309 Irish dairy herds was used to identify risk factors for the presence of antibodies to Salmonella, Neospora caninum and Leptospira interrogans serovar hardjo in extensively managed unvaccinated dairy herds. A previous study documented a herd-level seroprevalence in bulk milk of 49%, 19% and 86% for Salmonella, Neospora caninum and leptospira interrogans serovar hardjo, respectively in the unvaccinated proportion of these 309 herds in 2009. Association analyses in the present study were carried out using multiple logistic regression models. Herds where cattle were purchased or introduced had a greater likelihood of being positive to leptospira interrogans serovar hardjo (PNeospora caninum (PNeospora caninum possibly due to limited access of dogs to infected materials including afterbirths. The information from this study will assist in the design of suitable control programmes for the diseases under investigation in pasture-based livestock systems.

  16. Seasonal prevalence of antibodies to Leptospira interrogans in Antillean manatees from a landlocked lake in Tabasco, Mexico.

    Science.gov (United States)

    Aragón-Martínez, Arianna; Olivera-Gómez, León D; Jiménez-Domínguez, Darwin

    2014-07-01

    Factors that alter the dynamics of ecologic systems can influence transmission of infectious diseases and may lead to decreases in natural populations. Leptospirosis is a cosmopolitan disease of zoonotic importance that affects most mammals. At the southern Gulf of Mexico, Antillean manatees (Trichechus manatus manatus) inhabit highly variable environments, with extended floods during the rainy season and drought conditions during the dry season that affect food availability and the thermal environment for manatees. We tested for changes in prevalence and titers of antibodies to 12 serovars of Leptospira interrogans in manatees between dry and rainy seasons. We determined titers for L. interrogans through microscopic agglutination tests (MAT) from 10 manatees, six during the dry season (DS), and six during the rainy season (RS) in Laguna de las Ilusiones, a landlocked lake hosting a population of about 20 manatees. All individuals were antibody positive (titers ≥ 100) to at least one serovar. The serovars bataviae, bratislava, canicola, and icterohaemorrhagiae had overall prevalences ≥ 50%; bataviae, bratislava, and canicola had prevalences ≥ 50% during both seasons. Serovars icterohaemorrhagiae and pyrogenes had prevalences ≥ 50% during DS and pomona, tarassovi, wolfii, and autumnalis during RS. Significant differences in prevalence between seasons were found for pomona, tarassovi, and autumnalis. Titers of tarassovi, wolfii, autumnalis, and bataviae were significantly higher during RS. There was a high prevalence of L. interrogans during the RS independent of high availability of plant foods, coinciding with the epizootiology of the bacteria that are endemic to tropical regions. Another factor possibly influencing prevalence is high anthropogenic pressure at the lake, causing an increase in potential sources of infection. Because of possible cross-reaction in MAT, further research is needed on the molecular discrimination of serovars in animals in the

  17. Protective Immunity and Reduced Renal Colonization Induced by Vaccines Containing Recombinant Leptospira interrogans Outer Membrane Proteins and Flagellin Adjuvant

    Science.gov (United States)

    Monaris, D.; Sbrogio-Almeida, M. E.; Dib, C. C.; Canhamero, T. A.; Souza, G. O.; Vasconcellos, S. A.; Ferreira, L. C. S.

    2015-01-01

    Leptospirosis is a global zoonotic disease caused by different Leptospira species, such as Leptospira interrogans, that colonize the renal tubules of wild and domestic animals. Thus far, attempts to develop effective leptospirosis vaccines, both for humans and animals, have failed to induce immune responses capable of conferring protection and simultaneously preventing renal colonization. In this study, we evaluated the protective immunity induced by subunit vaccines containing seven different recombinant Leptospira interrogans outer membrane proteins, including the carboxy-terminal portion of the immunoglobulinlike protein A (LigAC) and six novel antigens, combined with aluminum hydroxide (alum) or Salmonella flagellin (FliC) as adjuvants. Hamsters vaccinated with the different formulations elicited high antigen-specific antibody titers. Immunization with LigAC, either with alum or flagellin, conferred protective immunity but did not prevent renal colonization. Similarly, animals immunized with LigAC or LigAC coadministered with six leptospiral proteins with alum adjuvant conferred protection but did not reduce renal colonization. In contrast, immunizing animals with the pool of seven antigens in combination with flagellin conferred protection and significantly reduced renal colonization by the pathogen. The present study emphasizes the relevance of antigen composition and added adjuvant in the efficacy of antileptospirosis subunit vaccines and shows the complex relationship between immune responses and renal colonization by the pathogen. PMID:26108285

  18. Safety and immunogenicity of subcutaneous or intramuscular administration of a monovalent inactivated vaccine against Leptospira interrogans serogroup Icterohaemorrhagiae in healthy volunteers

    NARCIS (Netherlands)

    Laurichesse, H.; Gourdon, F.; Smits, H. L.; Abdoe, T. H.; Estavoyer, J. M.; Rebika, H.; Pouliquen, P.; Catalina, P.; Dubray, C.; Beytout, J.

    2007-01-01

    The safety and immunogenicity of a monovalent inactivated vaccine against Leptospira interrogans serogroup Icterohaemorrhagiae was evaluated in 84 volunteers according to the route of administration, i.e., subcutaneous (SC) or intramuscular (IM), in a double-blind randomised trial. The volunteers

  19. Preliminary identification of secreted proteins by Leptospira interrogans serovar Kennewicki strain Pomona Fromm

    Energy Technology Data Exchange (ETDEWEB)

    Ricardi, L.M.P.; Portaro, F.C.; Abreu, P.A.E.; Barbosa, A.S. [Instituto Butantan, Sao Paulo, SP (Brazil); Morais, Z.M.; Vasconcellos, S.A. [Universidade de Sao Paulo (USP), SP (Brazil)

    2012-07-01

    Full text: This project aimed to identify secreted proteins by pathogenic Leptospira interrogans serovar Kennewicki strain Pomona Fromm (LPF) by proteomic analyses. The strain LPF, whose virulence was maintained by passages in hamsters, were cultured in EMJH medium. The supernatants were centrifuged, dialyzed and subjected to lyophilization. Protein samples were resolved first by IEF at pH 3 to 10, immobilized pH gradient 13-cm strips. Strips were then processed for the second-dimension separation on SDS-polyacrylamide gels. Proteins from gel spots were subjected to reduction, cysteine-alkylation, and in-gel tryptic digestion, and analyzed by LC/MS/MS spectrometry. Liquid chromatography-based separation followed by automated tandem mass spectrometry was also used to identify secreted proteins. In silico analyses were performed using the PSORTbV.3.0 program and SignalP server. One major obstacle to secretome studies is the difficulty to obtain extracts of secreted proteins without citoplasmatic contamination. In addition, the extraction of low concentration proteins from large volumes of culture media, which are rich in salts, BSA and other compounds, frequently interfere with most proteomics techniques. For these reasons, several experimental approaches were used to optimize the protocol applied. In spite of this fact, our analysis resulted in the identification of 200 proteins with high confidence. Only 5 of 63 secreted proteins predicted by in silico analysis were found. Other classes identified included proteins that possess signal peptide but whose cellular localization prediction is unknown or may have multiple localization sites, and proteins that lack signal peptide and are thus thought to be secreted via non conventional mechanisms or resulting from cytoplasmic contamination by cell lysis. Many of these are hypothetical proteins with no putative conserved domains detected. To our knowledge, this is the first study to identify secreted proteins by

  20. Preliminary identification of secreted proteins by Leptospira interrogans serovar Kennewicki strain Pomona Fromm

    International Nuclear Information System (INIS)

    Ricardi, L.M.P.; Portaro, F.C.; Abreu, P.A.E.; Barbosa, A.S.; Morais, Z.M.; Vasconcellos, S.A.

    2012-01-01

    Full text: This project aimed to identify secreted proteins by pathogenic Leptospira interrogans serovar Kennewicki strain Pomona Fromm (LPF) by proteomic analyses. The strain LPF, whose virulence was maintained by passages in hamsters, were cultured in EMJH medium. The supernatants were centrifuged, dialyzed and subjected to lyophilization. Protein samples were resolved first by IEF at pH 3 to 10, immobilized pH gradient 13-cm strips. Strips were then processed for the second-dimension separation on SDS-polyacrylamide gels. Proteins from gel spots were subjected to reduction, cysteine-alkylation, and in-gel tryptic digestion, and analyzed by LC/MS/MS spectrometry. Liquid chromatography-based separation followed by automated tandem mass spectrometry was also used to identify secreted proteins. In silico analyses were performed using the PSORTbV.3.0 program and SignalP server. One major obstacle to secretome studies is the difficulty to obtain extracts of secreted proteins without citoplasmatic contamination. In addition, the extraction of low concentration proteins from large volumes of culture media, which are rich in salts, BSA and other compounds, frequently interfere with most proteomics techniques. For these reasons, several experimental approaches were used to optimize the protocol applied. In spite of this fact, our analysis resulted in the identification of 200 proteins with high confidence. Only 5 of 63 secreted proteins predicted by in silico analysis were found. Other classes identified included proteins that possess signal peptide but whose cellular localization prediction is unknown or may have multiple localization sites, and proteins that lack signal peptide and are thus thought to be secreted via non conventional mechanisms or resulting from cytoplasmic contamination by cell lysis. Many of these are hypothetical proteins with no putative conserved domains detected. To our knowledge, this is the first study to identify secreted proteins by

  1. Na,K-ATPase: a molecular target for Leptospira interrogans endotoxin

    Directory of Open Access Journals (Sweden)

    Younes-Ibrahim M.

    1997-01-01

    Full Text Available On the basis of our report that a glycolipoprotein fraction (GLP extracted from Leptospira interrogans contains a potent inhibitor of renal Na,K-ATPase, we proposed that GLP-induced inhibition of Na,K-ATPase might be the primary cellular defect in the physiopathology of leptospirosis. The present study was designed to test this hypothesis by determining whether or not 1 GLP inhibits all the isoforms of Na,K-ATPase which are expressed in the tissues affected by leptospirosis, 2 Na,K-ATPase from leptospirosis-resistant species, such as the rat, is sensitive to GLP, 3 GLP inhibits Na,K-ATPase from intact cells, and 4 GLP inhibits ouabain-sensitive H,K-ATPase. The results indicate that in the rabbit, a leptospirosis-sensitive species, GLP inhibits with similar efficiency (apparent IC50: 120-220 µg protein GLP/ml all isoforms of Na,K-ATPase known to be expressed in target tissues for the disease. Na,K-ATPase from rat kidney displays a sensitivity to GLP similar to that of the rabbit kidney enzyme (apparent IC50: 25-80 and 50-150 µg protein GLP/ml for rat and rabbit, respectively, indicating that resistance to the disease does not result from the resistance of Na,K-ATPase to GLP. GLP also reduces ouabain-sensitive rubidium uptake in rat thick ascending limbs (pmol mm-1 min-1 ± SEM; control: 23.8 ± 1.8; GLP, 88 µg protein/ml: 8.2 ± 0.9, demonstrating that it is active in intact cells. Finally, GLP had no demonstrable effect on renal H,K-ATPase activity, even on the ouabain-sensitive form, indicating that the active principle of GLP is more specific for Na,K-ATPase than ouabain itself. Although the hypothesis remains to be demonstrated in vivo, the present findings are compatible with the putative role of GLP-induced inhibition of Na,K-ATPase as an initial mechanism in the physiopathology of leptospirosis

  2. Prevalence of Leptospira interrogans antibodies in free-ranging Tayassu pecari of the Southern Pantanal, Brazil, an ecosystem where wildlife and cattle interact.

    Science.gov (United States)

    de Freitas, Tatiana P Tavares; Keuroghlian, Alexine; Eaton, Donald P; de Freitas, Emanuel Barbosa; Figueiredo, Aline; Nakazato, Luciano; de Oliveira, Jacqueline M; Miranda, Flávia; Paes, Rita Cassia S; Monteiro, Leticia A R Carneiro; Lima, José Vergílio B; da C Neto, Aparecida A; Dutra, Valéria; de Freitas, Julio Cesar

    2010-12-01

    We surveyed a wild population of white-lipped peccaries (Tayassu pecari) in the Brazilian Pantanal for evidence of Leptospira interrogans. Serum samples from 71 free-ranging T. pecari were obtained between 2003 and 2005 in the southern Pantanal of Mato Grosso do Sul state. We used microscopic microagglutination to test for antibodies against 14 L. interrogans serovars (antibody titers ≥ 1:100 were considered seropositive). Seventy percent of captured animals tested positive for leptospirosis antibodies. Antibodies against icterohaemorrhagiae and autumnalis serovars were the most prevalent. We used log-linear analyses to test for associations among seropositivity, age class, and sex of captured animals. Seropositivity was strongly associated with animal age class, but independent of sex. Forty-six percent of animals less than 2 years old, 63% of adults during peak reproductive years, and 100% of the oldest age class were seropositive. A nonparametric multivariate procedure (MRPP) showed that the composition of serovar antibody types changed with age, and ANOVA models demonstrated that antibody titers increased with age, suggesting long-term exposure to a greater number and variety (i.e., serovar types) of L. interrogans infections. This study presents the first quantitative survey of antibodies against L. interrogans serovars in a T. pecari population of the Pantanal. The high prevalence of leptospirosis antibodies in free-ranging white-lipped peccaries and the potential impacts on reproduction and population dynamics emphasize the need for further studies investigating the roles of Pantanal wildlife and livestock in the transmission and maintenance of L. interrogans in the environment.

  3. Validación de un ELISA para la cuantificación de IgG antipolisacárido capsular de Neisseria meningitidis serogrupo C en sueros de ratones.

    Directory of Open Access Journals (Sweden)

    Maribel Cuello

    2001-12-01

    Full Text Available Se desarrolló un ensayo inmunoenzimático de fase sólida (ELISA indirecto para cuantificar anticuerpos IgG específicos antipolisacárido C en ratón, utilizando un prerrecubrimiento con Poli-L-lisina y luego el polisacárido capsular de Neisseria meningitidis serogrupo C (Instituto Finlay, La Habana, Cuba, para evaluar la respuesta inmune contra este componente en candidatos vacunales en estudios preclínicos. Como conjugado se utilizó anti-IgG ratón conjugado a fosfatasa alcalina, el cual se une a los anticuerpos antipolisacárido C producidos en ratones. La reacción es evidenciada por la degradación del sustrato p-nitrofenilfosfato. La detectibilidad del ensayo fue de 123,74 U/mL y la especificidad fue alta. La precisión interensayo, intraensayo y total, así como las desviaciones de la recuperación, linealidad y paralelismo no sobrepasaron el 10%. El ELISA permitió cuantificar los anticuerpos antipolisacárido C inducidos en ratones tanto por candidatos vacunales conjugados, como por la vacuna VA-MENGOC-BC y el polisacárido C sin conjugar.

  4. Perfil dos cães sororreagentes para aglutininas anti-Leptospira interrogans em Belo Horizonte, Minas Gerais, 2001/2002 Serological profile of seropositive dogs to anti-Leptospira interrogans agglutinins in Belo Horizonte, Minas Gerais, Brazil, 2001-2002

    Directory of Open Access Journals (Sweden)

    D.F. Magalhães

    2007-10-01

    Full Text Available The serological profile of seropositive dogs according to anti-Leptospira agglutinins was checked in Belo Horizonte including variables such as race, sex, age and whether the dog had an owner or not. The dogs were captured by the Zoonosis Control Center in nine neighborhoods around the city and were separated in two categories - with owners or captured on the streets. The prevalence of anti-Leptospira agglutinins was evaluated in 3,417 blood samples using the microscopic agglutination test (MAT from September 2001 to September 2002. It was found that 13.1% of the dogs had seropositive results with the most reactive serovars being Canicola (7.0%, Ballum (6.1%, Pyrogenes (3.2% and Icterohaemorrhagiae (2.9%. The prevalence of other serovars was less than 1.0%. Greater prevalence was found in male, crossbred dogs, without owners. There were no significant results due to age in 95% (P=0.808 of the cases. According to the results, more research should be done in order to isolate and classify the serovars in positive dogs, especially Ballum and Pyrogenes, which will suggest their inclusion in the commercial vaccines against leptospira used in dogs in this city.

  5. In vivo cell aggregations of a recent swine biofilm-forming isolate of Leptospira interrogans strain from Argentina Agregaciones celulares in vivo de Leptospira interrogans producidas por un aislamiento porcino capaz de formar biofilm

    Directory of Open Access Journals (Sweden)

    Bibiana Brihuega

    2012-09-01

    Full Text Available Leptospirosis is a zoonosis of ubiquitous distribution caused by spirochetes. Leptospires exist either as saprophytic water-associated organisms or as animal pathogens that can survive in water. Previous works have demonstrated that both saprophytic and pathogenic leptospires are able to produce functional biofilms, which consist of a community of bacteria embedded in an extracellular matrix attached to a surface. This structure is believed to provide protection from environmental aggressiveness. In the present study, we analyzed the capacity of biofilm formation both of a a recent field isolate of Leptospira interrogans serovar Pomona obtained from an aborted swine fetus and of the saprophytic Leptospira biflexa serovar Patoc. We used light microscopy, immunofluorescence, and scanning electron microscopic examinations on glass and polystyrene plate models to evaluate the process in vitro. The ability to form bacterial aggregations in vivo was tested using pregnant guinea pigs infected with both strains. We obtained biofilms both on glass and plastic surfaces. Scanning electron microscopic analysis showed differences in the biofilm structure formed by both strains. L. interrogans serovar Pomona cell aggregations were observed in placental tissues by light microscopy. Biofilms and cell aggregations are consistent with the life of saprophytic strains in water and could help pathogenic strains to colonize the host and lead to abortion in pregnant animals.La leptospirosis es una zoonosis de amplia distribución causada por el género Leptospira. Las leptospiras existen de manera saprófita asociadas a ambientes acuáticos o como patógenos animales que también pueden sobrevivir en el agua. Trabajos previos demostraron que tanto las leptospiras saprófitas como las patógenas tienen la capacidad de formar biofilms, que consisten en una comunidad de bacterias embebidas en una matriz extracelular adherida a una superficie. Esta estructura tendría la

  6. Isolation and Molecular Characterization of Leptospira interrogans and Leptospira borgpetersenii Isolates from the Urban Rat Populations of Kuala Lumpur, Malaysia

    Science.gov (United States)

    Benacer, Douadi; Zain, Siti Nursheena Mohd; Amran, Fairuz; Galloway, Renee L.; Thong, Kwai Lin

    2013-01-01

    Rats are considered the principal maintenance hosts of Leptospira. The objectives of this study were isolation and identification of Leptospira serovars circulating among urban rat populations in Kuala Lumpur. Three hundred urban rats (73% Rattus rattus and 27% R. norvegicus) from three different sites were trapped. Twenty cultures were positive for Leptospira using dark-field microscopy. R. rattus was the dominant carrier (70%). Polymerase chain reaction (PCR) confirmed that all isolates were pathogenic Leptospira species. Two Leptospira serogroups, Javanica and Bataviae, were identified using microscopic agglutination test (MAT). Pulsed-field gel electrophoresis (PFGE) identified two serovars in the urban rat populations: L. borgpetersenii serovar Javanica (85%) and L. interrogans serovar Bataviae (15%). We conclude that these two serovars are the major serovars circulating among the urban rat populations in Kuala Lumpur. Despite the low infection rate reported, the high pathogenicity of these serovars raises concern of public health risks caused by rodent transmission of leptospirosis. PMID:23358635

  7. Leptospira interrogans causes quantitative and morphological disturbances in adherens junctions and other biological groups of proteins in human endothelial cells.

    Directory of Open Access Journals (Sweden)

    Hiromi Sato

    2017-07-01

    Full Text Available Pathogenic Leptospira transmits from animals to humans, causing the zoonotic life-threatening infection called leptospirosis. This infection is reported worldwide with higher risk in tropical regions. Symptoms of leptospirosis range from mild illness to severe illness such as liver damage, kidney failure, respiratory distress, meningitis, and fatal hemorrhagic disease. Invasive species of Leptospira rapidly disseminate to multiple tissues where this bacterium damages host endothelial cells, increasing vascular permeability. Despite the burden in humans and animals, the pathogenic mechanisms of Leptospira infection remain to be elucidated. The pathogenic leptospires adhere to endothelial cells and permeabilize endothelial barriers in vivo and in vitro. In this study, human endothelial cells were infected with the pathogenic L. interrogans serovar Copenhageni or the saprophyte L. biflexa serovar Patoc to investigate morphological changes and other distinctive phenotypes of host cell proteins by fluorescence microscopy. Among those analyzed, 17 proteins from five biological classes demonstrated distinctive phenotypes in morphology and/or signal intensity upon infection with Leptospira. The affected biological groups include: 1 extracellular matrix, 2 intercellular adhesion molecules and cell surface receptors, 3 intracellular proteins, 4 cell-cell junction proteins, and 5 a cytoskeletal protein. Infection with the pathogenic strain most profoundly disturbed the biological structures of adherens junctions (VE-cadherin and catenins and actin filaments. Our data illuminate morphological disruptions and reduced signals of cell-cell junction proteins and filamentous actin in L. interrogans-infected endothelial cells. In addition, Leptospira infection, regardless of pathogenic status, influenced other host proteins belonging to multiple biological classes. Our data suggest that this zoonotic agent may damage endothelial cells via multiple cascades or

  8. Leptospira interrogans causes quantitative and morphological disturbances in adherens junctions and other biological groups of proteins in human endothelial cells

    Science.gov (United States)

    Sato, Hiromi

    2017-01-01

    Pathogenic Leptospira transmits from animals to humans, causing the zoonotic life-threatening infection called leptospirosis. This infection is reported worldwide with higher risk in tropical regions. Symptoms of leptospirosis range from mild illness to severe illness such as liver damage, kidney failure, respiratory distress, meningitis, and fatal hemorrhagic disease. Invasive species of Leptospira rapidly disseminate to multiple tissues where this bacterium damages host endothelial cells, increasing vascular permeability. Despite the burden in humans and animals, the pathogenic mechanisms of Leptospira infection remain to be elucidated. The pathogenic leptospires adhere to endothelial cells and permeabilize endothelial barriers in vivo and in vitro. In this study, human endothelial cells were infected with the pathogenic L. interrogans serovar Copenhageni or the saprophyte L. biflexa serovar Patoc to investigate morphological changes and other distinctive phenotypes of host cell proteins by fluorescence microscopy. Among those analyzed, 17 proteins from five biological classes demonstrated distinctive phenotypes in morphology and/or signal intensity upon infection with Leptospira. The affected biological groups include: 1) extracellular matrix, 2) intercellular adhesion molecules and cell surface receptors, 3) intracellular proteins, 4) cell-cell junction proteins, and 5) a cytoskeletal protein. Infection with the pathogenic strain most profoundly disturbed the biological structures of adherens junctions (VE-cadherin and catenins) and actin filaments. Our data illuminate morphological disruptions and reduced signals of cell-cell junction proteins and filamentous actin in L. interrogans-infected endothelial cells. In addition, Leptospira infection, regardless of pathogenic status, influenced other host proteins belonging to multiple biological classes. Our data suggest that this zoonotic agent may damage endothelial cells via multiple cascades or pathways

  9. Structural and mutational analyses of the Leptospira interrogans virulence-related heme oxygenase provide insights into its catalytic mechanism.

    Directory of Open Access Journals (Sweden)

    Anabel Soldano

    Full Text Available Heme oxygenase from Leptospira interrogans is an important virulence factor. During catalysis, redox equivalents are provided to this enzyme by the plastidic-type ferredoxin-NADP+ reductase also found in L. interrogans. This process may have evolved to aid this bacterial pathogen to obtain heme-iron from their host and enable successful colonization. Herein we report the crystal structure of the heme oxygenase-heme complex at 1.73 Å resolution. The structure reveals several distinctive features related to its function. A hydrogen bonded network of structural water molecules that extends from the catalytic site to the protein surface was cleared observed. A depression on the surface appears to be the H+ network entrance from the aqueous environment to the catalytic site for O2 activation, a key step in the heme oxygenase reaction. We have performed a mutational analysis of the F157, located at the above-mentioned depression. The mutant enzymes were unable to carry out the complete degradation of heme to biliverdin since the reaction was arrested at the verdoheme stage. We also observed that the stability of the oxyferrous complex, the efficiency of heme hydroxylation and the subsequent conversion to verdoheme was adversely affected. These findings underscore a long-range communication between the outer fringes of the hydrogen-bonded network of structural waters and the heme active site during catalysis. Finally, by analyzing the crystal structures of ferredoxin-NADP+ reductase and heme oxygenase, we propose a model for the productive association of these proteins.

  10. Vigilancia de Neisseria meningitidis en Argentina, 1993-2005: distribución de serogrupos, serotipos y serosubtipos causantes de enfermedad invasiva Surveillance of Neisseria meningitidis in Argentina, 1993-2005: Distribution of serogroups, serotypes and serosubtypes isolated from invasive disease

    Directory of Open Access Journals (Sweden)

    L. Chiavetta

    2007-03-01

    Full Text Available Neisseria meningitidis es agente causal de enfermedades severas como meningitis, bacteriemia y síndrome de shock séptico. Se presenta la distribución en serogrupos, serotipos y serosubtipos de 2244 aislamientos de N. meningitidis obtenidos de cuadros de meningitis y/o meningococcemia durante el período 1993-2005 y analizados en el Laboratorio Nacional de Referencia del INEI-ANLIS "Dr. Carlos G. Malbrán". Estos aislamientos eran provenientes de 33 hospitales de todo el país, conformados en una red nacional de laboratorios para el estudio de meningitis bacteriana. Durante el período 1993-1995 prevaleció el serogrupo B (66%, mientras que entre los años 1995 y 2001 prevaleció el serogrupo C (65%; a partir de esta fecha se restableció la prevalencia de B. En los últimos 5 años los serogrupos Y y W135 representaron en su conjunto el 15,6%, mientras que hasta el año 2000 no superaron el 4,7%. Se registró mayor diversidad en la distribución de serotipos y serosubtipos dentro del serogrupo B que dentro del serogrupo C. Los aislamientos no subtipables durante todo el período de estudio representaron el 52,8%; este elevado porcentaje evidencia la limitada capacidad de la serología para la determinación de subtipos de meningococo.Neisseria meningitidis is an important cause of meningitis, bacteremia and septic shock syndrome. We herein present the distribution of serogroups, serotypes and serosubtypes of 2244 isolates of N. meningitidis from patients with meningitis or meningococcemia, received within the period 1993-2005, in the National Reference Laboratory, INEI-ANLIS "Dr. Carlos G. Malbrán", from 33 Argentine hospitals that are included in a National Network devoted to for the study of bacterial meningitis. Between 1993-1995, serogroup B was prevalent (66% whereas in the period from 1995-2001, serogroup C prevailed (65%. However, following but after that period, the prevalence of serogroup B was recovered. In the last 5 years of the

  11. Live imaging of bioluminescent leptospira interrogans in mice reveals renal colonization as a stealth escape from the blood defenses and antibiotics.

    Directory of Open Access Journals (Sweden)

    Gwenn Ratet

    2014-12-01

    Full Text Available Leptospira (L. interrogans are bacteria responsible for a worldwide reemerging zoonosis. Some animals asymptomatically carry L. interrogans in their kidneys and excrete bacteria in their urine, which contaminates the environment. Humans are infected through skin contact with leptospires and develop mild to severe leptospirosis. Previous attempts to construct fluorescent or bioluminescent leptospires, which would permit in vivo visualization and investigation of host defense mechanisms during infection, have been unsuccessful. Using a firefly luciferase cassette and random transposition tools, we constructed bioluminescent chromosomal transformants in saprophytic and pathogenic leptospires. The kinetics of leptospiral dissemination in mice, after intraperitoneal inoculation with a pathogenic transformant, was tracked by bioluminescence using live imaging. For infective doses of 106 to 107 bacteria, we observed dissemination and exponential growth of leptospires in the blood, followed by apparent clearance of bacteria. However, with 2×108 bacteria, the septicemia led to the death of mice within 3 days post-infection. In surviving mice, one week after infection, pathogenic leptospires reemerged only in the kidneys, where they multiplied and reached a steady state, leading to a sustained chronic renal infection. These experiments reveal that a fraction of the leptospiral population escapes the potent blood defense, and colonizes a defined number of niches in the kidneys, proportional to the infective dose. Antibiotic treatments failed to eradicate leptospires that colonized the kidneys, although they were effective against L. interrogans if administered before or early after infection. To conclude, mice infected with bioluminescent L. interrogans proved to be a novel model to study both acute and chronic leptospirosis, and revealed that, in the kidneys, leptospires are protected from antibiotics. These bioluminescent leptospires represent a

  12. Multiple-locus variable-number tandem repeat analysis of Leptospira interrogans and Leptospira borgpetersenii isolated from small feral and wild mammals in East Asia.

    Science.gov (United States)

    Koizumi, Nobuo; Izumiya, Hidemasa; Mu, Jung-Jung; Arent, Zbigniew; Okano, Shou; Nakajima, Chie; Suzuki, Yasuhiko; Mizutani Muto, Maki; Tanikawa, Tsutomu; Taylor, Kyle R; Komatsu, Noriyuki; Yoshimatsu, Kumiko; Thi Thu Ha, Hoang; Ohnishi, Makoto

    2015-12-01

    Leptospira spp. are the causative agents of a worldwide zoonosis, leptospirosis, maintained by various mammals. Each Leptospira serovar is frequently associated with a particular maintenance host, and recently, Leptospira genotype-host association has also been suggested to limit serovars to restricted areas. We investigated the molecular characteristics of L. interrogans and L. borgpetersenii which were isolated from small feral and wild animals in four East Asian states using multiple-locus variable-number tandem repeat analysis (MLVA). MLVA using 11 loci was performed on 110 L. interrogans serogroups from Japan (79 strains of 5 serogroups from 3 animal species), Philippines (21; 3; 2), Taiwan (7; 2; 3), and Vietnam (3; 1; 1). A MLVA method using 4 loci for L. borgpetersenii was established and performed on 52 isolates from Japan (26; 3; 7), Philippines (13; 1; 2), and Taiwan (13; 1; 3). In L. interrogans, serogroups Autumnalis and Hebdomadis appeared more genetically diverse than serogroups Bataviae, Grippotyphosa, Icterohaemorrhagiae, Pomona, or Pyrogenes. The former serogroup strains with the exception of one Hebdomadis strain were isolated from Apodemus speciosus while all the latter serogroup strains with the exception of Grippotyphosa were isolated from Rattus norvegicus. L. borgpetersenii was isolated from at least 11 animal species while L. interrogans was isolated from five species, which might suggest a wider host range for L. borgpetersenii. Broad host preference in a single genotype was also observed, which colonized not only different species of the same genera but also multiple animal genera. This study demonstrates that there may be variability in the range of genetic diversity among different Leptospira serogroups, which may be attributed to maintenance host animals and environmental factors. Copyright © 2015. Published by Elsevier B.V.

  13. Isolation of Salmonella enterica and serologic reactivity to Leptospira interrogans in opossums (Didelphis virginiana) from Yucatán, México.

    Science.gov (United States)

    Ruiz-Pina, Hugo Antonio; Puc-Franco, Miguel Angel; Flores-Abuxapqui, Javier; Vado-Solis, Ignacio; Cardenas-Marrufo, María Fidelia

    2002-01-01

    The presence of Salmonella enterica and serologic evidence of infection by Leptospira interrogans, were detected in the opossum Didelphis virginiana in a semi-urban locality of the Yucatán State, México. Ninety-one opossums were captured during the period April 1996 and May 1998. From a total of 17 feces samples, four Salmonella enterica subsp. enterica serotypes (Sandiego, Newport, Anatum, and Minnesota), and one Salmonella enterica subsp. arizonae serovar O44:Z4,Z23:- were isolated. Some opossums presented mixed infections. From 81 sera samples, four (4.9%) were positive to antibodies to Leptospira serovars pomona and wolfii. Both animals infected with Salmonella enterica and those serologically positive to Leptospira interrogans were captured in peridomestic habitat. Opossums infected with Salmonella enterica, were captured in dry season, and those seropositive to Leptospira interrogans during the rainy season. The implications of infection and reactivity of these zoonotic pathogens in D. virginiana in the Yucatan state are briefly discussed.

  14. Occurrence of antibodies anti -Toxoplasma gondii, Neospora caninum and Leptospira interrogans in a captive deer herd in Southern Brazil.

    Science.gov (United States)

    Zimpel, Cristina Kraemer; Grazziotin, Ana Laura; de Barros Filho, Ivan Roque; Guimaraes, Ana Marcia de Sa; dos Santos, Leonilda Correia; de Moraes, Wanderlei; Cubas, Zalmir Silvino; de Oliveira, Marcos Jose; Pituco, Edviges Maristela; Lara, Maria do Carmo Custódio de Souza Hunold; Villalobos, Eliana Monteforte Cassaro; Silva, Lília Marcia Paulin; Cunha, Elenice Maria Sequetin; Castro, Vanessa; Biondo, Alexander Welker

    2015-01-01

    A large number of Brazilian zoos keep many endangered species of deer, however, very few disease surveillance studies have been conducted among captive cervids. Blood samples from 32 Brazilian deer (Blastocerus dichotomus, Mazama nana and Mazama americana) kept in captivity at Bela Vista Biological Sanctuary (Foz do Iguaçu, Brazil) were investigated for 10 ruminant pathogens, with the aims of monitoring deer health status and evaluating any potential zoonotic risk. Deer serum samples were tested for Brucella abortus, Leptospira (23 serovars), Toxoplasma gondii, Neospora caninum, bovine viral diarrhea virus, infectious bovine rhinotracheitis virus, foot-and-mouth disease virus, western equine encephalitis virus, eastern equine encephalitis virus and Venezuelan equine encephalitis virus. Antibodies against T. gondii (15.6%), N. caninum (6.2%) and L. interrogans serogroup Serjoe (3.1%) were detected. The serological results for all other infectious agents were negative. The deer were considered to be clinically healthy and asymptomatic regarding any disease. Compared with studies on free-ranging deer, the prevalences of the same agents tested among the captive deer kept at the Sanctuary were lower, thus indicating good sanitary conditions and high-quality management practices at the zoo.

  15. Features of two new proteins with OmpA-like domains identified in the genome sequences of Leptospira interrogans.

    Directory of Open Access Journals (Sweden)

    Aline F Teixeira

    Full Text Available Leptospirosis is an acute febrile disease caused by pathogenic spirochetes of the genus Leptospira. It is considered an important re-emerging infectious disease that affects humans worldwide. The knowledge about the mechanisms by which pathogenic leptospires invade and colonize the host remains limited since very few virulence factors contributing to the pathogenesis of the disease have been identified. Here, we report the identification and characterization of two new leptospiral proteins with OmpA-like domains. The recombinant proteins, which exhibit extracellular matrix-binding properties, are called Lsa46 - LIC13479 and Lsa77 - LIC10050 (Leptospiral surface adhesins of 46 and 77 kDa, respectively. Attachment of Lsa46 and Lsa77 to laminin was specific, dose dependent and saturable, with KD values of 24.3 ± 17.0 and 53.0 ± 17.5 nM, respectively. Lsa46 and Lsa77 also bind plasma fibronectin, and both adhesins are plasminogen (PLG-interacting proteins, capable of generating plasmin (PLA and as such, increase the proteolytic ability of leptospires. The proteins corresponding to Lsa46 and Lsa77 are present in virulent L. interrogans L1-130 and in saprophyte L. biflexa Patoc 1 strains, as detected by immunofluorescence. The adhesins are recognized by human leptospirosis serum samples at the onset and convalescent phases of the disease, suggesting that they are expressed during infection. Taken together, our data could offer valuable information to the understanding of leptospiral pathogenesis.

  16. Occurrence of antibodies anti -Toxoplasma gondii, Neospora caninum and Leptospira interrogans in a captive deer herd in Southern Brazil

    Directory of Open Access Journals (Sweden)

    Cristina Kraemer Zimpel

    Full Text Available Abstract A large number of Brazilian zoos keep many endangered species of deer, however, very few disease surveillance studies have been conducted among captive cervids. Blood samples from 32 Brazilian deer (Blastocerus dichotomus, Mazama nana and Mazama americana kept in captivity at Bela Vista Biological Sanctuary (Foz do Iguaçu, Brazil were investigated for 10 ruminant pathogens, with the aims of monitoring deer health status and evaluating any potential zoonotic risk. Deer serum samples were tested for Brucella abortus, Leptospira (23 serovars, Toxoplasma gondii, Neospora caninum, bovine viral diarrhea virus, infectious bovine rhinotracheitis virus, foot-and-mouth disease virus, western equine encephalitis virus, eastern equine encephalitis virus and Venezuelan equine encephalitis virus. Antibodies against T. gondii (15.6%, N. caninum (6.2% and L. interrogans serogroup Serjoe (3.1% were detected. The serological results for all other infectious agents were negative. The deer were considered to be clinically healthy and asymptomatic regarding any disease. Compared with studies on free-ranging deer, the prevalences of the same agents tested among the captive deer kept at the Sanctuary were lower, thus indicating good sanitary conditions and high-quality management practices at the zoo.

  17. Evaluación de la eficacia de VA-MENGOC-BC® en ratón Balb/c retados frente a los serogrupos A, B y C

    Directory of Open Access Journals (Sweden)

    Juan Francisco Infante

    2003-09-01

    Full Text Available Hasta la fecha se han desarrollado varios modelos experimentales para la reproducción experimental de la enfermedad meningocócica humana, cuya utilidad en la evaluación de la eficacia de medios de inmunización y terapia, así como en el estudio de la patogenia de la enfermedad es incuestionable. En el presente trabajo se describe la evaluación de la eficacia de VA-MENGOC-BC® y la Inmunoglobulina Humana Antimeningocócica BC frente a Neisseria meningitidis de los serogrupos A, B y C, empleando el ratón Balb/c tratado con mucina y dextrana férrica como estimulantes de la virulencia. Los ratones fueron inmunizados por vía intraperitoneal con una, dos o tres dosis de 0,5 mL de VA-MENGOC-BC®. El intervalo entre dosis fue de tres semanas entre la primera y segunda dosis y de 15 días entre la segunda y la tercera. El reto se realizó con dosis letales (1-3 x DL50 de N. meningitidis A, B ó C a los 15 ó 21 días después de aplicada la última dosis de vacuna. Para evaluar la actividad de la Inmunoglobulina Antimeningocócica BC como medio de inmunización pasiva, se trató otro grupo de ratones, 30 min, 2 y 6 h después habérseles inoculado los gérmenes. Se administraron en cada caso 5 mg de la inmunoglobulina por vía intraperitoneal o intravenosa en un volumen de 0,1 mL. Los resultados demostraron que tanto VA-MENGOC-BC® como la Globulina Antimeningocócica BC confieren protección significativa contra un reto letal con N. meningitidis en el modelo de ratón tratado con factores estimulantes de la virulencia.

  18. Isolation and characterization of Leptospira interrogans from pigs slaughtered in São Paulo State, Brazil Isolamento e caracterização de Leptospira interrogans de suínos abatidos no Estado de São Paulo, Brasil

    Directory of Open Access Journals (Sweden)

    Fabiana Miraglia

    2008-09-01

    Full Text Available With the aim of isolating Leptospira spp., blood serum, kidney, liver and genital tract of 137 female swine (40 sows and 97 gilts and also urine samples from 22 sows were collected in a slaughterhouse in the State of São Paulo, from April 2003 to August 2004. Four isolates were obtained from animals that presented microagglutination test (MAT titers > 100 for the serovar Pomona and one was obtained from an animal negative by MAT in which Leptospira was isolated from the liver and reproductive tract. The presence of leptospiral DNA was investigated by PCR, and positive results were found in kidneys of 11 females, liver of two, genital tract of two and urine of one of them. Nephrosis, interstitial multifocal nephritis, moderate to severe changing, hyalines cylinders and hemorrhagic focuses, hepatic and uterine horns congestion were histological lesions observed in higher frequency in animals positive for leptospira. The silver impregnation (Warthin Starry confirmed the presence of spirochetes in renal tubules of four females with positive leptospira cultures from kidneys. The serogroup of the five isolates was identified as Pomona by cross agglutination with reference polyclonal antibodies. Molecular characterization of the isolates was carried out by variable-number tandem-repeats analysis. All the isolates revealed a pattern distinct from the L. interrogans Pomona type strain, but identical to a previously identified pattern from strains isolated in Argentina belonging to serovar Pomona.Amostras de soro sanguíneo, rim, fígado e trato genital de 137 fêmeas suínas (40 matrizes e 97 marrãs e de urina de 22 matrizes foram colhidas em abatedouro no Estado de São Paulo, no período de abril de 2003 a agosto de 2004 tendo como objetivo o isolamento de Leptospira spp. Quatro estirpes foram isoladas de animais que apresentaram títulos, no teste de soroaglutinação microscópica (SAM > 100, para o sorovar Pomona e de um animal, não reagente na

  19. Leptospira interrogans en una población canina del Gran Buenos Aires: variables asociadas con la seropositividad

    Directory of Open Access Journals (Sweden)

    Rubel Diana

    1997-01-01

    Full Text Available Se determinó la seroprevalencia de leptospirosis en una población canina suburbana con el objeto de analizar la asociación entre distintas variables individuales y ambientales y la seropositividad a leptospirosis. El estudio, de diseño transversal, se llevó a cabo durante julio de 1992 en un barrio del Gran Buenos Aires en el que viven unos 9 500 habitantes y una población canina de unos 2 000 animales. Se estudió una muestra aleatoria de 223 perros, de cada uno de los cuales se obtuvo una muestra de sangre. La ficha epidemiológica del animal se obtuvo por encuesta al ama de casa. Las determinaciones serológicas se realizaron por microaglutinación frente a 10 serotipos de Leptospira interrogans. Se halló seropositividad en 57% de los 223 perros examinados; 82% de los sueros positivos coaglutinaron con dos o más serotipos. Los serotipos detectados con mayor frecuencia fueron canicola y pyrogenes. La seroprevalencia en hembras fue menor que en machos (P <0,05 y entre los cachorros de menos de 1 año de edad, menor que en los animales de mayor edad (P <0,01. El callejeo del perro y la presencia de agua estancada frente a la vivienda del propietario fueron los factores de riesgo más importantes entre los que se estudiaron. Las asociaciones de la seropositividad con el contacto con un basural, con el comportamiento de caza del perro y con la presencia de roedores en la vivienda no fueron estadísticamente significativas. Se discuten distintas medidas de control.

  20. Leptospira interrogans en una población canina del Gran Buenos Aires: variables asociadas con la seropositividad

    Directory of Open Access Journals (Sweden)

    Diana Rubel

    1997-08-01

    Full Text Available Se determinó la seroprevalencia de leptospirosis en una población canina suburbana con el objeto de analizar la asociación entre distintas variables individuales y ambientales y la seropositividad a leptospirosis. El estudio, de diseño transversal, se llevó a cabo durante julio de 1992 en un barrio del Gran Buenos Aires en el que viven unos 9 500 habitantes y una población canina de unos 2 000 animales. Se estudió una muestra aleatoria de 223 perros, de cada uno de los cuales se obtuvo una muestra de sangre. La ficha epidemiológica del animal se obtuvo por encuesta al ama de casa. Las determinaciones serológicas se realizaron por microaglutinación frente a 10 serotipos de Leptospira interrogans. Se halló seropositividad en 57% de los 223 perros examinados; 82% de los sueros positivos coaglutinaron con dos o más serotipos. Los serotipos detectados con mayor frecuencia fueron canicola y pyrogenes. La seroprevalencia en hembras fue menor que en machos (P <0,05 y entre los cachorros de menos de 1 año de edad, menor que en los animales de mayor edad (P <0,01. El callejeo del perro y la presencia de agua estancada frente a la vivienda del propietario fueron los factores de riesgo más importantes entre los que se estudiaron. Las asociaciones de la seropositividad con el contacto con un basural, con el comportamiento de caza del perro y con la presencia de roedores en la vivienda no fueron estadísticamente significativas. Se discuten distintas medidas de control.

  1. TLR4- and TLR2-mediated B cell responses control the clearance of the bacterial pathogen, Leptospira interrogans.

    Science.gov (United States)

    Chassin, Cécilia; Picardeau, Mathieu; Goujon, Jean-Michel; Bourhy, Pascale; Quellard, Nathalie; Darche, Sylvie; Badell, Edgar; d'Andon, Martine Fanton; Winter, Nathalie; Lacroix-Lamandé, Sonia; Buzoni-Gatel, Dominique; Vandewalle, Alain; Werts, Catherine

    2009-08-15

    Leptospirosis is a widespread zoonosis caused by pathogenic Leptospira interrogans that are transmitted by asymptomatic infected rodents. Leptospiral lipoproteins and LPS have been shown to stimulate murine cells via TLRs 2 and 4. Host defense mechanisms remain obscure, although TLR4 has been shown to be involved in clearing Leptospira. In this study, we show that double (TLR2 and TLR4) knockout (DKO) mice rapidly died from severe hepatic and renal failure following Leptospira inoculation. Strikingly, the severe proinflammatory response detected in the liver and kidney from Leptospira-infected DKO mice appears to be independent of MyD88, the main adaptor of TLRs. Infection of chimeric mice constructed with wild-type and DKO mice, and infection of several lines of transgenic mice devoid of T and/or B lymphocytes, identified B cells as the crucial lymphocyte subset responsible for the clearance of Leptospira, through the early production of specific TLR4-dependent anti-Leptospira IgMs elicited against the leptospiral LPS. We also found a protective tissue compartmentalized TLR2/TLR4-mediated production of IFN-gamma by B and T lymphocytes, in the liver and kidney, respectively. In contrast, the tissue inflammation observed in Leptospira-infected DKO mice was further characterized to be mostly due to B lymphocytes in the liver and T cells in the kidney. Altogether these findings demonstrate that TLR2 and TLR4 play a key role in the early control of leptospirosis, but do not directly trigger the inflammation induced by pathogenic Leptospira.

  2. Investigation on the presence of leptospires in ovaries of hamsters experimentally infected whith Leptospiras interrogans serovar pomona

    Directory of Open Access Journals (Sweden)

    Claudio Roberto de Almeida Camargo

    1993-12-01

    Full Text Available After inoculating L. interrogans serovar pomona in 75 primiparous hamsters (Mesocricetus auratus, the invasiveness of leptospires into lhe ovaries and lhe ability in causing ovary morphologic alterations were investigated by means of microscopic examination and bacterial isolation. For this purpose, 75 hamsters were inoculated with 0.5 ml of virulent strain containing 30-40 leptospires by the microscopic field and the other 15 hamsters were held as the uninfected controls. Signs and symptoms (prostration, tachypnea, rufled hair, jaundice, and nasal, bucal and perineal hemorrage were detected in all inoculated animals. The animals were killed in the agonic state of the illness, which were done through 4th and 7th day post inoculation. The ovaries were taken asseptically during the necropsies, thoroughly washed using the sterile phosphate buffered saline, in order to eliminate the possible external contamination. The fresh ovary samples were submitted to the dark field direct microscopic examination. After the formalin fixation, the specimens were stained by means of histopathologic techniques using the Levaditi and Hematoxylin Eosin stains. The ovary smears were also examined by the direct fluorescent antibody technique andlhe bacterial isolation was carried out in the Fletcher’s medium. The dark field direct microscopic examination was found tobe less sensitive in demonstrating the presence of leptospiresin the ovaries. In those specimens stained by the Lcvadititechnique, leptospires were visualized in different ovaryinternal structures, involving the interspace, pellucid zone andin the inner ovules. Through the histopathologic examination,typical morphologic alterations resembling acute infiamatoryprocess were found in 57% of ovaries examined.

  3. Leptospira interrogans activation of peripheral blood monocyte glycolipoprotein demonstrated in whole blood by the release of IL-6

    Directory of Open Access Journals (Sweden)

    F. Dorigatti

    2005-06-01

    Full Text Available Glycolipoprotein (GLP from pathogenic serovars of Leptospira has been implicated in the pathogenesis of leptospirosis by its presence in tissues of experimental animals with leptospirosis, the inhibition of the Na,K-ATPase pump activity, and induced production of cytokines. The aims of the present study were to investigate the induction of IL-6 by GLP in peripheral blood mononuclear cells (PBMC and to demonstrate monocyte stimulation at the cellular level in whole blood from healthy volunteers. PBMC were stimulated with increasing concentrations (5 to 2500 ng/ml of GLP extracted from the pathogenic L. interrogans serovar Copenhageni, lipopolysaccharide (positive control or medium (negative control, and supernatants were collected after 6, 20/24, and 48 h, and kept at -80ºC until use. Whole blood was diluted 1:1 in RPMI medium and cultivated for 6 h, with medium, GLP and lipopolysaccharide as described above. Monensin was added after the first hour of culture. Supernatant cytokine levels from PBMC were measured by ELISA and intracellular IL-6 was detected in monocytes in whole blood cultures by flow-cytometry. Monocytes were identified in whole blood on the basis of forward versus side scatter parameters and positive reactions with CD45 and CD14 antibodies. GLP ( > or = 50 ng/ml-induced IL-6 levels in supernatants were detected after 6-h incubation, reaching a peak after 20/24 h. The percentage of monocytes staining for IL-6 increased with increasing GLP concentration. Thus, our findings show a GLP-induced cellular activation by demonstrating the ability of GLP to induce IL-6 and the occurrence of monocyte activation in whole blood at the cellular level.

  4. Proteína LIC10494 de Leptospira interrogans serovar Copenhageni: modelo estructural y regiones funcionales asociadas

    Directory of Open Access Journals (Sweden)

    Orlando Emilio Acevedo

    2012-04-01

    Full Text Available Protein LIC10494 of Leptospira interrogans serovar Copenhageni: structural model and associated functional regions. Objective.Predict by computational means the 3D structure of the antigenic protein LIC10494 and report associated important functional regionsfor its pathogenicity and immunogenicity. Materials and methods. We performed a computational analysis of the primary structure ofLIC10494 using the servers BLAST, PROTPARAM, PROTSCALE, DAS, SOSUI, TOPPRED, TMAP, TMpred, SPLIT4, PHDHTM,TMHMM2, HMMTOP2, GLOBPLOT and PROSITE. The secondary structure was obtained by consensus of the algorithms SOPM,PREDATOR GOR4, DPM and DSC. The approach to the tertiary structure was obtained using the algorithm MUSTER. The energyminimization was done using the AMBER94 force field of the Schrodinger suite of molecular analysis, and the stereochemistry andenergy model validation was performed by the RAMPAGE server. The final model was visualized using PyMol V.0,98. Results. Thisstudy proposes a computational model that describes the 3D structure of the hypothetical lipoprotein LIC10494 and agrees with previousexperimental reports; thus, our study demonstrates the existence of patterns that could play an important role in the pathogenicity andprotection of the bacteria against the host immune system; the presence of a disorganized region between amino acids 80 and 140, andof a transmembrane segment between amino acids 8 and 22. Conclusion. The coincidence between structural and functional segments suggests that our model can be used to predict certain aspects of the biological behaviour of the protein according to the pathogenic andimmunogenic characteristics of the bacteria.

  5. Isolation of Salmonella enterica and serologic reactivity to Leptospira interrogans in opossums (Didelphis virginiana from Yucatán, México Aislamiento de Salmonella enterica y reactividad serológica a Leptospira interrogans en tlacuaches (Didelphis virginiana de Yucatán, México

    Directory of Open Access Journals (Sweden)

    Hugo Antonio RUIZ-PIÑA

    2002-07-01

    Full Text Available The presence of Salmonella enterica and serologic evidence of infection by Leptospira interrogans, were detected in the opossum Didelphis virginiana in a semi-urban locality of the Yucatán State, México. Ninety-one opossums were captured during the period April 1996 and May 1998. From a total of 17 feces samples, four Salmonella enterica subsp. enterica serotypes (Sandiego, Newport, Anatum, and Minnesota, and one Salmonella enterica subsp. arizonae serovar O44:Z4,Z23:- were isolated. Some opossums presented mixed infections. From 81 sera samples, four (4.9% were positive to antibodies to Leptospira serovars pomona and wolfii. Both animals infected with Salmonella enterica and those serologically positive to Leptospira interrogans were captured in peridomestic habitat. Opossums infected with Salmonella enterica, were captured in dry season, and those seropositive to Leptospira interrogans during the rainy season. The implications of infection and reactivity of these zoonotic pathogens in D. virginiana in the Yucatan state are briefly discussed.La presencia de Salmonella enterica y evidencia serológica de infección por Leptospira interrogans fueron detectadas en tlacuaches de la especie Didelphis virginiana capturados en una localidad semi-urbana del estado de Yucatán, México. Se capturaron 91 marsupiales durante el período de abril de 1996 a mayo de 1998. De un total de 17 muestras de heces, se aislaron cuatro serotipos de Salmonella enterica subsp. enterica (Sandiego, Newport, Anatum y Minnesota y una Salmonella enterica subsp. arizonae serovar O44:Z4,Z23:-. En algunos tlacuaches se registraron infecciones mixtas. De 81 muestras de suero, cuatro (4,9% presentaron reacciones positivas con los serovares pomona y wolffi, ambos pertenecientes al género Leptospira. Los tlacuaches con serología positiva fueron capturados en el hábitat peridomiciliar. Los animales infectados con Salmonella enterica fueron capturados en los períodos de seca y

  6. Development of the leptospirosis by experimental infection in hamsters (Mesocricetus auratus with Leptospira interrogans serovar Canicola, strain LO4, by intact and scratched skin exposures

    Directory of Open Access Journals (Sweden)

    Carolina de Sousa Américo Batista

    2010-10-01

    Full Text Available The establishment and evolution of leptospirosis in hamster (Mesocricetus auratus by experimental infection with Leptospira interrogans serovar Canicola, LO4 strain, by intact and scratched skin exposures, having as control the intraperitoneal route, were evaluated. Hundred-twenty female hamsters distributed in two groups according to inoculation route (intact and scratched skin were used. Infectious inoculum was constituted by a pure culture of L. interrogans serovar Canicola (strain LO4, isolated from liver from a slaughtered swine in Londrina, Paraná state and typified by agglutinins adsortion technique with monoclonal antibody kit at the Royal Tropical Institute, Amsterdam, the Netherlands. The animals were observed twice a day during 21 days. Animals that died were necropsied and kidneys, liver, genital tract (uterus and ovaries and brain were aseptically collected. On the 21st post-inoculation day, surviving animals were euthanized. In these animals, serum samples were also collected by cardiac puncture to antileptospires agglutinins research using microscopic agglutination test (MAT. Fresh direct microscopy and microbiological culture were used for the detection of leptospires. Scratched skin route induced larger lethality when compared to intact skin route, with establishment and evolution of leptospirosis. On the other hand, intact skin route induced renal and/or genital carrier state more frequently. LO4 strain presented low immunogenic power, characterized by soroconversion at the MAT in only one inoculated animal.

  7. SEROPREVALENCE OF NINE LEPTOSPIRA INTERROGANS SEROVARS IN WILD CARNIVORES, UNGULATES, AND PRIMATES FROM A ZOO POPULATION IN A METROPOLITAN REGION OF CHILE.

    Science.gov (United States)

    Moreno-Beas, Eduardo; Abalos, Pedro; Hidalgo-Hermoso, Ezequiel

    2015-12-01

    Serum samples from 130 individuals representing 42 species of carnivores, ungulates, and primates from a population of captive mammals in Metropolitan Region in Chile were tested for antibodies against nine serovars of Leptospira interrogans using the microscopic agglutination test. Ten percent of the animals were seropositive to one or more serovars. Seroprevalence was significantly higher in ungulates (20.4%) compared to carnivores (3.8%) and primates (3.4%). There were no significant differences in seroprevalence among sex and age ranges. The most frequent serovar detected was Autumnalis, present in 53.4% of antibody-positive animals. Most positive animals had titers of ≤1 : 200, except for a maned wolf ( Chrysocyon brachyurus ) with titers of 1 : 400 against serovar Hardjo. To the authors' knowledge, this is the first report of Leptospira exposure detected in native endangered pudu ( Pudu puda ) and the first confirmation of exposure to L. interrogans in captive wild mammals in Chile. Leptospirosis should be considered as a differential diagnosis in future disease presentation for hepatitis or abortions in captive mammals in Chile.

  8. Profiling of Leptospira interrogans, L. santarosai, L. meyeri and L. borgpetersenii by SE-AFLP, PFGE and susceptibility testing--a continuous attempt at species and serovar differentiation.

    Science.gov (United States)

    Moreno, Luisa Z; Miraglia, Fabiana; Lilenbaum, Walter; Neto, José S F; Freitas, Julio C; Morais, Zenaide M; Hartskeerl, Rudy A; da Costa, Barbara L P; Vasconcellos, Silvio A; Moreno, Andrea M

    2016-03-09

    Leptospirosis is a widespread systemic zoonosis, considered as reemerging in certain developing countries. Although the cross agglutinin absorption test is still considered the standard method for Leptospira identification, it presents several disadvantages. The aim of this study was to characterize Leptospira spp. isolated from various hosts by genotyping and broth microdilution susceptibility testing in an attempt to differentiate Leptospira species, serogroups and serovars. Forty-seven isolates were studied. They were previously serotyped, and species confirmation was performed by 16S rRNA sequencing. Single-enzyme amplified fragment length polymorphism (SE-AFLP) and pulsed-field gel electrophoresis (PFGE) analysis enabled the distinction of L. interrogans from L. santarosai, L. meyeri and L. borgpetersenii in two main clusters. Among L. interrogans, it was possible to differentiate into two new clusters the serogroup Icterohaemorrhagiae from the serogroups Canicola and Pomona. L. santarosai isolates presented higher genetic variation than the other species in both techniques. Interestingly, the minimum inhibitory concentration (MIC) cluster analysis also provided Leptospira serogroup differentiation. Further studies are necessary regarding serovar Bananal isolates, as they presented the highest MIC values for most of the antimicrobials tested. All studied techniques successfully distinguished Leptospira species and serogroups. Despite being library-dependent methods, these approaches are less labor intensive and more economically viable, particularly SE-AFLP, and can be implemented in most reference laboratories worldwide to enable faster Leptospira typing.

  9. Determination of Leptospira borgpetersenii serovar Javanica and Leptospira interrogans serovar Bataviae as the persistent Leptospira serovars circulating in the urban rat populations in Peninsular Malaysia.

    Science.gov (United States)

    Benacer, Douadi; Mohd Zain, Siti Nursheena; Sim, Shin Zhu; Mohd Khalid, Mohd Khairul Nizam; Galloway, Renee L; Souris, Marc; Thong, Kwai Lin

    2016-03-01

    Leptospirosis is an emerging infectious disease of global significance, and is endemic in tropical countries, including Malaysia. Over the last decade, a dramatic increase of human cases was reported; however, information on the primary vector, the rat, and the Leptospira serovars circulating among the rat population is limited. Therefore, the present study was undertaken to isolate Leptospira and characterise the serovars circulating in the urban rat populations from selected main cities in Peninsular Malaysia. Rat trappings were carried out between October 2011 to February 2014 in five urban cities which were chosen as study sites to represent different geographical locations in Peninsular Malaysia. Microscopic agglutination test (MAT) and PCR were carried out to identify the Leptospiral serogroup and determine the pathogenic status of the isolates, respectively while pulsed-field gel electrophoresis (PFGE) and random amplified polymorphic DNA (RAPD)-PCR were used to characterize the isolates. Three rat species were identified from the three hundred and fifty seven rats captured with Rattus rattus, being the dominant rat species (285, 80 %) followed by Rattus norgevicus (53, 15 %) and Rattus exulans (19, 5 %). Only 39 samples (11.0 %) were positive by culture and further confirmed as pathogenic Leptospira by PCR. Significant associations were shown between host infection with locality, season, host-age and species. Based on MAT, two serogroups were identified in the population namely; L. borgpetersenii serogroup Javanica (n = 16) and L. interrogans serogroup Bataviae (n = 23). Pulsed-field gel electrophoresis (PFGE) distinguished the two serovars in the urban rat populations: L. borgpetersenii serovar Javanica (41 %), and L. interrogans serovar Bataviae (59 %). RAPD-PCR yielded 14 distinct patterns and was found to be more discriminative than PFGE. This study confirms two Leptospira serovars circulating among the urban rats population in Peninsular

  10. Seropositivity to Leptospira interrogans serovar Bratislava associated to reproductive problems without significant biochemical or hematological alterations in horses Soropositividade para Leptospira interrogans serovar Bratislava associada a falhas reprodutivas sem alterações hematológicas e bioquímicas significativas em cavalos

    Directory of Open Access Journals (Sweden)

    Melissa Pinna

    2010-10-01

    Full Text Available The objective was to study haematological and biochemical alterations associated to seropositivity to Leptospira interrogans serovar Bratislava infection in horses with reproductive alterations, such as neonatal deaths, embryonic deaths and abortions. A flock of mares with poor reproductive performance was studied. Eighty-two (58.6% were seropositive (titre 200; 72 of those (87.8% for Bratislava. Slight haematological and biochemical alterations were observed, being more frequent (PO objetivo deste trabalho foi estudar alterações hematológicas e bioquímicas associadas à soropositividade para Leptospira interrogans sorovar Bratislava em cavalos com alterações reprodutivas, tais como mortes neonatais, absorção embrionária e abortamentos. Um rebanho de éguas com baixos índices reprodutivos foi estudado. Oitenta e duas (58,6% foram soropositivas (títulos 200, sendo 72 destas (87,8% para Bratislava. Foram observadas poucas alterações hematológicas e bioquímicas, mais frequentes (P<0,05 em éguas soropositivas do que soronegativas. Cavalos soropositivos para Bratislava não tinham alterações graves nos valores hematológicos e bioquímicos. Esses achados reforçam que esse sorovar seja adaptado de cavalos e cause apenas sintomas brandos, associados a falhas reprodutivas.

  11. Evaluación de la inmunogenicidad y la capacidad protectora homóloga de un candidato vacunal tetravalente de Leptospira, para uso veterinario

    Directory of Open Access Journals (Sweden)

    Yaritza Cuba-Romero

    2016-12-01

    Full Text Available La inmunogenicidad es un parámetro importante en estudios de inmunógenos. En la leptospirosis la respuesta inmune humoral es vital para la resistencia a la infección, de ahí que este trabajo se haya propuesto evaluar la inmunogenicidad y la capacidad protectora homóloga de un candidato tetravalente que incluye al serogrupo Ballum en su formulación. Se trabajó con la cepa 245-12 clasificada como L. borgpetersenii serovar Ballum, aislada a partir de un caso confirmado de leptospirosis. Con esta cepa previamente caracterizada desde el punto de vista de su virulencia, se formularon 5 lotes de una preparación vacunal tetravalente, la cual contiene además las cepas Canicola, Icterohaemorrhagiae y Pomona contenidas en la vacuna Polivalente-Leptospira, de uso veterinario. Se evaluó la inmunogenicidad de esta preparación, mediante microaglutinación y la capacidad de protección homóloga en hámster sirio dorado, frente al reto con 100 DL50. Los animales se inmunizaron con dos dosis de la vacuna (0,1mL con un intervalo de 15 días, el reto se llevó a cabo a los 14 días de concluido el esquema de inmunización. Los resultados obtenidos se compararon con los de la vacuna Polivalente-Leptospira. Todos los lotes de preparación tetravalente formulados cumplieron satisfactoriamente con los controles de calidad. Los lotes formulados en este estudio mostraron una significativa inmunogenicidad y capacidad de protección homologa frente al serogrupo Ballum, y lograron eliminar el estado de portador en los animales inmunizados. El presente trabajo, por primera vez, sienta las bases para formulaciones vacunales novedosas, en animales, conteniendo el serogrupo Ballum.

  12. The importance of Leptospira interrogans serovars Icterohaemorrhagiae and Canicola in coastal zone and in southern fields of Rio Grande do Sul, Brazil

    Directory of Open Access Journals (Sweden)

    Felipe J. Silva

    2014-01-01

    Full Text Available This study aimed to describe the occurrence of Leptospira interrogans serovars Icterohaemorrhagiae and Canicola, in coastal zone and in southern grasslands of Rio Grande do Sul, Brazil. In each one of the four analyzed farms blood samples were collected from free-living wild animals, domestic animals and humans to perform serological testing for leptospirosis. The presence of antibodies was verified by microscopic agglutination test (MAT. The criterion adopted to consider a serum as agglutination reactant was at least 50% of leptospira for a microscopic field of 100x. From 17 blood samples collected at Chuí, five (29.41% were positive, three (60.00% for serovar Icterohaemorrhagiae and two (40.00% for Canicola. From 21 samples collected in the County of Santana da Boa Vista, six (28.57% were positive, four (66.67% for serovar Canicola and two (33.33% for serovar Icterohaemorrhagiae. From 32 samples collected at Alegrete, 10 (31.25% were positive, seven (70.00% for serovar Icterohaemorrhagiae and three (30.00% foro serovar Canicola. From 17 blood samples collected in Cruz Alta, three (17.64% were positive, two (66.67% for serovar Icterohaemorrhagiae and one (33.33% for Canicola. It is necessary to improve sanitary practices on farms in the state of Rio Grande do Sul, in order to achieve success in leptospirosis control programs.

  13. MHC class II DRB diversity predicts antigen recognition and is associated with disease severity in California sea lions naturally infected with Leptospira interrogans

    Science.gov (United States)

    Acevedo-Whitehouse, Karina; Gulland, Frances; Bowen, Lizabeth

    2018-01-01

    We examined the associations between California sea lion MHC class II DRB (Zaca-DRB) configuration and diversity, and leptospirosis. As Zaca-DRB gene sequences are involved with antigen presentation of bacteria and other extracellular pathogens, we predicted that they would play a role in determining responses to these pathogenic spirochaetes. Specifically, we investigated whether Zaca-DRB diversity (number of genes) and configuration (presence of specific genes) explained differences in disease severity, and whether higher levels of Zaca-DRB diversity predicted the number of specific Leptospira interrogans serovars that a sea lion's serum would react against. We found that serum from diseased sea lions with more Zaca-DRB loci reacted against a wider array of serovars. Specific Zaca-DRB loci were linked to reactions with particular serovars. Interestingly, sea lions with clinical manifestation of leptospirosis that had higher numbers of Zaca-DRB loci were less likely to recover from disease than those with lower diversity, and those that harboured Zaca-DRB.C or –G were 4.5 to 5.3 times more likely to die from leptospirosis, regardless of the infective serovars. We propose that for leptospirosis, a disadvantage of having a wider range of antigen presentation might be increased disease severity due to immunopathology. Ours is the first study to examine the importance of Zaca-DRB diversity for antigen detection and disease severity following natural exposure to infective leptospires.

  14. MHC class II DRB diversity predicts antigen recognition and is associated with disease severity in California sea lions naturally infected with Leptospira interrogans.

    Science.gov (United States)

    Acevedo-Whitehouse, Karina; Gulland, Frances M D; Bowen, Lizabeth

    2018-01-01

    We examined the associations between California sea lion MHC class II DRB (Zaca-DRB) configuration and diversity, and leptospirosis. As Zaca-DRB gene sequences are involved with antigen presentation of bacteria and other extracellular pathogens, we predicted that they would play a role in determining responses to these pathogenic spirochaetes. Specifically, we investigated whether Zaca-DRB diversity (number of genes) and configuration (presence of specific genes) explained differences in disease severity, and whether higher levels of Zaca-DRB diversity predicted the number of specific Leptospira interrogans serovars that a sea lion's serum would react against. We found that serum from diseased sea lions with more Zaca-DRB loci reacted against a wider array of serovars. Specific Zaca-DRB loci were linked to reactions with particular serovars. Interestingly, sea lions with clinical manifestation of leptospirosis that had higher numbers of Zaca-DRB loci were less likely to recover from disease than those with lower diversity, and those that harboured Zaca-DRB.C or -G were 4.5 to 5.3 times more likely to die from leptospirosis, regardless of the infective serovars. We propose that for leptospirosis, a disadvantage of having a wider range of antigen presentation might be increased disease severity due to immunopathology. Ours is the first study to examine the importance of Zaca-DRB diversity for antigen detection and disease severity following natural exposure to infective leptospires. Copyright © 2017 Elsevier B.V. All rights reserved.

  15. Imunodiagnóstico da leptospirose humana através do teste ELISA-IgM, empregando-se diferentes preparações antigênicas a partir de sorotipos prevalentes de Leptospira interrogans Immunodiagnostic of human leptospirosis by ELISA-IgM, employing: different antigenic preparations as from prevalent serovars of Leptospira interrogans

    Directory of Open Access Journals (Sweden)

    Marcos Vinicius da Silva

    1990-08-01

    Full Text Available Realizou-se estudo comparativo de diferentes sorotipos de Leptospira interrogans utilizados na preparação de antígenos empregados no teste ELISA, para a detecção de anticorpos da classe IgM, em amostras de soro na fase precoce e tardia da leptospirose humana. Foram utilizados dez sorotipos, escolhidos entre os que apresentaram maior reatividade na soroaglutinação microscópica (SAM, na cidade de São Paulo. Os cinco sorotipos que apresentaram melhores resultados individualmente no teste ELISA-IgM (canicola, hebdomadis, icterohaemorrhagiae, cynopteri e brasiliensis, foram também estudados em mistura antigênica. Os antígenos não tratados apresentaram maior reatividade do que os antígenos tratados com Triton X - 100 (4% à temperatura de 50ºC, durante 4 horas. O teste ELISA-IgM empregando os sorotipos não tratados, isoladamente, e em mistura antigênica, mostrou-se altamente sensível, podendo ser empregado como teste de triagem para o diagnóstico precoce da leptospirose humana. Outra aplicação do teste é permitir a detecção do início de situações epidêmicas ou de surtos, possibilitando acionar medidas de vigilância epidemiológica.A comparative study among different serovars of Leptospira interrogans was performed in order to prepare antigens to detect IgM antibodies by ELISA in early and late phase of human leptospirosis. Ten serovars were chosen among the most prevalent detected by microscopic seroagglutination (SAM in São Paulo city. Using ELISA-IgM five of them showed better results (canicola, hebdomadis, icterohaemorrhagiae, cynopteri and brasiliensis. These ones were also studied in a pool. The non-treated antigens showed higher reactivity than the Triton X-100 (4%/50ºC/4h. ELISA-IgM using individually or pool of non treated antigens proved to be reliable with high sensitivity and should be used for an earlier diagnosis of leptospirosis, as a trial test. Faster diagnostic elucidation can be useful to detect

  16. SOROPREVALÊNCIA DE ANTICORPOS ANTI-Neospora caninum E ANTI-Leptospira interrogans EM DUAS PROPRIEDADES DE VACAS LEITEIRAS COM RELATOS DE PREJUÍZOS REPRODUTIVOS NOMUNICÍPIO DE GOIANDIRA, GOIÁS

    Directory of Open Access Journals (Sweden)

    Rafael Quirino Moreira

    2010-06-01

    Full Text Available The aim of this study was to determine the seroprevalence ofantibodies anti-Neospora caninum and anti-Leptospira interrogansin dairy cows from Goiandira, Goiás State, Brazil. Serum samplesof 53 dairy cows from two herds were assayed for anti-N. caninumantibodies using an indirect immunofluorescent antibody test (IFATand microscopic-agglutination technique (MAT for L. interrogansagglutinins. Sera reacting at dilutions ≥ 1:50 and ≥ 1:100 wereconsidered positive for N. caninum and L. interrogans antibodiesrespectively. It was found that 35.9% (14 cows of the samplesfrom Farm 1 and 64.3% (9 cows from Farm 2 were positive forN. caninum. For L. interrogans, 87.2% (34 cows from Farm 1 and64.3% (9 cows from Farm 2 were positive. The serovars foundedwere: wolffi (21.74%; hardjo (18.11%; bratislava (14.49%;australis (12.32%; tarassovi (12.32%; icterohaemorrhagiae(7.25%; sentot (5.80%, grippotyphosa (5.07%; patoc (2.17%;cynoptero (0.72%. According to the results, it was possible toconclude that neosporosis and leptospirosis are endemic in dairycows and may also be a significant animal and human healthproblem in Goiandira, GO, Brazil.

  17. Reporte histórico: Primer Aislamiento de Vibrio cholera serogrupo O1 biovar El Tor serovar Inaba durante la epidemia de cólera en el Perú ‑ 1991 Historical report: first isolation of Vibrio cholera serogroup O1 biovar El Tor serovar Inaba during the cholerae epidemic in Perú ‑ 1991

    Directory of Open Access Journals (Sweden)

    Nora Bravo Cruz

    2011-03-01

    Full Text Available Hace 20 años apareció una enfermedad diarreica nueva en el Perú y el Laboratorio de Referencia de Enteropatógenos del Instituto Nacional de Salud, cumplió una labor destacada en el aislamiento e identificación rápida y oportuna del Vibrio cholerae. La enfermedad del cólera no se había presentado anteriormente, pero en la última semana de enero de 1991 se detectó un brote epidémico de diarrea aguda con deshidratación intensa y algunos casos de fallecidos. La epidemia afectó, al comienzo, varias localidades del litoral peruano. Equipos de trabajo de la Oficina General de Epidemiología y de los laboratorios del Instituto Nacional de Salud obtuvieron muestras fecales de pacientes con diarrea aguda procedentes de las ciudades de Chancay, Chimbote, Piura y algunos hospitales de Lima. Las muestras colectadas en el medio de transporte de Cary y Blair fueron procesadas en el Laboratorio Nacional de Referencia de Enteropatógenos (LANARE del Instituto Nacional de Salud. De todas las muestras se aisló e identificó Vibrio cholerae serogrupo O1 biovar El Tor serovar Inaba que mostró ser sensible a la tetraciclina y a otros antibióticos. Esta investigación confirmó el primer brote epidémico de cólera en el Perú.20 years ago, a new diarrheal disease was introduced in Peru and the Enteropathogens Reference Laboratory of the Instituto Nacional de Salud had an outstanding role in the isolation and rapid and timely identification of Vibrio cholerae. Cholera had not been seen before, but during the last week of January 1991 an outbreak of acute diarrhea was detected, presenting intense dehydration and some deaths. The epidemic affected, in the beginning, many locations of the peruvian coast. Some working teams of the General Office of Epidemiology and of the Instituto Nacional de Salud obtained fecal samples from patients with acute diarrhea coming from the cities of Chancay, Chimbote, Piura and some hospitals in Lima. The collected samples

  18. Infecção experimental em suínos jovens com Leptospira interrogans sorovar wolffi: determinação de parâmetros bioquímicos Experimental infection by Leptospira interrogans serovar wolffi in young pigs: determination of biochemical parameters

    Directory of Open Access Journals (Sweden)

    José Carlos Rende

    2007-04-01

    Full Text Available Um estudo sobre infecção experimental foi realizado em oito suínos, com idade média de 90 dias, machos castrados, da raça Wessex, e distribuídos em dois grupos de quatro suínos cada. Durante 36 dias, foram analisadas as alterações bioquímicas nos soros dos suínos dos dois grupos. O Grupo I foi mantido como testemunho e recebeu 5,0mL de solução fisiológica estéril por via intravenosa (veia cava craniana e, no Grupo II, os suínos foram inoculados pela mesma via com 5,0mL de cultura de Leptospira interrogans sorovar wolffi , amostra L-10 selvagem isolada de tatu (Dasypus novemcinctus, contendo 1,0 x 10(8 leptospiras/mL. A partir do terceiro dia após a inoculação e em intervalos de 72 horas até o décimo oitavo dia, foram feitas coletas de sangue, sem anticoagulante, dos animais inoculados e testemunhas. Os parâmetros bioquímicos analisados foram: bilirrubina total, direta e indireta, ácidos graxos, glicose e proteínas plasmáticas. Foi detectado um aumento da bilirrubina direta no terceiro dia e um aumento no sexto dia da bilirrubina total e indireta após a inoculação. As dosagens de glicose, ácidos graxos e proteínas plasmáticas apresentaram uma diminuição a partir do terceiro dia da inoculação. Com os resultados obtidos, pode-se concluir que o aumento das taxas de bilirrubinas levam a uma definição de um diagnóstico de hemólise aguda, e que a hipoglicemia, a hipolipidemia e a hipoproteinemia podem estar relacionadas com lesões hepáticas e a uma septcemia.Todas as dosagens em todos os animais retornaram aos seus valores normais a partir do décimo quinto dia.Eight, 90 days old pigs, of the Wessex lineage all castrated male were used in experiment, divided into two groups of four animals. Biochemical alterations in the serum of the animals were analyzed in both groups during 36 days. Control (Group I received 5.0mL of a 0.9% sterile sodium chloride solution by intracranial vein injection; Group II animals

  19. Safety and efficacy of a new octavalent combined Erysipelas, Parvo and Leptospira vaccine in gilts against Leptospira interrogans serovar Pomona associated disease and foetal death.

    Science.gov (United States)

    Jacobs, A A C; Harks, F; Hoeijmakers, M; Collell, M; Segers, R P A M

    2015-07-31

    The safety and protective efficacy of a new octavalent combination vaccine containing inactivated Erysipelothrix rhusiopathiae, Parvovirus, and Leptospira interrogans (sensu lato) serogroups Canicola, Icterohaemorrhagiae, Australis (Bratislava), Grippotyphosa, Pomona and Tarassovi - Porcilis(®) Ery+Parvo+Lepto - was evaluated in laboratory studies and under field conditions. The safety (2× overdose and repeated dose) was tested in 26 gilts. In this study, neither vaccine related temperature increase nor other systemic reactions were observed after intramuscular vaccination. No local reactions were observed except for one animal that had a small local reaction (2cm diameter) that lasted for 5 days after the third vaccination. Efficacy was tested in 40 gilts. A group of 20 gilts was vaccinated at 20 and 24 weeks of age with Porcilis(®) Ery+Parvo+Lepto and a group of 20 age- and source-matched animals served as the control group. The gilts were inseminated at 41 weeks or 66 weeks of age and were challenged with serovar Pomona 10 weeks after insemination, corresponding to 6 months (n=2×10) and 12 months (n=2×10) after the last vaccination. After both the 6- and 12-month challenges the control animals developed clinical signs (fever, lethargy and anorexia) and leptospiraemia as determined by positive blood culture. In addition, both the 6- and 12-month challenges resulted in death of 21% and 27% of the total number of foetuses in the control groups, respectively. Clinical signs and leptospiraemia were statistically significantly lower in vaccinated gilts after both the 6- and 12-month challenges. In addition, foetal death was statistically significantly lower (3% and 2%, respectively) in vaccinated gilts after both the 6- and 12 month challenges. The vaccine was tested further under field conditions on a Portuguese farm with a history of an increasing abortion rate associated with a Leptospira serovar Pomona infection (confirmed by PCR and serology). This study was

  20. Detection of leptospires in clinically healthy piglets born from sows experimentally infected with Leptospira interrogans serovar Canicola Detecção de leptospiras em leitões clinicamente saudáveis nascidos de matrizes infectadas experimentalmente com Leptospira interrogans sorovar Canicola

    Directory of Open Access Journals (Sweden)

    Francisco Rafael M. Soto

    2006-12-01

    Full Text Available Leptospirosis is an important zoonosis that causes reproductive disorders in swine. The isolation of leptospires from aborted fetuses, stillbirths and weak piglets was obtained in several occasions, however, the bacteria was never isolated from apparently healthy piglets born from apparently healthy infected dams. Six sows of the Landrace breed with a known date of service and pregnancy confirmed by ultrasonography were infected intravenously with 5ml of Leptospira interrogans serovar Canicola inoculum between 76 and 90 days of gestation, and one week after farrowing, at least one piglet per sow was euthanized and samples of liver, kidneys, lungs, heart, spleen and gastric content were taken and examined by PCR. Reproductive disorders or any clinical sign of infection were not observed in the inoculated sows. The piglets born from these animals presented no clinical signs or macroscopic lesions that could be attributed to leptospirosis. All inoculated sows presented anti-leptospires antibodies by microscopic serum-agglutination test (MAT in the postinoculation serum samples and leptospires were not found in the urine as well as were not detected by PCR applied in this material, however, PCR accomplished in kidneys and liver from a euthanized sow presented positive results. Of the total of 12 euthanized piglets, 10 (83.3% presented positive results by PCR in at least one of the kidney, liver, heart, spleen, lung and gastric content samples. The present study reports the vertical transmission of the infection and the detection of leptospires in clinically healthy piglets born from experimentally infected sows, which is important of the epidemiological point of view as the maintenance of clinically healthy infected animals may allow the persistence of the bacteria in the herd, exposing other animals to the risk of infection.A Leptospirose é uma importante zoonose que causa transtornos reprodutivos em suínos. O isolamento de leptospiras de fetos

  1. Plasmin cleaves fibrinogen and the human complement proteins C3b and C5 in the presence of Leptospira interrogans proteins: A new role of LigA and LigB in invasion and complement immune evasion.

    Science.gov (United States)

    Castiblanco-Valencia, Mónica Marcela; Fraga, Tatiana Rodrigues; Pagotto, Ana Helena; Serrano, Solange Maria de Toledo; Abreu, Patricia Antonia Estima; Barbosa, Angela Silva; Isaac, Lourdes

    2016-05-01

    Plasminogen is a single-chain glycoprotein found in human plasma as the inactive precursor of plasmin. When converted to proteolytically active plasmin, plasmin(ogen) regulates both complement and coagulation cascades, thus representing an important target for pathogenic microorganisms. Leptospira interrogans binds plasminogen, which is converted to active plasmin. Leptospiral immunoglobulin-like (Lig) proteins are surface exposed molecules that interact with extracellular matrix components and complement regulators, including proteins of the FH family and C4BP. In this work, we demonstrate that these multifunctional molecules also bind plasminogen through both N- and C-terminal domains. These interactions are dependent on lysine residues and are affected by ionic strength. Competition assays suggest that plasminogen does not share binding sites with C4BP or FH on Lig proteins at physiological molar ratios. Plasminogen bound to Lig proteins is converted to proteolytic active plasmin in the presence of urokinase-type plasminogen activator (uPA). Lig-bound plasmin is able to cleave the physiological substrates fibrinogen and the complement proteins C3b and C5. Taken together, our data point to a new role of LigA and LigB in leptospiral invasion and complement immune evasion. Plasmin(ogen) acquisition by these versatile proteins may contribute to Leptospira infection, favoring bacterial survival and dissemination inside the host. Copyright © 2016. Published by Elsevier GmbH.

  2. Control of Gene Expression in Leptospira spp. by Transcription Activator-Like Effectors Demonstrates a Potential Role for LigA and LigB in Leptospira interrogans Virulence.

    Science.gov (United States)

    Pappas, Christopher J; Picardeau, Mathieu

    2015-11-01

    Leptospirosis is a zoonotic disease that affects ∼1 million people annually, with a mortality rate of >10%. Currently, there is an absence of effective genetic manipulation tools for targeted mutagenesis in pathogenic leptospires. Transcription activator-like effectors (TALEs) are a recently described group of repressors that modify transcriptional activity in prokaryotic and eukaryotic cells by directly binding to a targeted sequence within the host genome. To determine the applicability of TALEs within Leptospira spp., two TALE constructs were designed. First, a constitutively expressed TALE gene specific for the lacO-like region upstream of bgaL was trans inserted in the saprophyte Leptospira biflexa (the TALEβgal strain). Reverse transcriptase PCR (RT-PCR) analysis and enzymatic assays demonstrated that BgaL was not expressed in the TALEβgal strain. Second, to study the role of LigA and LigB in pathogenesis, a constitutively expressed TALE gene with specificity for the homologous promoter regions of ligA and ligB was cis inserted into the pathogen Leptospira interrogans (TALElig). LigA and LigB expression was studied by using three independent clones: TALElig1, TALElig2, and TALElig3. Immunoblot analysis of osmotically induced TALElig clones demonstrated 2- to 9-fold reductions in the expression levels of LigA and LigB, with the highest reductions being noted for TALElig1 and TALElig2, which were avirulent in vivo and nonrecoverable from animal tissues. This study reconfirms galactosidase activity in the saprophyte and suggests a role for LigA and LigB in pathogenesis. Collectively, this study demonstrates that TALEs are effective at reducing the expression of targeted genes within saprophytic and pathogenic strains of Leptospira spp., providing an additional genetic manipulation tool for this genus. Copyright © 2015, American Society for Microbiology. All Rights Reserved.

  3. Comparison between generalized linear modelling and additive Bayesian network; identification of factors associated with the incidence of antibodies against Leptospira interrogans sv Pomona in meat workers in New Zealand.

    Science.gov (United States)

    Pittavino, M; Dreyfus, A; Heuer, C; Benschop, J; Wilson, P; Collins-Emerson, J; Torgerson, P R; Furrer, R

    2017-09-01

    Additive Bayesian Network (ABN) is a graphical model which extends Generalized Linear Modelling (GLM) to multiple dependent variables. The present study compares results from GLM with those from ABN analysis used to identify factors associated with Leptospira interrogans sv Pomona (Pomona) infection by exploring the advantages and disadvantages of these two methodologies, to corroborate inferences informing health and safety measures at abattoirs in New Zealand (NZ). In a cohort study in four sheep slaughtering abattoirs in NZ, sera were collected twice a year from 384 meat workers and tested by Microscopic Agglutination with a 91% sensitivity and 94% specificity for Pomona. The study primarily addressed the effect of work position, personal protective equipment (PPE) and non-work related exposures such as hunting on a new infection with Pomona. Significantly associated with Pomona were "Work position" and two "Abattoirs" (GLM), and "Work position" (ABN). The odds of Pomona infection (OR, [95% CI]) was highest at stunning and hide removal (ABN 41.0, [6.9-1044.2]; GLM 57.0, [6.9-473.3]), followed by removal of intestines, bladder, and kidneys (ABN 30.7, [4.9-788.4]; GLM 33.8, [4.2-271.1]). Wearing a facemask, glasses or gloves (PPE) did not result as a protective factor in GLM or ABN. The odds of Pomona infection was highest at stunning and hide removal. PPE did not show any indication of being protective in GLM or ABN. In ABN all relationships between variables are modelled; hence it has an advantage over GLM due to its capacity to capture the natural complexity of data more effectively. Copyright © 2017 The Authors. Published by Elsevier B.V. All rights reserved.

  4. Resposta humoral, recuperação bacteriana e lesões histológicas em camundongos geneticamente selecionados para bons e maus produtores de anticorpos e Balb/c, frente à infecção por Leptospira interrogans sorovar icterohaemorrhagiae Humoral immune response, bacterial recovery and time lesions in mice geneticaly selected for high and low antibody production and in outbreed Balb/c mice face to Leptospira interrogans sorovar icterohaemorrhagiae

    Directory of Open Access Journals (Sweden)

    Márcia Marinho

    2003-01-01

    Full Text Available O presente trabalho teve por finalidade associar a cinética da resposta humoral à recuperação de leptospiras viáveis e à intensidade das lesões teciduais em camundongos geneticamente selecionados para bons (High e maus (Low produtores de anticorpos (seleção IV-A, além de camundongos outbreed, Balb/c, inoculados com amostra patogênica de Leptospira interrogans sorovar icterohaemorrhagiae. As linhagens High e Low (seleção IV-A apresentam modificações em alguns compartimentos da resposta imune, principalmente em relação à atividade macrofágica, representando fenótipos extremos encontrados em populações naturais heterogêneas. Os camundongos foram sacrificados em oito momentos após a infecção. A análise dos resultados revelou que a partir do 7º dia após a infecção, os camundongos da linhagem High apresentaram elevação nos títulos de anticorpos estatisticamente significantes quando comparados aos camundongos da linhagem Low, mantendo assim o efeito multiespecífico. Os camundongos Balb/c apresentaram resultados intermediários entre as duas linhagens. A produção de anticorpos colaborou como fator limitante à infecção, pois quando obteve-se maior recuperação de leptospiras, na fase inicial da infecção, os títulos de anticorpos encontravam-se em elevação. As lesões observadas nos órgãos de camundongos infectados consistiram basicamente nos mesmos processos inflamatórios e degenerativos, que não se alteraram, variando apenas o grau de comprometimento tecidual, de acordo com a linhagem. A linhagem high apresentou lesões mais extensas que as apresentadas pelas linhagens low e Balb/c, sendo que nesta última as lesões foram moderadas. De forma geral a linhagem High e Balb/c apresentaram um perfil de resposta Th2, com o maior índice de produção de anticorpos e gravidade das lesões, enquanto a linhagem Low apresentou um perfil de resposta Th1.The aim of the present work was to evaluate the association

  5. Respuesta inmune mucosal inducida por proteoliposoma y cocleato derivados de N. meningitidis serogrupo B

    Directory of Open Access Journals (Sweden)

    Judith del Campo

    2009-08-01

    Full Text Available Mucosal vaccination offers attractive advantages to conventional systemic vaccination. Most pathogens enter or establish infection at mucosal surfaces. This represents an enormous challenge for vaccine development. Nevertheless, the availability of safe and effective adjuvants that function mucosally is the major limitation. Therefore, we investigated the impact of mucosal immunization with the Neisseria meningitidis B proteoliposome (AFPL1, Adjuvant Finlay Proteoliposome 1 and its-derived cochleate (Co, AFCo1. They contain multiple PAMPs as immunopotentiators and have delivery system ability as well as Th1 polarization activity. Groups of female mice were immunized by nasal, oral, intravaginal, or intramuscular routes with three doses with AFPL1/AFCo1 alone or containing ovalbumin or glycoprotein (g D2 from Herpes Simplex Virus type 2 (HSV-2. High levels of specific IgG antibodies were detected in sera of mice vaccinated with either route. However, specific IgA antibodies were produced in saliva and vaginal wash only following mucosal delivering. The polarization to a Th1 pattern was confirmed by testing the induction of IgG2a/IgG2c antibody, positive delayed-type hypersensitivity reactions, and gIFN production. Additionally, AFCo1gD2 showed practically no vaginal HSV-2 replication and 100% protection against lethal vaginal HSV-2 challenge. In conclusion, the results support the use of AFCo1 as potent Th1 adjuvant for mucosal vaccines, particularly for nasal route.

  6. First Isolates of Leptospira spp., from Rodents Captured in Angola

    Science.gov (United States)

    Fortes-Gabriel, Elsa; Carreira, Teresa; Vieira, Maria Luísa

    2016-01-01

    Rodents play an important role in the transmission of pathogenic Leptospira spp. However, in Angola, neither the natural reservoirs of these spirochetes nor leptospirosis diagnosis has been considered. Regarding this gap, we captured rodents in Luanda and Huambo provinces to identify circulating Leptospira spp. Rodent kidney tissue was cultured and DNA amplified and sequenced. Culture isolates were evaluated for pathogenic status and typing with rabbit antisera; polymerase chain reaction (PCR) and sequencing were also performed. A total of 37 rodents were captured: Rattus rattus (15, 40.5%), Rattus norvegicus (9, 24.3%), and Mus musculus (13, 35.2%). Leptospiral DNA was amplified in eight (21.6%) kidney samples. From the cultures, we obtained four (10.8%) Leptospira isolates belonging to the Icterohaemorrhagiae and Ballum serogroups of Leptospira interrogans and Leptospira borgpetersenii genospecies, respectively. This study provides information about circulating leptospires spread by rats and mice in Angola. PMID:26928840

  7. Descripción de un brote de leptospirosis en la ciudad de Santa Fe, Argentina, marzo-abril de 1998 Description of a leptospirosis outbreak in the city of Santa Fe, Argentina, March-April 1998

    Directory of Open Access Journals (Sweden)

    Norma B. Vanasco

    2000-01-01

    Full Text Available En marzo-abril de 1998 se identificó en un barrio de la ciudad de Santa Fe (Argentina un brote de una enfermedad aguda caracterizada por fiebre, cefaleas y mialgias intensas. Se presentan los estudios realizados en relación con este brote y los intentos de identificación de la fuente y del modo de transmisión. Los hallazgos epidemiológicos, serológicos y clínicos indicaron que el agente causal fue Leptospira interrogans. Como prueba de tamizaje se aplicó la técnica de aglutinación macroscópica con antígeno termorresistente, seguida de la prueba de ELISA y, como prueba de confirmación, la aglutinación microscópica frente a 10 serovariedades de L. interrogans. Se estudiaron 32 individuos, 8 perros y 8 muestras de agua. Se registraron 12 casos confirmados, 2 probables y 18 negativos. En seis perros se demostró la existencia de infección y en las muestras de agua se detectó la presencia de espiroquetas móviles. Los sueros humanos reaccionaron con las serovariedades ballum, canicola, icterohaemorrhagiae y pyrogenes, y los caninos con ballum, canicola y pomona. La coaglutinación observada en todos los casos confirmados indica que se trató de casos agudos de leptospirosis, pero no permite identificar la serovariedad causal. Salvo en el caso índice, no se reconoció clínicamente la enfermedad. Varios hechos sugieren que la causa del brote fue la inundación pluvial de la zona estudiada. Los resultados de este estudio resaltan la necesidad de una vigilancia activa de la leptospirosis ante desastres naturales como las inundaciones.In March-April 1998 in a neighborhood in the city of Santa Fe, Argentina, there was an outbreak of an acute disease characterized by fever, headaches, and intense myalgias. This article presents the studies surrounding this outbreak and the attempts to identify the source and the mode of transmission. The epidemiological, serological, and clinical findings indicated that the causative agent was Leptospira

  8. First Isolates of Leptospira spp., from Rodents Captured in Angola.

    Science.gov (United States)

    Fortes-Gabriel, Elsa; Carreira, Teresa; Vieira, Maria Luísa

    2016-05-04

    Rodents play an important role in the transmission of pathogenic Leptospira spp. However, in Angola, neither the natural reservoirs of these spirochetes nor leptospirosis diagnosis has been considered. Regarding this gap, we captured rodents in Luanda and Huambo provinces to identify circulating Leptospira spp. Rodent kidney tissue was cultured and DNA amplified and sequenced. Culture isolates were evaluated for pathogenic status and typing with rabbit antisera; polymerase chain reaction (PCR) and sequencing were also performed. A total of 37 rodents were captured: Rattus rattus (15, 40.5%), Rattus norvegicus (9, 24.3%), and Mus musculus (13, 35.2%). Leptospiral DNA was amplified in eight (21.6%) kidney samples. From the cultures, we obtained four (10.8%) Leptospira isolates belonging to the Icterohaemorrhagiae and Ballum serogroups of Leptospira interrogans and Leptospira borgpetersenii genospecies, respectively. This study provides information about circulating leptospires spread by rats and mice in Angola. © The American Society of Tropical Medicine and Hygiene.

  9. Transcriptional Response of Leptospira interrogans to Different Iron Sources

    Science.gov (United States)

    Leptospirosis is a globally important zoonotic disease. Humans can become infected via exposure to infected animals or contaminated water or soil. Iron is an essential element for many cellular processes and its sequestration in the host environment constitutes an immune defence mechanism. Pathoge...

  10. Distribution of Plasmids in Distinct Leptospira Pathogenic Species.

    Directory of Open Access Journals (Sweden)

    Yanzhuo Wang

    2015-11-01

    Full Text Available Leptospirosis, caused by pathogenic Leptospira, is a worldwide zoonotic infection. The genus Leptospira includes at least 21 species clustered into three groups--pathogens, non-pathogens, and intermediates--based on 16S rRNA phylogeny. Research on Leptospira is difficult due to slow growth and poor transformability of the pathogens. Recent identification of extrachromosomal elements besides the two chromosomes in L. interrogans has provided new insight into genome complexity of the genus Leptospira. The large size, low copy number, and high similarity of the sequence of these extrachromosomal elements with the chromosomes present challenges in isolating and detecting them without careful genome assembly. In this study, two extrachromosomal elements were identified in L. borgpetersenii serovar Ballum strain 56604 through whole genome assembly combined with S1 nuclease digestion following pulsed-field gel electrophoresis (S1-PFGE analysis. Further, extrachromosomal elements in additional 15 Chinese epidemic strains of Leptospira, comprising L. borgpetersenii, L. weilii, and L. interrogans, were successfully separated and identified, independent of genome sequence data. Southern blot hybridization with extrachromosomal element-specific probes, designated as lcp1, lcp2 and lcp3-rep, further confirmed their occurrences as extrachromosomal elements. In total, 24 plasmids were detected in 13 out of 15 tested strains, among which 11 can hybridize with the lcp1-rep probe and 11 with the lcp2-rep probe, whereas two can hybridize with the lcp3-rep probe. None of them are likely to be species-specific. Blastp search of the lcp1, lcp2, and lcp3-rep genes with a nonredundant protein database of Leptospira species genomes showed that their homologous sequences are widely distributed among clades of pathogens but not non-pathogens or intermediates. These results suggest that the plasmids are widely distributed in Leptospira species, and further elucidation of

  11. Distribution of Plasmids in Distinct Leptospira Pathogenic Species.

    Science.gov (United States)

    Wang, Yanzhuo; Zhuang, Xuran; Zhong, Yi; Zhang, Cuicai; Zhang, Yan; Zeng, Lingbing; Zhu, Yongzhang; He, Ping; Dong, Ke; Pal, Utpal; Guo, Xiaokui; Qin, Jinhong

    2015-11-01

    Leptospirosis, caused by pathogenic Leptospira, is a worldwide zoonotic infection. The genus Leptospira includes at least 21 species clustered into three groups--pathogens, non-pathogens, and intermediates--based on 16S rRNA phylogeny. Research on Leptospira is difficult due to slow growth and poor transformability of the pathogens. Recent identification of extrachromosomal elements besides the two chromosomes in L. interrogans has provided new insight into genome complexity of the genus Leptospira. The large size, low copy number, and high similarity of the sequence of these extrachromosomal elements with the chromosomes present challenges in isolating and detecting them without careful genome assembly. In this study, two extrachromosomal elements were identified in L. borgpetersenii serovar Ballum strain 56604 through whole genome assembly combined with S1 nuclease digestion following pulsed-field gel electrophoresis (S1-PFGE) analysis. Further, extrachromosomal elements in additional 15 Chinese epidemic strains of Leptospira, comprising L. borgpetersenii, L. weilii, and L. interrogans, were successfully separated and identified, independent of genome sequence data. Southern blot hybridization with extrachromosomal element-specific probes, designated as lcp1, lcp2 and lcp3-rep, further confirmed their occurrences as extrachromosomal elements. In total, 24 plasmids were detected in 13 out of 15 tested strains, among which 11 can hybridize with the lcp1-rep probe and 11 with the lcp2-rep probe, whereas two can hybridize with the lcp3-rep probe. None of them are likely to be species-specific. Blastp search of the lcp1, lcp2, and lcp3-rep genes with a nonredundant protein database of Leptospira species genomes showed that their homologous sequences are widely distributed among clades of pathogens but not non-pathogens or intermediates. These results suggest that the plasmids are widely distributed in Leptospira species, and further elucidation of their biological

  12. Ecology of Vibrio cholerae serogroup 01 in aquatic environments La ecología de Vibrio cholerae serogrupo 01 en ambientes acúaticos

    OpenAIRE

    René J. Borroto

    1997-01-01

    The endemic and seasonal nature of cholera depends upon the survival of Vibrio cholerae 01 in a viable but not necessarily culturable state in ecologic niches in aquatic environments during interepidemic periods. To understand the ecology of V. cholerae it is necessary to know which aquatic ecosystems can harbor it and thus contribute to the endemic presence of cholera in Latin America. This article summarizes knowledge about the ecology of V. cholerae 01, specifically, the abiotic and biotic...

  13. Caracterización fenotípica y genotípica de aislamientos de Neisseria meningitidis, serogrupo B, procedentes de Cartagena, Colombia, 2012-2014

    Directory of Open Access Journals (Sweden)

    Jaime Moreno

    2015-03-01

    Conclusión. La caracterización clínica, epidemiológica y molecular de los aislamientos causantes de enfermedad meningocócica es necesaria para el conocimiento de la propagación de clones virulentos y facilita la detección temprana de casos, lo que reduce los riesgos de epidemia.

  14. Exposure to selected Pathogens in to selected pathogens in Geoffroy's cats and domestic carnivores from central Argentina.

    Science.gov (United States)

    Uhart, Marcela M; Rago, M Virginia; Marull, Carolina A; Ferreyra, Hebe del Valle; Pereira, Javier A

    2012-10-01

    Wild carnivores share a high percentage of parasites and viruses with closely related domestic carnivores. Because of increased overlap and potential contact with domestic species, we conducted a retrospective serosurvey for 11 common carnivore pathogens in 40 Geoffroy's cats (Leopardus geoffroyi) sampled between 2000 and 2008 within or near two protected areas in central Argentina (Lihué Calel National Park, La Pampa, and Campos del Tuyú National Park, Buenos Aires), as well as five domestic cats and 11 domestic dogs from catde ranches adjacent to Lihué Calel Park. Geoffroy's cats had detectable antibody to canine distemper virus (CDV), feline calicivirus (FCV), feline coronavirus, feline panleukopenia virus (FPV), Toxoplasma gondii, Leptospira interrogans (serovars Ictero/Icter and Ballum), and Dirofilaria immitis. None of the wild cats had antibodies to feline herpesvirus, feline immunodeficiency virus (FIV), feline leukemia virus, or rabies virus. Domestic dogs had antibodies to CDV, canine adenovirus, canine herpesvirus, and canine parvovirus. Antibodies to FPV, FCV, FIV, and T. gondii were found in domestic cats. We provide the first data on exposure of free-ranging Geoffroy's cats to pathogens at two sites within the core area of the species distribution range, including the first report of antibodies to CDV in this species. We encourage continued monitoring for diseases in wild and domestic carnivores as well as preventive health care for domestic animals, particularly in park buffer zones where overlap is greatest.

  15. Using a top predator as a sentinel for environmental contamination with pathogenic bacteria: the Iberian wolf and leptospires.

    Science.gov (United States)

    Millán, Javier; García, Emilio J; Oleaga, Álvaro; López-Bao, José Vicente; Llaneza, Luis; Palacios, Vicente; Candela, Mónica G; Cevidanes, Aitor; Rodríguez, Alejandro; León-Vizcaíno, Luis

    2014-12-01

    The Iberian wolf (Canis lupus) is the top predator in the Iberian environments in which it lives, feeding on a wide range of species, thus encountering a wide range of disease agents. Therefore, the wolf can serve as sentinel of environmental contamination with pathogens. We investigated the exposure of free-living wolves to 14 serovars of Leptospira interrogans sensu lato. Kidney samples from 49 wolves collected from 2010-2013 in northwestern Spain were analysed by culture, direct immunofluorescence and polymerase chain reaction. Tissue fluids were analysed for antibodies by a microscopic agglutination test. Ten wolves (observed prevalence: 20%, 95% confidence interval = 11-33%) showed evidence of contact with leptospires, eight through direct detection and nine through serology (7 wolves were positive according to both techniques). Titres below the cut-off level were also detected in seven cases. Serovars confirmed were Canicola (n = 4), Icterohaemorrhagiae (n = 3) and Sejroë, Ballum and Grippotyphosa (n = 1 each), indicating that wolves were infected with serovars for which dogs, rodents and ungulates, are the natural hosts and supporting the utility of the wolf and other large predators as environmental sentinels for pathogens.

  16. Using a top predator as a sentinel for environmental contamination with pathogenic bacteria: the Iberian wolf and leptospires

    Directory of Open Access Journals (Sweden)

    Javier Millán

    2014-12-01

    Full Text Available The Iberian wolf (Canis lupus is the top predator in the Iberian environments in which it lives, feeding on a wide range of species, thus encountering a wide range of disease agents. Therefore, the wolf can serve as sentinel of environmental contamination with pathogens. We investigated the exposure of free-living wolves to 14 serovars of Leptospira interrogans sensu lato. Kidney samples from 49 wolves collected from 2010-2013 in northwestern Spain were analysed by culture, direct immunofluorescence and polymerase chain reaction. Tissue fluids were analysed for antibodies by a microscopic agglutination test. Ten wolves (observed prevalence: 20%, 95% confidence interval = 11-33% showed evidence of contact with leptospires, eight through direct detection and nine through serology (7 wolves were positive according to both techniques. Titres below the cut-off level were also detected in seven cases. Serovars confirmed were Canicola (n = 4, Icterohaemorrhagiae (n = 3 and Sejroë, Ballum and Grippotyphosa (n = 1 each, indicating that wolves were infected with serovars for which dogs, rodents and ungulates, are the natural hosts and supporting the utility of the wolf and other large predators as environmental sentinels for pathogens.

  17. Comparison of the effects of UV-A radiation on Leptospira interrogan ...

    African Journals Online (AJOL)

    ... self-defense from taking place. UV-A radiation's effect on antigenic components was also investigated. The immunoblotting method was used and the results are supported by scanning electron microscopy (SEM) and transmission electron microscopy (TEM) results. Possible explanations for these results are discussed.

  18. Antimicrobial drug susceptibility of Leptospira interrogans serovar hardjo isolated from cattle.

    Science.gov (United States)

    Prescott, J F; Nicholson, V M

    1988-01-01

    The susceptibility to commonly used drugs of 18 isolates of Leptospira hardjo from the kidneys of feedlot cattle from different sources was determined quantitatively. All isolates were susceptible to penicillin G, ampicillin, tetracycline, erythromycin and streptomycin. Susceptibility to sulphamethazine was ambiguous. No drug resistance was detected and the results were similar to those described for other serovars. PMID:3370565

  19. Post-translational modification of LipL32 during Leptospira interrogans infection

    Science.gov (United States)

    Leptospirosis, a re-emerging disease of global importance caused by pathogenic Leptospira spp., is considered the world’s most widespread zoonotic disease. Rats serve as asymptomatic carriers of pathogenic Leptospira and are critical for disease spread. In such reservoir hosts, leptospires colonize ...

  20. Asymptomatic and chronic carriage of Leptospira interrogans serovar Pomona in California sea lions (Zalophus californianus)

    Science.gov (United States)

    Since 1970, periodic outbreaks of leptospirosis, caused by pathogenic spirochetes in the genus Leptospira, have caused morbidity and mortality of California sea lions (Zalophus californianus) along the Pacific coast of North America. Yearly seasonal epizootics of varying magnitude occur between the ...

  1. Interaction of Leptospira interrogans with Human Proteolytic Systems Enhances Dissemination through Endothelial Cells and Protease Levels

    Science.gov (United States)

    Vieira, Monica L.; Alvarez-Flores, Miryam P.; Kirchgatter, Karin; Romero, Eliete C.; Alves, Ivy J.; de Morais, Zenaide M.; Vasconcellos, Silvio A.; Chudzinski-Tavassi, Ana M.

    2013-01-01

    We have recently reported the ability of Leptospira to capture plasminogen (PLG) and generate plasmin (PLA) bound on the microbial surface in the presence of exogenous activators. In this work, we examined the effects of leptospiral PLG binding for active penetration through the endothelial cell barrier and activation. The results indicate that leptospires with PLG association or PLA activation have enhanced migration activity through human umbilical vein endothelial cell (HUVEC) monolayers compared with untreated bacteria. Leptospira cells coated with PLG were capable of stimulating the expression of PLG activators by HUVECs. Moreover, leptospires endowed with PLG or PLA promoted transcriptional upregulation matrix metalloprotease 9 (MMP-9). Serum samples from patients with confirmed leptospirosis showed higher levels of PLG activators and total MMP-9 than serum samples from normal (healthy) subjects. The highest level of PLG activators and total MMP-9 was detected with microscopic agglutination test (MAT)-negative serum samples, suggesting that this proteolytic activity stimulation occurs at the early stage of the disease. Furthermore, a gelatin zymography profile obtained for MMPs with serum samples from patients with leptospirosis appears to be specific to leptospiral infection because serum samples from patients with unrelated infectious diseases produced no similar degradation bands. Altogether, the data suggest that the Leptospira-associated PLG or PLA might represent a mechanism that contributes to bacterial penetration of endothelial cells through an activation cascade of events that enhances the proteolytic capability of the organism. To our knowledge, this is the first proteolytic activity associated with leptospiral pathogenesis described to date. PMID:23478319

  2. Reporte de insuficiencia renal producida por Leptospira Interrogans Serovar Pomona en Colombia

    OpenAIRE

    Fortunato Ospino; Ligia Sedano de León; Manuel Isaac Gallego

    1988-01-01

    Se describe la presentación de un caso de leptospirosis producida por L. pomona en un paciente de 20 años de edad, trabajadora habitual en un molino de arroz y caracterizado por un síndrome de insuficiencia renal y hepática. El cuadro clínico consistió principalmente en malestar general, anorexia, vómito, fiebre, diarrea, ictericia y hemorragias subconjuntivales. Los exámenes de laboratorio mostraron alteraciones, en los niveles de nitrógeno ureico, creatinina, depuración de creatinina, conce...

  3. Protein LIC10494 of Leptospira interrogans serovar Copenhageni: structural model and associated functional regions.

    OpenAIRE

    Barreto, Leidy Viviana; Departamento de Nutrición y Bioquímica, Facultad de Ciencias, Pontificia Universidad Javeriana, Bogotá D.C., Colombia; Barreto, George Emílio; Departamento de Nutrición y Bioquímica, Facultad de Ciencias, Pontificia Universidad Javeriana, Bogotá D.C., Colombia; Morales, Ludis; Departamento de Nutrición y Bioquímica, Facultad de Ciencias, Pontificia Universidad Javeriana, Bogotá D.C., Colombia; Acevedo, Orlando Emilio; Departamento de Física, Facultad de Ciencias, Pontificia Universidad Javeriana, Bogotá D.C., Colombia; González Santos, Janneth

    2012-01-01

    Objective. Predict by computational means the 3D structure of the antigenic protein LIC10494 and report associated important functional regions for its pathogenicity and immunogenicity. Materials and methods. We performed a computational analysis of the primary structure of LIC10494 using the servers BLAST, PROTPARAM, PROTSCALE, DAS, SOSUI, TOPPRED, TMAP, TMpred, SPLIT4, PHDHTM, TMHMM2, HMMTOP2, GLOBPLOT and PROSITE. The secondary structure was obtained by consensus of the algorithms SOPM, PR...

  4. Reporte de insuficiencia renal producida por Leptospira Interrogans Serovar Pomona en Colombia

    Directory of Open Access Journals (Sweden)

    Fortunato Ospino

    1988-06-01

    Full Text Available Se describe la presentación de un caso de leptospirosis producida por L. pomona en un paciente de 20 años de edad, trabajadora habitual en un molino de arroz y caracterizado por un síndrome de insuficiencia renal y hepática. El cuadro clínico consistió principalmente en malestar general, anorexia, vómito, fiebre, diarrea, ictericia y hemorragias subconjuntivales. Los exámenes de laboratorio mostraron alteraciones, en los niveles de nitrógeno ureico, creatinina, depuración de creatinina, concentración de cloro, fosfatasa alcalina y bilirrubina directa lo cual podría indicar un daño en el funcionamiento hepático y renal. Las alteraciones en la velocidad de sedimentación, hemoglobina, hematocrito y leucocitos (Tabla 1 explican la anemia e infección ocasionada por la L. pomona en la paciente. El diagnóstico de leptospirosis fue confirmado por el aislamiento del microorganismo de la orina a pesar de no haber detectado anticuerpos en el suero de la paciente. Se pone en evidencia la necesidad de realizar siempre el diagnóstico diferencial con leptospirosis en todo síndrome hepatorrenal, especialmente en los casos con antecedentes epidemiológicos o que por la sintomatología clínica se sospeche la infección.

  5. Human leptospirosis in Tanzania: sequencing and phylogenetic analysis confirm that pathogenic Leptospira species circulate among agro-pastoralists living in Katavi-Rukwa ecosystem.

    Science.gov (United States)

    Muller, Shabani K; Assenga, Justine A; Matemba, Lucas E; Misinzo, Gerald; Kazwala, Rudovick R

    2016-06-10

    Leptospirosis is a neglected zoonotic disease of worldwide public health importance. The disease affects humans, domestic animals and wildlife. However, leptospirosis is challenging in its diagnosis in humans. Culture technique, which is time consuming, is not recommended for clinical diagnosis. For these reasons, serological and molecular techniques remain the test of choice. The major objective of this study was to explore the genetic characteristic of Leptospira species which are prevalent among agro-pastoralists living in Katavi-Rukwa Ecosystem, Tanzania. A cross-sectional epidemiological study was carried out in the Katavi-Region South-west, Tanzania between August, 2013 and November, 2014. A total of 267 participants were randomly recruited for the study. Microscopic agglutination test (MAT) was used to detect antibody against six Leptospira antigens including local serogroups Icterohaemorrhagiae, Ballum, Grippotyphosa, Sejroe and reference serogroups Hebdomadis, and Australis. Samples with MAT titers ≥ 1:160 were scored as positive, samples with MAT titers ranging from 1:20 to 1:80 were scored as exposed to Leptospira, and absence of agglutination titers was scored as negative. All MAT positive samples, including the low titre samples were subjected to PCR using the respective 16S rRNA primers for the pathogenic and non-pathogenic species. Out of 267 samples tested, 80 (29.9 %) were positive with MAT. The major circulating leptospiral serogroups were Sejroe (15.7 %,), Icterohaemorrhagiae (8.9 %), Grippotyphosa (4.8 %), Hebdomadis (3.37 %), Australis (1.49 %) and Ballum (1.19 %). By using PCR, 33 (15.7 %) out of 210 samples were pathogenic Leptospira while no saprophytic Leptospira spp. was detected. Partial 16S rRNA gene sequences of Leptospira species which were obtained from this study were submitted to GenBank and acquired accession numbers KP313246 and KP313247. Phylogenetic analysis of the nucleotide sequences revealed that species

  6. Comparison of three diagnostic techniques for the detection of leptospires in the kidneys of wild house mice (Mus musculus Comparação de três métodos de diagnóstico para detecção de leptospiras em rins de camundongos selvagens (Mus musculus

    Directory of Open Access Journals (Sweden)

    Carlos A. Rossetti

    2004-03-01

    leptospiras, as quais foram serologicamente tipificadas. O outro rim foi microscopicamente examinado por coloração de cortes histológicos pela hematoxilina-eosina, impregnação pela prata e imunohistoquímica. Leptospiras pertencentes ao serogrupo Ballum foram isoladas em 16 (39% das 41 amostras availadas. A presença do agente foi observada em 18 (44% e 19 (46% das 41 amostras avaliadas por impregnação pela prata e imunohistoquímica, respectivamente. Leptospiras foram detectadas em grande numero na superfície apical das células epiteliais e no lumen dos túbulos medulares e foram menos frequentemente encontradas na superficie apical de células epiteliais ou no lúmen dos túbulos corticais, o que é considerado achado raro em animais portadores. Lesões microscópicas consistindo de nefrite mononuclear intersticial focal, atrofia glomerular e descamação das células tubulares epiteliais foram observadas em 13 dos 19 animais infectados e em 10 dos 22 animais não infectados. Não houve diferença estatisticamente significativa entre presença de lesões em animais infectados e não infectados (P=0,14. As três técnicas empregadas, isolamento, impregnação pela prata e imunohistoquímica, apresentaram alta concordância (k³0,85 e não apresentaram diferenças estatisticamente significativas (P>0,05. Esse trabalho descreve a presença incomum de leptospira em rins de animais portadores, porém com esse estudo não foi possível estabelecer uma relação entre lesões e presença de leptospira.

  7. Molecular and serological characterization of Leptospira interrogans serovar Canicola isolated from dogs, swine, and bovine in Brazil

    NARCIS (Netherlands)

    Miraglia, Fabiana; de Morais, Zenaide M.; Dellagostin, Odir A.; Seixas, Fabiana K.; Freitas, Julio C.; Zacarias, Francielle G. S.; Delbem, Adina C.; Ferreira, Thaís S. P.; Souza, Gisele O.; Hartskeerl, Rudy A.; Vasconcellos, Silvio A.; Moreno, Andrea M.

    2012-01-01

    The identification of Leptospira clinical isolates through genotyping and serotyping, besides the recognition of its reservoirs, are important tools for understanding the epidemiology of leptospirosis, and they are also keys for identifying new species and serovars. Fourteen clinical isolates from

  8. Fatal Septicemic Melioidosis in a Young Military Person Possibly Co-Infected With Leptospira Interrogans and Orientia Tsutsugamushi

    Directory of Open Access Journals (Sweden)

    Po-Liang Lu

    2005-04-01

    Full Text Available Concurrent melioidosis, leptospirosis, and scrub typhus after rural activities is rarely reported. A 19-year-old previously healthy man had fever onset after 2 weeks of military training. Pneumonia became evident on the fifth day of fever under intravenous penicillin and oral minocycline therapy. Acute respiratory failure developed the next day with shock and acute renal and liver function deterioration, which resulted in death. Blood cultures on the third and fifth days grew Burkholderia pseudomallei. Serology revealed leptospirosis and scrub typhus. The emergence of melioidosis in Taiwan and this death without antibiotic treatment for melioidosis alert us that B. pseudomallei should be included as a possible pathogen of pneumonia and sepsis, especially after rural activities.

  9. LipL32 Is a Subsurface Lipoprotein of Leptospira interrogans: presentation of new data and reevaluation of previous studies.

    Directory of Open Access Journals (Sweden)

    Marija Pinne

    Full Text Available The agents of leptospirosis, a zoonosis with worldwide distribution, are pathogenic spirochetes belonging to the genus Leptospira. The leptospiral life cycle involves transmission via fresh water and colonization of the renal tubules of their reservoir hosts. Infection of accidental hosts, including humans, may result in life-threatening sequelae. Bacterial outer membrane proteins (OMPs, particularly those with surface-exposed regions, play crucial roles in pathogen virulence mechanisms and adaptation to environmental conditions, including those found in the mammalian host. Therefore, elucidation and characterization of the surface-exposed OMPs of Leptospira spp. is of great interest in the leptospirosis field. A thorough, multi-pronged approach for assessing surface exposure of leptospiral OMPs is essential. Herein, we present evidence for a sub-surface location for most or all of the major leptospiral lipoprotein, LipL32, based on surface immunofluorescence utilizing three different types of antibodies and four different permeabilization methods, as well as surface proteolysis of intact and lysed leptospires. We reevaluate prior evidence presented in support of LipL32 surface-exposure and present a novel perspective on a protein whose location has been misleading researchers, due in large part to its extraordinary abundance in leptospiral cells.

  10. Crystallization and preliminary X-ray analysis of LipL32 from Leptospira interrogans serovar Copenhageni

    International Nuclear Information System (INIS)

    Hauk, Pricila; Guzzo, Cristiane R.; Ho, Paulo L.; Farah, Chuck S.

    2009-01-01

    Recombinant selenomethionine-labelled LipL32, the major surface protein of pathogenic Leptospira, has been purified and crystallized. Data sets from two crystals were collected, one of which diffracted to 2.25 Å resolution. LipL32 is a major surface protein that is expressed during infection by pathogenic Leptospira. Here, the crystallization of recombinant LipL32 21–272 , which corresponds to the mature LipL32 protein minus its N-terminal lipid-anchored cysteine residue, is described. Selenomethionine-labelled LipL32 21–272 crystals diffracted to 2.25 Å resolution at a synchrotron source. The space group was P3 1 21 or P3 2 21 and the unit-cell parameters were a = b = 126.7, c = 96.0 Å

  11. Methylation and in vivo expression of the surface-exposed Leptospira interrogans outer membrane protein OmpL32

    Science.gov (United States)

    Recent studies have revealed that bacterial protein methylation is a widespread post-translational modification that is required for virulence in selected pathogenic bacteria. In particular, altered methylation of outer membrane proteins has been shown to modulate the effectiveness of the host immu...

  12. Carriage of Leptospira interrogans among domestic rats from an urban setting highly endemic for leptospirosis in Brazil

    NARCIS (Netherlands)

    de Faria, Marcos Tucunduva; Calderwood, Michael S.; Athanazio, Daniel A.; McBride, Alan J. A.; Hartskeerl, Rudy A.; Pereira, Martha Maria; Ko, Albert I.; Reis, Mitermayer G.

    2008-01-01

    A survey was conducted to identify reservoirs for urban leptospirosis in the city of Salvador, Brazil. Sampling protocols were performed in the vicinity of households of severe leptospirosis cases identified during active hospital-based surveillance. Among a total of 142 captured Rattus norvegicus

  13. Prevalence of antileptospiral serum antibodies in dogs in Ireland

    Science.gov (United States)

    A total of 474 serum samples from client owned Irish dogs were tested for the presence of antibodies against serovars Canicola, Icterohaemorrhagiae, Bratislava, Autumnalis, Pomona, Altodouro, Grippotyphosa, Mozdok, Hardjobovis and Ballum. Six percent of dogs presented to veterinary practitioners for...

  14. LemA and Erp Y-like recombinant proteins from Leptospira interrogans protect hamsters from challenge using AddaVax™ as adjuvant.

    Science.gov (United States)

    Oliveira, Thaís Larré; Schuch, Rodrigo Andrade; Inda, Guilherme Roig; Roloff, Bárbara Couto; Neto, Amilton Clair Pinto Seixas; Amaral, Marta; Dellagostin, Odir Antonio; Hartwig, Daiane Drawanz

    2018-05-03

    Recombinant subunit vaccines have been extensively evaluated as promising alternatives against leptospirosis. Here, we evaluated two proteins in formulations containing the adjuvant AddaVax™ as vaccine candidates for prevention and control of leptospirosis. Recombinant proteins rErp Y-like and rLemA were characterized by ELISA to assess their ability to bind extracellular matrix (ECM) components and fibrinogen. Groups of eight hamsters were immunized intramuscularly with rErp Y-like or rLemA mixed with a squalene-based adjuvant (AddaVax), and then vaccine efficacy was determined in terms of protection against a lethal challenge. The humoral immune response was determined by ELISA, and the evidence of sub-lethal infection was evaluated by histopathology and kidney culture. rLemA protein binds laminin, fibrinogen, and collagen type IV, while rErp Y-like interacts with fibrinogen. Significant protection was achieved for rLemA and rErp Y-like vaccines, which showed 87.5% and 62.5% survivals, respectively. On day 28, the humoral immune response was significantly greater in the vaccine groups as compared to that in the control group, and the response was predominantly based on IgG2/3. The surviving animals showed negative results in culture isolation but presented with tissue lesions in the lungs and kidneys. Cumulatively, our findings suggest that LemA and Erp Y-like proteins act as adhesins and are able to protect against mortality, but not against tissue lesions. Moreover, AddaVax is a novel adjuvant with potential for improving the immunogenicity of leptospiral vaccines. Copyright © 2018 Elsevier Ltd. All rights reserved.

  15. An ortholog of the Leptospira interrogans lipoprotein LipL32 aids in the colonization of Pseudoalteromonas tunicata to host surfaces

    Directory of Open Access Journals (Sweden)

    Melissa eGardiner

    2014-07-01

    Full Text Available The bacterium P. tunicata is a common surface colonizer of marine eukaryotes, including the macroalga Ulva australis. Genomic analysis of P. tunicata identified genes potentially involved in surface colonization, including genes with homology to bacterial virulence factors that mediate attachment. Of particular interest is the presence of a gene, designated ptlL32, encoding an ortholog to the Leptospira lipoprotein LipL32, which has been shown to facilitate the interaction of Leptospira sp. with host extracellular matrix (ECM structures and is thought to be an important virulence trait for pathogenic Leptospira. To investigate the role of PtlL32 in the colonization by P. tunicata we constructed and characterized a ΔptlL32 mutant strain. Whilst P. tunicata ΔptlL32 bound to an abiotic surface with the same capacity as the wild type strain, it had a marked effect on the ability of P. tunicata to bind to ECM, suggesting a specific role in attachment to biological surfaces. Loss of PtlL32 also significantly reduced the capacity for P. tunciata to colonize the host algal surface demonstrating a clear role for this protein as a host-colonization factor. PtlL32 appears to have a patchy distribution across specific groups of environmental bacteria and phylogenetic analysis of PtlL32 orthologous proteins from non-Leptospira species suggests it may have been acquired via horizontal gene transfer between distantly related lineages. This study provides the first evidence for an attachment function for a LipL32- like protein outside the Leptospira and thereby contributes to the understanding of host colonization in ecologically distinct bacterial species.

  16. Glicolipoproteína de Leptospira interrogans sorogrupo icterohaemorrhagiae: distribuição em fígado e rim de cobaias experimentalmente infectadas

    Directory of Open Access Journals (Sweden)

    R.T. Macêdo Santos

    1989-08-01

    Full Text Available Acredita-se que as lesões teciduais na leptospirose possam decorrer da ação direta das leptospiras, de toxinas sintetizadas ou liberadas durante sua lise. O presente estudo visou a extração quimica da glicolipoproteína (GLP da leptospira, a produção de anti-soro anti-GLP e a avaliação de sua distribuição em cortes de fígado e rim de cobaias inoculadas e sacrificadas em estudo seqüencial diário até o 6°dia de infecção, correspondente ao pico da doença. Procurou-se também correlacionar a expressão tecidual da GLP com o grau de lesões locais, em busca de novos subsídios para a compreensão da patogenia da leptospirose. A QLP foi detectada em fígado e rim de 2 dentre 6 cobaias no 5°dia e em todas as 6 no 6° dia de infecção, sob a forma de grânulos no citoplasma de macrófagos, livres no interstício ou acolados à membrana de células endoteliais e parenquimatosas, especialmente nas regiões mais lesadas. A cronologia do aparecimento da GLP e sua distribuição sugerem tratar-se de produto dc lise de leptospiras fagocitadas por macrófagos e que esta substância, conquanto não comprovada como iniciadora das lesões, associa-se a seu agravamento nas etapas mais avançadas da leptospirose.

  17. Signaling via ITGB1/FAK and microfilament rearrangement mediates the internalization of Leptospira interrogans in mouse J774A.1 macrophages

    Directory of Open Access Journals (Sweden)

    Zhao Xin

    2015-01-01

    Full Text Available Leptospirosis caused by pathogenic Leptospira species is a worldwide zoonotic 2 infectious disease, but the mechanisms of leptospiral internalization remain poorly understood. Here, we report that mouse J774A.1 macrophages expressed integrin-subfamily proteins (ITGB1, ITGB2 and ITGB3. Antibody blockage and siRNA-based knockdown of ITGB1 decreased the internalization of leptospires into mouse J774A.1 macrophage cells. The internalization required focal adhesion kinase (FAK activation in J774A.1 cells rather than phosphoinositide-3-kinase (PI3K, and microfilament rather than microtubule aggregation during infection. The data indicated that the ITGB1/FAK/microfilament signaling pathway is responsible for leptospiral internalization in mouse macrophages.

  18. Intestinal spirochetosis: first cases reported in Brazil and the use of immunohistochemistry as an aid in histopathological diagnosis Espiroquetose intestinal: primeiros casos no Brasil e o uso de técnicas imunohistoquímicas como ajuda no diagnóstico histopatológico

    Directory of Open Access Journals (Sweden)

    T. de Brito

    1996-02-01

    ógico foi feito através de colorações de rotina, tais como a hematoxilina-eosina, que mostraram franja basofílica de 3µ de espessura sobre a borda em escova do epitélio e por impregnações pela prata como o método de Whartin-Starry. Métodos imunohistoquímicos, usando dois soros primários policlonais, um contra o Treponema pallidum e o outro contra Leptospira interrogans, serovar copenhageni serogrupo Icterohaemorrhagiae revelaram reatividade cruzada com os antígeno/s dos espiroquetas produzindo um contraste acentuado da franja sobre o epitélio colônico e preservando a morfologia espiralada do parasita. Em um paciente, com acentuada diarréia, a imunohistoquímica detectou antígenos de espiroqueta no citoplasma de uma célula da cripta intestinal, demonstrando que a infecção estava mais disseminada do que parecia pelas colorações comuns. Portanto, os métodos imunohistoquímicos facilitam o diagnóstico histológico da espiroquetose intestinal e podem , também, contribuir para a melhor compreensão da patogenia da doença. A microscopia eletrônica de transmissão e a microscopia de varredura, realizadas em um paciente, demonstraram que os espiroquetas lembram a espécie designada como Brachyspira aalborgi.

  19. Detection of Leptospira spp. in the semen and urine of bulls serologically reactive to Leptospira interrogans serovar hardjo Detecção de Leptospira spp. em sêmen e urina de touros sorologicamente reagentes a Leptospira interrogans sorovar hardjo

    Directory of Open Access Journals (Sweden)

    Fernanda Senter Magajevski

    2005-03-01

    Full Text Available This study evaluated PCR for the detection of leptospires in semen and urine of ten serologically reactive bulls, comparing these results with those obtained with other diagnosis techniques. Two collections of materials were done in alternate days. Semen and urine samples were separated in aliquots for: direct visualization in dark field microscopy; inoculation in hamsters (for semen only; isolation in culture media; and PCR. No hamster was positive by the microscopic agglutination test (MAT; kidney and liver fragments from the hamsters were used in an isolation attempt in culture media, with one positive isolation from the kidney of a hamster inoculated with semen of one bull, and from liver of hamsters inoculated with semen of three bulls. Isolation in culture was negative for all semen samples, but positive for five urine samples by direct inoculation. In PCR there was no positive result for semen samples, and only one urine sample was positive, which was coincident with one of the positive cultures. It was not possible to visualize leptospires in any of the samples by dark field microscopy.O presente trabalho avaliou a PCR na detecção de leptospiras em sêmen e urina de dez touros sorologicamente reagentes, comparando seus resultados com aqueles obtidos por outras técnicas de diagnóstico. Foram realizadas duas colheitas de materiais em dias alternados. As amostras de sêmen e de urina foram separadas em alíquotas para visualização direta em microscopia de campo escuro, inoculação em hamsters (apenas para o sêmen, isolamento em meio de cultura e PCR. Nenhum hamster apresentou positividade na prova de soroaglutinação microscópica (SAM; fragmentos de rins e fígado desses animais foram utilizados para a tentativa de isolamento em meio de cultura, sendo positivo o cultivo a partir do rim de hamster inoculado com semen de um touro, e do fígado de hamsters inoculados com o semen de três touros. O isolamento em meio de cultura foi negativo para todas as amostras de sêmen, mas foi positivo para cinco amostras de urina. Na PCR não houve resultado positivo para as amostras de sêmen, e apenas uma amostra de urina apresentou resultado positivo, sendo coincidente com uma das culturas positivas. Não foi possível visualizar leptospiras em nenhuma das amostras por exame direto em microscopia de campo escuro.

  20. ORF Alignment: NC_004342 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available interrogans serovar Copenhageni str. ... Fiocruz L1-130] ... Length = 63 ... Query: 185 IKDRCGTCTACIDACPTGALKPYQIDAGKCISH...HTLEDGSEEIPDTYGWLVGCDICQDVC 244 ... IKDRCGTCTACIDACPTGALKPYQIDAGKCISH...HTLEDGSEEIPDTYGWLVGCDICQDVC Sbjct: 1 ... IKDRCGTCTACIDACPTGALKPYQIDAGKCISHHTLEDGSEEIPDTYGWLVGCDICQDVC 60 ...

  1. ORF Alignment: NC_005823 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available interrogans serovar Copenhageni str. ... Fiocruz L1-130] ... Length = 63 ... Query: 185 IKDRCGTCTACIDACPTGALKPYQIDAGKCISH...HTLEDGSEEIPDTYGWLVGCDICQDVC 244 ... IKDRCGTCTACIDACPTGALKPYQIDAGKCISH...HTLEDGSEEIPDTYGWLVGCDICQDVC Sbjct: 1 ... IKDRCGTCTACIDACPTGALKPYQIDAGKCISHHTLEDGSEEIPDTYGWLVGCDICQDVC 60 ...

  2. Enfermedad meningocócica. Situación en España en la temporada 1998-1999

    Directory of Open Access Journals (Sweden)

    Rosa Cano Portero

    2000-01-01

    Full Text Available FUNDAMENTO: El cambio en el patrón epidemiológico sufrido por la enfermedad meningocócica en gran parte del país en la temporada 1996-1997 y la decisión de intervenir mediante una campaña de vacunación en el grupo de 18 meses a 19 años de edad con vacuna bivalente de polisacáridos, fueron el motivo para reforzar la vigilancia epidemiológica de esta enfermedad MÉTODOS: Se calcularon, para la temporada 1998-1999, tasas y otros indicadores de incidencia y letalidad por serogrupo y edad según los datos notificados al Sistema de Enfermedades de Declaración Obligatoria. RESULTADOS: La incidencia global fue superior que la temporada previa, aunque, la razón de tasas no indicó un riesgo significativamente mayor. Se produjo un aumento significativo de la tasa por serogrupo B y por segundo año consecutivo, la tasa por serogrupo C disminuyó, aunque no de forma significativa. Se produjo un aumento en el número de defunciones. La letalidad por serogrupo C aumentó en el grupo de 1 a 4 años. La incidencia se mantuvo alta y con un claro patrón estacional en las comunidades que no vacunaron. En el resto la incidencia se redujo y el patrón estacional desapareció. CONCLUSIONES: A los dos años de la intervención el predominio de casos del serogrupo B es general en todas las CCAA, excepto en las tres que no vacunaron, en ellas, durante estos dos últimos años, ha predominado el serogrupo C. En las CCAA que vacunaron se aprecia un incremento de la incidencia, aunque no significativo, entre los niños menores de cuatro años.

  3. ORF Alignment: NC_000964 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Carbon storage regulator csrA [Leptospira interrogans ... serovar Lai str. 56601] gb|AAN51504.1| Carbo...n storage ... regulator csrA [Leptospira interrogans serovar lai str. ... ...r. ... Fiocruz L1-130] sp|Q8EYB0|CSRA_LEPIN Carbon storage ... regulator homolog sp|Q72MJ6|CSRA_

  4. ORF Alignment: NC_001318 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Carbon storage regulator csrA [Leptospira interrogans ... serovar Lai str. 56601] gb|AAN51504.1| Carbo...n storage ... regulator csrA [Leptospira interrogans serovar lai str. ... ...r. ... Fiocruz L1-130] sp|Q8EYB0|CSRA_LEPIN Carbon storage ... regulator homolog sp|Q72MJ6|CSRA_

  5. ORF Alignment: NC_000919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Carbon storage regulator csrA [Leptospira interrogans ... serovar Lai str. 56601] gb|AAN51504.1| Carbo...n storage ... regulator csrA [Leptospira interrogans serovar lai str. ... ...r. ... Fiocruz L1-130] sp|Q8EYB0|CSRA_LEPIN Carbon storage ... regulator homolog sp|Q72MJ6|CSRA_

  6. ORF Alignment: NC_006156 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Carbon storage regulator csrA [Leptospira interrogans ... serovar Lai str. 56601] gb|AAN51504.1| Carbo...n storage ... regulator csrA [Leptospira interrogans serovar lai str. ... ...r. ... Fiocruz L1-130] sp|Q8EYB0|CSRA_LEPIN Carbon storage ... regulator homolog sp|Q72MJ6|CSRA_

  7. ORF Alignment: NC_002570 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Carbon storage regulator csrA [Leptospira interrogans ... serovar Lai str. 56601] gb|AAN51504.1| Carbo...n storage ... regulator csrA [Leptospira interrogans serovar lai str. ... ...r. ... Fiocruz L1-130] sp|Q8EYB0|CSRA_LEPIN Carbon storage ... regulator homolog sp|Q72MJ6|CSRA_

  8. ORF Alignment: NC_005823 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Carbon storage regulator csrA [Leptospira interrogans ... serovar Lai str. 56601] gb|AAN51504.1| Carbo...n storage ... regulator csrA [Leptospira interrogans serovar lai str. ... ...r. ... Fiocruz L1-130] sp|Q8EYB0|CSRA_LEPIN Carbon storage ... regulator homolog sp|Q72MJ6|CSRA_

  9. ORF Alignment: NC_003030 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Carbon storage regulator csrA [Leptospira interrogans ... serovar Lai str. 56601] gb|AAN51504.1| Carbo...n storage ... regulator csrA [Leptospira interrogans serovar lai str. ... ...r. ... Fiocruz L1-130] sp|Q8EYB0|CSRA_LEPIN Carbon storage ... regulator homolog sp|Q72MJ6|CSRA_

  10. ORF Alignment: NC_004342 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Carbon storage regulator csrA [Leptospira interrogans ... serovar Lai str. 56601] gb|AAN51504.1| Carbo...n storage ... regulator csrA [Leptospira interrogans serovar lai str. ... ...r. ... Fiocruz L1-130] sp|Q8EYB0|CSRA_LEPIN Carbon storage ... regulator homolog sp|Q72MJ6|CSRA_

  11. ORF Alignment: NC_006087 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Carbon storage regulator csrA [Leptospira interrogans ... serovar Lai str. 56601] gb|AAN51504.1| Carbo...n storage ... regulator csrA [Leptospira interrogans serovar lai str. ... ...r. ... Fiocruz L1-130] sp|Q8EYB0|CSRA_LEPIN Carbon storage ... regulator homolog sp|Q72MJ6|CSRA_

  12. ORF Alignment: NC_004193 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Carbon storage regulator csrA [Leptospira interrogans ... serovar Lai str. 56601] gb|AAN51504.1| Carbo...n storage ... regulator csrA [Leptospira interrogans serovar lai str. ... ...r. ... Fiocruz L1-130] sp|Q8EYB0|CSRA_LEPIN Carbon storage ... regulator homolog sp|Q72MJ6|CSRA_

  13. NCBI nr-aa BLAST: CBRC-CJAC-01-0924 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-0924 ref|NP_713695.1| Heme exporter protein A [Leptospira interrogans ...serovar Lai str. 56601] gb|AAN50713.1|AE011508_10 Heme exporter protein A [Leptospira interrogans serovar Lai str. 56601] NP_713695.1 3.5 22% ...

  14. Resultados del estudio de subdetección del meningococo en vacunados en Galicia

    Directory of Open Access Journals (Sweden)

    Alberto Malvar Pintos

    2000-01-01

    Full Text Available FUNDAMENTOS: A partir la vigilancia activa y el seguimiento de la Enfermedad Meningocócica (EM tras la campaña de vacunación realizada en Galicia, se observó que la proporción de aislamientos del serogrupo responsable de la enfermedad entre los casos de sospechosos de EM (SEM que habían sido vacunados era menor que entre los no vacunados. Ante esta situación se realizó un estudio con el fin de determinar si en el origen de esas SEM sin aislamiento se encontraba la N. Meningitidis del serogrupo C y cuantificar la importancia de esa subdetección. MÉTODOS: Para ello, y durante el período de estudio (desde la semana 26 de 1997 a la semana 14 de 1999, se tomaron muestras de LCR y sangre de las SEM sin aislamiento, para su estudio con PCR para especie y serogrupo. El análisis de las muestras fue realizado por el laboratorio de microbiología del hospital Clínico de Santiago de Compostela. RESULTADOS: De los 120 casos notificados durante el periodo de estudio, se analizaron por PCR 65 (38 vacunados y 27 no vacunados, resultando positivas para N. meningitidis en un 65% (42 muestras, 74% en vacunados y 52% en no vacunados. . Estimando, a partir de los casos estudiados, los resultados para el total, y excluyendo los casos PCR negativo, encontramos que, para el serogrupo C, sólo en el 27% de los casos ocurridos en vacunados se consigue aislarlo, frente al 80% en los no vacunados (p<0.0001. Estos porcentajes son, para el caso del B, del 59 y 71% respectivamente, diferencia estadísticamente no significativa. CONCLUSIONES: La vacuna provocó una verdadera subdetección de meningococos del serogrupo C entre los casos vacunados

  15. Preliminary Investigations on the Distribution of Leptospira Serovars in Domestic Animals in North-west Morocco.

    Science.gov (United States)

    Benkirane, A; Noury, S; Hartskeerl, R A; Goris, M G A; Ahmed, A; Nally, J E

    2016-04-01

    Leptospirosis is a neglected zoonosis of global importance with a complex epidemiology that affects humans, domestic and wild mammals. However, due to the diversity of clinical signs and difficulties of establishing a confirmatory laboratory diagnosis, the disease remains poorly investigated, particularly in the developing world. In Morocco, a descriptive study of the seroprevalence of Leptospira infection in animals has never been undertaken. To fill this gap, the current study was conducted on a subset of animals in north-west Morocco as a preliminary step towards understanding the epidemiological patterns of animal leptospirosis in the country. The study was conducted on 289 serum samples collected between January and April 2012 from dogs, cattle, sheep, goats and donkeys in the areas of Rabat-Temara, Sidi Kacem and Oulmes. All serum samples were tested by the MAT with 14 reference strains of the most prevalent pathogenic serovars of Leptospira and two serovars of non-pathogenic Leptospira. The overall seroprevalence of Leptospira in cattle, sheep, goats, dogs and donkeys was 15%, 18%, 20%, 21% and 20%, respectively. The most prevalent serogroups found in each species were Ballum, Sejroe, and Australis in cattle, Ballum, Australis and Sejroe in sheep, Australis and Ballum in goats, Javanica and Australis in donkey and Australis, Ballum and Canicola in dogs. Of all the serogroups tested in this study, Icterohaemorrhagiae, the only serogroup which has been previously reported in humans in Morocco, was rarely reactive. The majority of reactive sera were collected from low land areas. A large number of sera samples classified as seronegative when tested against pathogenic leptospires were positive when tested against non-pathogenic leptospires; this is suggestive of possible novel, as yet unclassified, Leptospira serovars in Morocco. Eleven of thirteen sheep urine samples were positive by real-time PCR confirming their role as Leptospira carriers in Morocco. © 2014

  16. Studies of the binding of ficolin-2 and ficolin-3 from the complement lectin pathway to Leptospira biflexa, Pasteurella pneumotropica and Diarrheagenic Escherichia coli

    DEFF Research Database (Denmark)

    Sahagún-Ruiz, Alfredo; Breda, Leandro Carvalho Dantas; Valencia, Mónica Marcela Castiblanco

    2015-01-01

    . We show for the first time that human ficolin-2 recognizes the nonpathogenic spirochete Leptospira biflexa serovar Patoc, but not the pathogenic Leptospira interrogans serovar Kennewicki strain Fromm. Additionally, human ficolin-2 and ficolin-3 recognize pathogenic Pasteurella pneumotropica...

  17. Evaluation of risk factors of prevalence of leptospirosis in sheep flocks

    Directory of Open Access Journals (Sweden)

    M Imandar

    2012-02-01

    Full Text Available Leptospirosis  is  a  worldwide  bacterial  zoonoses  that  its  main  source  are  wild animals  and  rodents  That  leptospirals  excrete  in  their  urine. This  disease  causes  fever, hemoglobinuria, jaundice, abortion, mastitis, reduced  milk  production, reproductive  disorders  and  death  in  cattle, that  major  complications  in  sheep  are  abortion  and  pyelonephritis. The  purpose  of  this  study  is the  evaluation  of   risk  factors  for  leptospirosis  disease  and  its  association  with  high  prevalence  of  infection  in  the  sheep  flocks. Accordingly, 260 serum samples were collected from 20 flocks of  sheep. Then  with  microscopic  agglutination  test (MAT using  6  live  antigen  Leptospira  interrogans  include  Pomona , canicola, icterohaemorrhagiae, gryppotyphoza, ballum  and  hardjo  was  studied. MAT  test  results  of  the  serum  samples  showed  the  contamination  was  28.46%. Most  contamination  of  the  samples  was  allocated  to  sheep  who  lived  in  swampy  areas, so  that  70.28%  of  positive   samples  were  included. 56.25%  of  positive  samples  among  the  samples  showed  positive  reaction  with  serotype canicola. On the other hand, 76.56%  of  the  positive  samples  belonged  to  animals  which  in  their  environment, rodents   in  very  large  numbers  were  observed. The  sheep  that  kept  in moist  and  wet  environment  to  be  had  60%  of  positive  samples , and  finally  the  highest frequency  of  positive  animals  were  ranged  among  ages  3  to  6  years  old, the  incidence  of  the  disease  increased  in  older  animals. By  attention  to  the  results, increasing  of  age, living  in  swampy  and  wet  bed, being  infectious  dogs  in  side  of  flocks and  also  very  large

  18. Seguridad, reactogenicidad e inmunogenicidad de una nueva vacuna de polisacáridos meningocócicos en adultos jóvenes cubanos

    Directory of Open Access Journals (Sweden)

    Rossana Estruch–de la Guardia

    2017-04-01

    Full Text Available Se realizó un estudio aleatorizado, controlado y a doble ciegas, en 352 adultos jóvenes cubanos entre 18 y 35 años de edad, con el objetivo de evaluar la seguridad, reactogenicidad y la inmunogenicidad de una nueva vacuna de polisacáridos de Neisseria meningitidis serogrupos A, C y W135, producida por el Instituto Finlay de Vacunas (La Habana, Cuba, con respecto a su similar comercial Mencevax® ACW de Glaxo Smith Kline. Se tomaron muestras de suero antes y 28 días después de la vacunación. La reactogenicidad de ambas vacunas fue similar. Los síntomas y signos, tanto locales como generales fueron leves y aparecieron principalmente durante las primeras 48 h después de la vacunación. Ningún sujeto presentó eventos adversos graves durante los 28 días del período de vigilancia. La vacuna en estudio mostró ser segura y poco reactogénica; sus porcentajes de seroconversión a los 28 días posteriores a la vacunación fueron de: 92,19 % para el serogrupo A, 88,89 % para C y 90,06 % para W135. No se detectaron diferencias con respecto a la seroconversión. La seroprotección alcanzada con la vacuna en estudio fue de 98,44 %, 91,81 % y 95,32 % para los serogrupos A, C y W135 respectivamente y no fue inferior con respecto a la vacuna control para los tres serogrupos estudiados.

  19. Sensitivity of pathogenic and free-living Leptospira spp. to UV radiation and mitomycin C

    International Nuclear Information System (INIS)

    Stamm, L.V.; Charon, N.W.

    1988-01-01

    The habitats for the two major Leptospira spp. differ. The main habitat of L. biflexa is soil and water, whereas L. interrogans primarily resides in the renal tubules of animals. We investigated whether these two species, along with L. illini (species incertae sedis), differ with respect to their sensitivity to UV radiation. The doses of UV resulting in 37, 10 and 1% survival were determined for representive serovars from each species. L. interrogans serovar pomona was 3.0 to 4.8 times more sensitive to UV than the other Leptospira species under the 37, 10, and 1% survival parameters. In comparison to other bacteria, L. interrogans serovar pomona is among the most sensitive to UV. In a qualitative UV sensitivity assay., L. interrogans serovars were found to be in general more sensitive than L. biflexa serovars. All three species were found to have a photoreactivation DNA repair mechanism. Since organisms that are resistant to UV are often resistant to the DNA cross-linking agent mitomycin C, we tested the relative sensitivity of several Leptospira serovars to this compound. With few exceptions, L. biflexa and L. illini serovars were considerably more resistant to mitomycin C than the L. interrogans serovars. The mitomycin C sensitivity assay could be a useful addition to current characterization tests used to differentiate the Leptospira species

  20. Sensitivity of pathogenic and free-living Leptospira spp. to UV radiation and mitomycin C

    Energy Technology Data Exchange (ETDEWEB)

    Stamm, L.V.; Charon, N.W.

    1988-03-01

    The habitats for the two major Leptospira spp. differ. The main habitat of L. biflexa is soil and water, whereas L. interrogans primarily resides in the renal tubules of animals. We investigated whether these two species, along with L. illini (species incertae sedis), differ with respect to their sensitivity to UV radiation. The doses of UV resulting in 37, 10 and 1% survival were determined for representive serovars from each species. L. interrogans serovar pomona was 3.0 to 4.8 times more sensitive to UV than the other Leptospira species under the 37, 10, and 1% survival parameters. In comparison to other bacteria, L. interrogans serovar pomona is among the most sensitive to UV. In a qualitative UV sensitivity assay., L. interrogans serovars were found to be in general more sensitive than L. biflexa serovars. All three species were found to have a photoreactivation DNA repair mechanism. Since organisms that are resistant to UV are often resistant to the DNA cross-linking agent mitomycin C, we tested the relative sensitivity of several Leptospira serovars to this compound. With few exceptions, L. biflexa and L. illini serovars were considerably more resistant to mitomycin C than the L. interrogans serovars. The mitomycin C sensitivity assay could be a useful addition to current characterization tests used to differentiate the Leptospira species.

  1. Leptospirosis in fox squirrels (Sciurus niger) of Larimer County, Colorado, USA.

    Science.gov (United States)

    Dirsmith, Katherine; VanDalen, Kaci; Fry, Tricia; Charles, Brad; VerCauteren, Kurt; Duncan, Colleen

    2013-07-01

    Leptospirosis is a zoonotic disease caused by the bacterium Leptospira interrogans. The organism is typically maintained within a geographic region by colonizing renal tubules of carrier animals and shed into the environment in urine. We assessed whether L. interrogans was present in fox squirrels (Sciurus niger) in Larimer County, Colorado, USA, and whether it is associated with disease. Twenty-two squirrels were trapped from 29 November 2011 to 15 December 2011 for use in an unrelated study. The squirrels were individually housed for 33-65 days and euthanized; no clinical disease was observed. On gross examination, significant renal lesions were observed in 6 of 22 animals (27%). Histologically, affected animals had severe neutrophilic tubulitis with interstitial nephritis. Immunohistochemistry was conducted on the kidneys of all animals and 10 of 22 (45%) were positive for L. interrogans, with varying severity of infection. The same 10 squirrels were serologically positive for antibodies specific to L. interrogans. These results suggest that L. interrogans is present in fox squirrels in Larimer County, Colorado, USA, and may be associated with varying degrees of renal disease. Further investigation into the role of wildlife in the ecology of leptospirosis within the region is warranted.

  2. Comparative analysis of lipopolysaccharides of pathogenic and intermediately pathogenic Leptospira species.

    Science.gov (United States)

    Patra, Kailash P; Choudhury, Biswa; Matthias, Michael M; Baga, Sheyenne; Bandyopadhya, Keya; Vinetz, Joseph M

    2015-10-30

    Lipopolysaccharides (LPS) are complex, amphipathic biomolecules that constitute the major surface component of Gram-negative bacteria. Leptospira, unlike other human-pathogenic spirochetes, produce LPS, which is fundamental to the taxonomy of the genus, involved in host-adaption and also the target of diagnostic antibodies. Despite its significance, little is known of Leptospira LPS composition and carbohydrate structure among different serovars. LPS from Leptospira interrogans serovar Copenhageni strain L1-130, a pathogenic species, and L. licerasiae serovar Varillal strain VAR 010, an intermediately pathogenic species, were studied. LPS prepared from aqueous and phenol phases were analyzed separately. L. interrogans serovar Copenhageni has additional sugars not found in L. licerasiae serovar Varillal, including fucose (2.7%), a high amount of GlcNAc (12.3%), and two different types of dideoxy HexNAc. SDS-PAGE indicated that L. interrogans serovar Copenhageni LPS had a far higher molecular weight and complexity than that of L. licerasiae serovar Varillal. Chemical composition showed that L. interrogans serovar Copenhageni LPS has an extended O-antigenic polysaccharide consisting of sugars, not present in L. licerasiae serovar Varillal. Arabinose, xylose, mannose, galactose and L-glycero-D-mannoheptose were detected in both the species. Fatty acid analysis by gas chromatography-mass spectrometry (GC-MS) showed the presence of hydroxypalmitate (3-OH-C16:0) only in L. interrogans serovar Copenhageni. Negative staining electron microscopic examination of LPS showed different filamentous morphologies in L. interrogans serovar Copenhageni vs. L. licerasiae serovar Varillal. This comparative biochemical analysis of pathogenic and intermediately pathogenic Leptospira LPS reveals important carbohydrate and lipid differences that underlie future work in understanding the mechanisms of host-adaptation, pathogenicity and vaccine development in leptospirosis.

  3. [Detection of leptospira by culture of vitreous humor and detection of antibodies against leptospira in vitreous humor and serum of 225 horses with equine recurrent uveitis].

    Science.gov (United States)

    Dorrego-Keiter, Elisa; Tóth, József; Dikker, Lieke; Sielhorst, Jutta; Schusser, Gerald Fritz

    2016-01-01

    In the ongoing discussion regarding the aetiopathogenesis of equine recurrent uveitis (ERU) it was the aim of the present study to elucidate the relationship of leptospira infection and ERU. In a population of 225 horses leptospira were examined in vitreous humor by culture and leptospira antibody were detected in vitreous humor and serum samples. Preoperative serum samples were collected from 221/225 ERU patients of different age, gender and breed. Undiluted vitreous humor was aseptically taken from 198/225 patients that underwent pars plana vitrectomy at the beginning of surgery and from 27/225 patients' eyeball after enucleation: Serum and vitreous humor were tested for specific leptospiral antibodies by microscopic agglutination test (MAT). Furthermore, vitreous humor was examined by culture. 20 patients which were euthanized due to a live-threatening disease other than ERU served as a control group. A total of 127/221 (57.5%) horses had serum antibodies (≥ 1:100). Most frequently antibodies against L. interrogans serovar Grippotyphosa were detected (79/127), followed by L. interrogans serovar lcterohaemorrhagiae (34/127) and L. interrogans serovar Bratislava (29/127). Only 79/225 horses (35.1%) had leptospiral antibodies in vitreous humor, in which L. interrogans serovar Grippotyphosa (67/79) was identified most frequently followed by L. interrogans serovar Pomona (18/79) and L. interrogans serovar lcterohaemorrhagiae (8/79) which was identified as single or multiple reaction. Isolation of leptospira from vitreous humor was positive in 34/212 horses (16%). 10/20 control horses had a positive antibody titer against leptospira in serum and 2/20 horses in vitreous humor, whereas there was no leptospira detected in culture. The result of 84% negative cultures from vitreous humor of 212 ERU patients is decisive for the diagnosis and therapy of ERU.

  4. Molecular characterization of Leptospira sp by multilocus variable number tandem repeat analysis (MLVA from clinical samples: a case report

    Directory of Open Access Journals (Sweden)

    Hélène Pailhoriès

    2015-08-01

    Full Text Available Leptospirosis is a zoonotic infection for which diagnosis is difficult. It has appeared as a global emerging infectious disease over recent years. Genotype determination often requires a Leptospira strain obtained by culture, which is a long and fastidious technique. A method based on multilocus variable number tandem repeat analysis (MLVA to determine the genotype of Leptospira interrogans, performed directly on blood or urine samples, is proposed. This method was applied to a fatal case of leptospirosis for which the geographical origin of infection was unknown. This technique will allow a genotype to be obtained for L. interrogans, even when cultures remain negative.

  5. Use of saprophytic leptospira strains in the serodiagnosis of experimental leptospirosis in guinea-pigs (Cavia sp

    Directory of Open Access Journals (Sweden)

    Raul J. S. Girio

    1988-04-01

    Full Text Available The efficiency of four Leptospira biflexa strains (Buenos Aires, Patoc 1, Rufino and São Paulo as single antigen in the serodiagnosis in guinea-pigs experimentally infected with seven Leptospira interrogans serovars (canicola, grippotyphosa, hardjo, icterohaemorrhagiae, pomona, tarassovi and wolffi was evaluated by the microscopic agglutination test. The four saprophytic strains were not able to reveal antibody titres in sera of guinea-pigs experimentally infected with Leptospira interrogans. Serological cross-reactions were observed between strains Patoc 1 and São Paulo and between serovars wolffi and hardjo.

  6. Radiometric method for the rapid detection of Leptospira organisms

    International Nuclear Information System (INIS)

    Manca, N.; Verardi, R.; Colombrita, D.; Ravizzola, G.; Savoldi, E.; Turano, A.

    1986-01-01

    A rapid and sensitive radiometric method for detection of Leptospira interrogans serovar pomona and Leptospira interrogans serovar copenhageni is described. Stuart's medium and Middlebrook TB (12A) medium supplemented with bovine serum albumin, catalase, and casein hydrolysate and labeled with 14 C-fatty acids were used. The radioactivity was measured in a BACTEC 460. With this system, Leptospira organisms were detected in human blood in 2 to 5 days, a notably shorter time period than that required for the majority of detection techniques

  7. Radiometric method for the rapid detection of Leptospira organisms

    Energy Technology Data Exchange (ETDEWEB)

    Manca, N.; Verardi, R.; Colombrita, D.; Ravizzola, G.; Savoldi, E.; Turano, A.

    1986-02-01

    A rapid and sensitive radiometric method for detection of Leptospira interrogans serovar pomona and Leptospira interrogans serovar copenhageni is described. Stuart's medium and Middlebrook TB (12A) medium supplemented with bovine serum albumin, catalase, and casein hydrolysate and labeled with /sup 14/C-fatty acids were used. The radioactivity was measured in a BACTEC 460. With this system, Leptospira organisms were detected in human blood in 2 to 5 days, a notably shorter time period than that required for the majority of detection techniques.

  8. EVOLUCIÓN DE LA ENFERMEDAD MENINGOCÓCICA EN LA POBLACIÓN INFANTIL DE LA COMUNIDAD VALENCIANA (1996-2000. EFECTIVIDAD DE LA VACUNACIÓN ANTIMENINGOCÓCICA A+B

    Directory of Open Access Journals (Sweden)

    Mercedes Goicoechea Sáez

    2003-01-01

    Full Text Available por serogrupo C en la Comunidad Valenciana durante 1996-1997 motivó la realización de una campaña de vacunación antimeningocócica A+C en la población de 18 meses a 19 años de edad (entre septiembre y diciembre de 1997. El objetivo de este estudio es analizar el impacto de la campaña en cuanto a la epidemiología, clínica, evolución de la enfermedad meningocócica y estado de vacunación de la población infantil con el fin de valorar la efectividad vacunal. Métodos: Los datos se obtuvieron de las historias clínicas de los niños menores de 15 años, que presentaron síntomas y signos clínicos sugestivos de enfermedad invasora con aislamiento de Neisseria. meningitidis y/o que cumplían con los criterios de definición de caso establecidos, atendidos en todos los hospitales públicos de la Comunidad Valenciana entre 1996-2000. La evolución de la incidencia se valoró mediante tasas de incidencia. La clínica y su evolución (secuelas y letalidad mediante la frecuencia y distribución por serogrupo y edad. La efectividad vacunal se calculó según la fórmula de Orestein. Resultados: Se registró un total de 302 casos de enfermedad invasora por N. meningitidis. La tasa de incidencia por serogrupo C en niños menores de 15 años disminuyó tras la campaña de vacunación desde 5,82/105 habitantes en 1997 a 1,68/105 habitantes en 1998. Tres años después de la campaña se ha vuelto a tasas similares a la época prevacunal, con un aumento por serogrupo B en los 2 últimos años. El 61% de las secuelas se da en menores de 5 años. La letalidad fue más elevada para el serogrupo C. La efectividad vacunal al tercer año tras la campaña ha sido del 83,7% para el grupo de 5-14 años y del 69,1% para el grupo de 19 meses-4 años. Conclusión: La vacuna polisacarídica se mostró efectiva para interrumpir el brote. La disminución de la incidencia del serogrupo C es atribuible a la efectividad vacunal obtenida.

  9. Evolución de la enfermedad meningocócica en la población infantil de la Comunidad Valenciana (1996-2000: Efectividad de la vacunación antimeningocócica A+C

    Directory of Open Access Journals (Sweden)

    Goicoechea Sáez Mercedes

    2003-01-01

    Full Text Available Fundamento: El incremento de la enfermedad meningocócica por serogrupo C en la Comunidad Valenciana durante 1996-1997 motivó la realización de una campaña de vacunación antimeningocócica A+C en la población de 18 meses a 19 años de edad (entre septiembre y diciembre de 1997. El objetivo de este estudio es analizar el impacto de la campaña en cuanto a la epidemiología, clínica, evolución de la enfermedad meningocócica y estado de vacunación de la población infantil con el fin de valorar la efectividad vacunal. Métodos: Los datos se obtuvieron de las historias clínicas de los niños menores de 15 años, que presentaron síntomas y signos clínicos sugestivos de enfermedad invasora con aislamiento de Neisseria. meningitidis y/o que cumplían con los criterios de definición de caso establecidos, atendidos en todos los hospitales públicos de la Comunidad Valenciana entre 1996-2000. La evolución de la incidencia se valoró mediante tasas de incidencia. La clínica y su evolución (secuelas y letalidad mediante la frecuencia y distribución por serogrupo y edad. La efectividad vacunal se calculó según la fórmula de Orestein. Resultados: Se registró un total de 302 casos de enfermedad invasora por N. meningitidis. La tasa de incidencia por serogrupo C en niños menores de 15 años disminuyó tras la campaña de vacunación desde 5,82/10(5 habitantes en 1997 a 1,68/10(5 habitantes en 1998. Tres años después de la campaña se ha vuelto a tasas similares a la época prevacunal, con un aumento por serogrupo B en los 2 últimos años. El 61% de las secuelas se da en menores de 5 años. La letalidad fue más elevada para el serogrupo C. La efectividad vacunal al tercer año tras la campaña ha sido del 83,7% para el grupo de 5-14 años y del 69,1% para el grupo de 19 meses-4 años. Conclusión: La vacuna polisacarídica se mostró efectiva para interrumpir el brote. La disminución de la incidencia del serogrupo C es atribuible a la

  10. AGLUTININAS ANTILEPTÓSPIRA EM EQÜINOS NO ESTADO DE GOIÁS ANTILEPTOSPIRA AGGLUTININS IN EQUINES IN THE GOIÁS STATE, BRAZIL

    Directory of Open Access Journals (Sweden)

    Marly Francisca Cândido

    2007-09-01

    Full Text Available

    Foram analisados 694 hemossoros de eqüinos, procedentes de sete rnunicípios goianos, encontrando-se uma positividade para aglutininas antileptóspira que variou de 8,8 a 25,0%, com o valor médio de 14,4%. Diferentes sorotipos foram pesquisados, pela técnica de GALTON et alii (1962, encontrando-se positividade para os sorotipos grippotyphosa, wolffi, ballum e australis. Os autores concluíram pela necessidade de prosseguimento de novas pesquisas, com a finalidade de averiguar-se a presença ou não de diferentes sorotipos observados em outros Estados e não encontrados na presente pesquisa, além da realização de estudo epidemiológico local e regional.

    694 equine serum blood tests were made from horses of 7 counties of the State of Goiás. Positive rates of Leptospira agglutinins varied from 8.8 to 25.0% with an average of 14.4%. Different serum types were studied by the technique developed by GALTON et alii (1962 finding positiveness for the following serum types: grippotyphosa, wolffi, ballum and australis.

  11. Aislamiento y serotipificación de Salmonella sp. en estanques con Crocodylus intermedius y testudines cautivos en Villavicencio - Colombia

    Directory of Open Access Journals (Sweden)

    Diana Pachón C.

    2011-05-01

    Full Text Available Objetivo. Determinar la presencia de microorganismos del género Salmonella sp. en el ambiente acuático de los ejemplares Crocodylus intermedius y testudines en la Estación de Biología Tropical Roberto Franco (EBTRF. Materiales y métodos. En este estudio se utilizó la metodología estándar para aislar e identificar microorganismos del género Salmonella sp., a partir de muestras de agua y sedimento de 52 estanques (nEstanques Crocodylus=25; nEstanques testudines=27; se procedió a serotipificar los aislamientos por el método convencional de Kaufmann-White y se realizaron pruebas de sensibilidad a antimicrobianos por la técnica de Kirby Bauer. Resultados. Se determinó la presencia de Salmonella sp., en un 33% del total de estanques muestreados. El 29% de los aislamientos de Salmonella sp. serotipificados, correspondió al serogrupo B; los serogrupos C, C1, C2 y D1 presentaron menores porcentajes. Con las pruebas de sensibilidad a antimicrobianos se determinó que el 100% de los aislamientos fueron sensibles a norfloxacina. Conclusiones. La ocurrencia de Salmonella sp., en los estanques de la EBTRF fue del 33%, con la mayor presencia del serogrupo B, donde se encuentran especies con características ampliamente zoonóticas. Con los resultados obtenidos es necesario el seguimiento de las normas de bioseguridad establecidas en la estación para el manejo de las poblaciones allí mantenidas y evitar de esa manera la ocurrencia de cuadros zoonóticos.

  12. Evolución de la enfermedad meningocócica en la Comunidad de Madrid. Efectividad de la vacunación antimeningocócica A+C

    Directory of Open Access Journals (Sweden)

    Gutiérrez Rodríguez Mª Ángeles

    2000-01-01

    Full Text Available FUNDAMENTO: En el año 1997 (entre el 22 de septiembre y el 14 de noviembre se efectuó una campaña de vacunación antimeningocócica A+C en la Comunidad de Madrid, en el grupo de edad de 18 meses a 19 años, ante el aumento del número de casos de enfermedad meningocócica por serogrupo C presentado en la temporada 1996-97. Este estudio forma parte de la evaluación de dicha campaña. MÉTODOS: Se ha valorado la evolución de la incidencia de la enfermedad meningocócica, mediante la comparación de tasas; y se ha determinado la efectividad de la vacunación al año (temporada 1997-98 y a los dos años (temporadas 1997-98 y 1998-99 de seguimiento. La efectividad vacunal se ha calculado como (1-(Tasa en vacunados/Tasa en no vacunados*100. RESULTADOS: Se ha producido un descenso significativo en la incidencia de enfermedad meningocócica por serogrupo C al comparar las temporadas 1997-98 y 1998-99 con la temporada epidémica (1996-97. La efectividad vacunal a los dos años de seguimiento tras la campaña de vacunación ha sido de un 76,9% para la población global de 18 meses a 19 años y de un 88,5% en el grupo de vacunados entre 15 y 19 años. CONCLUSIONES: La efectividad vacunal obtenida es compatible con lo descrito en la literatura. La disminución significativa de la incidencia de enfermedad meningocócica por serogrupo C ha sido debida a la efectividad vacunal obtenida.

  13. Eficacia de la vacuna meningocócica de polisacárido capsular del grupo C

    Directory of Open Access Journals (Sweden)

    González Enríquez Jesús

    1997-01-01

    Full Text Available FUNDAMENTO: Este trabajo consiste esencialmente en una revisión sistemática de la literatura científica sobre los efectos, intensidad y duración de la respuesta serológica, así como sobre la eficacia, efectividad y seguridad de la vacuna meningocócica de polisacárido capsular del grupo C. MÉTODOS: Búsqueda en repertorio MEDLINE en el periodo 1970-1996. Búsqueda específica de ensayos clínicos aleatorizados y estudios de intervención prospectivos en humanos con vacunas de polisacáridos capsulares de meningococo en el mismo repertorio y periodo. Análisis crítico de literatura científica y síntesis de evidencia. RESULTADOS: La vacuna de polisacárido capsular del serogrupo C es considerada segura y ha mostrado una eficacia superior al 85% en adultos y niños mayores, 70% (IC95%: 5-91% en niños menores de 5 años y 55% (IC90%: 14-76% en niños de 2-3 años. La vacuna no se ha mostrado eficaz en niños menores de 2 años. La duración de niveles de anticuerpos protectores disminuye con la edad. La proporción de niños menores de 6 años efectivamente protegidos al año de la vacunación es baja. La vacunación no limita la respuesta serológica de vacunaciones ulteriores. CONCLUSIONES: La vacuna meningocócica de polisacárido capsular del serogrupo C está indicada en adultos y niños mayores de 2 años como protección contra la enfermedad meningocócica causada por este serogrupo en situaciones de alto riesgo de enfermedad. La escasa protección que ofrece la vacuna en los menores de 2 años, la limitada eficacia en menores de 5 años y la corta duración de la inmunidad que confiere a estas edades, hace que la vacunación rutinaria no esté recomendada y que la vacuna se use fundamentalmente en el control de brotes epidémicos causados por serogrupo C.

  14. Estudio de la resistencia a antibióticos [beta]-lactámicos en aislamientos clínicos de "salmonella typhimurium"

    OpenAIRE

    Güerri Santos, María Luisa

    2002-01-01

    Estudiando las características de las cepas de Salmonella aisladas en el Hospital Universitario "La Paz" (Madrid) durante los últimos once años concluímos que el serogrupo más frecuente es el D9 (exceptuando el año 1996 en el que predomina el B4), la población más afectada son los niños, y los casos de bacteriemia tienen lugar en pacientes con factores predisponentes (VIH y otras enfermedades debilitantes). Se observa un aumento de la resistencia a antibióticos, especialmente llamativa para l...

  15. Renaturalización de complexos proteicos de membrana externa de Neisseria meningitidis en liposomas: estrutura e potencial vacinal

    OpenAIRE

    Freixeiro Díaz, Paula

    2015-01-01

    Aínda que as vacinas baseadas en vesículas de membrana externa son eficaces fronte ás cepas epidémicas de N. meningitidis do serogrupo B, estas continúan a presentar importantes limitacións e estase a realizar un grande esforzo no desenvolvemento de novas vacinas e na reformulación das xa existentes. A resposta inmune fronte a estas vacinas diríxese principalmente fronte aos complexos de porinas. Este traballo pretende un mellor coñecemento dos complexos de porinas e do papel da RmpM mediante...

  16. Estudio de la estructura genética de poblaciones de "Vibrio cholerae"

    OpenAIRE

    Farfán Sellarés, Maribel

    2002-01-01

    Se ha estudiado la variabilidad genética de poblaciones de V. cholerae procedentes de distintas fuentes y orígenes geográficos, que agrupan diferentes serogrupos y biotipos de esta especie. Se ha analizado la variabilidad genética a dos niveles: a un nivel proteico, aplicando la técnica de electroforesis de aloenzimas multilocus (MLEE), y a un nivel génico, realizando el análisis de secuencias multilocus (MLST). Con ello, se ha intentado determinar la relación genética existente entre las dis...

  17. Detección y caracterización de aislados de "escherichia coli" de origen clínico y fecal en gallinas ponedoras

    OpenAIRE

    Gibert Perelló, Magdalena

    2011-01-01

    El objetivo de esta tesis ha sido realizar la caracterización de aislados de E. coli clínicos (responsables de cuadros de colibacilosis en gallinas ponedoras) y fecales. Tras llevar a cabo el aislamiento e identificación bioquímica de los aislados, se ha procedido a la determinación del serogrupo, patotipo (detección de factores de virulencia por PCR), sensibilidad a antimicrobianos y pulsotipo (mediante la técnica de Pulsed Field-Gel Electrophoresis, PFGE). Además, se ha realizado un estudio...

  18. Comportamiento de la vigilancia epidemiológica de la leptospirosis humana en Colombia, 2007-2011

    Directory of Open Access Journals (Sweden)

    Solmara Bello

    2013-08-01

    Full Text Available Introducción. La leptospirosis es una zoonosis reemergente de distribución mundial causada por una espiroqueta del género Leptospira. Durante los últimos años en Colombia aumentó el número de casos en humanos y animales. Objetivo. Caracterizar epidemiológicamente los casos de leptospirosis notificados al Sistema Nacional de Vigilancia en Salud Pública de Colombia y hacer una aproximación para conocer los serogrupos que circulan en el país. Materiales y métodos. Se diseñó un estudio observacional de corte retrospectivo, con registros del proceso de vigilancia de los casos reportados por el software Sivigila y muestras enviadas al Grupo de Microbiología de la Red Nacional de Laboratorios, durante el periodo 2007 a 2011. Se registraron variables de tipo sociodemográficas y se analizaron 17 serogrupos de Leptospira. En el análisis seutilizaron medidas de frecuencia, tendencia central y dispersión. Resultados. Se procesaron 11.786 registros, confirmándose 4.621 casos de leptospirosis. Las entidades territoriales con mayor registro fueron Valle del Cauca, Antioquia, Risaralda, Atlántico y Barranquilla; y las de incidencia más alta fueron Guaviare, Risaralda, San Andrés, Santa Marta y Barranquilla. El mayor número de casos reportados perteneció al área urbana, con mayor frecuencia de hombres (77 %, estudiantes (19,4 % y amas de casas (13,6 %, con una mediana por edad de 29 años (rango intercuartílico: 45-19. Se evidenció la circulación de 17 serogrupos en el país; los más frecuentes fueron Australis (24,89 %, Hebdomadis (9,33 % y Sejroe (8,0 %. Conclusión. En Colombia se ha mejorado la notificación y clasificación final de los casos, lo que ha permitido identificar al serogrupo Australis como el de mayor circulación.   doi: http://dx.doi.org/10.7705/biomedica.v33i0.1608

  19. Caracterización fenotípica de cepas invasivas de Neisseria meningitidis aisladas en Cuba durante 20 años

    Directory of Open Access Journals (Sweden)

    Isabel Martínez

    2006-04-01

    Full Text Available Se investigaron los marcadores epidemiológicos (serogrupos, serotipos, subtipos, inmunotipos de 429 cepas invasivas, aisladas en Cuba durante 20 años (1982-2002. Basándonos en el comportamiento de la incidencia de la Enfermedad Meningocócica (EM en el período investigado, las cepas se distribuyeron en dos etapas: epidémica y postepidémica. La epidémica, comprendió 279 cepas aisladas entre 1982-1992 y la ostepidémica, incluyó 150 aislamientos pertenecientes al período comprendido entre 1993-2002. Todas se cultivaron en Agar Mueller Hinton con suero fetal bovino (5% y se incubaron 24-48 horas, 37 0C, en atmósfera húmeda con 5% de C02. La identificación de género, especie y serogrupo, se realizó mediante métodos convencionales; para la caracterización de los sero/subtipos e inmunotipos, se utilizó el ensayo inmunoenzimático (ELISA de células enteras con anticuerpos monoclonales. En ambas etapas predominó el serogrupo B (97,90%: epidémica (96,77% y postepidémica (100%. Sin embargo, el serogrupo C (1,43% y cepas no agrupables (1,8%, sólo se observaron en aislamientos de la etapa epidémica. Los otros marcadores prevalentes fueron: serotipo 4 (86,48%, subtipo P1.19,15 (78,32%, inmunotipo L3,7,9 (90,2% , todos mostraron cifras similares en ambos períodos.Predominó el fenotipo B:4:P1.19,15:L3,7,9 (69,69%, aunque, en la etapa postepidémica (77,34%, el porcentaje fue superior al de la etapa epidémica (65,66% (p<0,05; además, en las cepas de este período, se observó una mayor diversidad de asociaciones fenotípicas. Los resultados obtenidos de esta caracterización fenotípica de las cepas de Neisseria meningitidis aisladas de enfermos aporta datos valiosos al estudio, prevención y control exitoso de la EM en Cuba.

  20. Leptospira and leptospirosis in China.

    Science.gov (United States)

    Hu, Weilin; Lin, Xu'ai; Yan, Jie

    2014-10-01

    In this review, we introduce the epidemiological features, clinical types, laboratory diagnosis, and routine surveillance of leptospirosis in China. Leptospirosis has been prevalent sporadically in China in recent years, but its incidence has decreased, probably due to the lower leptospire-carrying rate in pigs. Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai is the most common pathogen in Chinese leptospirosis patients and Apodemus agrarius is its major animal host. At least 75% of Chinese leptospirosis patients suffer from the mild influenza-like type of leptospirosis that is caused by any serovars of L. interrogans. However, leptospirosis patients with the pulmonary diffuse hemorrhagic type have a high mortality (40-60%). L. interrogans serovar Lai is the causative agent in 75% of the pulmonary diffuse hemorrhagic leptospirosis patients. Several outer membrane protein antigens exist in all the L. interrogans serovars prevailing in China and predominant T- and B-cell combined epitopes in the outer membrane protein antigens have been identified that can be used for developing novel universal leptospirosis vaccines. Leptospirosis cases in the Chinese population have gradually decreased in recent years, but it is still an important zoonotic infectious disease. The development of universal vaccines is critical for the prevention and control of leptospirosis.

  1. Downregulation of the Na/K-ATPase pump by leptospiral glycolipoprotein activates the NLRP3 inflammasome.

    Science.gov (United States)

    Lacroix-Lamandé, Sonia; d'Andon, Martine Fanton; Michel, Eric; Ratet, Gwenn; Philpott, Dana J; Girardin, Stephen E; Boneca, Ivo G; Vandewalle, Alain; Werts, Catherine

    2012-03-15

    Leptospira interrogans is responsible for a zoonotic disease known to induce severe kidney dysfunction and inflammation. In this work, we demonstrate that L. interrogans induces NLRP3 inflammasome-dependent secretion of IL-1β through the alteration of potassium transport in bone marrow-derived macrophages. Lysosome destabilization also contributed to the IL-1β production upon stimulation with live, but not dead, bacteria. Using bone marrow-derived macrophages from various TLRs and nucleotide-binding oligomerization domain-deficient mice, we further determined that IL-1β production was dependent on TLR2 and TLR4, suggesting a participation of the leptospiral LPS to this process. Hypokaliemia in leptospirosis has been linked to the presence of glycolipoprotein, a cell wall component of L. interrogans that is known to inhibit the expression and functions of the Na/K-ATPase pump. We show in this study that glycolipoprotein activates the inflammasome and synergizes with leptospiral LPS to produce IL-1β, mimicking the effect of whole bacteria. These results were confirmed in vivo, as wild-type mice expressed more IL-1β in the kidney than TLR2/4-deficient mice 3 d postinfection with L. interrogans. Collectively, these findings provide the first characterization, to our knowledge, of bacteria-induced activation of the NLRP3 inflammasome through the downregulation of a specific host potassium transporter.

  2. Opsonization of Treponema pallidum is mediated by immunoglobulin G antibodies induced only by pathogenic treponemes.

    OpenAIRE

    Shaffer, J M; Baker-Zander, S A; Lukehart, S A

    1993-01-01

    Rabbit antisera to Leptospira interrogans, Borrelia hermsii, and Treponema phagedenis biotype Reiter, reactive to shared spirochetal antigens, failed to enhance phagocytosis of Treponema pallidum by macrophages, while immunoglobulin G to Treponema pallidum subsp. pertenue and Treponema paraluiscuniculi promoted phagocytosis. Opsonic antibodies are directed to pathogen-restricted, not shared spirochetal, antigens.

  3. ORF Alignment: NC_005823 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005823 gi|45656251 >1v04A 13 339 27 348 2e-65 ... ref|YP_000337.1| paraoxonase [Le...ptospira interrogans serovar Copenhageni str. ... Fiocruz L1-130] gb|AAS68974.1| paraoxonase [Leptosp

  4. ORF Alignment: NC_004342 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004342 gi|24213099 >1v04A 13 339 27 348 5e-66 ... ref|NP_710580.1| paraoxonase 3-l...ike protein [Leptospira interrogans serovar Lai str. ... 56601] gb|AAN47598.1| paraoxonase 3-like pro

  5. Sequence analysis corresponding to the PPE and PE proteins in ...

    Indian Academy of Sciences (India)

    Unknown

    Amino acid sequence analysis corresponding to the PE proteins resulted in the identification of tandem repeats comprising 41–43 amino acid ..... Q9RAP8. Leptospira interrogans serovar ictero- haemorrhagiae-B. ORFC protein. 5. P71003. Bacillus subtilis-B. Hypothetical 49⋅4 kDa protein. 5. ALL2941. Anabaena sp.

  6. Using a top predator as a sentinel for environmental contamination with pathogenic bacteria: the Iberian wolf and leptospires

    OpenAIRE

    Millán, Javier; García, Emilio J; Oleaga, Álvaro; López-Bao, José Vicente; Llaneza, Luis; Palacios, Vicente; Candela, Mónica G; Cevidanes, Aitor; Rodríguez, Alejandro; León-Vizcaíno, Luis

    2014-01-01

    The Iberian wolf (Canis lupus) is the top predator in the Iberian environments in which it lives, feeding on a wide range of species, thus encountering a wide range of disease agents. Therefore, the wolf can serve as sentinel of environmental contamination with pathogens. We investigated the exposure of free-living wolves to 14 serovars of Leptospira interrogans sensu lato. Kidney samples f...

  7. Letter to the Editor

    Science.gov (United States)

    We would like to express several concerns regarding the article “Efficacy of vaccination of cattle with the Leptospira interrogans serovar Hardjo type hardjoprajitno component of a pentavalent Leptospira bacterin against experimental challenge with Leptospira borgpetersenii serovar Hardjo type hardj...

  8. Interaction of bovine peripheral blood polymorphonuclear cells and Leptospira species; innate responses in the natural bovine reservoir host.

    Science.gov (United States)

    Cattle are the reservoir hosts of Leptospira borgpetersenii serovar Hardjo, and also be reservoir hosts of other Leptospira species such as L. kirschneri, and L. interrogans. As a reservoir host, cattle shed Leptospira, infecting other animals, including humans. Previous studies with human and murin...

  9. Expansion of the in vitro assay for Leptospira potency testing to other Serovars: Case study with Leptospira hardjo

    Science.gov (United States)

    The Code for Federal Regulations (9 CFR 113:101-104) specifies how vaccine potency is evaluated in a hamster model for evaluation of leptospiral vaccines against pomona, icterohaemorrhagiae, canicola, and grippotyphosa serotypes of Leptospira interrogans. There are several issues which complicate th...

  10. Genotypes of Leptospira spp. strains isolated from dogs in Buenos Aires, Argentina.

    Science.gov (United States)

    Grune Loffler, Sylvia; Passaro, Diego; Samartino, Luis; Soncini, Analía; Romero, Graciela; Brihuega, Bibiana

    2014-01-01

    Leptospirosis is an infectious disease of wide global distribution, which is endemic in Argentina. The objective of this study was to obtain the genetic profiles of Leptospira spp. strains isolated from clinical cases of dogs in the province of Buenos Aires by the multiple-locus variable-number tandem repeat analysis (MLVA). Eight isolated canine strains were genotyped by MLVA, obtaining the identical profile of Leptospira interrogans serovar Canicola Hond Utrecht IV in the strains named Dogy and Mayo. The strains named Bel, Sarmiento, La Plata 4581 and La Plata 5478 were identical to the profile of the genotype of L. interrogans serovar Portlandvere MY 1039.The strain named Avellaneda was identical to the genotype profile of L. interrogans serovar Icterohaemorrhagiae RGA and the strain named SB had the same profile as the L. interrogans serovar Pomona Baires genotype and was similar to the profile of serovar Pomona Pomona genotype. It would be useful to include a larger number of isolates from different dog populations in various provinces of Argentina and to characterize the genetic profiles of the strains circulating in the country. The information obtained will be useful for the control of leptospirosis in the dog population. Copyright © 2014 Asociación Argentina de Microbiología. Publicado por Elsevier España. All rights reserved.

  11. Investigation of infectious reproductive pathogens of large ruminants: Are neosporosis, brucellosis, leptospirosis and BVDV of relevance in Lao PDR?

    Science.gov (United States)

    Olmo, L; Dye, M T; Reichel, M P; Young, J R; Nampanya, S; Khounsy, S; Thomson, P C; Windsor, P A; Bush, R D

    2018-01-01

    N. caninum, bovine viral diarrhoea virus, Brucella abortus and Leptospira interrogans serovar Hardjo are globally significant reproductive pathogens that cause abortion and reproductive loss in large ruminants. Prevalence information is lacking in Lao People's Democratic Republic (Laos) despite the poor reproductive performance of cattle and buffalo. Serological examination of frozen cattle (n=90) and buffalo (n=61) sera by commercially available enzyme-linked immunosorbent assays provided the first reported screening of some of these pathogens in Laos. Seroprevalence differed amongst these large ruminant species, with N. caninum, BVDV and L. interrogans serovar Hardjo antibodies found in 68.9% (95% CI±11.6), 4.9% (95% CI±5.4) and 3.3% (95% CI±4.5) of buffalo sera, respectively, and in 7.8% (95% CI±5.5), 10.0% (95% CI±6.2) and 22.2% (95% CI±8.6) of cattle sera, respectively. Buffalo sera had a significantly higher seroprevalence of N. caninum compared to cattle (p<0.001) and cattle sera had a significantly higher seroprevalence of L. interrogans serovar Hardjo compared to buffalo (p=0.003). Variability was also observed across provinces for N. caninum in buffalo (p=0.007) and for L. interrogans serovar Hardjo in cattle (p=0.071), suggesting provincial risk factors conducive to pathogen transmission. BVDV and N. caninum seropositivity were negatively associated in buffalo (p=0.018) and cattle (p=0.003). In buffalo, L. interrogans serovar Hardjo and BVDV seropositivity were associated (p=0.035, p=0.039). The identification of antibodies against three major abortifacient pathogens in Laos prompts further research to determine if infection is associated with low reproductive efficiency and the risk factors for infection. This is needed for the development of evidence based prevention strategies for improved large ruminant reproductive management among smallholders in Laos. Copyright © 2017 Elsevier B.V. All rights reserved.

  12. Lipopolysaccharide Specific Immunochromatography Based Lateral Flow Assay for Serogroup Specific Diagnosis of Leptospirosis in India.

    Directory of Open Access Journals (Sweden)

    Shanmugam Vanithamani

    Full Text Available Leptospirosis is a re-emerging infectious disease that is under-recognized due to low-sensitivity and cumbersome serological tests. MAT is the gold standard test and it is the only serogroup specific test used till date. Rapid reliable alternative serogroup specific tests are needed for surveillance studies to identify locally circulating serogroups in the study area.In the present investigation the serological specificity of leptospiral lipopolysaccharides (LPS was evaluated by enzyme linked immunosorbent assay (ELISA, dot blot assay and rapid immunochromatography based lateral flow assay (ICG-LFA. Sera samples from 120 MAT positive cases, 174 cases with febrile illness other than leptospirosis, and 121 seronegative healthy controls were evaluated for the diagnostic sensitivity and specificity of the developed assays. LPS was extracted from five locally predominant circulating serogroups including: Australis (27.5%, Autumnalis (11.7%, Ballum (25.8%, Grippotyphosa (12.5%, Pomona (10% and were used as antigens in the diagnostics to detect IgM antibodies in patients' sera. The sensitivity observed by IgM ELISA and dot blot assay using various leptospiral LPS was >90% for homologous sera. Except for Ballum LPS, no other LPS showed cross-reactivity to heterologous sera. An attempt was made to develop LPS based ICG-LFA for rapid and sensitive serogroup specific diagnostics of leptospirosis. The developed ICG-LFA showed sensitivity in the range between 93 and 100% for homologous sera. The Wilcoxon analysis showed LPS based ICG-LFA did not differ significantly from the gold standard MAT (P>0.05.The application of single array of LPS for serogroup specific diagnosis is first of its kind. The developed assay could potentially be evaluated and employed for as MAT alternative.

  13. Prevalence of antibodies to selected viral and bacterial pathogens in wild boar (Sus scrofa) in Campania Region, Italy.

    Science.gov (United States)

    Montagnaro, Serena; Sasso, Simona; De Martino, Luisa; Longo, Mariangela; Iovane, Valentina; Ghiurmino, Gianbenedetto; Pisanelli, Giuseppe; Nava, Donatella; Baldi, Loredana; Pagnini, Ugo

    2010-01-01

    Serum samples were collected from wild boars (Sus scrofa) harvested during the 2005-2006 hunting season in Campania, southern Italy. Samples were tested for antibodies to Leptospira interrogan, Brucella spp., Salmonella spp., Aujeszky disease virus (ADV), porcine reproductive and respiratory stress syndrome virus (PRRSV), porcine parvovirus (PPV), classical swine fever virus (CSFV), and swine vesicular disease virus (SVDV). Of the 342 serum samples tested, 15 (4.4%) were seropositive to Brucella spp., nine (2.6%) were seropositive to L. interrogans, 66 (19.3%) were seropositive for Salmonella spp., 105 (30.7%) were seropositive for ADV, 27 (7.9%) were seropositive for PPV, and 129 (37.7%) were seropositive for PRRSV. All sera tested seronegative for SVDV and CSFV antibodies. These results, recorded for the first time in Campania, support the hypothesis that wild boar are reservoirs of certain infectious agents, but some infections in wild boars originate from their domestic counterparts.

  14. Prevalence of antibody titers to leptospira spp. in Minnesota white-tailed deer

    Science.gov (United States)

    Goyal, S.M.; Mech, L.D.; Nelson, M.E.

    1992-01-01

    Serum samples (n = 204) from 124 white-tailed deer (Odocoileus virginianus) in northeastern Minnesota (USA) were collected from 1984 through 1989 and tested for antibodies to six serovars of Leptospira interrogans (bratislava, canicola, grippotyphosa, hardjo, icterohemorrhagiae, and pomona) using a microtiter agglutination test. Eighty-eight (43%) sera were positive at greater than or equal to 1:100 for antibodies against serovars pomona and/or bratislava; none was positive for any of the other four serovars. None of the 31 sera collected in 1984-85 was positive, whereas all 54 sera collected from 1986 through 1988 had titers of greater than or equal to 1:100. During 1989, only 34 (29%) of 119 sera had titers of greater than or equal to 1:100. Based on these results, we believe there to be wide variability in exposure of Minnesota deer to Leptospira interrogans.

  15. PESQUISA DE AGLUTININAS ANTILEPTOSPIRA EM SOROS SANGUÍNEOS DE ASININOS (Equus Asinus E DE CONDUTORES DE VEÍCULOS DE TRAÇÃO ANIMAL NA CIDADE DE SÃO LUÍS, MA, BRASIL

    Directory of Open Access Journals (Sweden)

    Danilo Cutrim Bezerra

    2010-12-01

    Full Text Available With the objective of searching the presence of antileptospiras agglutinin in sanguine serum of donkeys used in animal traction vehicles and of the wagon’s conductors in the city of São Luis, MA, and of identifying serovars of higher occurrence, 60 serum samples of donkeys and 60 of conductors were tested regarding 30 serovars of Leptospira interrogans by using the microscopic seroagglutination test. Of the 60 blood serum samples of donkeys, 85% showed seropositivity, reacting to 21 serovars out of the 30 tested. Copenhageni, Pyrogenes, Autumnalis and Icterohaemorrhagiae were the most frequent ones, in decreasing sequence. Regarding the serum of the conductors, 38.34% presented seropositivity, reacting to 12 serovars of Leptospira interrogans and the most frequenty ones were Copenhageni, Pyrogenes, Icterohaemorrhagiae and Autumnalis. These results indicate a high incidence of anti-leptospira agglutinins in donkeys and humans, being serovars copenhageni and pyrogenes the most prevalent.

  16. Application of PCR-based DNA sequencing technique for the detection of Leptospira in peripheral blood of septicemia patients

    Directory of Open Access Journals (Sweden)

    Ram, S.

    2012-01-01

    Full Text Available Aim: Isolation, dark field detection and microscopic agglutination test (MAT are considered ―gold standard‖ tests for diagnosis of Leptospirosis. Several PCR assays are reported but very few have been evaluated for detection of Leptospirosis. Therefore, this study was undertaken. This study aims to design and standardize polymerase chain reaction (PCR - based DNA sequencing technique for the detection of pathogenic Leptospira from peripheral blood of patients clinically diagnosed with septicemia. Methodology and Results: Two hundred and seven (207 blood samples from patients were diagnosed with septicemia which includes 100 bacterial (other than Leptospira culture positive and 107 bacterial culture negative samples were studied. Primers for Nested PCR targeting LipL32 gene of Leptospira interrogans were designed and the specificity of primers was tested against serum samples positive/negative by either MAT or dark field microscopy. PCR amplified products were further confirmed by DNA sequencing. The standardized nPCR was sensitive and specific to Leptospira interrogans. Twenty-one (21% out of 100 culture positive blood samples, three (2.8% out of 107 culture negative samples showed nPCR positivity and were confirmed as Leptospira interrogans by DNA sequencing (p<0.001. A sensitive nPCR specific to Leptospira interrogans was developed. Conclusion, significance and impact of study: The p value (<0.001 signifies that Leptospira is commonly associated with other bacteria circulating in blood indicating that a decreased immune status is created primarily by a bacterium with enhanced possibility of development of Leptospiral infection probably be of an endogenous origin.

  17. Identification of leptospiral isolates by bacterial restriction endonuclease analysis (Brenda

    Directory of Open Access Journals (Sweden)

    Venkatesha M

    2001-01-01

    Full Text Available DNA samples from 19 reference serovars belonging to 19 different serogroups of Leptospira interrogans and two serovars belonging to Leptospira biflexa were examined by bacterial restriction endonuclease analysis using EcoR I and Hae III enzymes. All the serovars gave unique restriction patterns that differed from each other. DNA from 10 local isolates digested with these enzymes produced patterns which on comparison with the standard patterns produced by reference strains could be identified to serovar level.

  18. Myocarditis, pancreatitis, polyarthritis, mononeuritis multiplex and vasculitis with symmetrical peripheral gangrene of the lower extremities as a rare presentation of leptospirosis: a case report and review of the literature

    OpenAIRE

    Panagopoulos, Periklis; Terzi, Irene; Karanikas, Michail; Galanopoulos, Nikolaos; Maltezos, Efstratios

    2014-01-01

    Introduction Leptospirosis is a zoonosis caused by the spirochete, Leptospira interrogans. While most cases of leptospirosis are mild to moderate, the course may be complicated by multiorgan dysfunction. We present a rare case of leptospirosis with acute myocarditis, pancreatitis, polyarthritis, mononeuritis multiplex and severe vasculitis with necrosis of the extremities. Case presentation A 32-year-old man from Congo presented with high-grade fever, confusion and headache. He developed tach...

  19. Human Leptospirosis on Reunion Island, Indian Ocean: Are Rodents the (Only Ones to Blame?

    Directory of Open Access Journals (Sweden)

    Vanina Guernier

    2016-06-01

    Full Text Available Although leptospirosis is a zoonosis of major concern on tropical islands, the molecular epidemiology of the disease aiming at linking human cases to specific animal reservoirs has been rarely explored within these peculiar ecosystems.Five species of wild small mammals (n = 995 as well as domestic animals (n = 101 were screened for Leptospira infection on Reunion Island; positive samples were subsequently genotyped and compared to Leptospira from clinical cases diagnosed in 2012-2013 (n = 66, using MLST analysis. We identified two pathogenic species in human cases, namely Leptospira interrogans and Leptospira borgpetersenii. Leptospira interrogans was by far dominant both in clinical samples (96.6% and in infected animal samples (95.8%, with Rattus spp and dogs being its exclusive carriers. The genetic diversity within L. interrogans was apparently limited to two sequence types (STs: ST02, identified among most clinical samples and in all rats with complete MLST, and ST34, identified in six humans, but not in rats. Noteworthy, L. interrogans detected in two stray dogs partially matched with ST02 and ST34. Leptospira borgpetersenii was identified in two clinical samples only (3.4%, as well as in cows and mice; four haplotypes were identified, of which two seemingly identical in clinical and animal samples. Leptospira borgpetersenii haplotypes detected in human cases were clearly distinct from the lineage detected so far in the endemic bat species Mormopterus francoismoutoui, thus excluding a role for this volant mammal in the local human epidemiology of the disease.Our data confirm rats as a major reservoir of Leptospira on Reunion Island, but also pinpoint a possible role of dogs, cows and mice in the local epidemiology of human leptospirosis. This study shows that a comprehensive molecular characterization of pathogenic Leptospira in both clinical and animal samples helps to gaining insight into leptospirosis epidemiology within a specific

  20. The Bug Stops Here: Force Protection and Emerging Infectious Diseases

    Science.gov (United States)

    2005-11-01

    probably higher. Mounting evidence implicates microbes in heart disease, rheumatoid arthritis, diabetes, multiple sclerosis, autism , chronic lung diseases...Leptospirosis is a disease caused by the bacterium Leptospira interrogans, found in the tissues and urine of infected dogs , swine, and rodents. It is...Middle East and Central Asia. Some of these species have an animal reservoir in nature (burrow-dwelling rodents, dogs ), while others are

  1. Leptospira diversity in animals and humans in Tahiti, French Polynesia.

    Science.gov (United States)

    Guernier, Vanina; Richard, Vaea; Nhan, Tuxuan; Rouault, Eline; Tessier, Anita; Musso, Didier

    2017-06-01

    Leptospirosis is a highly endemic bacterial zoonosis in French Polynesia (FP). Nevertheless, data on the epidemiology of leptospirosis in FP are scarce. We conducted molecular studies on Leptospira isolated from humans and the potential main animal reservoirs in order to identify the most likely sources for human infection. Wild rats (n = 113), farm pigs (n = 181) and domestic dogs (n = 4) were screened for Leptospira infection in Tahiti, the most populated island in FP. Positive samples were genotyped and compared to Leptospira isolated from human cases throughout FP (n = 51), using secY, 16S and LipL32 sequencing, and MLST analysis. Leptospira DNA was detected in 20.4% of rats and 26.5% of pigs. We identified two Leptospira species and three sequence types (STs) in animals and humans: Leptospira interrogans ST140 in pigs only and L. interrogans ST17 and Leptospira borgpetersenii ST149 in humans and rats. Overall, L. interrogans was the dominant species and grouped into four clades: one clade including a human case only, two clades including human cases and dogs, and one clade including human cases and rats. All except one pig sample showed a unique L. interrogans (secY) genotype distinct from those isolated from humans, rats and dogs. Moreover, LipL32 sequencing allowed the detection of an additional Leptospira genotype in pigs, clearly distinct from the previous ones. Our data confirm rats as a major potential source for human leptospirosis in FP. By contrast to what was expected, farm pigs did not seem to be a major reservoir for the Leptospira genotypes identified in human patients. Thus, further investigations will be required to determine their significance in leptospirosis transmission in FP.

  2. Epidemiology of Leptospira Transmitted by Rodents in Southeast Asia

    Science.gov (United States)

    Mielcarek, Mathilde; Tatard, Caroline; Chaval, Yannick; Suputtamongkol, Yupin; Buchy, Philippe; Jittapalapong, Sathaporn; Herbreteau, Vincent; Morand, Serge

    2014-01-01

    Background Leptospirosis is the most common bacterial zoonoses and has been identified as an important emerging global public health problem in Southeast Asia. Rodents are important reservoirs for human leptospirosis, but epidemiological data is lacking. Methodology/Principal Findings We sampled rodents living in different habitats from seven localities distributed across Southeast Asia (Thailand, Lao PDR and Cambodia), between 2009 to 2010. Human isolates were also obtained from localities close to where rodents were sampled. The prevalence of Leptospira infection was assessed by real-time PCR using DNA extracted from rodent kidneys, targeting the lipL32 gene. Sequencing rrs and secY genes, and Multi Locus Variable-number Tandem Repeat (VNTR) analyses were performed on DNA extracted from rat kidneys for Leptospira isolates molecular typing. Four species were detected in rodents, L. borgpetersenii (56% of positive samples), L. interrogans (36%), L. kirschneri (3%) and L. weilli (2%), which were identical to human isolates. Mean prevalence in rodents was approximately 7%, and largely varied across localities and habitats, but not between rodent species. The two most abundant Leptospira species displayed different habitat requirements: L. interrogans was linked to humid habitats (rice fields and forests) while L. borgpetersenii was abundant in both humid and dry habitats (non-floodable lands). Conclusion/Significance L. interrogans and L. borgpetersenii species are widely distributed amongst rodent populations, and strain typing confirmed rodents as reservoirs for human leptospirosis. Differences in habitat requirements for L. interrogans and L. borgpetersenii supported differential transmission modes. In Southeast Asia, human infection risk is not only restricted to activities taking place in wetlands and rice fields as is commonly accepted, but should also include tasks such as forestry work, as well as the hunting and preparation of rodents for consumption, which

  3. Six new leptospiral serovars isolated from wild animals in Peru.

    OpenAIRE

    Liceras de Hidalgo, J L; Sulzer, K R

    1984-01-01

    Six new serovars of Leptospira interrogans were isolated from opossums (Didelphis marsupialis and Philander opossum) trapped in the Peruvian jungle. The proposed names, type strain designation, and serogroup of the serovars, respectively, were: huallaga, strain M-7, Djasiman serogroup; luis, strain M-6, Tarassovi serogroup; machiguenga, strain MMD-3, Icterohaemorrhagiae serogroup; rioja, strain MR-12, Bataviae serogroup; rupa rupa, strain M-3, Sejroe serogroup; and tingomaria, strain M-13, Cy...

  4. Niveles de anticuerpos bactericidas frente a meningococo C tras la vacunación de niños de 2 a 6 años de edad en Andalucía

    OpenAIRE

    Elena Delgado Torralbo; Julio Vázquez Moreno; Javier García León; Jesús González Enríquez; Ferrán Martínez Navarro; Sonsoles Berrón Morato; José María Mayoral Cortés; Mª. Angeles Rubin Gómez; Camila Méndez Martínez; Margarita Cortés Majó; Mónica Chaves Caballero; Mª Luisa Bernal González

    2000-01-01

    FUNDAMENTO: En 1997 el 18,5% de los casos de Enfermedad Meningocócica por serogrupo C en Andalucía fueron niños de 2 a 4 años de edad; edades donde respuesta inmune inicial y duración de la vacuna antimeningocócica de polisacárido capsular A+C, es menor que en edades superiores. Se diseñó una investigación para medir la respuesta inmune producida por esta vacuna, en niños de 2 a 6 años de edad, y compararla con la inmunidad natural presente en niños no vacunados. MÉTODOS: I.- Doble estudio de...

  5. Generation of Mammalian Host-adaptedLeptospira interrogansby Cultivation in Peritoneal Dialysis Membrane Chamber Implantation in Rats.

    Science.gov (United States)

    Grassmann, André Alex; McBride, Alan John Alexander; Nally, Jarlath E; Caimano, Melissa J

    2015-07-20

    Leptospira interrogans can infect a myriad of mammalian hosts, including humans (Bharti et al. , 2003; Ko et al. , 2009). Following acquisition by a suitable host, leptospires disseminate via the bloodstream to multiple tissues, including the kidneys, where they adhere to and colonize the proximal convoluted renal tubules (Athanazio et al. , 2008). Infected hosts shed large number of spirochetes in their urine and the leptospires can survive in different environmental conditions before transmission to another host. Differential gene expression by Leptospira spp. permits adaption to these new conditions. Here we describe a protocol for the cultivation of Leptospira interrogans within Dialysis Membrane Chambers (DMCs) implanted into the peritoneal cavities of Sprague-Dawley rats (Caimano et al. , 2014). This technique was originally developed to study mammalian adaption by the Lyme disease spirochete, Borrelia burgdorferi (Akins et al. , 1998; Caimano, 2005). The small pore size (8,000 MWCO) of the dialysis membrane tubing used for this procedure permits access to host nutrients but excludes host antibodies and immune effector cells. Given the physiological and environmental similarities between DMCs and the proximal convoluted renal tubule, we reasoned that the DMC model would be suitable for studying in vivo gene expression by L. interrogans . In a 20 to 30 min procedure, DMCs containing virulent leptospires are surgically-implanted into the rat peritoneal cavity. Nine to 11 days post-implantation, DMCs are explanted and organisms recovered. Typically, a single DMC yields ~10 9 mammalian host-adapted leptospires (Caimano et al. , 2014). In addition to providing a facile system for studying the transcriptional and physiologic changes pathogenic L. interrogans undergo within the mammal, the DMC model also provides a rationale basis for selecting new targets for mutagenesis and the identification of novel virulence determinants. Caution: Leptospira interrogans is a

  6. Environmental Factors Influencing White-Tailed Deer (Odocoileus virginianus Exposure to Livestock Pathogens in Wisconsin.

    Directory of Open Access Journals (Sweden)

    Shelli Dubay

    Full Text Available White-tailed deer (Odocoileus virginianus are commonly exposed to disease agents that affect livestock but environmental factors that predispose deer to exposure are unknown for many pathogens. We trapped deer during winter months on two study areas (Northern Forest and Eastern Farmland in Wisconsin from 2010 to 2013. Deer were tested for exposure to six serovars of Leptospira interrogans (grippotyphosa, icterohaemorrhagiae, canicola, bratislava, pomona, and hardjo, bovine viral diarrhea virus (BVDV-1 and BVDV-2, infectious bovine rhinotracheitis virus (IBR, and parainfluenza 3 virus (PI3. We used logistic regression to model potential intrinsic (e.g., age, sex and extrinsic (e.g., land type, study site, year, exposure to multiple pathogens variables we considered biologically meaningful to exposure of deer to livestock pathogens. Deer sampled in 2010-2011 did not demonstrate exposure to BVDV, so we did not test for BVDV in subsequent years. Deer had evidence of exposure to PI3 (24.7%, IBR (7.9%, Leptospira interrogans serovar pomona (11.7%, L. i. bratislava (1.0%, L. i. grippotyphosa (2.5% and L. i. hardjo (0.3%. Deer did not demonstrate exposure to L. interrogans serovars canicola and icterohaemorrhagiae. For PI3, we found that capture site and year influenced exposure. Fawns (n = 119 were not exposed to L. i. pomona, but land type was an important predictor of exposure to L. i. pomona for older deer. Our results serve as baseline exposure levels of Wisconsin white-tailed deer to livestock pathogens, and helped to identify important factors that explain deer exposure to livestock pathogens.

  7. Perturbando mentes: el cine como herramienta de transformación personal

    OpenAIRE

    Rodríguez Hoyos, Carlos; Manrique Solana, Rafael

    2015-01-01

    Resumen: En este artículo se analizan e interrogan las potencialidades didácticas del cine en los espacios de educación superior. Para ello, se revisan diversas propuestas de integración del cine en las aulas universitarias que han sido sistematizadas en dos grandes tradiciones: la educación para el cine y la educación con el cine. Finalmente, se realiza una propuesta de educación por el cine, que trata de reconocer y desarrollar el potencial de este medio para llevar a cabo transformaciones ...

  8. Literatura y violencia en la narrativa latinoamericana reciente

    OpenAIRE

    Basile, Teresa

    2015-01-01

    Los trabajos reunidos en Literatura y violencia en la narrativa latinoamericana reciente interrogan los modos de narrar las experiencias extremas de la historia latinoamericana de las últimas décadas. Configuran un variado mapa de la violencia de las últimas décadas, que comienza con las dictaduras del Cono Sur y arriba a los setecientos femicidios de Ciudad Juárez; un recorrido que va de sur a norte, de los 70 a los 90, de la violencia dictatorial a la violencia neoliberal y a la guerra de l...

  9. Balance sobre la historiografía del deporte en Colombia. Un panorama de su desarrollo

    OpenAIRE

    Ruiz Patiño, Jorge Humberto

    2017-01-01

    Este artículo busca realizar un análisis crítico de la producción académica sobre historia del deporte en Colombia. En concreto, las investigaciones se interrogan principalmente desde los temas que abordan y en menor medida desde sus presupuestos teóricos y abordajes metodológicos. El texto se encuentra dividido en dos secciones en las cuales se tratan de identificar las respuestas a dos grandes preguntas: ¿Cómo surge el deporte en Colombia? y ¿Cuáles son los factores que incidieron en la dif...

  10. Presentación a nuestro segundo volumen

    Directory of Open Access Journals (Sweden)

    Jessica Visotsky

    2013-07-01

    Full Text Available En nuestra segunda presentación de la revista nuestrAmérica hemos decidido dedicar este número a compilar una serie de reflexiones en torno a la universidad    pública  y  el  pensamiento  crítico.  Estos  escritos  condensan reflexiones y trabajos  en los que directamente o indirectamente sus autores problematizan a la universidad pública,   la interpelan, la interrogan en un trabajo dialéctico de mirar y mirarse en sus prácticas.

  11. Bilateral facial palsy associated with leptospirosis

    Directory of Open Access Journals (Sweden)

    Andressa Alves da Silva

    Full Text Available Leptospirosis is a zoonosis of worldwide occurrence caused by the spirochete Leptospira interrogans. It is an acute feverish disease with a broad clinical spectrum and follows a characteristic biphasic course. Bilateral facial palsy is a rare clinical condition and the differential diagnosis of its causes is extensive. The objective of this exploratory study, presented as a case report, is to describe the occurrence of bilateral facial palsy as an unusual manifestation of leptospirosis. This suggestion should not be overlooked when analyzing the causes for bilateral facial palsy, and should be considered with other possible differential diagnoses, some of which are potentially fatal.

  12. Expression of sialic acids and other nonulosonic acids in Leptospira

    Directory of Open Access Journals (Sweden)

    Ricaldi N Jessica

    2012-08-01

    Full Text Available Abstract Background Sialic acids are negatively charged nine carbon backbone sugars expressed on mammalian cell surfaces. Sialic acids are part of a larger family of nonulosonic acid (NulO molecules that includes pseudaminic and legionaminic acids. Microbial expression of sialic acids and other nonulosonic acids has been shown to contribute to host-microbe interactions in a variety of contexts, including participation in colonization, immune subversion, and behaviors such as biofilm formation, autoagglutination and motility. Previous research has suggested that some spirochetes may also express these molecules. Results Here we use a combination of molecular tools to investigate the presence of NulO biosynthetic gene clusters among clinical and saprophytic isolates of the genus Leptospira. Polymerase chain reaction and Southern blotting suggested that a variety of leptospires encoded NulO biosynthetic pathways. High performance liquid chromatography and mass spectrometry analyses provided biochemical evidence that di-N-acetylated NulO molecules are expressed at relatively high levels by L. interrogans serovar Lai strain 55601, and at lower levels by L. alexanderi serovar Manhao and L. fainei serovar Hurstbridge. Endogenous expression of N-acetylneuraminic acid (Neu5Ac, the most common sialic acid was documented in L. interrogans serovar Copenhageni strain L1-130. Neu5Ac biosynthesis is also supported by a unique gene fusion event resulting in an enzyme with an N-terminal N-acetylneuraminic acid synthase domain and a C-terminal phosphatase domain. This gene fusion suggests that L. interrogans uses a Neu5Ac biosynthetic pathway more similar to animals than to other bacteria. Analysis of the composition and phylogeny of putative NulO biosynthetic gene clusters in L. interrogans serovar Lai and serovar Copenhageni revealed that both strains have complete biosynthetic pathways for legionamimic acid synthesis, a molecule with the same stereochemistry

  13. Genotipificación y evaluación de la dinámica de infección de un aislamiento colombiano de Leptospira santarosai en el modelo experimental en hámster

    Directory of Open Access Journals (Sweden)

    Piedad Agudelo-Flórez

    2014-09-01

    Conclusión. Se identificó la presencia de la especie L. santarosai con capacidad patógena comparable con la cepa Fiocruz L1-130 de L. interrogans, de reconocida virulencia y tropismo pulmonar, en cuanto a los aspectos histopatológicos de tropismo a pulmón y riñón. Nunca antes se había evaluado en un modelo experimental un aislamiento de origen local bajo estos criterios biológicos.

  14. Resultados preliminares de la evaluación de diferentResultados diferentes concentraciones de la suspensión bacteriana empleada como inóculo en el Ensayo bactericida de Sangre Total

    Directory of Open Access Journals (Sweden)

    María Amalia Camaraza

    2000-06-01

    Full Text Available El Ensayo Bactericida del Suero (EBS, está considerado como la “prueba de oro” para evaluar la eficacia serológica de vacunas antimeningocócicas, teniendo en cuenta que la presencia de anticuerpos bactericidas en el suero se relaciona con la protección frente a esta enfermedad. Los niveles de anticuerpos anticapsulares obtenidos frente a los serogrupos A y C de Neisseria meningitidis han confirmado la utilidad de esta técnica. Sin embargo, se señala una pobre correlación entre los resultados de laboratorio y la protección clínica demostrada después de la aplicación de vacunas compuestas por vesículas de membrana externa del serogrupo B. Ison y colaboradores desarrollaron el Ensayo de Sangre Total (EST, que evalúa la capacidad bactericida de la sangre. Los resultados obtenidos indican que es un marcador de inmunidad más sensible que el EBS para el serogrupo B. En un estudio de evaluación de la vacuna antimeningocócica cubana VA-MENGOC-BC®, realizado en infantes y empleando el EST, se obtuvo un 50% de respondedores a la cepa homóloga (B:4:P1.19,15. La respuesta contra cepas heterólogas resultó baja. Teniendo en cuenta estos resultados y los de otros estudios realizados por los autores, se evaluó el comportamiento de la prueba utilizando concentraciones menores de la suspensión bacteriana empleada como inóculo. Para este propósito se estudió la actividad bactericida de la sangre de dos adultos sanos, mediante el EST frente a las cepas B:4:P1.19,15 (Cu 385/83 y B:15:P1.7,16 (MC58. Se evaluaron, además de la concentración recomendada originalmente (106ó107 UFC/mL, dos inferiores (105 y 104 UFC/mL. El primer donante mostró una actividad lítica del 40% frente a la cepa homóloga, a una concentración de inóculo de 107 UFC/mL. Para las concentraciones de 105 y 104 UFC/mL la lisis fue de alrededor del 80%. El comportamiento frente a la cepa heteróloga fue de un 25% de lisis a la mayor concentración del inóculo y

  15. Brote de legionelosis en Murcia en julio de 2001. La óptica de sanidad ambiental

    Directory of Open Access Journals (Sweden)

    C. Gutiérrez Molina

    2002-06-01

    Full Text Available Se exponen las medidas de intervención adoptadas para el estudio y control del brote. Se encontraron 126 instalaciones con riesgo (45 de ellas de alto: 70 torres de refrigeración y similares, 35 fuentes ornamentales, 1 obra con movimiento de tierra y 20 sistemas con circuito cerrado aire-agua, que se distribuyeron por categorías de riesgo.De forma inmediata se clausuraron: las fuentes ornamentales, el baldeo de calles y riegos por aspersión de parques y la obra.Se realizaron un total de 486 inspecciones y 1040 toma de muestras, ordenando la limpieza y desinfección de torres de refrigeración y similares y su clausura en caso necesario. Posteriormente, se cambio de relleno en torres de refrigeración positivas a Lp.Del total de instalaciones investigadas (339, en 57 (16’9% se encontró un cultivo positivo a Lp. Distribución por tipo de instalación con cultivo positivo a Lp: en torres de refrigeración 23 (6’8%, en fuentes ornamentales 3 (7,32% y en agua sanitaria 31 (9’1%.Distribución por serogrupos: LpS1 (62’3%, serogrupos 2-14 (36’68%.LpS1Olda Olda (21’74% fue la mas abundante seguida de LpS1 Pontiac Filadelfia Lugano (18’84% frente a LpS1 Pontiac Filadelfia Glasgow (en 1 ocasión, 1’45%, esta ultima fue la aislada en las 18 muestras de enfermos.En 355 ocasiones se dispone de cultivo y PCR, encontrándose una sensibilidad de 30,8% (Intervalo de confianza al 95%, de 25,1 y una especificidad del 99,4±0,8. Hay que considerar la eventual influencia en los resultados aportada por la posible aparición de dos falsos negativos en el cultivo.Se encuentra un elevado porcentaje de muestras correspondientes a Legionella pneumophilla serogrupo 1, dentro de estas prevalecen las tipo Pontiac Philadelphia, y dentro de estas las tipo Lugano.La primera desinfección no erradicó la contaminación en su totalidad. Abundando en lo anterior, el hallazgo de un número considerable de torres de refrigeración positivas a Lp tras limpieza y

  16. Comparision of efficacy of two experimental bovine leptospira vaccines under laboratory and field.

    Science.gov (United States)

    Balakrishnan, G; Roy, Parimal

    2014-05-15

    Two different inactivated vaccines for bovine leptospirosis were prepared with five different Leptospira serovars namely australis, ballum, hardjo, hebdomadis and pomona and adjuvanted with Montanide ISA 206 (Vaccine-I) or adjuvanted with Aluminium hydroxide gel (Vaccine-II) to evaluate the efficacy of the vaccines. The immunogenicity of the vaccines was studied in rabbits under experimental condition and in cattle under field condition for a period of 180 days. Antibody response against five different leptospira serovars ranged from 6.84 log2 to 9.64 log2 (GM-MAT titres) in rabbits at 180 days after vaccination with vaccine I, whereas in vaccine II, the titre value ranged from 5.64 log2 to 7.44 log2. In the case of cattle under field condition, vaccine I showed GM-MAT titres of 6.84 log2 to 7.69 log2 against five different serovars at 150 days following vaccination. Such titres were maintained following vaccination with vaccine II for 120 days only. It is concluded that vaccine I is a better vaccine than vaccine II. However both the vaccines showed high immune response of 5.64 log2 at six months of immunization. Vaccination did not cause any adverse reaction in the vaccinated cattle. Copyright © 2014 Elsevier B.V. All rights reserved.

  17. Portadores nasofaríngeos de Neisseria meningitidis en trabajadores con riesgo ocupacional

    Directory of Open Access Journals (Sweden)

    Isabel Martínez

    2010-04-01

    Full Text Available Los portadores de Neisseria meningitidis constituyen la principal fuente de infección y transmisión de la enfermedad meningocócica. Conocer su prevalencia, las características de las cepas aisladas y los factores de riesgos asociados con el estado de portador, aportan datos valiosos al control y vigilancia epidemiológica de esta entidad clínica. Para cumplimentar los objetivos propuestos se realizó un estudio transversal descriptivo de portadores de N. meningitidis en 112 trabajadores de un centro de producción de biofarmacéuticos de La Habana, con edades comprendidas entre 18_60 años. Previo a su realización se cumplió con las exigencias bioéticas requeridas para este tipo de estudio. A todos se les realizó un exudado nasofaríngeo y una encuesta, donde se indagó sobre factores de riesgo (edad, sexo, hacinamiento, hábito de fumar, consumo de bebidas alcohólicas, amigdalectomía y antecedentes de infección respiratoria que favorecen la condición del portador. La identificación de las cepas de N. meningitidis se realizó según métodos convencionales, la clasificación de los serogrupos se hizo por aglutinación en láminas portaobjetos con antisueros comerciales y para la identificación de los serotipos y subtipos se empleó un ensayo inmunoenzimático (ELISA de células enteras con anticuerpos monoclonales. Se detectó un 8% de portadores de N. meningitidis con predominio del serogrupo B (77,8% y el fenotipo más frecuente fue el B:4:P1.4 (33,3%. Al analizar el estado de portador y su asociación con los factores de riesgo, la edad (p = 0,05 y el sexo (p = 0,013 mostraron diferencias significativas. Se demostró la posibilidad del riesgo ocupacional en aquellos individuos que por su profesión están en contacto con microorganismos patógenos

  18. Enfermedad meningocócica.Un estudio de caso control en Ciudad Habana, noviembre 2003-julio 2005

    Directory of Open Access Journals (Sweden)

    Antonio Pérez

    2011-04-01

    Full Text Available Cuba ejecuta un programa de inmunización antimeningocócica desde 1991. El propósito de este estudio fue identificar posibles factores asociados a la ocurrencia de casos en grupos de vacunados. Un total de nueve casos con enfermedad meningocócica (EM en Ciudad Habana se registraron en el período noviembre de 2003- julio 2005 en menores de 20 años, pero se estudiaron solo 7, por encontrarse uno fuera del país y otro fallecido. Se seleccionaron aleatoriamente 34 controles comunitarios para comparar con los casos e identificar algunos factores de riesgo asociados y evaluar los anticuerpos bactericidas y ELISA existentes contra la proteína de membrana externa del serogrupo B. El 100% de los casos estudiados presentó la forma meníngea, con una estadía hospitalaria promedio de 9,8 días y una letalidad de 14,3% (1/7. En el análisis bivariado se encontró la no lactancia materna asociada (OR 3,17 IC95%= 0,44-27,85 a la ocurrencia de la enfermedad, sin significación estadística (p>0,05 por el pequeño universo de estudio. Finalmente, la regresión logística multivariada indicó asociación con la no lactancia materna (OR 3,22 IC95%= 0,52-19,52 con la ocurrencia de la enfermedad, pero igualmente esta no fue significativa. La prueba de Mann Whitney para la comparación de los títulos de anticuerpos para el antígeno B en casos y controles mostró una diferencia muy significativa (p< 0,01 a favor de los enfermos, por la respuesta de la memoria inmune a la infección natural. La vacuna cubana es protectora para la enfermedad meningocócica serogrupo BC. En el 57% de los casos de EM los síntomas comenzaron como promedio cuatro años después de la aplicación de la segunda dosis de la vacuna.

  19. Bacteriemia por Vibrio cholerae no-O1, no-O139 en un paciente en hemodiálisis crónica Non-O1, non-O139 Vibrio cholerae bacteremia in a chronic hemodialysis patient

    Directory of Open Access Journals (Sweden)

    Mariela S. Zárate

    2011-06-01

    Full Text Available Vibrio cholerae no-O1, no-O139 es un agente poco frecuente como causal de bacteriemias y no hay informes que documenten su presencia en pacientes en hemodiálisis crónica. Se describe el caso de una paciente en hemodiálisis crónica que presentó un cuadro de sepsis, por lo cual inició un tratamiento con vancomicina y ceftacidima. Al cabo de seis horas y media de incubación en el sistema BACT/ALERT de hemocultivo, se evidenció la presencia de bacilos curvos gram negativos, posteriormente identificados como Vibrio cholerae mediante pruebas bioquímicas convencionales y el uso de los kits API 20 NE y VITEK 2. La evaluación del serogrupo y de la presencia de factores de patogenicidad, realizada en el laboratorio de referencia, determinó que el microorganismo hallado pertenecía al serogrupo no-O1, no-O139. No se detectó la toxina de cólera, tampoco el factor de colonización ni la toxina termoestable. El aislamiento presentó sensibilidad frente a ampicilina, trimetoprima-sulfametoxazol, ciprofloxacina, tetraciclina, ceftacidima y cefotaxima por el método de difusión con discos y por VITEK 2. La paciente cumplió 14 días de tratamiento con ceftacidima endovenosa, con evolución favorable.Non-O1, and non-O139 Vibrio cholerae is an infrequent cause of bacteremia. There are no reports of such bacteremia in chronic hemodialysis patients. This work describes the case of a chronic hemodialysis patient that had an episode of septicemia associated with dialysis. Blood cultures were obtained and treatment was begun with vancomycin and ceftazidime. After 6.5 hours of incubation in the Bact/Alert system there is evidence of gram-negative curved bacilli that were identified as Vibrio cholerae by conventional biochemical tests, API 20 NE and the VITEK 2 system. This microorganism was sent to the reference laboratory for evaluation of serogroup and virulence factors and was identified as belonging to the non-O1 and non-O139 serogroup. The cholera

  20. Structural and functional characterization of an orphan ATP-binding cassette ATPase involved in manganese utilization and tolerance in Leptospira spp.

    Science.gov (United States)

    Benaroudj, Nadia; Saul, Frederick; Bellalou, Jacques; Miras, Isabelle; Weber, Patrick; Bondet, Vincent; Murray, Gerald L; Adler, Ben; Ristow, Paula; Louvel, Hélène; Haouz, Ahmed; Picardeau, Mathieu

    2013-12-01

    Pathogenic Leptospira species are the etiological agents of the widespread zoonotic disease leptospirosis. Most organisms, including Leptospira, require divalent cations for proper growth, but because of their high reactivity, these metals are toxic at high concentrations. Therefore, bacteria have acquired strategies to maintain metal homeostasis, such as metal import and efflux. By screening Leptospira biflexa transposon mutants for their ability to use Mn(2+), we have identified a gene encoding a putative orphan ATP-binding cassette (ABC) ATPase of unknown function. Inactivation of this gene in both L. biflexa and L. interrogans strains led to mutants unable to grow in medium in which iron was replaced by Mn(2+), suggesting an involvement of this ABC ATPase in divalent cation uptake. A mutation in this ATPase-coding gene increased susceptibility to Mn(2+) toxicity. Recombinant ABC ATPase of the pathogen L. interrogans exhibited Mg(2+)-dependent ATPase activity involving a P-loop motif. The structure of this ATPase was solved from a crystal containing two monomers in the asymmetric unit. Each monomer adopted a canonical two-subdomain organization of the ABC ATPase fold with an α/β subdomain containing the Walker motifs and an α subdomain containing the ABC signature motif (LSSGE). The two monomers were arranged in a head-to-tail orientation, forming a V-shaped particle with all the conserved ABC motifs at the dimer interface, similar to functional ABC ATPases. These results provide the first structural and functional characterization of a leptospiral ABC ATPase.

  1. Isolation and characterization of partially purified leptospiral antigens Isolamento e caracterização de antígenos parcialmente purificados de Leptospira

    Directory of Open Access Journals (Sweden)

    M.C. Koury

    1991-10-01

    Full Text Available The methanol extract of Leptospira interrogans serovar canicola was purified by precipitation with acetone or acetone and chloroform. The antigenicity of the antigen was not altered by heating or treatment with pepsin and pronase. However the antigenicity was lost when the antigen was treated with periodic acid. Chemical analysis revealed the presence of 40% carbohydrate (22% methylpentose, 28%; hexoses,4% protein, 20% lipid and 2,7% phosphate. The complement fixation test with sera from patients with leptospirosis agreed with the microscopic agglutination reaction.Extrato metílico de Leptospira interrogans sorovar canicola foi purificado por precipitação com acetona ou acetona e clorofórmio. A antigenicidade não foi alterada por aquecimento ou tratamento com pepsina e pronase, entretanto foi perdida quando o antígeno foi tratado com ácido periódico. Análise química revelou a presença de 40% de carboidrato (22% de metilpentose, 28% de hexose, 4% de proteína, 20% de lípide e 2,7% de fosfato. Reação de fixação de complemento realizada com soros de pacientes com leptospirose apresentou concordância com a reação de aglutinação microscópica.

  2. Brote de leptospirosis en terneros en recría en la provincia de Corrientes, Argentina Leptospirosis outbreak in calves from Corrientes Province, Argentina

    Directory of Open Access Journals (Sweden)

    María G. Draghi

    2011-03-01

    Full Text Available La leptospirosis es una enfermedad infecciosa que produce importantes pérdidas económicas en la producción ganadera. Los signos característicos de la enfermedad son aborto, muerte embrionaria, muerte de terneros de pocos días de vida y mastitis. Se describe un brote de leptospirosis en terneros en actividad de recría. Se realizaron estudios histopatológicos, de hemoparásitos, inmunofluorescencia y cultivos bacterianos. Se aisló Leptospira interrogans serovar Pomona a partir de muestras de los terneros muertos.Leptospirosis is an infectious disease resulting in significant economic losses in livestock production. This disease causes abortion, embryo death, death of calves within the first few days of life and mastitis. We report a leptospirosis outbreak in calf growing and fattening. Histopathological and hemoparasite studies, immunofluorescence, and bacterial cultures were performed. A strain of Leptospira interrogans serovar Pomona was isolated from samples collected from dead calves.

  3. Serosurvey of Leptospirainterrogans, Brucellaabortus and Chlamydophilaabortus infection in free-ranging giant anteaters (Myrmecophaga tridactyla from Brazil

    Directory of Open Access Journals (Sweden)

    Flávia R. Miranda

    2015-05-01

    Full Text Available Abstract:A serological survey for antibodies against Leptospira interrogans, Brucella abortus, and Chlamydophila abortus was conducted in 21 clinically healthy, free-ranging giant ant- eaters (Myrmecophaga tridactyla from Parque Nacional das Emas (Goiás State, Brazil; n=6, Parque Nacional da Serra da Canastra (Minas Gerais State, Brazil; n=9, and RPPN SESC Pantanal (Mato Grosso State, Brazil; n=6 between July 2001 and September 2006. Sera were screened for antibodies against 22 serovars of Leptospira interrogans with a microscopic agglutination test. Twelve tested positive for L. interrogansserovars sentot (n=5 in PN Emas, n=2 in PN Serra da Canastra, butembo (n=2 in PN Serra da Canastra, autumnalis, bataviae, and shermani/icterohaemorrhagiae(n=1 each in SESC PantanalOne adult female tested positive for B. abortus with the buffered plate antigen test. All sera were negative for C. abortususing the complement fixation text. This is the first report of pathogens that may interfere with the reproduction and population dynamics of free-ranging giant anteaters.

  4. Use of a New High Resolution Melting Method for Genotyping Pathogenic Leptospira spp.

    Directory of Open Access Journals (Sweden)

    Florence Naze

    Full Text Available Leptospirosis is a worldwide zoonosis that is endemic in tropical areas, such as Reunion Island. The species Leptospira interrogans is the primary agent in human infections, but other pathogenic species, such as L. kirschner and L. borgpetersenii, are also associated with human leptospirosis.In this study, a melting curve analysis of the products that were amplified with the primer pairs lfb1 F/R and G1/G2 facilitated an accurate species classification of Leptospira reference strains. Next, we combined an unsupervised high resolution melting (HRM method with a new statistical approach using primers to amplify a two variable-number tandem-repeat (VNTR for typing at the subspecies level. The HRM analysis, which was performed with ScreenClust Software, enabled the identification of genotypes at the serovar level with high resolution power (Hunter-Gaston index 0.984. This method was also applied to Leptospira DNA from blood samples that were obtained from Reunion Island after 1998. We were able to identify a unique genotype that is identical to that of the L. interrogans serovars Copenhageni and Icterohaemorrhagiae, suggesting that this genotype is the major cause of leptospirosis on Reunion Island.Our simple, rapid, and robust genotyping method enables the identification of Leptospira strains at the species and subspecies levels and supports the direct genotyping of Leptospira in biological samples without requiring cultures.

  5. A survey of zoonotic pathogens carried by house mouse and black rat populations in Yucatan, Mexico.

    Science.gov (United States)

    Panti-May, J A; DE Andrade, R R C; Gurubel-González, Y; Palomo-Arjona, E; Sodá-Tamayo, L; Meza-Sulú, J; Ramírez-Sierra, M; Dumonteil, E; Vidal-Martínez, V M; Machaín-Williams, C; DE Oliveira, D; Reis, M G; Torres-Castro, M A; Robles, M R; Hernández-Betancourt, S F; Costa, F

    2017-08-01

    The house mouse (Mus musculus) and the black rat (Rattus rattus) are reservoir hosts for zoonotic pathogens, several of which cause neglected tropical diseases (NTDs). Studies of the prevalence of these NTD-causing zoonotic pathogens, in house mice and black rats from tropical residential areas are scarce. Three hundred and two house mice and 161 black rats were trapped in 2013 from two urban neighbourhoods and a rural village in Yucatan, Mexico, and subsequently tested for Trypanosoma cruzi, Hymenolepis diminuta and Leptospira interrogans. Using the polymerase chain reaction we detected T. cruzi DNA in the hearts of 4·9% (8/165) and 6·2% (7/113) of house mice and black rats, respectively. We applied the sedimentation technique to detect eggs of H. diminuta in 0·5% (1/182) and 14·2% (15/106) of house mice and black rats, respectively. Through the immunofluorescent imprint method, L. interrogans was identified in 0·9% (1/106) of rat kidney impressions. Our results suggest that the black rat could be an important reservoir for T. cruzi and H. diminuta in the studied sites. Further studies examining seasonal and geographical patterns could increase our knowledge on the epidemiology of these pathogens in Mexico and the risk to public health posed by rodents.

  6. Comparative genomic analyses of transport proteins encoded within the genomes of Leptospira species.

    Science.gov (United States)

    Buyuktimkin, Bora; Saier, Milton H

    2015-11-01

    Select species of the bacterial genus Leptospira are causative agents of leptospirosis, an emerging global zoonosis affecting nearly one million people worldwide annually. We examined two Leptospira pathogens, Leptospira interrogans serovar Lai str. 56601 and Leptospira borgpetersenii serovar Hardjo-bovis str. L550, as well as the free-living leptospiral saprophyte, Leptospira biflexa serovar Patoc str. 'Patoc 1 (Ames)'. The transport proteins of these leptospires were identified and compared using bioinformatics to gain an appreciation for which proteins may be related to pathogenesis and saprophytism. L. biflexa possesses a disproportionately high number of secondary carriers for metabolite uptake and environmental adaptability as well as an increased number of inorganic cation transporters providing ionic homeostasis and effective osmoregulation in a rapidly changing environment. L. interrogans and L. borgpetersenii possess far fewer transporters, but those that they have are remarkably similar, with near-equivalent representation in most transporter families. These two Leptospira pathogens also possess intact sphingomyelinases, holins, and virulence-related outer membrane porins. These virulence-related factors, in conjunction with decreased transporter substrate versatility, indicate that pathogenicity was accompanied by progressively narrowing ecological niches and the emergence of a limited set of proteins responsible for host invasion. The variability of host tropism and mortality rates by infectious leptospires suggests that small differences in individual sets of proteins play important physiological and pathological roles. Copyright © 2015 Elsevier Ltd. All rights reserved.

  7. Molecular and serological characterization of the first Leptospira santarosai strain isolated from a dog.

    Science.gov (United States)

    Miotto, Bruno Alonso; Moreno, Luisa Zanolli; Guilloux, Aline Gil Alves; Sousa, Gisele Oliveira de; Loureiro, Ana Paula; Moreno, Andrea Micke; Lilenbaum, Walter; Vasconcellos, Silvio Arruda; Heinemann, Marcos Bryan; Hagiwara, Mitika Kuribayashi

    2016-10-01

    Leptospirosis is a zoonotic disease of global importance caused by pathogenic Leptospira species. Dogs can become asymptomatically infected, acting like reservoir hosts for pathogenic Leptospira, notably Leptospira interrogans serovar Canicola. Identification of such individuals and characterization of leptospires involved in chronic infections may unravel the role of dogs in the epidemiology of particular leptospiral strains. The aim of the present work was to describe the first Leptospira santarosai strain isolated from a dog. The dog was kept in a public shelter in São Paulo city, Brazil, and presented asymptomatic urinary shedding detected by PCR. Prospective evaluation was performed to fully characterize its chronic carrier state. The dog did not present anti-Leptospira titles or clinical/laboratorial abnormalities during the evaluations; nevertheless long-term urinary shedding was confirmed by PCR and leptospires were recovered from two occasions. The isolated strain was molecularly characterized by partial 16S rRNA and secY gene sequencing and MLST analysis. Serogroup identification was performed using polyclonal antibodies. The strain was identified as Leptospira santarosai, serogroup Sejroe. This is the first evidence in the literature of the isolation of L. santarosai in dogs. Our findings show that dogs can persistently harbor leptospires other than L. interrogans. Copyright © 2016 Elsevier B.V. All rights reserved.

  8. Whole Genome Shotgun Sequencing Shows Selection on Leptospira Regulatory Proteins during in vitro Culture Attenuation

    Science.gov (United States)

    Lehmann, Jason S.; Corey, Victoria C.; Ricaldi, Jessica N.; Vinetz, Joseph M.; Winzeler, Elizabeth A.; Matthias, Michael A.

    2016-01-01

    Leptospirosis is the most common zoonotic disease worldwide with an estimated 500,000 severe cases reported annually, and case fatality rates of 12–25%, due primarily to acute kidney and lung injuries. Despite its prevalence, the molecular mechanisms underlying leptospirosis pathogenesis remain poorly understood. To identify virulence-related genes in Leptospira interrogans, we delineated cumulative genome changes that occurred during serial in vitro passage of a highly virulent strain of L. interrogans serovar Lai into a nearly avirulent isogenic derivative. Comparison of protein coding and computationally predicted noncoding RNA (ncRNA) genes between these two polyclonal strains identified 15 nonsynonymous single nucleotide variant (nsSNV) alleles that increased in frequency and 19 that decreased, whereas no changes in allelic frequency were observed among the ncRNA genes. Some of the nsSNV alleles were in six genes shown previously to be transcriptionally upregulated during exposure to in vivo-like conditions. Five of these nsSNVs were in evolutionarily conserved positions in genes related to signal transduction and metabolism. Frequency changes of minor nsSNV alleles identified in this study likely contributed to the loss of virulence during serial in vitro culture. The identification of new virulence-associated genes should spur additional experimental inquiry into their potential role in Leptospira pathogenesis. PMID:26711524

  9. Comparative analyses of transport proteins encoded within the genomes of Leptospira species.

    Science.gov (United States)

    Buyuktimkin, Bora; Saier, Milton H

    2016-09-01

    Select species of the bacterial genus Leptospira are causative agents of leptospirosis, an emerging global zoonosis affecting nearly one million people worldwide annually. We examined two Leptospira pathogens, Leptospira interrogans serovar Lai str. 56601 and Leptospira borgpetersenii serovar Hardjo-bovis str. L550, as well as the free-living leptospiral saprophyte, Leptospira biflexa serovar Patoc str. 'Patoc 1 (Ames)'. The transport proteins of these leptospires were identified and compared using bioinformatics to gain an appreciation for which proteins may be related to pathogenesis and saprophytism. L. biflexa possesses a disproportionately high number of secondary carriers for metabolite uptake and environmental adaptability as well as an increased number of inorganic cation transporters providing ionic homeostasis and effective osmoregulation in a rapidly changing environment. L. interrogans and L. borgpetersenii possess far fewer transporters, but those that they all have are remarkably similar, with near-equivalent representation in most transporter families. These two Leptospira pathogens also possess intact sphingomyelinases, holins, and virulence-related outer membrane porins. These virulence-related factors, in conjunction with decreased transporter substrate versatility, indicate that pathogenicity arose in Leptospira correlating to progressively narrowing ecological niches and the emergence of a limited set of proteins responsible for host invasion. The variability of host tropism and mortality rates by infectious leptospires suggests that small differences in individual sets of proteins play important physiological and pathological roles. Copyright © 2016. Published by Elsevier Ltd.

  10. Serology and protein electrophoresis for evidence of exposure to 12 mink pathogens in free-ranging American mink (Neovison vison) in Argentina.

    Science.gov (United States)

    Martino, Pablo Eduardo; Samartino, Luis Ernesto; Stanchi, Néstor Oscar; Radman, Nilda Esther; Parrado, Eduardo Joaquín

    2017-12-01

    Basic pathologic characteristics for farmed minks were previously reported worldwide. However, its status in the wild has not been studied in detail. Serology and electrophoresis were carried out for evidence of exposure to 12 mink pathogens on two different locations. Serology was done in 87 wild minks by reference techniques against Toxoplasma gondii, Encephalitozoon cuniculi, Neospora caninum, Brucella abortus, Mycobacterium bovis, Leptospira interrogans, canine distemper virus (CDV), canine adenovirus (CAV), canine parvovirus (CPV), rabies virus (RV), Influenza A virus (FLUAV) and Aleutian disease virus (ADV). Hypergammaglobulinemia, the ADV main clinical feature, was determined by conventional electrophoresis. Seventy-one percent of the 87 sera had antibodies against one or more pathogens. ADV accounted for the highest seroprevalence (29%), followed by T. gondii (26%), L. interrogans (14%), M. bovis (12%), B. abortus (9%), N. caninum (3%), CPV (3%) and CDV (2%). Seroprevalence was influenced by location but not sex or age. Additionally, 16% of the seropositive samples for ADV had gammaglobulin levels >40.0 g/L. Antibody titers for CDV and CPV were low and difficult to interpret as almost all these cases had borderline concentrations. A cautious interpretation of the results is urged as the epidemiological role of the wild mink is largely unexplored for most of these agents. Nevertheless, the information may be clinically relevant..

  11. Development of an indirect enzyme-linked immunosorbent assay for the detection of leptospiral antibodies in dogs.

    Science.gov (United States)

    Ribotta, M J; Higgins, R; Gottschalk, M; Lallier, R

    2000-01-01

    Serology plays an important role in the diagnosis of leptospirosis. Few laboratories have the resources, expertise, or facilities to perform the microscopic agglutination test (MAT). Thus, there is a need for a rapid and simple serological test that could be used in any diagnostic laboratory. In this study, a genus-specific, heat-stable antigenic preparation from Leptospira interrogans serovar pomona was used in an enzyme-linked immunosorbent assay (ELISA) for the detection of leptospiral antibodies in dog sera. This antigenic preparation reacted with rabbit antisera against L. interrogans serovars bratislava, autumnalis, icterohaemorrhagiae and pomona and with rabbit antiserum against L. kirschneri serovar grippotyphosa. The ELISA showed a relative specificity of 95.6% with 158 dog sera which were negative at a dilution of 1:100 in the MAT for serovars pomona, bratislava, icterohaemorrhagiae, autumnalis, hardjo, and grippotyphosa. The relative sensitivity of this assay with 21 dog sera that revealed serovars MAT titres of > or =100 to different serovars was 100%. This assay is easily standardized, technically more advantageous than MAT, and uses an antigenic preparation that can be routinely prepared in large amounts. It was concluded that this ELISA is sufficiently sensitive test to be used as an initial screening test for the detection of leptospiral antibodies in canine sera, with subsequent confirmation of positive test results with the MAT.

  12. Isolation of Leptospira from a phocid: acute renal failure and mortality from Leptospirosis in rehabilitated northern elephant seals (Mirounga angustirostris), California, USA.

    Science.gov (United States)

    Delaney, Martha A; Colegrove, Kathleen M; Spraker, Terry R; Zuerner, Richard L; Galloway, Renee L; Gulland, Frances M D

    2014-07-01

    During rehabilitation, acute renal failure due to leptospirosis occurred in eight male northern elephant seals (Mirounga angustirostris) that stranded along the central California coast in 2011. Characteristic histologic lesions including renal tubular degeneration, necrosis, and mineralization, and mild lymphoplasmacytic interstitial nephritis were noted in the six animals examined. Immunohistochemistry, bacterial culture, and PCR were positive in 2/3, 2/3, and 3/4 seals, respectively, and 6/8 had high serum antibody titers to Leptospira interrogans serovar pomona. Pulsed-field gel electrophoresis confirmed one isolate as serovar pomona. Variable number tandem repeat (VNTR) analysis showed both elephant seal isolates were identical to each other but distinct from those isolated from California sea lions (Zalophus californianus). The time from stranding to onset of azotemia was 1 to 38 (median=24) days, suggesting some seals were infected at the rehabilitation facility. Based on temporal and spatial incidence of infection, transmission among elephant seals likely occurred during rehabilitation. Molecular (VNTR) analysis of the two isolates indicates there is a unique L. interrogans serovar pomona genotype in elephant seals, and sea lions were not the source of infection prior to or during rehabilitation. This study confirms the susceptibility of northern elephant seals to leptospirosis, indicates intraspecies transmission during rehabilitation, and reports the first isolation and preliminary characterization of leptospires from elephant seals.

  13. Streptococcus pneumoniae aislados durante 2002-2006: serotipos y resistencia antibiótica. Correlación con las vacunas existentes

    Directory of Open Access Journals (Sweden)

    José María Guevara-Duncan

    2008-03-01

    Full Text Available Objetivos: Identificar los serotipos de S. pneumoniae aislados, correlacionándolos con los incluidos en las vacunas existentes y su resistencia antimicrobiana. Diseño: Estudio descriptivo, observacional y longitudinal. Lugar: Instituto de Medicina Tropical Daniel A. Carrión, Facultad de Medicina, UNMSM. Material biológico: Cepas de Streptococcus pneumoniae. Intervenciones: Cuarenta Streptococcus pneumoniae de nuestro cepario, aislados entre el 2002 y 2006, fueron serotipificados en el Instituto de Salud Carlos III en Madrid -España; 15 fueron invasivos, 11 aislados de infecciones localizadas, 6 de portadores y 8 eran multiresistentes. Principales medidas de resultados: Protección de las vacunas existentes en nuestro medio a las infecciones causadas por Streptococcus pneumoniae. Resultados: Hubo 14 serotipos diferentes y los serogrupos más identificados fueron 23, 19 y 6. El 28,6% estaba contenido en la vacuna 7-valente, 42,9% en la 9-valente, 50% en la 11-valente y el 71,4% en la 23-valente; 57,5% fue resistente a la penicilina y 30% a eritromicina. El grupo de Streptococcus invasivo resultó más sensible a los antibióticos que los otros grupos. Los serotipos asociados a multirresistencia fueron 19F y 23F. Conclusiones: Ninguna de las vacunas protege a todas las infecciones causadas por Streptococcus pneumoniae, en nuestro medio.

  14. Leptospirosis infantil en pacientes con síndrome febril en la región de Urabá, Colombia

    Directory of Open Access Journals (Sweden)

    Janeth Pérez-García

    Full Text Available El objetivo del estudio fue describir los casos de leptospirosis infantil en cuatro municipios de la región de Urabá (Colombia y factores relacionados con severidad de los cuadros clínicos. Se realizó un estudio transversal analítico retrospectivo de 74 pacientes menores de 17 años con síndrome febril por leptospirosis entre 2010 y 2012. El mayor número de casos correspondió a niños de áreas urbanas (57/74; 77%, entre 10 y 14 años (33/74; 44,5%. La respuesta por MAT más frecuente fue a los serogrupos Grippothyposa y Bratislava, asociados a reservorios silvestres y pecuarios respectivamente. Se encontró asociación entre la presencia de animales domésticos dentro de la vivienda (OR 2,73; IC95% 0,98-7,60; p=0,05 y la severidad de la enfermedad. El riesgo de leptospirosis infantil severa se relaciona con la tenencia de animales domésticos dentro de la vivienda.

  15. Estudio de toxicidad por dosis única y tolerancia local de una vacuna antimeningocócica tipo B en ratas Sprague Dawley

    Directory of Open Access Journals (Sweden)

    Juan F. Núñez

    2006-08-01

    Full Text Available La vacuna antimeningocócica tipo B, objetivo de este estudio, contiene vesículas purificadas de la membrana externa del meningococo del serogrupo B de la cepa (Cu- 385 - 83 B:4:P1.19,15. El esquema de vacunación propuesto en humanos consiste en tres dosis de 0,5 mL, separadas por un intervalo óptimo de ocho semanas. El objetivo de este estudio de toxicidad en ratas Sprague Dawley (SD fue determinar la toxicidad potencial, letalidad, órganos, sistemas susceptibles y otros eventos adversos, así como la toxicidad en el sitio de inoculación después de la administración de una dosis de la vacuna en estudio. Los resultados indicaron que, bajo las condiciones del estudio y según los criterios establecidos para evaluar los resultados, la vacuna antimeningocócica tipo B, no produce efectos tóxicos en el modelo animal usado. Todo lo que se observó fueron formaciones granulomatosas a nivel del punto de inoculación. Estas formaciones han sido reportadas como pertenecientes a los adyuvantes de depósito, como el hidróxido de aluminio, usado en otras vacunas parenterales. Se concluye que la vacuna antimeningocócica tipo B resultó satisfactoria en las pruebas de toxicidad por dosisúnica y tolerancia local realizadas en la especie rata.

  16. VACUNAS E INFECCIONES RESPIRATORIAS

    Directory of Open Access Journals (Sweden)

    Dr. Rodolfo Villena

    2017-01-01

    Full Text Available Las vacunas han demostrado ser una excelente estrategia para reducir la morbimortalidad en infecciones respiratorias, con un perfil de seguridad adecuado. Nuestro PNI incorpora varias de ellas con este objetivo, logrando resultados de alto impacto a nivel de salud pública. Para que esto prosiga se requiere de nuestro compromiso y conocimiento para estimular, difundir y obtener altas tasas de cobertura, de manera de lograr efectos de protección indirecta, conocidos como inmunidad comunitaria. Por otro lado, se debe mantener la vigilancia epidemiológica de los agentes inmunoprevenibles para conocer su oscilación temporal, serogrupos, sero y/o genotipos, de manera de establecer directrices adecuadas de edad y esquemas de vacunación para la población. Debemos avanzar en estos temas y realizar estudios de efectividad de las vacunas que hemos introducido, para conocer su aporte en la prevención de infecciones respiratorias, de manera de objetivar sus beneficios, conocer el impacto en poblaciones de riesgo y avanzar en la vacunación de embarazadas, para otorgar mejores estrategias de prevención a nuestra población.

  17. Sistema de Lotes de Siembra de cepas de Neisseria meningitidis cultivadas en medios de origen no animal

    Directory of Open Access Journals (Sweden)

    Carmen Alina del Puerto-Sardiñas

    2016-04-01

    Full Text Available En la producción de biológicos, especialmente aquellos obtenidos de microorganismos, resulta esencial contar con un suministro de cepas estable y bien caracterizado como materia prima para la producción. Para esto, es imprescindible conservar las cepas vacunales empleando el Sistema de Lotes de Siembra, así como contar con medios de cultivo que garanticen un óptimo crecimiento microbiano y la presencia de los antígenos de interés. En el Instituto Finlay de La Habana se trabaja en la obtención de una vacuna contra Neisseria meningitidis libre de componentes de origen animal. En el presente trabajo se elaboraron y caracterizaron Lotes de Siembra de Referencia y Trabajo de Neisseria meningitidis serogrupos A, C, Y, W135 y X cultivados en medios de origen no animal y cumpliendo con las Buenas Prácticas de Producción vigentes. Se estableció la documentación adecuada que incluye: expedientes de cada lote, los procedimientos normalizados de operación, los registros de elaboración y control de los lotes, las especificaciones de calidad y los certificados de ensayo.

  18. Evaluación citotóxica y genotóxica del adyuvante AFCo1 por el ensayo de morfología de la cabeza del espermatozoide en ratón NMRI

    Directory of Open Access Journals (Sweden)

    Aníbal Domínguez

    2016-01-01

    Full Text Available Se realizó un estudio para evaluar el potencial citogenotóxico en células espermáticas de ratón, del adyuvante AFCo1 (Adyuvante Finlay Cocleato 1, obtenido a partir del proteoliposoma de Neisseria meningitidis serogrupo B. El AFCo1 y su diluente se administraron por vía intranasal en una dosis de 40 µL (1 mg/mL, mientras que los controles positivo (ciclofosfamida y negativo (agua destilada estéril, se administraron por vía oral a razón de 40 mg y 1 mL/kg, respectivamente. Se utilizaron ratones (NMRI de 8-12 semanas de edad, con peso corporal entre 27-30 g, a los cuales se les aplicaron cinco dosis con un intervalo de 24 h, durante los primeros cinco días del experimento. Se evaluó la toxicidad general (peso corporal e indicadores testiculares de citotoxicidad testicular (concentración espermática y genotoxicidad (morfología espermática. El AFCo1 y su diluente no provocaron toxicidad general, citotoxicidad, ni genotoxicidad. La ciclofosfamida sí produjo citotoxicidad (47,77% y genotoxicidad (534,61%. Se concluye que el AFCo1 y su diluente pueden ser considerados como no tóxicos para las células espermáticas en el nivel de dosis y para el biomodelo animal utilizado.

  19. Variabilidad genética de aislamientos de Salmonella typhimurium (grupo B obtenidos de hígados de pollo destinados para consumo humano

    Directory of Open Access Journals (Sweden)

    Martín Talavera Rojas

    2011-01-01

    Full Text Available Se determinó la frecuencia de aislamientos de Salmonella spp en hígados de pollo para venta, en cuatro mercados del área metropolitana de la ciudad de Toluca, México. El aislamiento bacteriológico se realizó de acuerdo a la norma NOM-114-SSA1- 1994 para la determinación de Salmonella en alimentos. Se realizó la prueba de ERIC-PCR para determinar la variedad genética de las cepas de Salmonella aisladas. De un total de 520 muestras incluidas en el estudio, 7 (1.34 % resultaron positivas a Salmonella serogrupo B (typhimurim. En el ERIC-PCR se observaron cuatro perfiles, encontrando similitud entre cepas de diferentes mercados, lo cual podría indicar que el manejo que se les da a las canales y vísceras es de suma importancia, además que la presencia en hígados de pollo para consumo humano debe ser considerado como una fuente importante de infección, ya que cualquier serovariedad de esta bacteria representa un potencial de infección para el humano.

  20. Leptospirosis serosurvey in bovines from Brazilian Pantanal using IGG ELISA with recombinant protein LipL32 and microscopic agglutination test Sorodiagnóstico de leptospirose em bovinos do Pantanal brasileiro utilizando ELISA IgG com proteína recombinante LipL32 e soroaglutinação microscópica

    Directory of Open Access Journals (Sweden)

    Renata Graça Pinto Tomich

    2007-12-01

    Full Text Available This investigation was carried out in Brazilian Pantanal: region with important biodiversity. This region's climatic conditions, hydrology and geomorphology as well as the existence of great variety of wild species favor the maintenance of the Leptospira in the environment. The aim of this study was to evaluate IgG ELISA with recombinant protein LipL32 in comparison with microscopic agglutination test (MAT and additionally contribute to the knowledge of the distribution of the one of most important worldwide zoonotic infection, assessing the seropositivity of bovine leptospirosis in beef cattle herds of Brazilian Pantanal, an important ecological preserved area, where cattle constitute not only the most important economic resource but also the major activity compatible of the conservation of natural resource of the region. Out of 282 samples of cattle serum analyzed, 143 (50.71% were positive in MAT. The serovar Hardjo (genotypic Hardjoprajitno and Hardjobovis, Wolffi and Ballum showed the largest frequency of reactive samples. In the IgG ELISA rLipL32, 161 samples (57.09% were positive. This result was higher than obtained by MAT (pEste estudo foi realizado no Pantanal brasileiro: região que apresenta importante biodiversidade. As condições de clima, hidrologia e geomorfologia dessa região, bem como a existência de grande variedade de espécies animais silvestres, favorecem a manutenção da Leptospira no meio ambiente. O objetivo desse estudo foi avaliar o ELISA IgG com proteína recombinante LipL32 em comparação com a soroaglutinação microscópica (SAM para o diagnóstico sorológico de Leptospira. Adicionalmente, contribuir para o conhecimento da distribuição da leptospirose bovina, uma das mais importantes zoonoses mundialmente distribuída. Foi avaliada a soropositividade para essa bactéria em rebanhos bovinos de corte da região do Pantanal, uma área onde o bovino constitui não apenas o recurso econômico mais importante

  1. Prevalencia de anticuerpos anti-Leptospira spp. en personas con exposición laboral en el departamento del Tolima / Prevalence of anti-Leptospira spp. antibodies among people with occupational exposure in Tolima Department

    Directory of Open Access Journals (Sweden)

    Blanca L. Guzmán-Barragán

    2016-05-01

    Full Text Available Resumen Objetivo: estimar la prevalencia de anticuerpos IgM contra Leptospira spp., mediante el Ensayo de Inmunoabsorción Ligado a Enzimas (elisa, en la población de riesgo laboral de 8 municipios del Tolima. Metodología: se obtuvieron muestras de sangre de 261 empleados, las cuales fueron analizadas mediante la técnica de elisa para la detección de anticuerpos IgM anti-Leptospira spp., seguido de mat y serotipificación. Resultado: se estimó una seroprevalencia del 25,29%, con una seroreactividad mayor en trabajadores de plantas de beneficio animal (34,2%, recolección de residuos sólidos (27,1% y trabajadores de acueducto y alcantarillado (14,8%. La actividad en plantas de beneficio animal se identificó como factor de riesgo de Leptospira spp. (OR=1,86. Los serovares identificados fueron L. Bratislava (16, Ballum (5, Tarassovi (3, Hebdomadis (2, Sejroe (2 y Icterhemorragiae (1. El municipio de Libano presento el mayor porcentaje de positividad (36,96%, seguido de Espinal y Guamo con 28,57% cada uno. Discusión: la evaluación del sistema de vigilancia indicó deficiencia en recursos y debilidades de los profesionales de la salud al desconocer los procedimientos, investigación, diagnóstico y notificación de la enfermedad. Conclusiones: la leptospirosis está presente en poblaciones de riesgo laboral en el Tolima y se hace necesario abordar esta problemática en la población de otros municipios y los animales transmisores de la enfermedad. / Abstract Objective: to estimate the prevalence of IgM antibodies against Leptospira spp. Using the enzyme-linked immunosorbent assay (elisa in a population at occupational risk from 8 municipalities of the Tolima department, Colombia. Methodology: blood samples were collected from 261 employees and analyzed with the elisa technique to detect IgM and anti-Leptospira spp. antibodies. This was followed by mat and serotyping. Results: a seroprevalence of 25.29% was estimated, with higher

  2. [MALDI-TOF MASS-SPECTROMETRIC ANAIYSIS OF LEPTOSPIRA SPP. USED IN SERODIAGNOSTICS OF LEPTOSPIROSIS].

    Science.gov (United States)

    Zyeva, E V; Stoyanova, N A; Tokarevich, N K; Totolyan, Areg A

    2015-01-01

    Creation of a classification model of Leptospira spp. serovar model using ClinProTools 3.0 software and evaluation of use of MALDI-TOF MS as a method of quality control of reference strains of leptospira. 10 reference strains of Leptospira spp. were used in the study according to microscopic agglutination reaction from the collection of Pasteur RIEM. All the strains were cultivated for 10 days in Terskikh medium at 28 degrees C. Cell extracts were obtained by ethanol/formic acid method. α-cyano-4-hydroxycinnamic acid solution was used as a matrix. Mass-spectra were obtained in Microflex mass-spectrometer (Bruker Daltonics, Germany). External validation of the test-model was carried out using novel spectra of every reference strain during their repeated reseeding. Values of cross-validation and confirmatory ability of the optimal model, built on a genetic algorithm, was 99.14 and 100%, respectively. This model contained 11 biomarker peaks (m/z 2959, 3447, 3548, 3764, 3895, 5221, 5917, 6173, 6701, 7013, 8364) for serovar classification. Results of the external validation have shown a 100% correct classification in serovar classesin Sejroe, Ballum, Tarassovi; Copenhageni, Mozdoc, Grippotyphosa and Patoc, that indicates a high prognostic ability of the model in these classes. However, data from verification matrix have shown, that 50%.of the spectra from Canicola and Pomona serovars were classified as Patoc class, that could be associated with cross serological activity of Patoc serovar L. biflexa with pathogenic leptospirae. MALDI-TOF mass-spectrometry method combined with building and using the classification model could be a useful instrument for intra-laboratory control of leptospira reseeding.

  3. COMPARISON OF 16S rRNA-PCR-RFLP, LipL32-PCR AND OmpL1-PCR METHODS IN THE DIAGNOSIS OF LEPTOSPIROSIS

    Directory of Open Access Journals (Sweden)

    Tülin GÜVEN GÖKMEN

    Full Text Available SUMMARY Leptospirosis is still one of the most important health problems in developing countries located in humid tropical and subtropical regions. Human infections are generally caused by exposure to water, soil or food contaminated with the urine of infected wild and domestic animals such as rodents and dogs. The clinical course of leptospirosis is variable and may be difficult to distinguish from many other infectious diseases. The dark-field microscopy (DFM, serology and nucleic acid amplification techniques are used to diagnose leptospirosis, however, a distinctive standard reference method is still lacking. Therefore, in this study, we aimed to determine the presence of Leptospira spp., to differentiate the pathogenic L. interrogans and the non-pathogenic L. biflexa, and also to determine the sensitivity and specificity values of molecular methods as an alternative to conventional ones. A total of 133 serum samples, from 47 humans and 86 cattle were evaluated by two conventional tests: the Microagglutination Test (MAT and the DFM, as well as three molecular methods, the 16S rRNA-PCR followed by Restriction Fragment Lenght Polymorphism (RFLP of the amplification products 16S rRNA-PCR-RFLP, LipL32-PCR and OmpL1-PCR. In this study, for L. interrogans, the specificity and sensitivity rates of the 16S rRNA-PCR and the LipL32-PCR were considered similar (100% versus 98.25% and 100% versus 98.68%, respectively. The OmpL1-PCR was able to classify L. interrogans into two intergroups, but this PCR was less sensitive (87.01% than the other two PCR methods. The 16S rRNA-PCR-RFLP could detect L. biflexa DNA, but LipL32-PCR and OmpL1-PCR could not. The 16S rRNA-PCR-RFLP provided an early and accurate diagnosis and was able to distinguish pathogenic and non-pathogenic Leptospira species, hence it may be used as an alternative method to the conventional gold standard techniques for the rapid disgnosis of leptospirosis.

  4. Comparative transcriptional and translational analysis of leptospiral outer membrane protein expression in response to temperature.

    Directory of Open Access Journals (Sweden)

    Miranda Lo

    Full Text Available BACKGROUND: Leptospirosis is a global zoonosis affecting millions of people annually. Transcriptional changes in response to temperature were previously investigated using microarrays to identify genes potentially expressed upon host entry. Past studies found that various leptospiral outer membrane proteins are differentially expressed at different temperatures. However, our microarray studies highlighted a divergence between protein abundance and transcript levels for some proteins. Given the abundance of post-transcriptional expression control mechanisms, this finding highlighted the importance of global protein analysis systems. METHODOLOGY/PRINCIPAL FINDINGS: To complement our previous transcription study, we evaluated differences in the proteins of the leptospiral outer membrane fraction in response to temperature upshift. Outer membrane protein-enriched fractions from Leptospira interrogans grown at 30 degrees C or overnight upshift to 37 degrees C were isolated and the relative abundance of each protein was determined by iTRAQ analysis coupled with two-dimensional liquid chromatography and tandem mass spectrometry (2-DLC/MS-MS. We identified 1026 proteins with 99% confidence; 27 and 66 were present at elevated and reduced abundance respectively. Protein abundance changes were compared with transcriptional differences determined from the microarray studies. While there was some correlation between the microarray and iTRAQ data, a subset of genes that showed no differential expression by microarray was found to encode temperature-regulated proteins. This set of genes is of particular interest as it is likely that regulation of their expression occurs post-transcriptionally, providing an opportunity to develop hypotheses about the molecular dynamics of the outer membrane of Leptospira in response to changing environments. CONCLUSIONS/SIGNIFICANCE: This is the first study to compare transcriptional and translational responses to temperature

  5. ¿CÓMO ENGANCHAN ELLAS DE LA NACIÓN? SOBRE LA POESÍA ÉPICA A COMIENZOS DEL SIGLO XXI

    Directory of Open Access Journals (Sweden)

    Helena González

    2014-10-01

    Full Text Available Puede hacerse cargo la poeta del nosotros sin sucumbir a una idea de comunidad sentimental vertebrada a partir de una postergación utópica? ¿Cómo puede llevar a debate al mismo tiempo la causa de las mujeres y la de la nación subalterna sin que una tienda a abarcar a la otra como paraguas totalizador? ¿Cómo se construye una épica no heroica adecuada a un tiempo en el que no son posibles las narraciones míticas o técnicas sobre el origen de una comunidad? Chus Pato y Ana Romaní ofrecen en sus poemarios publicados a partir del año 2000 modelos que interrogan a la comunidad desde la transformación de las formas poéticas de lo épico para cuestionar la identidad nacional desde la diferencia sexual.

  6. La razón de ser de la presencia de Joseph Conrad en El sueño del celta de Mario Vargas Llosa e Historia secreta de Costaguana de Juan Gabriel Vásquez

    Directory of Open Access Journals (Sweden)

    Caroline Houde

    2015-07-01

    Full Text Available Este artículo pretende ofrecer un estudio de la influencia actual de la obra de Joseph Conrad en la literatura hispanoamericana a través del análisis de dos novelas: Historia secreta de Costaguana (2007, de Juan Gabriel Vásquez, y El sueño del celta (2010, de Mario Vargas Llosa. En primera instancia, se presenta una visión panorámica del influjo conradiano en la América del siglo XX, tanto por lo que atañe al desarrollo de la crítica poscolonial, como por lo que se relaciona con la representación conradiana del topos de la selva en la narrativa hispanoamericana. Luego, se plantea cómo las dos novelas rememoran ciertos hipotextos conradianos e interrogan el aporte de Conrad a la literatura y al Poscolonialismo.

  7. Rats, cities, people, and pathogens: a systematic review and narrative synthesis of literature regarding the ecology of rat-associated zoonoses in urban centers.

    Science.gov (United States)

    Himsworth, Chelsea G; Parsons, Kirbee L; Jardine, Claire; Patrick, David M

    2013-06-01

    Urban Norway and black rats (Rattus norvegicus and Rattus rattus) are the source of a number of pathogens responsible for significant human morbidity and mortality in cities around the world. These pathogens include zoonotic bacteria (Leptospira interrogans, Yersina pestis, Rickettsia typhi, Bartonella spp., Streptobacillus moniliformis), viruses (Seoul hantavirus), and parasites (Angiostrongylus cantonensis). A more complete understanding of the ecology of these pathogens in people and rats is critical for determining the public health risks associated with urban rats and for developing strategies to monitor and mitigate those risks. Although the ecology of rat-associated zoonoses is complex, due to the multiple ways in which rats, people, pathogens, vectors, and the environment may interact, common determinants of human disease can still be identified. This review summarizes the ecology of zoonoses associated with urban rats with a view to identifying similarities, critical differences, and avenues for further study.

  8. Parasitic and Bacterial Infections of Myocastor coypus in a Metropolitan Area of Northwestern Italy.

    Science.gov (United States)

    Zanzani, Sergio A; Di Cerbo, Annarita; Gazzonis, Alessia L; Epis, Sara; Invernizzi, Anna; Tagliabue, Silvia; Manfredi, Maria T

    2016-01-01

    Coypus (Myocastor coypus) are widespread throughout Europe. In northern Italy, they are abundant in the flatland areas, and their high population densities can cause economic loss and ecosystem damage. We examined 153 coypus for selected parasitic and bacterial infections. We found Strongyloides myopotami (63.4% prevalence), Trichostrongylus duretteae (28.1%), Eimeria coypi (86.3%), and Eimeria seideli (6.8%), but did not find Giardia duodenalis or Cryptosporidium spp. We also isolated Staphylococcus aureus (10.1%), Escherichia coli (4.5%), and Streptococcus spp. (3.4%) from lung samples; no Salmonella spp. were isolated from fecal samples. Coypus had antibodies to Toxoplasma gondii (28.9%) and to four serovars of Leptospira interrogans (44.9%); Australis/Bratislava was the serovar most frequently detected. It is clear that coypu can be infected with pathogens of human and veterinary importance.

  9. El suicidio, sus estatutos y ética del psicoanálisis. // Suicide, its statutes and the ethics of psychoanalysis.

    Directory of Open Access Journals (Sweden)

    David Vargas Castro.

    2010-06-01

    Full Text Available This paper examines Freud´s and Lacan´s perspectives about suicide, emphasizing on the theoretical formulations and statutes given to it in the works of each of the authors mentioned. At the same time, the text brings up and analyses the ethical perspectives underlying such formulations, so they can be traced in the ethics of psychoanalysis proposed by each of these authors. // En el presente texto se abordan las perspectivas de Freud y de Lacan en torno al suicidio, destacando las formulaciones teóricas y estatutos otorgados a este a lo largo de la obra de cada uno de los autores mencionados. A su vez, se resaltan e interrogan las perspectivas éticas que subyacen a dichas formulaciones, de tal forma que puedan rastrearse en la ética del psicoanálisis que cada uno de estos autores propuso.

  10. Pathology and pathophysiology of pulmonary manifestations in leptospirosis

    Directory of Open Access Journals (Sweden)

    Marisa Dolhnikoff

    Full Text Available Leptospirosis is a re-emerging zoonosis occurring as large outbreaks throughout the world caused by Leptospira interrogans. The incidence of pulmonary involvement in leptospirosis has been reported to be increasing in the last years, affecting up to 70% of the patients. Alveolar hemorrhage presented as dyspnea and hemoptysis is the main pulmonary manifestation. The emergence of massive hemoptysis and acute respiratory distress syndrome has characterized the recent changes reported in the clinical patterns of leptospirosis. The pulmonary involvement has been emerged as a serious life threat, becoming the main cause of death due to leptospirosis in some countries. In this review we present the main clinical and pathological manifestations of pulmonary involvement in leptospirosis, with special focus on recent data concerning the pathophysiological mechanisms underlying lung injury.

  11. Structural reconstruction of the catalytic center of LiPDF through multiple scattering calculation with MXAN

    International Nuclear Information System (INIS)

    Guo Xiaoyun; Chu Wangsheng; Ma Sixuan; Gong Weimin; Benfatto, Maurizio; Hu Tiandou; Xie Yaning; Wu Ziyu

    2006-01-01

    Peptide deformylase (PDF, EC 3.5.1.27) is essential for the normal growth of eubacterium but not for mammalians. Recently, PDF has been studied as a target for new antibiotics. In this paper, X-ray absorption spectroscopy was employed to determine the local structure around the zinc ion of PDF from Leptospira Interrogans in dry powder, because it is very difficult to obtain the crystallized sample of LiPDF. We performed X-ray absorption near edge structure (XANES) calculation and reconstructed successfully the local geometry of the active center, and the results from calculations show that a water molecule (Wat1) has moved towards the zinc ion and lies in the distance range to coordinate with the zinc ion weakly. In addition, the sensitivity of theoretical spectra to the different ligand bodies was evaluated in terms of goodness-of-fit

  12. Is it too cold for Leptospira interrrogans transmission on the Faroese Islands?

    DEFF Research Database (Denmark)

    Jensen, Per Moestrup; Magnussen, Eydfinn

    2016-01-01

    Leptospira interrogans is a bacterium that can infect most mammal species. Brown rats are considered to be one of the most important reservoirs of Leptospira because they frequently are infected and live in close proximity to humans. Past studies of prevalence of Leptospira in brown rats indicate...... that temperature - both high and low - may negatively affect the prevalence rate in rats, so that Leptospira is rare or even absent at temperatures below 7-8 °C. Here we investigated the prevalence of infection in brown rats on the Faroese Islands (mean temperature of 6.5 °C) and did not find any infected animals...... in a sample of 95 animals. We propose that prevalence rates of Leptospira are very low in rural brown rats in the cooler Scandinavian regions, even though urban/sewer rats might be highly infected in the same regions....

  13. High-resolution melt-curve analysis of random-amplified-polymorphic-DNA markers, for the characterisation of pathogenic Leptospira

    DEFF Research Database (Denmark)

    Tulsiani, Suhella; Craig, S B; Graham, G C

    2010-01-01

    A new test for pathogenic Leptospira isolates, based on RAPD-PCR and high-resolution melt (HRM) analysis (which measures the melting temperature of amplicons in real time, using a fluorescent DNA-binding dye), has recently been developed. A characteristic profile of the amplicons can be used...... to define serovars or detect genotypes. Ten serovars, of leptospires from the species Leptospira interrogans (serovars Australis, Robinsoni, Hardjo, Pomona, Zanoni, Copenhageni and Szwajizak), L. borgpetersenii (serovar Arborea), L. kirschneri (serovar Cynopteri) and L. weilii (serovar Celledoni), were...... of Leptospira serotypes using a DNA-based methodology is now possible. As an objective and relatively inexpensive and rapid method of serovar identification, at least for cultured isolates, RAPD-HRM assays show convincing potential....

  14. Genotyping of Leptospira directly in urine samples of cattle demonstrates a diversity of species and strains in Brazil.

    Science.gov (United States)

    Hamond, C; Pestana, C P; Medeiros, M A; Lilenbaum, W

    2016-01-01

    The aim of this study was to identify Leptospira in urine samples of cattle by direct sequencing of the secY gene. The validity of this approach was assessed using ten Leptospira strains obtained from cattle in Brazil and 77 DNA samples previously extracted from cattle urine, that were positive by PCR for the genus-specific lipL32 gene of Leptospira. Direct sequencing identified 24 (31·1%) interpretable secY sequences and these were identical to those obtained from direct DNA sequencing of the urine samples from which they were recovered. Phylogenetic analyses identified four species: L. interrogans, L. borgpetersenii, L. noguchii, and L. santarosai with the most prevalent genotypes being associated with L. borgpetersenii. While direct sequencing cannot, as yet, replace culturing of leptospires, it is a valid additional tool for epidemiological studies. An unexpected finding from this study was the genetic diversity of Leptospira infecting Brazilian cattle.

  15. Effect of metal ion on the structure and function of LiPDF: The study of the fine structure around the metal site using XANES

    International Nuclear Information System (INIS)

    Wang Yu; Chu Wangsheng; Yang Feifei; Yu Meijuan; Zhao Haifeng; Gong Weimin; Dong Yuhui; Xie Yaning; Wu, Ziyu

    2010-01-01

    We used X-ray absorption near edge structure (XANES) spectroscopy to investigate the metal-dependent enzymatic activity of the peptide deformylase from Leptospira interrogans (LiPDF). Ab initio full multiple scattering calculations performed by MXAN are applied to obtain the local structure of the cobalt-containing LiPDF (Co-LiPDF) and zinc-containing LiPDF (Zn-LiPDF) around the metal sites in pH9.0 buffer solution. The result shows the cobalt-wat1 (the bond water molecule) distance of Co-LiPDF is 1.89 A, much shorter than that of Zn-LiPDF, 2.50 A. That is an essential factor for its low catalytic activity.

  16. Structural reconstruction of the catalytic center of LiPDF through multiple scattering calculation with MXAN

    Energy Technology Data Exchange (ETDEWEB)

    Guo Xiaoyun [Beijing Synchrotron Radiation Facility, Institute of High Energy Physics, CAS, 100049 Beijing (China); School of Life Science, Key Laboratory of Structural Biology, University of Science and Technology of China, 230026 Hefei, Anhui (China); Chu Wangsheng [Beijing Synchrotron Radiation Facility, Institute of High Energy Physics, CAS, 100049 Beijing (China); Department of Physics, University of Science and Technology of China, 230026 Hefei, Anhui (China); Ma Sixuan [Beijing Synchrotron Radiation Facility, Institute of High Energy Physics, CAS, 100049 Beijing (China); Gong Weimin [National Laboratory of Biomacromolecules, Institute of Biophysics, Chinese Academy of Sciences, 100101 Beijing (China); Benfatto, Maurizio [Instituto Nazionale di Fisica Nucleare, Laboratori Nazionali di Frascati, P.O. Box 13, 00044 Frascati (Italy); Hu Tiandou [Beijing Synchrotron Radiation Facility, Institute of High Energy Physics, CAS, 100049 Beijing (China); Xie Yaning [Beijing Synchrotron Radiation Facility, Institute of High Energy Physics, CAS, 100049 Beijing (China); Wu Ziyu [Beijing Synchrotron Radiation Facility, Institute of High Energy Physics, CAS, 100049 Beijing (China) and Instituto Nazionale di Fisica Nucleare, Laboratori Nazionali di Frascati, P.O. Box 13, 00044 Frascati (Italy)]. E-mail: wuzy@mail.ihep.ac.cn

    2006-11-15

    Peptide deformylase (PDF, EC 3.5.1.27) is essential for the normal growth of eubacterium but not for mammalians. Recently, PDF has been studied as a target for new antibiotics. In this paper, X-ray absorption spectroscopy was employed to determine the local structure around the zinc ion of PDF from Leptospira Interrogans in dry powder, because it is very difficult to obtain the crystallized sample of LiPDF. We performed X-ray absorption near edge structure (XANES) calculation and reconstructed successfully the local geometry of the active center, and the results from calculations show that a water molecule (Wat1) has moved towards the zinc ion and lies in the distance range to coordinate with the zinc ion weakly. In addition, the sensitivity of theoretical spectra to the different ligand bodies was evaluated in terms of goodness-of-fit.

  17. Genetic diversity of Leptospira in northwestern Colombia: first report of Leptospira santarosai as a recognised leptospirosis agent

    Directory of Open Access Journals (Sweden)

    Ronald Guillermo Peláez Sanchez

    Full Text Available The region of Antioquia in northeastern Colombia has the highest number of reported leptospirosis cases in the country. It also shows high seroprevalence indexes in the general population and socio-environmental conditions favourable for the transmission of the disease between humans and animals. In this study, 25 Leptospira isolates from Colombia’s Antioquia department were identified to the species level as L. santarosai (12, L. interrogans (9 and L. meyeri (4 using phylogenetic analysis of the Amidohydrolase gene. Typing at the serovar level was performed using multilocus sequence typing (MLST and monoclonal antibodies. The serovars Canalzonae, Babudieri, Alice, Beye, and Copenhageni have been identified as causing human or animal infections in Antioquia, Colombia. The four environmental isolates were not identified to the serovar level. L. santarosai serovar Canalzonae and Alice were identified as new etiologic agents of human leptospirosis in Antioquia, Colombia. This paper reports species and serovars that were previously unknown in the region.

  18. Effect of metal ion on the structure and function of LiPDF: The study of the fine structure around the metal site using XANES

    Energy Technology Data Exchange (ETDEWEB)

    Wang Yu [Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China); National Synchrotron Radiation Laboratory, University of Science and Technology of China, Hefei 230029 (China); Chu Wangsheng, E-mail: cws@ihep.ac.c [Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China); Yang Feifei; Yu Meijuan; Zhao Haifeng [Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China); Gong Weimin [National Laboratory of Biomacromolecules, Institute of Biophysics, Chinese Academy of Sciences, Beijing 100101 (China); Dong Yuhui; Xie Yaning [Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China); Wu, Ziyu, E-mail: wuzy@ustc.edu.c [National Synchrotron Radiation Laboratory, University of Science and Technology of China, Hefei 230029 (China); Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China)

    2010-07-21

    We used X-ray absorption near edge structure (XANES) spectroscopy to investigate the metal-dependent enzymatic activity of the peptide deformylase from Leptospira interrogans (LiPDF). Ab initio full multiple scattering calculations performed by MXAN are applied to obtain the local structure of the cobalt-containing LiPDF (Co-LiPDF) and zinc-containing LiPDF (Zn-LiPDF) around the metal sites in pH9.0 buffer solution. The result shows the cobalt-wat1 (the bond water molecule) distance of Co-LiPDF is 1.89 A, much shorter than that of Zn-LiPDF, 2.50 A. That is an essential factor for its low catalytic activity.

  19. Represión y vigilancia hacia el Trabajo Docente durante la Dictadura Militar en Chile (1973-1990

    Directory of Open Access Journals (Sweden)

    Felipe Andres Zurita Garrido

    2017-01-01

    Full Text Available Este artículo tiene como objetivo analizar las políticas de represión y vigilancia ejercidas contra el Trabajo Docente durante la Dictadura Militar (1973-1990. Para alcanzar este objetivo se interrogan diferentes fuentes: Informes de Derechos Humanos, Actas de las Sesiones Secretas de la Junta Militar y documentos propios del funcionamiento cotidiano del aparato de represión. Allí, la figura de profesoras y profesores encuentra un lugar de destaque en tanto grupo a corregir y perseguir, situación que invita a sostener que la Dictadura Militar dedicó una especial atención hacía el Trabajo Docente, apoyándose en estrategias de vigilancia y persecución especialmente diseñadas para estas finalidades.

  20. Detection of reactive canines to Leptospira in Campeche City, Mexico Detección de caninos reaccionantes a Leptospira en la ciudad de Campeche, México

    Directory of Open Access Journals (Sweden)

    Selene del C Blum Domínguez

    2013-03-01

    Full Text Available Leptospira reactivity in stray and household dogs in Campeche as well as associated risk factors to the seropositivity in household dogs have been herein determined. The survey included 323 dogs, 142 of which were stray dogs and 181 household dogs. Nine Leptospira interrogans serovars were tested by the microagglutination test. Reactivity was 21.3 % (69/323, 17.2 % corresponded to household dogs and 26.7 % to stray dogs. Leptospira Canicola (29 %, Leptospira Hardjo (22.58 %, and Leptospira Icterohaemorrhagiae (16.12 % were the most common serovars reacting against the serum of household animals, while Leptospira Canicola (15.78 %, Leptospira Icterohaemorrhagiae (13.15 %, and Leptospira Pomona (7.89 % were those reacting in stray dogs. Results showed that all dogs have been in contact with different Leptospira serovars and outdoor exposure is the main infection risk factor.

  1. Organización, planeación y administración educativa. Perspectivas teóricas en la escuela

    Directory of Open Access Journals (Sweden)

    Yolanda Contreras Bello

    2011-01-01

    Full Text Available El presente artículo de reflexión pretende abordar el concepto de organización, planeación y administración educativa como criterios que interrogan el contexto educativo, entendiendo por este, un conjunto de instituciones políticas, económicas y jurídicas en el cual cada uno de dichos conceptos se integran como elementos constitutivos de la prestación del servicio educativo. Los antecedentes de la administración como categoría científica desplazan la planeación y organización educativa como categorías que integran el sistema educativo en donde la administración se vincula con procesos industriales propios del sistema capitalista.

  2. Survey of Leptospira spp in pampas deer (Ozotoceros bezoarticus in the Pantanal wetlands of the state of Mato Grosso do Sul, Brazil by serology and polymerase chain reaction

    Directory of Open Access Journals (Sweden)

    Anahí Souto Vieira

    2011-09-01

    Full Text Available This work reports a survey of Leptospira spp in pampas deer (Ozotoceros bezoarticus in the Pantanal wetlands of the state of Mato Grosso do Sul, Brazil by serology and polymerase chain reaction (PCR. Seventy pampas deer were captured in the dry season and surveyed using PCR, microscopic agglutination test (MAT (n = 51 and by both techniques (n = 47. PCR detected infections in two pampas deer and MAT detected infections in three. Through sequencing and phylogenetic analyses, the PCR-amplified fragment detected in deer was identified as Leptospira interrogans. Serovars Pomona and Butembo were detected using MAT and the highest titre was 200 for serovar Pomona. Epidemiological aspects of the findings are discussed.

  3. Borrelia burgdorferi antibodies in dogs from Cotia county, São Paulo State, Brazil

    Directory of Open Access Journals (Sweden)

    JOPPERT Adriana Marques

    2001-01-01

    Full Text Available Dogs sera samples collected from Cotia County, São Paulo were tested using indirect immunoenzymatic test (ELISA in order to study Lyme disease serology in dogs. ELISA method was standardized and G39/40 North American strain of Borrelia burgdorferi was used as antigen. Positive results were confirmed employing the Western blotting technique. Because of the possibility of cross-reactions, sera were also tested for different serological strains of Leptospira interrogans and L. biflexa using microscopic sera agglutination test. Twenty-three of 237 (9.7% serum samples were positive in the ELISA; 20 of them (86.9% were confirmed by the Western blotting, what suggests that Cotia may be a risk area for Lyme disease. Although 4 samples (1.7% were positive for Lyme disease and leptospirosis, no correlation was found between the results (X² = 0.725; p = 0.394 what suggests absence of serological cross reactivity.

  4. EL CUERPO DEL ARCHIVO: FUNCIÓN, TESTIMONIO Y LA RESPONSABILIDAD DE UN ORDEN. APUNTES SOBRE 'INSENSATEZ' Y 'DOS VECES JUNIO'

    Directory of Open Access Journals (Sweden)

    Martín Lombardo

    2018-01-01

    Full Text Available A partir de las novelas Insensatez de Horacio Castellanos Moya y Dos veces junio de Martín Kohan, el presente artículo reflexiona sobre la representación de un archivo y de un testimonio en un texto narrativo. A través de dos maneras diferentes en que se hace uso del archivo y del documento institucional para hacer una denuncia política, las dos novelas interrogan sobre el estilo de redacción de un documento, sobre los usos del cuerpo de quien cumple una función institucional, sobre la tensión entre el archivo y el testimonio para así plantear el vínculo entre lo irrepresentable del horror, la fantasía y la verdad histórica.

  5. Survey for selected pathogens in wild pigs (Sus scrofa) from Guam, Marianna Islands, USA.

    Science.gov (United States)

    Cleveland, Christopher A; DeNicola, Anthony; Dubey, J P; Hill, Dolores E; Berghaus, Roy D; Yabsley, Michael J

    2017-06-01

    Pigs (Sus scrofa) were introduced to Guam in the 1600's and are now present in high densities throughout the island. Wild pigs are reservoirs for pathogens of concern to domestic animals and humans. Exposure to porcine parvovirus, transmissible gastroenteritis, and Leptospira interrogans has been documented in domestic swine but data from wild pigs are lacking. The close proximity of humans, domestic animals, and wild pigs, combined with the liberal hunting of wild pigs, results in frequent opportunities for pathogen transmission. From February-March 2015, blood, tissue and ectoparasite samples were collected from 47 wild pigs. Serologic testing found exposure to Brucella spp. (2%), Toxoplasma gondii (11%), porcine reproductive and respiratory syndrome (PRRS) virus (13%), porcine circovirus type 2 (36%), pseudorabies virus (64%), Actinobacillus pleuropneumoniae (93%), Lawsonia intracellularis (93%), and porcine parvovirus (94%). Eleven (24%) samples had low titers (1:100) to Leptospira interrogans serovars Bratislava (n=6), Icterohaemorrhagiae (n=6), Pomona (n=2), and Hardjo (n=1). Kidney samples from nine pigs with Leptospira antibodies were negative for Leptospira antigens. Numerous pigs had Metastrongylus lungworms and three had Stephanurus dentatus. Lice (Hematopinus suis) and ticks (Amblyomma breviscutatum) were also detected. No antibodies to Influenza A viruses were detected. In contrast to the previous domestic swine survey, we found evidence of numerous pathogens in wild pigs including new reports of pseudorabies virus, PRRS virus, Brucella, and Leptospira in pigs on Guam. These findings highlight that domestic swine-wild pig interactions should be prevented and precautions are needed when handling wild pigs to minimize the risk of pathogen transmission. Copyright © 2017 Elsevier B.V. All rights reserved.

  6. Health assessment of wild lowland tapir (Tapirus terrestris) populations in the Atlantic Forest and Pantanal biomes, Brazil (1996-2012).

    Science.gov (United States)

    Medici, Emília Patrícia; Mangini, Paulo Rogerio; Fernandes-Santos, Renata Carolina

    2014-10-01

    Abstract The lowland tapir (Tapirus terrestris) is found in South America and is listed as Vulnerable to Extinction by the International Union for Conservation of Nature, Red List of Threatened Species. Health issues, particularly infectious diseases, are potential threats for the species. Health information from 65 wild tapirs from two Brazilian biomes, Atlantic Forest (AF) and Pantanal (PA), were collected during a long-term study (1996-2012). The study included physic, hematologic and biochemical evaluations, microbiologic cultures, urinalysis, and serologic analyses for antibodies against 13 infectious agents (viral and bacterial). The AF and PA tapirs were significantly different for several hematologic and biochemical parameters. Ten bacteria taxa were identified in the AF and 26 in the PA. Antibodies against five viruses were detected: Bluetongue virus, eastern equine encephalitis virus, western equine encephalitis virus, infectious bovine rhinotracheitis virus, and porcine parvovirus. A high prevalence of exposure to Leptospira interrogans (10 serovars: Autumnalis, Bratislava, Canicola, Copenhageni, Grippotyphosa, Hardjo, Hebdomadis, Icterohaemorrhagiae, Pomona, and Pyrogenes) was detected in both the AF and PA sites. A greater diversity of serovars and higher antibody titers were found in the PA. Statistically significant differences between sites were found for L. interrogans, equine encephalitis virus, and porcine parvovirus. Based on physical evaluations, both AF and PA populations were healthy. The differences in the overall health profile of the AF and PA tapir populations appear to be associated with environmental factors and infectious diseases ecology. The extensive datasets on hematology, biochemistry, urinalysis, and microbiology results from this paper can be used as reference values for wild tapirs.

  7. Cyclical changes in seroprevalence of leptospirosis in California sea lions: endemic and epidemic disease in one host species?

    Directory of Open Access Journals (Sweden)

    St Leger Judy

    2007-11-01

    Full Text Available Abstract Background Leptospirosis is a zoonotic disease infecting a broad range of mammalian hosts, and is re-emerging globally. California sea lions (Zalophus californianus have experienced recurrent outbreaks of leptospirosis since 1970, but it is unknown whether the pathogen persists in the sea lion population or is introduced repeatedly from external reservoirs. Methods We analyzed serum samples collected over an 11-year period from 1344 California sea lions that stranded alive on the California coast, using the microscopic agglutination test (MAT for antibodies to Leptospira interrogans serovar Pomona. We evaluated seroprevalence among yearlings as a measure of incidence in the population, and characterized antibody persistence times based on temporal changes in the distribution of titer scores. We conducted multinomial logistic regression to determine individual risk factors for seropositivity with high and low titers. Results The serosurvey revealed cyclical patterns in seroprevalence to L. interrogans serovar Pomona, with 4–5 year periodicity and peak seroprevalence above 50%. Seroprevalence in yearling sea lions was an accurate index of exposure among all age classses, and indicated on-going exposure to leptospires in non-outbreak years. Analysis of titer decay rates showed that some individuals probably maintain high titers for more than a year following exposure. Conclusion This study presents results of an unprecedented long-term serosurveillance program in marine mammals. Our results suggest that leptospirosis is endemic in California sea lions, but also causes periodic epidemics of acute disease. The findings call into question the classical dichotomy between maintenance hosts of leptospirosis, which experience chronic but largely asymptomatic infections, and accidental hosts, which suffer acute illness or death as a result of disease spillover from reservoir species.

  8. Serum activity of platelet-activating factor acetylhydrolase is a potential clinical marker for leptospirosis pulmonary hemorrhage.

    Directory of Open Access Journals (Sweden)

    Junwei Yang

    Full Text Available Pulmonary hemorrhage has been recognized as a major, often lethal, manifestation of severe leptospirosis albeit the pathogenesis remains unclear. The Leptospira interrogans virulent serogroup Icterohaemorrhagiae serovar Lai encodes a protein (LA2144, which exhibited the platelet-activating factor acetylhydrolase (PAF-AH activity in vitro similar to that of human serum with respect to its substrate affinity and specificity and thus designated L-PAF-AH. On the other hand, the primary amino acid sequence of L-PAF-AH is homologous to the alpha1-subunit of the bovine brain PAF-AH isoform I. The L-PAF-AH was proven to be an intracellular protein, which was encoded unanimously and expressed similarly in either pathogenic or saprophytic leptospires. Mongolian gerbil is an appropriate experimental model to study the PAF-AH level in serum with its basal activity level comparable to that of human while elevated directly associated with the course of pulmonary hemorrhage during severe leptospirosis. Mortality occurred around the peak of pulmonary hemorrhage, along with the transition of the PAF-AH activity level in serum, from the increasing phase to the final decreasing phase. Limited clinical data indicated that the serum activity of PAF-AH was likely to be elevated in the patients infected by L. interrogans serogroup Icterohaemorrhagiae, but not in those infected by other less severe serogroups. Although L-PAF-AH might be released into the micro-environment via cell lysis, its PAF-AH activity apparently contributed little to this elevation. Therefore, the change of PAF-AH in serum not only may be influential for pulmonary hemorrhage, but also seems suitable for disease monitoring to ensure prompt clinical treatment, which is critical for reducing the mortality of severe leptospirosis.

  9. Direct Detection and Differentiation of Pathogenic Leptospira Species Using a Multi-Gene Targeted Real Time PCR Approach

    Science.gov (United States)

    Ferreira, Ana Sofia; Costa, Pedro; Rocha, Teresa; Amaro, Ana; Vieira, Maria Luísa; Ahmed, Ahmed; Thompson, Gertrude; Hartskeerl, Rudy A.; Inácio, João

    2014-01-01

    Leptospirosis is a growing public and veterinary health concern caused by pathogenic species of Leptospira. Rapid and reliable laboratory tests for the direct detection of leptospiral infections in animals are in high demand not only to improve diagnosis but also for understanding the epidemiology of the disease. In this work we describe a novel and simple TaqMan-based multi-gene targeted real-time PCR approach able to detect and differentiate Leptospira interrogans, L. kirschneri, L. borgpeteresenii and L. noguchii, which constitute the veterinary most relevant pathogenic species of Leptospira. The method uses sets of species-specific probes, and respective flanking primers, designed from ompL1 and secY gene sequences. To monitor the presence of inhibitors, a duplex amplification assay targeting both the mammal β-actin and the leptospiral lipL32 genes was implemented. The analytical sensitivity of all primer and probe sets was estimated to be <10 genome equivalents (GE) in the reaction mixture. Application of the amplification reactions on genomic DNA from a variety of pathogenic and non-pathogenic Leptospira strains and other non-related bacteria revealed a 100% analytical specificity. Additionally, pathogenic leptospires were successfully detected in five out of 29 tissue samples from animals (Mus spp., Rattus spp., Dolichotis patagonum and Sus domesticus). Two samples were infected with L. borgpetersenii, two with L. interrogans and one with L. kirschneri. The possibility to detect and identify these pathogenic agents to the species level in domestic and wildlife animals reinforces the diagnostic information and will enhance our understanding of the epidemiology of leptopirosis. PMID:25398140

  10. Prevalence and Genotype Allocation of Pathogenic Leptospira Species in Small Mammals from Various Habitat Types in Germany.

    Science.gov (United States)

    Obiegala, Anna; Woll, Dietlinde; Karnath, Carolin; Silaghi, Cornelia; Schex, Susanne; Eßbauer, Sandra; Pfeffer, Martin

    2016-03-01

    Small mammals serve as most important reservoirs for Leptospira spp., the causative agents of Leptospirosis, which is one of the most neglected and widespread zoonotic diseases worldwide. The knowledge about Leptospira spp. occurring in small mammals from Germany is scarce. Thus, this study's objectives were to investigate the occurrence of Leptospira spp. and the inherent sequence types in small mammals from three different study sites: a forest in southern Germany (site B1); a National Park in south-eastern Germany (site B2) and a renaturalised area, in eastern Germany (site S) where small mammals were captured. DNA was extracted from kidneys of small mammals and tested for Leptospira spp. by real-time PCR. Positive samples were further analysed by duplex and conventional PCRs. For 14 positive samples, multi locus sequence typing (MLST) was performed. Altogether, 1213 small mammals were captured: 216 at site B1, 456 at site B2 and 541 at site S belonging to following species: Sorex (S.) araneus, S. coronatus, Apodemus (A.) flavicollis, Myodes glareolus, Microtus (Mi.) arvalis, Crocidura russula, Arvicola terrestris, A. agrarius, Mustela nivalis, Talpa europaea, and Mi. agrestis. DNA of Leptospira spp. was detected in 6% of all small mammals. At site B1, 25 small mammals (11.6%), at site B2, 15 small mammals (3.3%) and at site S, 33 small mammals (6.1%) were positive for Leptospira spp. Overall, 54 of the positive samples were further determined as L. kirschneri, nine as L. interrogans and four as L. borgpetersenii while five real-time PCR-positive samples could not be further determined by conventional PCR. MLST results revealed focal occurrence of L. interrogans and L. kirschneri sequence type (ST) 117 while L. kirschneri ST 110 was present in small mammals at all three sites. Further, this study provides evidence for a particular host association of L. borgpetersenii to mice of the genus Apodemus.

  11. [Genotyping and evaluation of infection dynamics in a Colombian isolate of Leptospira santarosai in hamster as an experimental model].

    Science.gov (United States)

    Agudelo-Flórez, Piedad; Durango, Harold; Aranzazu, Diego; Rodas, Juan David; Travi, Bruno

    2014-01-01

    Is necessary to develop models for the study of leptospirosis. To genotype a Colombian strain of Leptospira isolated from a human with Weil´s syndrome and to evaluate its infection dynamics in the hamster experimental model. Genotyping was performed by amplification and sequence analysis of the rrs 16S and lipL32 genes. The median lethal dose was determined in intraperitoneally inoculated hamsters. The patterns of clinical chemistry, the duration of leptospiremia, leptospiruria and pathological findings were studied and compared in the same animal model infected with L. interrogans (Fiocruz L1-130). Molecular typing revealed that the isolate corresponded to the pathogenic species L. santarosai, which was recovered from hamsters´ kidneys and lungs and detected by lipL32 PCR from day 3 post-infection in these organs. There was a marked increase of C-reactive protein in animals at day 5 post-infection (3.25 mg/dl; normal value: 0.3 mg/dl) with decreases by day 18 (2.60 mg/dl: normal value: 0.8 mg/dl). Biomarkers of urea showed changes consistent with possible renal acute failure (day 5 post-infection: 49.01 mg/dl and day 18 post-infection: 53.71 mg/dl). Histopathological changes included interstitial pneumonia with varying degrees of hemorrhage and interstitial nephritis. The pathogenic species L. santarosai was identified in Colombia. Its pathogenicity as determined by tropism to lung and kidney was comparable to that of L. interrogans Fiocruz L1-130, well known for its virulence and pulmonar tropism. The biological aspects studied here had never before been evaluated in an autochthonous isolate.

  12. Whole genome analysis of Leptospira licerasiae provides insight into leptospiral evolution and pathogenicity.

    Directory of Open Access Journals (Sweden)

    Jessica N Ricaldi

    Full Text Available The whole genome analysis of two strains of the first intermediately pathogenic leptospiral species to be sequenced (Leptospira licerasiae strains VAR010 and MMD0835 provides insight into their pathogenic potential and deepens our understanding of leptospiral evolution. Comparative analysis of eight leptospiral genomes shows the existence of a core leptospiral genome comprising 1547 genes and 452 conserved genes restricted to infectious species (including L. licerasiae that are likely to be pathogenicity-related. Comparisons of the functional content of the genomes suggests that L. licerasiae retains several proteins related to nitrogen, amino acid and carbohydrate metabolism which might help to explain why these Leptospira grow well in artificial media compared with pathogenic species. L. licerasiae strains VAR010(T and MMD0835 possess two prophage elements. While one element is circular and shares homology with LE1 of L. biflexa, the second is cryptic and homologous to a previously identified but unnamed region in L. interrogans serovars Copenhageni and Lai. We also report a unique O-antigen locus in L. licerasiae comprised of a 6-gene cluster that is unexpectedly short compared with L. interrogans in which analogous regions may include >90 such genes. Sequence homology searches suggest that these genes were acquired by lateral gene transfer (LGT. Furthermore, seven putative genomic islands ranging in size from 5 to 36 kb are present also suggestive of antecedent LGT. How Leptospira become naturally competent remains to be determined, but considering the phylogenetic origins of the genes comprising the O-antigen cluster and other putative laterally transferred genes, L. licerasiae must be able to exchange genetic material with non-invasive environmental bacteria. The data presented here demonstrate that L. licerasiae is genetically more closely related to pathogenic than to saprophytic Leptospira and provide insight into the genomic bases for

  13. Rapid Isolation and Susceptibility Testing of Leptospira spp. Using a New Solid Medium, LVW Agar

    Science.gov (United States)

    Wuthiekanun, Vanaporn; Amornchai, Premjit; Paris, Daniel H.; Langla, Sayan; Thaipadunpanit, Janjira; Chierakul, Wirongrong; Smythe, Lee D.; White, Nicholas J.; Day, Nicholas P. J.; Peacock, Sharon J.

    2013-01-01

    Pathogenic Leptospira spp., the causative agents of leptospirosis, are slow-growing Gram-negative spirochetes. Isolation of Leptospira from clinical samples and testing of antimicrobial susceptibility are difficult and time-consuming. Here, we describe the development of a new solid medium that facilitates more-rapid growth of Leptospira spp. and the use of this medium to evaluate the Etest's performance in determining antimicrobial MICs to drugs in common use for leptospirosis. The medium was developed by evaluating the effects of numerous factors on the growth rate of Leptospira interrogans strain NR-20157. These included the type of base agar, the concentration of rabbit serum (RS), and the concentration and duration of CO2 incubation during the initial period of culture. The highest growth rate of NR-20157 was achieved using a Noble agar base supplemented with 10% RS (named LVW agar), with an initial incubation at 30°C in 5% CO2 for 2 days prior to continuous culture in air at 30°C. These conditions were used to develop the Etest for three species, L. interrogans (NR-20161), L. kirschnerii (NR-20327), and L. borgpetersenii (NR-20151). The MICs were read on day 7 for all samples. The Etest was then performed on 109 isolates of pathogenic Leptospira spp. The MIC90 values for penicillin G, doxycycline, cefotaxime, ceftriaxone, and chloramphenicol were 0.64 units/ml and 0.19, 0.047, 0.5, and 2 μg/ml, respectively. The use of LVW agar, which enables rapid growth, isolation of single colonies, and simple antimicrobial susceptibility testing for Leptospira spp., provides an opportunity for new areas of fundamental and applied research. PMID:23114772

  14. Leptospira Species in Feral Cats and Black Rats from Western Australia and Christmas Island.

    Science.gov (United States)

    Dybing, Narelle A; Jacobson, Caroline; Irwin, Peter; Algar, David; Adams, Peter J

    2017-05-01

    Leptospirosis is a neglected, re-emerging bacterial disease with both zoonotic and conservation implications. Rats and livestock are considered the usual sources of human infection, but all mammalian species are capable of carrying Leptospira spp. and transmitting pathogenic leptospires in their urine, and uncertainty remains about the ecology and transmission dynamics of Leptospira in different regions. In light of a recent case of human leptospirosis on tropical Christmas Island, this study aimed to investigate the role of introduced animals (feral cats and black rats) as carriers of pathogenic Leptospira spp. on Christmas Island and to compare this with two different climatic regions of Western Australia (one island and one mainland). Kidney samples were collected from black rats (n = 68) and feral cats (n = 59) from Christmas Island, as well as feral cats from Dirk Hartog Island (n = 23) and southwest Western Australia (n = 59). Molecular (PCR) screening detected pathogenic leptospires in 42.4% (95% confidence interval 29.6-55.9) of cats and 2.9% (0.4-10.2) of rats from Christmas Island. Sequencing of cat- and rat-positive samples from Christmas Island showed 100% similarity for Leptospira interrogans. Pathogenic leptospires were not detected in cats from Dirk Hartog Island or southwest Western Australia. These findings were consistent with previous reports of higher Leptospira spp. prevalence in tropical regions compared with arid and temperate regions. Despite the abundance of black rats on Christmas Island, feral cats appear to be the more important reservoir species for the persistence of pathogenic L. interrogans on the island. This research highlights the importance of disease surveillance and feral animal management to effectively control potential disease transmission.

  15. Ecología de Vibrio cholerae en relación al Fitoplancton y variables fisicoquímicas en ríos de Tucumán (Argentina Ecology of Vibrio cholerae in relation to phytoplankton and physico-chemical variables in rivers of Tucumán (Argentina

    Directory of Open Access Journals (Sweden)

    V. Mirande

    Full Text Available Vibrio cholerae muestra gran diversidad serológica en base a su antígeno somático O, conociéndose al menos 200 serogrupos. De éstos, solamente O1 y O139 son causantes de epidemias o pandemias. En Latinoamérica el serogrupo O1 reapareció en 1991, tras cien años de no presentar brotes en el continente. Esta bacteria sobrevive y se multiplica asociada al plancton, independientemente de la aparición de infecciones humanas. Desde la década del noventa, en Tucumán, se detectaron casos esporádicos de diarrea por Vibrio cholerae no-O1. El objetivo del presente trabajo fue estudiar la posible relación entre la presencia de especímenes de fitoplancton, variables fisicoquímicas y aislamientos de Vibrio cholerae en ríos de Tucumán. Se realizaron 18 campañas en los ríos Lules y Salí entre 2003-2005. Se estudiaron las variables fisicoquímicas del agua (pH, temperatura, conductividad y oxígeno disuelto, el fitoplancton (riqueza y frecuencia relativa y las cepas aisladas de V. cholerae. Los resultados evidenciaron diferencias en la calidad del agua, observándose períodos de anoxia en el río Salí. Las diatomeas sobresalieron en la mayoría de los meses y generalmente estuvieron en porcentajes superiores al 85 %. Sólo se aisló Vibrio cholerae no-O1, no-O139, detectándose más frecuentemente en los meses cálidos, con pH alcalino, aún con baja concentración de oxígeno.Vibrio cholerae shows a great serologic diversity in relation to his O somatic antigen and we know at least 200 serogroups. About these, only O1 and O139 are responsible of epidemics and pandemics. The serogroup O1 reemerged in Latin America in 1991 after being absent from the continent for nearly a century. This bacterium survives and grows up associated to plankton, independently of appearance of human infections. From 90 th decade, there were sporadic cases of diarrhea because of Vibrio cholerae O1 in Tucumán. The aims of this paper were to study the possible

  16. Desarrollo de un método de CLAR-IR para la determinación de etanol residual en vacuna Development of a HPLC-IR method for determination of residual ethanol in vaccine

    Directory of Open Access Journals (Sweden)

    Matilde Cuevas Valdespino

    2009-08-01

    Full Text Available Los ingredientes farmacéuticos activos de la vacuna antimeningocócica cubana VA-MENGOC-BC TM (vesículas de membrana externa purificadas de Neisseria meningitidis, serogrupo B y polisacárido capsular purificado de Neisseria meningitidis, serogrupo C son conservados en etanol, de ahí que dicha vacuna posea un contenido de etanol residual, cuya concentración real no se conocía hasta el momento. Las regulaciones internacionales plantean que los productos biofarmacéuticos y sus ingredientes farmacéuticos activos deben tener bien caracterizadas todas sus impurezas, por lo que el objetivo de este trabajo fue el desarrollo de un método de determinación de etanol mediante cromatografía líquida de alta resolución-índice de refracción para estos fines y su comparación con un método utilizado frecuentemente para cuantificar este solvente, como es la cromatografía gaseosa. El método evaluado resultó ser útil y con una buena robustez para la determinación de este solvente orgánico en esta vacuna antimenigocócica. No se detectaron diferencias estadísticamente significativas entre los resultados obtenidos al evaluar las mismas muestras de vacuna mediante ambos métodos cromatográficos (cromatografía líquida de alta resolución y cromatografía gaseosa, lo que indica la posibilidad del uso de la cromatografía líquida de alta resolución en sustitución de la cromatografía gaseosa para esta determinación.Active pharmaceutical ingredients of Cuban anti-meningococcal vaccine VA-MENGOC-BC TM (vesicles of purified external membranes of Neisseria meningitidis, B serum-group, and purified capsular polysaccharide of Neisseria meningitidis, serum-group C are stored in ethanol, thus that such vaccine has residual ethanol content, of which real concentration is not known just now. International regulations propose that the biopharmaceutical products and its active pharmaceutical ingredients must to have well defined all impurities, thus

  17. Caracterización de aislamientos de Vibrio cholerae no-O1, no-O139 asociados a cuadros de diarrea Characterization of Vibrio cholerae non-O1 and non-O139 isolates associated with diarrhea

    Directory of Open Access Journals (Sweden)

    S. González Fraga

    2009-03-01

    Full Text Available La infección por Vibrio cholerae, el agente causal del cólera, se trasmite al hombre por ingestión de agua y alimentos contaminados. Aunque son los serogrupos O1 y O139 los que habitualmente se asocian al cólera epidémico, los aislamientos de otros serogrupos también son causales de gastroenteritis e infecciones extra-intestinales. Durante el período 2003-2005, se investigó la presencia de V. cholerae en la materia fecal de niños con diarrea atendidos en el Hospital del Niño Jesús, Tucumán. Se recuperaron 34 aislamientos de V. cholerae no-O1, no-O139. Se determinaron sus perfiles de virulencia por PCR, la sensibilidad a los antimicrobianos y la diversidad genética por electroforesis en campo pulsado. Se obtuvieron ocho perfiles de virulencia, aunque ningún aislamiento fue positivo para la toxina colérica ni para la toxina termoestable. Cuatro aislamientos fueron positivos para el sistema de secreción de tipo tres. El 17,6% de los aislamientos fueron resistentes o de sensibilidad intermedia a ampicilina y el 5,9% fueron resistentes a trimetoprima-sulfametoxazol. Los aislamientos resultaron muy diversos: se hallaron 27 patrones distintos en 29 aislamientos tipificables por electroforesis en campo pulsado. A pesar de su baja incidencia, V. cholerae continúa siendo un agente causal de diarrea en niños, los que se ven afectados por una amplia variedad de cepas circulantes.Vibrio cholerae, etiologic agent of cholera, is transmitted to humans by ingestion of contaminated food or water. Even though serogroups O1 and O139 are the ones usually associated to epidemic cholera, isolates from other serogroups also cause gastroenteritis and extraintestinal infections. During the period 2003-2005, presence of V. cholerae in stools was investigated in children with diarrhea that seaked assistance at the Niño Jesús Hospital in Tucumán. Thirty four isolates of V. cholerae non-O1, non-O139 were recovered. We characterized the isolates studying

  18. Brotes de leptospirosis humana en la provincia de Ciego de Ávila, Cuba Human leptospirosis outbreak in the district of Ciego de Ávila, Cuba

    Directory of Open Access Journals (Sweden)

    Miguel Suárez Hernández

    1999-02-01

    Full Text Available Se analizan los brotes de leptospirosis ocurridos en la provincia de Ciego de Ávila en el periodo de 1980 a 1995. En la etapa se notifican 40 brotes. Las actividades principales vinculadas a los mismos fueron la atención al cultivo de la caña de azúcar, al cultivo del plátano, el baño en río y las inundaciones. Se nota un incremento de brotes a partir del mes de junio. En los meses de octubre y noviembre se reportan las mayores incidencias. Los grupos de edades que más casos aportaron fueron de 10-14 años, 15-19 años y 30-34 años. El sexo más afectado fue el masculino. Los grupos más afectados fueron los estudiantes, pobladores urbanos y trabajadores agrícolas cañeros. De los 40 brotes, 21 fueron confirmados por medio de la prueba de microaglutinación y 19 por la prueba hemolitica, siendo los serogrupos más frecuentes Pomona y Australis.Forty leptospirosis outbreaks occurred in Ciego de Avila province from 1980 to 1995. The main events involved in the outbreaks were floods, bathing in rivers and activities related to sugar cane and banana cultivation. The number of cases increased after June, with higher incidences reported in October and November. The most affected age groups were 10-14 years, 15-19 years and 30-34 years. Men were more affected than women. Students, people residing in the urban zone and farmers were the most affected groups. A total of 21 outbreaks out of 40 were confirmed by the microagglutination test and the remaining 19 by the hemolytic test. Pomona and Australis were the serogroups most frequently detected by microagglutination.

  19. Neumonía aguda de la comunidad y hemorragia pulmonar por leptospirosis en el área metropolitana Buenos Aires

    Directory of Open Access Journals (Sweden)

    Alfredo Seijo

    2011-04-01

    Full Text Available El objetivo del trabajo es comunicar los hallazgos epidemiológicos, clínicos y de diagnóstico de la neumonía y hemorragia pulmonar por leptospirosis, en el período enero 2007 a octubre 2009. Un 64% (20/31 de pacientes con diagnóstico de leptospirosis tuvieron neumonía. Quince de ellos (75% presentaron neumonía grave, de los cuales siete (35% desarrollaron hemorragia pulmonar. En diez enfermos (32% el motivo de consulta e inicio del cuadro clínico fue una gastroenteritis secretoria con fiebre y dolor abdominal. La ictericia sólo se manifestó en once pacientes (35%. La técnica de reacción en cadena de la polimerasa (PCR fue útil para el diagnóstico en muestra obtenida post mortem. De un hemocultivo se aisló una cepa clasificada dentro del serogrupo canicola. Se clasificaron las neumonías en tres tipos: neumonías de curso no grave con escasa repercusión general; neumonías graves asociadas a formas clínicas sistémicas con ictericia, insuficiencia renal, trombocitopenia y hemorragia pulmonar; también de curso grave, no asociada a ictericia, insuficiencia renal o trombocitopenia grave. El tratamiento antibiótico iniciado en los primeros días de enfermedad (promedio 3.2 días no tuvo influencia en la evolución de las neumonías graves. Se plantea además considerar tres formas clínicas de leptospirosis: anictérica, ictérica (con sus variantes evolutivas y hemorragia pulmonar.

  20. De la secuencia de un genoma bacteriano a la identificación de candidatos vacunales

    Directory of Open Access Journals (Sweden)

    Daniel Yero Corona

    2006-04-01

    Full Text Available Cada día hay más secuencias genómicas completas de un gran número de patógenos humanos. La disponibilidad de estas secuencias ha cambiado completamente el panorama para el desarrollo de vacunas, introduciendo una nueva línea de pensamiento en este proceso. Esta metodología comienza por la secuencia genómica y mediante un análisis computacional se predicen aquellos antígenos más probables a ser candidatos vacunales. Por ejemplo, con el uso de herramientas bioinformáticas se puede hacer un pesquisaje in silico de aquellas proteínas expuestas en la superficie bacteriana, con vistas a identificar antígenos candidatos vacunales. La confirmación in vitro de estos resultados de localización celular y el uso de modelos animales para evaluar la inmunogenicidad de los candidatos acota finalmente el número de candidatos definidos por la computadora. A este proceso, aplicado por primera vez a Neisseria meningitidis serogrupo B, se le denomina vacunología inversa. La genómica también brinda información sobre la biología y la virulencia de especies patogénicas mediante la genómica comparativa. En este trabajo de revisión, describimos cómo la genómica puede ser usada en la identificación de nuevos candidatos vacunales.

  1. Identificación y tipificación de biotipos y serotipos de Yersinia enterocolitica

    Directory of Open Access Journals (Sweden)

    Paulino Elizalde Castañeda

    2001-08-01

    Full Text Available OBJETIVO: Conocer la existencia de Yersinia enterocolitica en suínos visiblemente sanos y sacrificados para el consumo humano. MÉTODOS: Fueron estudiadas 100 muestras de tejido linfático obtenidas en el momento del sacrifício, en un matadero del Estado de México. Fueron realizados muestreos pilotos de 20 casos, de los cuales 20% fueron positivos, permitiendo obtener una muestra estudiada (n=100. Las muestras colectadas de tejido linfático fueron acondicionadas para el aislamiento de Yersinia enterocolitica en caldo de Rappaport y en medio de cultivo de Salmonella-Shigella y MacConkey. Las identificaciones fueron efectuadas por medio de pruebas bioquímicas y serológicas, utilizándose en el caso los antisueros O:3, O:8 y O:9 para la biotipificación correspondiente. RESULTADOS: Fueron obtenidos 22 aislamientos tipificándose 8 serotipos pertenecientes al O:3 y 8 al O:9 correspondientes al biotipo 1; y, en 6 muestras no fue posible la serotipificación. No se encontró en el total de los aislados el serotipo O:8. CONCLUSIONES: En base en la metodología, se registró la presencia de Y. enterocolitica y sus serogrupos en tejido linfático de porcinos por la primera vez en México; esto es importante porque el patógeno y sus serotipos aislados están comprometidos con mayor frecuencia con problemas de salud pública.

  2. Selección de cepas de Shigella sonnei para el desarrollo de una vacuna efectiva contra la shigellosis

    Directory of Open Access Journals (Sweden)

    Olga M. Martínez

    2008-12-01

    Full Text Available En el Instituto Finlay se desarrolló una metodología de trabajo que contribuyó a la selección de cepas de Shigella sonnei como posibles candidatos vacunales contra la shigellosis. Las cepas investigadas, donadas por el Centro Provincial de Higiene y Epidemiología de Ciudad de La Habana, se caracterizaron según los métodos convencionales. La identificación del serogrupo y serotipo se realizó por aglutinación en láminas portaobjetos con antisueros comerciales; mientras que para el estudio de la susceptibilidad antimicrobiana se utilizó el DIRAMIC 10, un equipo semiautomatizado que proporcionó los resultados 4 horas después de su realización. Se investigó también la presencia de plásmidos de virulencia, por el crecimiento de Shigella spp. en medio de agar Triptona Soya con Rojo Congo al 0,025%, así como la expresión de las proteínas de la membrana externa en SDS-PAGE; para las pruebas de virulencia y potencia se emplearon los modelos animales (modelo ratón-pulmón y Test de Sereny. Los resultados obtenidos con la metodología utilizada permitieron la selección de la cepa de S. sonnei A-04 como la más adecuada para la obtención del posible candidato vacunal.

  3. Caracterización proteómica de vesículas de membrana externa extraídas de Shigella sonnei

    Directory of Open Access Journals (Sweden)

    María de los A Padrón-Collaz

    2017-12-01

    Full Text Available Las vacunas compuestas por vesículas de membrana externa (VMEs previenen de manera exitosa la enfermedad meningocócica del serogrupo B. Esta plataforma tecnológica de obtención puede ser aplicada para otros patógenos bacterianos Gram negativos. Una vacuna de VMEs desarrollada contra Shigella sonnei fue obtenida a través de una extracción de componentes celulares y su caracterización por electroforesis en geles de poliacrilamida unidimensional (1D. Se estudiaron las mejores condiciones de solubilización de las muestras, separación electroforética e identificación a través de espectrometría de masas acoplada a cromatografía de alta presión después del corte de las bandas y su tratamiento enzimático con tripsina. En esta etapa se identificaron un total de 57 proteínas en 23 bandas (2,5 proteínas por banda escindida, 47 de las proteínas no repetidas. Las proteínas inmunogénicas presentes en VMEs de S. sonnei fueron cuantificadas en cuanto a masa molecular por 1D-Western blotting en membranas de nitrocelulosa con anticuerpos obtenidos a partir de ratones inmunizados con las VMEs. Como que las bandas electroforéticas 1D contenían más de una proteína, se estudiaron las mejores condiciones de separación por el método de electroforesis bidimensional (2D para el establecimiento del mapa proteico; tal que el incremento del tamaño de las tiras, el tiempo de focalización y la aplicación catódica garantizaron la mayor resolución.

  4. Nivel de corte de los ELISAs para cuantificación de anticuerpos inducidos por la vacuna antimeningocócica VA-MENGOC-BC

    Directory of Open Access Journals (Sweden)

    Rolando Ochoa

    2001-06-01

    Full Text Available Para medir el grado de protección inducido por vacunas antimeningocócicas se ha establecido el Ensayo Bactericida en Suero (EBS y se perfeccionan otros ensayos inmunobiológicos, sin embargo, es necesario contar con pruebas sencillas como el ELISA, capaz de evaluar un gran número de muestras. Se estimó el nivel de corte de los ELISAs para la cuantificación de IgG humana contra los antígenos de VA-MENGOC-BC, vacuna antimeningocócica compuesta por vesículas proteicas de membrana externa de meningococo B y polisacárido capsular de meningococo C, con respecto a un panel de muestras de suero de lactantes, caracterizado por Ensayo Bactericida en Sangre Total (EBST. Los valores correspondientes a la máxima sensibilidad y especificidad fueron respectivamente; 2 μg/mL y 12 μg/mL para antipolisacárido C, y 1000 U/mL y 7000 U/mL para antiproteínas de membrana externa. La mayor coincidencia se obtuvo con 6 μg/mL y 2500 U/mL. Se evaluó otro panel de muestras de suero de adolescentes entre 14 y 18 años, por ELISA y EBS para Neisseria meningitidis serogrupos B y C, alcanzándose una buena concordancia. Doce años después de la inmunización con VA-MENGOC-BC persiste una importante concentración de anticuerpos contra los antígenos vacunales en los sueros estudiados.

  5. Brote de legionelosis en Murcia en julio de 2001. La óptica de sanidad ambiental Outbreak of Legionella disease in Murcia, at July 2001. The environmental health point of view

    Directory of Open Access Journals (Sweden)

    F. Sintas Lozano

    2002-06-01

    Full Text Available Se exponen las medidas de intervención adoptadas para el estudio y control del brote. Se encontraron 126 instalaciones con riesgo (45 de ellas de alto: 70 torres de refrigeración y similares, 35 fuentes ornamentales, 1 obra con movimiento de tierra y 20 sistemas con circuito cerrado aire-agua, que se distribuyeron por categorías de riesgo.De forma inmediata se clausuraron: las fuentes ornamentales, el baldeo de calles y riegos por aspersión de parques y la obra.Se realizaron un total de 486 inspecciones y 1040 toma de muestras, ordenando la limpieza y desinfección de torres de refrigeración y similares y su clausura en caso necesario. Posteriormente, se cambio de relleno en torres de refrigeración positivas a Lp.Del total de instalaciones investigadas (339, en 57 (16’9% se encontró un cultivo positivo a Lp. Distribución por tipo de instalación con cultivo positivo a Lp: en torres de refrigeración 23 (6’8%, en fuentes ornamentales 3 (7,32% y en agua sanitaria 31 (9’1%.Distribución por serogrupos: LpS1 (62’3%, serogrupos 2-14 (36’68%.LpS1Olda Olda (21’74% fue la mas abundante seguida de LpS1 Pontiac Filadelfia Lugano (18’84% frente a LpS1 Pontiac Filadelfia Glasgow (en 1 ocasión, 1’45%, esta ultima fue la aislada en las 18 muestras de enfermos.En 355 ocasiones se dispone de cultivo y PCR, encontrándose una sensibilidad de 30,8% (Intervalo de confianza al 95%, de 25,1 y una especificidad del 99,4±0,8. Hay que considerar la eventual influencia en los resultados aportada por la posible aparición de dos falsos negativos en el cultivo.Se encuentra un elevado porcentaje de muestras correspondientes a Legionella pneumophilla serogrupo 1, dentro de estas prevalecen las tipo Pontiac Philadelphia, y dentro de estas las tipo Lugano.La primera desinfección no erradicó la contaminación en su totalidad. Abundando en lo anterior, el hallazgo de un número considerable de torres de refrigeración positivas a Lp tras limpieza y

  6. DIAGNOSTICO SEROLÓGICO DE NEUMONIA POR LEGIONELLA. INCIDENCIA EN UN PERIODO DE TRES AÑOS EN EL AREA SANITARIA OESTE DE VALLADOLID

    Directory of Open Access Journals (Sweden)

    M.A. Mazón

    2005-12-01

    other two cases the title of the first sample already was > 1/1024.Although in our casuistic the incidence of pneumonia by Legionella is low, we can observe the importance of the determination of the urinary Legionella antigen as well as the delayed appearance of antibodies. The clinical importance of this single observation carried us to practice a second determination of antibodies when the suspicion of pneumonia by Legionella is high. RESUMEN.Introducción: Las especies de Legionella son bacilos gram negativos. Fueron descritas por primera vez en los 70 asociados a la enfermedad de los legionarios (EL. Casi la mitad de las 34 especies conocidas son patógenas para el hombre. Las manifestaciones clínicas de infecciones por Legionella son fundamentalmente respiratorias. La forma más común es la neumonía aguda, que varía en severidad de enfermedad suave que no requiere hospitalización a neumonía fatal.Material y Métodos: Se han estudiado y revisado los resultados correspondientes a la medición de anticuerpos frente a L. pneumophila por inmunofluorescencia indirecta, IFI (Gull Laboratories, que determina anticuerpos frente a un pool de serogrupos 1, 2, 3, 4, 5, 6, 7 y 8. El número de resultados obtenidos por IFI, correspondientes al periodo 2000-2003, ha sido de 1249, procedentes de diferentes Servicios de nuestro Centro.La determinación de antígeno urinario de Legionella, se ha realizado, en casi todas muestras estudiadas, mediante una técnica inmunocromatográfica rápida para la detección cualitativa del antígeno serogrupo 1 de L. pneumophila (Binax NOW.Resultados y Discusión: De todas las determinaciones realizadas (1249, solo se han confirmado 12 casos de neumonía por Legionella. Posteriormente, se revisaron las historias clínicas y se observó que las edades de los casos confirmados oscilaban entre los 40 y 87 años, con un promedio de edad de 40, de los cuales 8 eran varones y 4 mujeres. Desde el punto de vista de factores de riesgo 6 eran

  7. Clinical, serological and echocardiographic examination of healthy field dogs before and after vaccination with a commercial tetravalent leptospirosis vaccine.

    Science.gov (United States)

    Spiri, Andrea M; Rodriguez-Campos, Sabrina; Matos, José M; Glaus, Tony M; Riond, Barbara; Reusch, Claudia E; Hofmann-Lehmann, Regina; Willi, Barbara

    2017-05-25

    Leptospirosis is a re-emerging bacterial zoonosis caused by spirochetes of the genus Leptospira. Severe disease has been reported in dogs in Europe despite vaccination with bivalent Leptospira vaccines. Recently, a tetravalent canine Leptospira vaccine (Nobivac® L4) was licenced in Europe. The goal of this study was to investigate clinical signs, microscopic agglutination test (MAT) titres, haematology, blood biochemistry, cardiac (c) Troponin I levels and echocardiography before and after vaccination with this tetravalent vaccine. Forty-eight healthy dogs were prospectively enrolled and vaccinated twice, 3-4 weeks apart (T0 and T1). Before vaccination (T0) and 16-31 days after the second vaccination (T2), MAT (n = 48), haematology (n = 48), blood biochemistry (n = 36) and cTroponin I measurements (n = 29) were performed, and MAT was repeated 347-413 days after the second vaccination (T3, n = 44). Echocardiography was performed before the first and second vaccination (T0 and T1, n = 24). Mild and transient clinical signs within 5 days following the first and second vaccination occurred in 23% and 10% of the dogs, respectively. Before the first vaccination (T0), all dogs showed negative MAT titres for the tested serovars except for Canicola (50% with titres 100-400). At T2, positive MAT titres to the serovars Canicola (100%), Australis (89%), Grippotyphosa (86%), Bratislava (60%), Autumnalis (58%), Copenhageni (42%), Pomona (12%), Pyrogenes (8%) and Icterohaemorrhagiae (2%) were found. Median to high titres (≥ 400) were most common to the serovar Canicola (92%) and less common to the serovars Australis (41%), Grippotyphosa (21%), Bratislava (12%), Autumnalis (4%), Pyrogenes (4%) and Pomona (2%). At T3, positive MAT titres (titre range: 100-400) were found in 2-18% of the dogs to serovars of the vaccine serogroups and in 2-18% of the dogs to the non-vaccine serovars Pomona, Autumnalis, Pyrogenes and Ballum. Haematology, blood biochemistry, c

  8. Caracterización molecular de serovariedades de Leptospira spp. aisladas de muestras de animales y agua en Colombia

    Directory of Open Access Journals (Sweden)

    Claudia M. Romero-Vivas

    2013-08-01

    Full Text Available Introducción. La leptospirosis es una infección bacteriana transmitida directa o indirectamente de animales a humanos, la cual puede resultar en una enfermedad hemorrágica grave, hepática o renal y pulmonar. Hay 20 especies de Leptospira conocidas y cientos de serovariedades, algunas de las cuales pertenecen a diferentes especies. Es esencial identificar las serovariedades patógenas y sus reservorios potenciales para enfocar estrategias de control. Objetivo. Caracterizar las serovariedades de Leptospira aisladas de muestras de roedores, perros, cerdos y agua en Colombia. Materiales y métodos. Las cepas de leptospiras aisladas fueron identificadas como patógenas usando la reacción en cadena de la polimerasa (PRC. Sus ADN y el ADN de Salmonella Braenderup H9812 (marcador de peso molecular fueron cortados con NotI y corridos en electroforesis de campo pulsado. Los patrones de la ECP se analizaron con base en los criterios de tipificación para cepas bacterianas y el coeficiente de Dice, cuando se compararon con 200 cepas aisladas en otras partes del mundo. Los perfiles de ADN con un coeficiente de Dice entre 73,7 % y 100 % se consideraron pertenecientes a la misma especie. Resultados. Todos los aislamientos fueron cepas patógenas y cinco se caracterizaron genéticamente. El aislamiento P275 (coeficiente de Dice: 84 % y el P282 (coeficiente de Dice: 95 % de cerdos, se relacionaron con Leptospira interrogans de serovariedad Pomona; el aislamiento de rata (I15 fue indistinguible de Leptospira interrogans de serovariedades Icterohaemorrhagiae o Copenhageni (coeficiente de Dice: 100 %, mientras que los aislamientos de perro (C67 y agua (A42 no se relacionaron (coeficiente de Dice <73,7 % con ninguna de las 200 cepas de referencia; las más cercanas fueron Leptospira noguchii de serovariedades Nicaragua (coeficiente de Dice: 63 % y Orleans (coeficiente de Dice: 60 %. Conclusiones. Esta fue la primera caracterización molecular de serotipos de

  9. Leptopirosis in animal of animal house of Biologic Science Center of Londrina State University / Leptospirose em animais do biotério central do Centro de Ciências Biológicas da Universidade Estadual de Londrina

    Directory of Open Access Journals (Sweden)

    Ernst Eckehardt Muller

    2000-12-01

    Full Text Available Leptospirosis has been described in laboratory animal house of several countries happening among mice. albino rats. guinea pigs, dogs, rabbits, monkeys and man. The laboratory animal house of Biologic Science Center of Londrina State University maintains and breeds several species of animals and stray dogs trapped in citíes of Paraná State. In this paper w e r e utilized for leptospirosis research, 325 wistar rats. 323 albino mice. 289 dogs, 135 rabbits. 119 guinea pigs, and 57 black rats trapped around of animal house. The microscopic agglutination test with 22 cultures of Leptospira interrogans showed positive results in 110 dogs and o n e guinea pig, having been found antibodies against serovars canicola (62, 7%, pyrogenes (51,8%, castellonis (30.9% and icterobaemorrhagiae (23,6%. The dark field microscopy examination of 574 urine samples (282 albino mice, 224 wistar rats, 29 black rats, 24 dogs, 13 rabbits and two guinea pigs showed positive resuíts in six dogs. The seven attempts of urine and kidneys isolation were negatives.A leptospirose tem sido descrita em biotérios de vários países, acometendo camundongos, ratos albinos, cobaios, cães, coelhos e macacos além do manipuladores. O Biotério Centrai do Centro de Ciências Biológicas da Universidade Estadual de Londrina mantém e cria várias espécies de animais além de receber cães de rua, capturados em municípios do Estado do Paraná. Neste trabalho foram utilizados para a pesquisa de leptospirose, soros de 325 ratos wistar, 323 camundongos albinos. 289 cães de rua, 135 coelhos, 119 cobaios, além de 57 ratos pretos capturados nas proximidades do biotério. A prova de somaglutinação microscópica com 22 soroiipos de Lepiospira interrogans mostrou resultados positivos em 110 cães e um cobaio, sendo encontrado anticorpos principalmente contra os soroiipos canicola (62. 7%. pyrogenes (51.8%. castellonis (30,9% e icterohaemorrhagiae (23.6%. A pesquisa direta de leptospira em

  10. Diagnóstico molecular de Leptospira spp em matrizes suínas descartadas

    Directory of Open Access Journals (Sweden)

    Sérgio José de Oliveira

    2007-02-01

    Full Text Available O Diagnóstico de leptospirose foi efetuado através de método molecular, histopatológico e sorológico em 30 matrizes suínas, descartadas, no Rio Grande do Sul, Brasil. Os objetivos foram comparar a eficiência dos 3 métodos, verificar a sensibilidade de um método de PCR que utiliza um primer único baseado na seqüência de um elemento repetitivo do genoma de Leptospira interrogans, bem como verificar a possível detecção de leptospiras em vários tecidos, incluindo o trato genital. Os animais foram selecionados com base no teste de aglutinação microscópica para incluir tanto animais negativos como positivos e com baixos e altos títulos sorológicos. As maiores freqüências (90 % dos aniamis positivos e títulos (100 to 800 foram observados para L. interrogans serovar bratislava. Leptospiras foram detectadas por histopatologia em apenas 9 matrizes, todas com altos títulos (pelo menos 100. Um produto de PCR de 438 bp foi observado em todos os animais (fragmentos de 25 rins, 24 úteros e 9 ovidutos. Produtos de PCR similares foram obtidos em DNA de culturas de leptospiras patogênicas, enquanto a não patogênica, L. patoc apresentou um padrão distinto. Nenhum produto de amplificação de DNA de Leptospira spp foi detectado em DNA de culturas de Escherichia coli, Proteus mirabilis, Pseudomonas aeruginosa, Salmonella sp, Streptococcus sp and Staphylococcus aureus, ou de sangue de dois leitões. O método molecular foi, assim, específico e o mais eficiente para detectar baixos níveis de patógeno, sendo capaz de diferenciar leptospiras patogênicas e não patogênicas.

  11. Renal involvement in leptospirosis: the effect of glycolipoprotein on renal water absorption.

    Directory of Open Access Journals (Sweden)

    Katia Regina Cesar

    Full Text Available BACKGROUND: Leptospirotic renal lesions frequently produce a polyuric form of acute kidney injury with a urinary concentration defect. Our study investigated a possible effect of the glycolipoprotein, (GLPc extracted from L. interrogans, on vasopressin (Vp action in the guinea pig inner medullary collecting duct (IMCD. METHODS: The osmotic water permeability (Pf µm/s was measured by the microperfusion in vitro technique. AQP2 protein abundance was determined by Western Blot. Three groups were established for study as follows: Group I, IMCD from normal (ngp, n = 5 and from leptospirotic guinea-pigs (lgp-infected with L. interrogans serovar Copenhageni, GLPc, n = 5; Group II, IMCD from normal guinea-pigs in the presence of GLPc (GLPc group, n = 54; Group III, IMCD from injected animals with GLPc ip (n = 8. RESULTS: In Group I, PFS were: ngp--61.8±22.1 and lgp--8.8±12.4, p<0.01 and the urinary osmolalities were: lgp--735±64 mOsm/Kg and ngp--1,632±120 mOsm/Kg. The lgp BUN was higher (176±36 mg% than the ngp (56±9 mg%. In Group II, the Pf was measured under GLPc (250 µg/ml applied directly to the bath solution of the microperfused normal guinea-pig IMCDs. GLPc blocked Vp (200 pg/ml, n = 5 action, did not block cAMP (10(-4 M, and Forskolin (Fors--10(-9 M action, but partially blocked Cholera Toxin (ChT--10(-9 M action. GLP from L.biflexa serovar patoc (GLPp, non pathogenic, 250 µg did not alter Vp action. In Group III, GLPc (250 µg injected intraperitoneally produced a decrease of about 20% in IMCD Aquaporin 2 expression. CONCLUSION: The IMCD Pf decrease caused by GLP is evidence, at least in part, towards explaining the urinary concentrating incapacity observed in infected guinea-pigs.

  12. Niveles de anticuerpos bactericidas frente a meningococo C tras la vacunación de niños de 2 a 6 años de edad en Andalucía

    Directory of Open Access Journals (Sweden)

    Elena Delgado Torralbo

    2000-01-01

    Full Text Available FUNDAMENTO: En 1997 el 18,5% de los casos de Enfermedad Meningocócica por serogrupo C en Andalucía fueron niños de 2 a 4 años de edad; edades donde respuesta inmune inicial y duración de la vacuna antimeningocócica de polisacárido capsular A+C, es menor que en edades superiores. Se diseñó una investigación para medir la respuesta inmune producida por esta vacuna, en niños de 2 a 6 años de edad, y compararla con la inmunidad natural presente en niños no vacunados. MÉTODOS: I.- Doble estudio de seguimiento: a grupos de niños previamente vacunados y grupos control, b grupo de niños que iba a ser vacunado, para análisis pre y postvacunal (1, 6 y 12 meses y grupo control. II.- La actividad bactericida se midió según protocolo estandarizado del CDC frente a cepa de N. meningítidis C-11. Los sueros con título de actividad bactericida (TAB ³ 1:8 se consideraron protectores. RESULTADOS: Al mes y a los 2 meses de vacunarse la proporción de TAB³ 1:8 era significativamente superior a la del grupo control (65,5% y 73,9% frente a 2,2% y 12%. En el prevacunal y en el postvacunal a los 6, 7, 12 y 13 meses no se observó diferencia significativa entre vacunados y controles. CONCLUSIONES: Las diferencias entre vacunados y no vacunados 1 y 2 meses después de la vacunación indican seroconversión en los vacunados. Para el grupo de edad de 2 a 6 años la actividad bactericida adquirida declina rápidamente, ya que a los 6 meses dejan de observarse diferencias con el grupo control.

  13. Enfermedad neumocócica invasiva en niños de la Región de Murcia

    Directory of Open Access Journals (Sweden)

    Espín M.I.

    2002-01-01

    Full Text Available Objetivo: La disponibilidad de una vacuna neumocócica conjugada plantea la necesidad de conocer la incidencia y características de la enfermedad neumocócica invasiva en niños de la Región de Murcia, con la finalidad de obtener información que pueda ser de utilidad para establecer adecuadamente las indicaciones de vacunación. Métodos: Se ha realizado una búsqueda retrospectiva de casos de enfermedad invasiva por Streptococcus pneumoniae en menores de 15 años de edad atendidos en hospitales de la Región de Murcia durante el período 1991-2000. Las fuentes de datos utilizadas han sido las bases de datos de los Servicios de Microbiología, el Conjunto Mínimo de Datos Básicos, registro de altas pediátricas y Registro EDO. Resultados: La tasa de incidencia para el período 1996-2000 fue, para los menores de 1 año, de 18,25 por 10(5 personas-año en el caso de enfermedad invasiva (10,6 para meningitis; para los menores de 2 años, de 13,6 para enfermedad invasiva (6 para meningitis; para menores de 5 años, de 8,9 (1,35 para meningitis, y para los menores de 15 años, de 3,7 (1,3 para meningitis. El 28% de los casos presentaba factores de riesgo. Las complicaciones alcanzaron el 35,2% y las secuelas el 5%. La letalidad fue del 11,8%. Los serogrupos prevalentes fueron el 19, el 6, el 18, el 5, el 14 y el 23. Conclusiones: El alto porcentaje de casos con factores de riesgo de enfermedad neumocócica invasiva aconseja la implantación de programas de vacunación dirigidos a todos los niños con factores de riesgo. La incidencia de enfermedad neumocócica invasiva encontrada en la Región de Murcia difiere de la de otras zonas geográficas; sin embargo, la incidencia de meningitis es similar a la de otros estudios. La gravedad de la enfermedad justifica la realización de estudios coste-efectividad para valorar la posible incorporación de la vacuna en el calendario vacunal.

  14. Enfermedad meningocócica e impacto de la vacunación sistemática con la vacuna conjugada antimeningocócica C en un área sanitaria de Andalucía

    Directory of Open Access Journals (Sweden)

    Concepción Cruz Rojo

    2005-01-01

    Full Text Available comenzó en julio de 2000 la vacunación con vacuna conjugada antimeningocócica C de todos los niños nacidos con posterioridad al 1 de enero de 1995, y en septiembre de 2001 se amplíó a los nacidos a partir del 1 de enero de 1991, esto es, hasta los 10 años de edad. El objetivo de este trabajo es valorar la efectividad de esta vacuna tras su introducción masiva en los niños del área geográfica de un distrito sanitario, midiendo su impacto. Métodos: Mediante un estudio longitudinal retrospectivo de incidencia poblacional se calculan las coberturas vacunales de los niños nacidos entre los años 1991 y 2001 y las tasas de incidencia de los casos declarados de enfermedad meningocócica en siete temporadas epidemiológicas (1997/98 a 2003/04. El impacto de la vacunación frente a la meningitis del serogrupo C se calcula comparando las tasas promedios anuales de las temporadas previas y posteriores a las campañas de vacunación en la población menor y mayor de 10 años, utilizando el test exacto de Fisher. Resultados: En el periodo de estudio se declararon 109 casos de enfermedad meningocócica, de los que 50 eran de meningitis C. A partir de la temporada 2000-2001 descendió la incidencia de meningitis C en los niños menores de 10 años. En este grupo de edad se encuentran diferencias significativas entre las tasas promedio anual de las temporadas prevacunales y postvacunales (de 8,2 a 2,0 por 100.000 habitantes. En la población mayor de 10 años no se observa este descenso en la incidencia. En el periodo de estudio no se ha declarado ningún caso de fallo vacunal. Conclusiones: La ausencia de fallos vacunales y la disminución de la incidencia de enfermedad meningocócica C en los niños menores de 10 años sugiere la buena efectividad de esta nueva vacuna conjugada frente al meningococo C

  15. Características etiológicas, clínicas y sociodemográficas de la diarrea aguda en Venezuela Etiological, clinical, and sociodemographic characteristics of acute diarrhea in Venezuela

    Directory of Open Access Journals (Sweden)

    María I. Urrestarazu

    1999-09-01

    Full Text Available En cuatro ciudades de Venezuela se llevó a cabo un estudio para evaluar las características epidemiológicas, clínicas y etiológicas de la diarrea aguda en niños menores de 5 años. Entre junio de 1993 y mayo de 1995 se estudiaron 2 552 niños con diarrea y 793 controles que fueron atendidos en el hospital. Para el análisis estadístico de los resultados se empleó la prueba exacta de Fisher. Los rotavirus fueron los agentes más importantes, tanto por su frecuencia (30% como por su asociación con la deshidratación (58%. Le siguieron en importancia Campylobacter spp. (13% y Escherichia coli serogrupos O clásicos (9%, pero su asociación con la diarrea solo fue estadísticamente significativa en los niños menores de 3 meses, hecho de particular importancia desde el punto de vista del tratamiento. Se confirmó la importancia de la edad como factor determinante de la prevalencia y gravedad de la diarrea.In four cities of Venezuela a study was carried out to evaluate the epidemiological, clinical, and etiological characteristics of acute diarrhea in children under 5 years of age. The study was done between June 1993 and May 1995 and involved children who were seen in a hospital, 2 552 with diarrhea and 793 controls. The Fisher exact test was used for the statistical analysis of the results. Rotaviruses were the most important agents, both in terms of their frequency (30% and their association with dehydration (58%. Following in importance were Campylobacter spp. (13% and Escherichia coli classical O serogroups (9%, but their association with diarrhea was only statistically significant among children less than 3 months old, a fact that is particularly important from the standpoint of treatment. The importance of age was confirmed as a determining factor in the prevalence and severity of diarrhea.

  16. Bactericide serum assay to assess the immune response induced by meningococcal and cholera vaccines

    Directory of Open Access Journals (Sweden)

    Bárbara Cedré

    2012-12-01

    Full Text Available La susceptibilidad al sistema bactericida del suero es una característica de las bacterias gramnegativas. Existen muchos ejemplos en las enterobacterias, de hecho cualquier procariote que presente una membrana lipídica pudiera ser potencialmente susceptible a la lisis mediada por anticuerpos dependiente del complemento, aunque existen cepas que muestran resistencia al sistema bacteriolítico. Estas son frecuentemente aisladas como agente causal de infecciones que involucran daño tisular, lo que indica que la resistencia a la actividad lítica del suero es determinante de la virulencia en algunas infecciones debido a bacterias gramnegativas. Para algunas enfermedades causadas por estas bacterias la vacunación constituye la medida de prevención más efectiva, como es el caso del cólera y la enfermedad meningocócica. La inducción de anticuerpos con capacidad lítica, producto de la vacunación, se considera en muchos casos el mejor correlato con la protección y se estima que individuos que desarrollan anticuerpos bactericidas, ya sea por una infección clínica o por la vacunación, están protegidos contra la infección o la enfermedad. De ahí que el ensayo bactericida del suero sea la prueba de oro para evaluar la eficacia de muchas vacunas. Ensayos clínicos llevados a cabo con vacunas contra los serogrupos A, B, C, Y y W 135 de N. meningitidis y con vacunas de cólera, ya sean vivas atenuadas o inactivadas, han demostrado la inducción de anticuerpos con actividad lítica que luego han correlacionado con la protección en ensayos de eficacia o frente a un reto experimental. Por lo que resulta imprescindible la estandarización y validación de estos ensayos para su empleo como criterio de inmunogenicidad en el desarrollo de estas vacunas.

  17. Estudio de un brote de leptospirosis en Honduras tras el paso del huracán Mitch y potencialidad profiláctica de vax-SPIRAL®

    Directory of Open Access Journals (Sweden)

    Mariela Naranjo

    2007-12-01

    Full Text Available En Honduras, uno de los países de Centroamérica más afectados por el huracán Mitch, debido a las fuertes lluvias e inundaciones, se crearon las condiciones idóneas para el desarrollo de un brote de leptospirosis. Un grupo de especialistas cubanos realizamos un estudio a 68 pacientes con un cuadro clínico epidemiológico sospechoso de leptospirosis entre los pobladores del Departamento de Puerto Cortés, una las regiones más comprometidas. A todos los pacientes se les tomó una muestra de sangre para hemocultivo y obtención de suero. Se empleó la técnica de aglutinación microscópica (MAT para la identificación de las cepas de leptospira y para evaluar la protección conferida por vax-SPIRAL® (vacuna antileptospirósica cubana frente al reto con la cepa aislada y se verificó la prevalencia de leptospiras en los riñones e hígado. Se observó un predominio de pacientes del sexo masculino, en un grupo entre 15-49 años. Los municipios de este Departamento con un mayor número de casos fueron San Pedro Sula, La Lima y Chamelecón. Los síntomas más frecuentes fueron: fiebre, cefalea, mialgias, malestar general, entre otros. Más del 80% de los individuos manifestaron la presencia de roedores en sus viviendas y que tuvieron contacto con aguas estancadas y animales domésticos. La cepa aislada del hemocultivo positivo fue del serogrupo Icterohaemorrhagiae, muy virulento en el modelo animal empleado. Se evidenció el 100% de protección de los hámsteres inmunizados con vax-SPIRAL® y retados con la cepa de Honduras. El análisis macroscópico de los órganos de los animales inmunizados que sobrevivieron al reto al 100%, reveló la ausencia de signos característicos de la infección.

  18. Genome Sequence Analysis of Vibrio cholerae clinical isolates from 2013 in Mexico reveals the presence of the strain responsible for the 2010 Haiti outbreak.

    Science.gov (United States)

    Díaz-Quiñonez, José Alberto

    2017-01-01

    La primera semana de septiembre de 2013, el Sistema Nacional de Vigilancia Epidemiológica identificó dos casos de cólera en Ciudad de México. Los cultivos de ambas muestras se confirmaron como Vibrio cholerae serogrupo O1, serotipo Ogawa, biotipo El Tor. Los análisis iniciales por electroforesis por campos pulsados y por reacción en cadena de la polimerasa indicaron que ambas cepas eran similares, pero diferentes de las previamente reportadas en México. La semana siguiente se identificaron cuatro casos más en una comunidad del Estado de Hidalgo, ubicada a 121 kilómetros al noreste de Ciudad de México. Posteriormente se inició un brote de cólera en la región de La Huasteca. Los análisis genómicos de cuatro cepas obtenidas en este estudio confirmaron la presencia de las islas de patogenicidad VPI -1 y VPI-2, VSP-1 y VSP-2, y del elemento integrador SXT. La estructura genómica de los cuatro aislamientos fue similar a la de V. cholerae cepa 2010 EL-1786, identificada durante la epidemia en Haití en 2010. Este estudio pone de manifiesto que la epidemiología molecular es una herramienta muy poderosa para vigilar, prevenir y controlar enfermedades de importancia en salud pública en México. The first week of September 2013, the National Epidemiological Surveillance System identified two cases of cholera in Mexico City. The cultures of both samples were confirmed as Vibrio cholerae serogroup O1, serotype Ogawa, biotype El Tor. Initial analyses by pulsed-field gel electrophoresis and by polymerase chain reaction-amplification of the virulence genes, suggested that both strains were similar, but different from those previously reported in Mexico. The following week, four more cases were identified in a community in the state of Hidalgo, located 121 km northeast of Mexico City. Thereafter a cholera outbreak started in the region of La Huasteca. Genomic analyses of the strains obtained in this study confirmed the presence of pathogenicity islands VPI-1 and

  19. Portadores de Neisseria meningitidis, caracterización de las cepas aisladas y respuesta inmune basal a VA-MENGOC-BC

    Directory of Open Access Journals (Sweden)

    María J. Valdés

    2008-08-01

    Full Text Available Con el propósito de conocer la prevalencia de portadores de Neisseria meningitidis en un grupo de adolescentes, los marcadores epidemiológicos de las cepas aisladas, así como los factores de riesgo asociados con el estado de portador y la respuesta inmune basal a VA-MENGOC-BC , se realizó un estudio transversal descriptivo de portadores en 189 estudiantes de 12-19 años de un politécnico de Ciego de Ávila, siguiendo las Normas Bioéticas establecidas. A los estudiantes se les realizó un exudado faríngeo y una extracción de sangre para la obtención de suero, así como una encuesta relacionada con aspectos de la investigación. La identificación de N. meningitidis se hizo por el sistema API NH (bioMérieux. Los serosubtipos e inmunotipos se clasificaron por ELISA de células enteras con anticuerpos monoclonales y la respuesta inmune basal se detectó por el Ensayo Bactericida del Suero. Se determinó la susceptibilidad antimicrobiana de las cepas frente a la penicilina, cloranfenicol, rifampicina, sulfadiacina sódica, ceftriaxona y ciprofloxacina. La prevalencia de portadores de N. meningitidis fue del 17%. Predominaron las cepas no agrupables (84,7%, seguidas por los serogrupos B (12,5% y Z (3,1%, destacándose la ausencia del C. Prevaleció el fenotipo NA:NT:P1.NST:L3,7,9 (12,5%, las cepas resistentes a la sulfadiacina (78,2% y sensibles a penicilina (81,3%, aunque el 18,7% mostró sensibilidad intermedia a este fármaco. Al resto de los antimicrobianos todas fueron sensibles. Se constató una respuesta inmune de memoria a la vacuna antimeningocócica (VAMENGOC-BC®, 12 años después de su aplicación, con títulos bactericidas anti C y B de 25 y 42%, respectivamente, resultados que pudieran estar influenciados por la inmunización sistemática que se realiza en Cuba con esta vacuna desde 1991.

  20. Brote de legionelosis asociado a un balneario

    Directory of Open Access Journals (Sweden)

    I. Santa Marina Rodríguez

    2001-06-01

    Full Text Available En 1998 el inicio de la temporada de actividad de un balneario en Gipuzkoa coincidió con la detección de un brote de legionelosis asociado al mismo, lo cual condujo al cierre de la instalación y al estudio epidemiológico -casos y controles- y ambiental oportunos. Se definió como caso toda persona que durante su estancia en el balneario o durante los 10 días siguientes presentará neumonía o un cuadro febril compatible con fiebre de Pontiac.El estudio ambiental incluyó la inspección del balneario y entorno y muestreos de los sistemas sanitarios de agua y de los elementos de hidroterapia.De las 287 personas encuestadas de la Comunidad Autónoma Vasca, el 12.5% cumplían con la definición de caso; 9 casos presentaron neumonía y 26 fiebre de Pontiac. La curva epidémica se inició el 7 de mayo, alcanzando un pico los días 14 y 15 de mayo y finalizando el día 20. El riesgo de enfermar ajustado por edad, sexo y consumo de tabaco se asoció con la duración de la estancia en el balneario (OR=118.5, 95% I.C: 18.7-750.2 y con el uso de una piscina (OR=10.5, 95% I.C: 1.3-82.6. Se detecto L. pneumophila serogrupo1 en recuentos superiores a 103 ufc/l en diversos puntos de la red de hidroterapia y en la ducha de la habitación de uno de los enfermos. El análisis por electroforesis en campos pulsados de una muestra biológica y muestras ambientales permitió la confirmación genotípica. El establecimiento se abrió al público tras realizar un tratamiento de choque y comprobar que transcurridos 15 días no se detectó L. pneumophila en las muestras ambientales.

  1. Niveles de anticuerpos bactericidas frente a meningococo C tras la vacunación de niños de 2 a 6 años de edad en Andalucía

    Directory of Open Access Journals (Sweden)

    Delgado Torralbo Elena

    2000-01-01

    Full Text Available FUNDAMENTO: En 1997 el 18,5% de los casos de Enfermedad Meningocócica por serogrupo C en Andalucía fueron niños de 2 a 4 años de edad; edades donde respuesta inmune inicial y duración de la vacuna antimeningocócica de polisacárido capsular A+C, es menor que en edades superiores. Se diseñó una investigación para medir la respuesta inmune producida por esta vacuna, en niños de 2 a 6 años de edad, y compararla con la inmunidad natural presente en niños no vacunados. MÉTODOS: I.- Doble estudio de seguimiento: a grupos de niños previamente vacunados y grupos control, b grupo de niños que iba a ser vacunado, para análisis pre y postvacunal (1, 6 y 12 meses y grupo control. II.- La actividad bactericida se midió según protocolo estandarizado del CDC frente a cepa de N. meningítidis C-11. Los sueros con título de actividad bactericida (TAB > o = 1:8 se consideraron protectores. RESULTADOS: Al mes y a los 2 meses de vacunarse la proporción de TAB > o = 1:8 era significativamente superior a la del grupo control (65,5% y 73,9% frente a 2,2% y 12%. En el prevacunal y en el postvacunal a los 6, 7, 12 y 13 meses no se observó diferencia significativa entre vacunados y controles. CONCLUSIONES: Las diferencias entre vacunados y no vacunados 1 y 2 meses después de la vacunación indican seroconversión en los vacunados. Para el grupo de edad de 2 a 6 años la actividad bactericida adquirida declina rápidamente, ya que a los 6 meses dejan de observarse diferencias con el grupo control.

  2. Síndrome urémico hemolítico en Uruguay. Aspectos microbiológicos y clínicos, aportes para su conocimiento regional

    Directory of Open Access Journals (Sweden)

    Gustavo Varela

    2015-06-01

    Full Text Available Introducción: El síndrome urémico hemolítico (SUH es una enfermedad de severidad variable que afecta sobre todo a niños menores de 5 años. Está definido por la tríada anemia hemolítica microangiopática, trombocitopenia e insuficiencia renal aguda. La mayoría de los casos aparecen luego de un episodio de diarrea aguda, causado por cepas de Escherichia coli productoras de toxina Shiga (STEC. Objetivo: Establecer las características de las cepas STEC recuperadas de niños con SUH, e informar sobre algunos aspectos clínicos y características epidemiológicas de estos casos. Materiales y métodos: Se realizó un estudio descriptivo que incluyó niños con SUH. La detección de las cepas STEC se realizó por PCR a partir de cultivos de materias fecales. En cada cepa se estableció el genotipo, serotipo y perfil de susceptibilidad a los antibióticos. Resultados: Se estudiaron 43 niños con SUH. Los casos ocurrieron predominantemente en los meses cálidos, afectando niños provenientes de hogares ubicados fuera de la capital y con cobertura privada de salud. La mayoría presentaban el antecedente de diarrea con sangre y 70% habían recibido antibióticos antes de obtener las muestras. En 7 niños se recuperaron 8 cepas STEC; 7 correspondieron a serogrupos no-O157. Todas portaban los genes eae y ehxA. Conclusiones: La mayoría de los casos ocurren en meses cálidos, en niños que cursaron diarrea con sangre, provenientes de hogares ubicados fuera de la ciudad capital. Los cultivos STEC no-O157 fueron los más prevalentes.

  3. Similarities in Leptospira Serogroup and Species Distribution in Animals and Humans in the Indian Ocean Island of Mayotte

    Science.gov (United States)

    Desvars, Amélie; Naze, Florence; Vourc'h, Gwenaël; Cardinale, Eric; Picardeau, Mathieu; Michault, Alain; Bourhy, Pascale

    2012-01-01

    Our objective was to identify local animal reservoirs of leptospirosis to explain the unusual features of Leptospira strains recently described among patients on the island of Mayotte. By means of a microscopic agglutination test using local clinical isolates, we found that 11.2% of black rats were seropositive to Leptospira, whereas 10.2% of flying foxes, 2% of lemurs, 93.1% of domestic dogs, and 87.5% of stray dogs were seropositive. As observed in humans, Mini was the main serogroup circulating in animals, whereas serogroup Icterohaemorrhagiae was absent. Using quantitative polymerase chain reaction, we also showed that 29.8% of rats carried leptospires in their kidneys. The sequencing of 16S rRNA gene sequences of Leptospira found in black rat kidneys identified four genomospecies (Leptospira borgpetersenii, Leptospira interrogans, Leptospira kirschneri, and L. borgpetersenii group B), which established black rats as the major source of leptospirosis transmission to humans. The origins of such a genetic diversity in Leptospira strains are discussed. PMID:22764304

  4. Coexistence and survival of pathogenic leptospires by formation of biofilm with Azospirillum.

    Science.gov (United States)

    Kumar, K Vinod; Lall, Chandan; Raj, R Vimal; Vedhagiri, K; Vijayachari, P

    2015-06-01

    Pathogenic Leptospira spp. represent one cause of leptospirosis worldwide and have long been regarded as solitary organisms in soil and aquatic environments. However, in the present study, Leptospira interrogans was observed to be associated with environmental biofilms with 21 bacterial isolates belonging to 10 genera. All 21 isolates were examined for their coaggregation and biofilm-forming ability with leptospires in vitro. Among these, Azospirillum brasilense RMRCPB showed maximum interspecies coaggregation with leptospiral strains (>75%, visual score of +4). Other significant coaggregating isolates belonged to the genera Sphingomonas, Micrococcus, Brevundimonas, Acinetobacter and Paracoccus. Biofilms of leptospires in combination with A. brasilense RMRCPB showed high resistance to penicillin G, ampicillin and tetracycline (minimum bactericidal concentration ≥800 μg/mL) and tolerance to UV radiation and high temperature (up to 49°C). This study hypothesized that biofilm formation with A. brasilense protects the pathogenic Leptospira from adverse environmental conditions/stress. This coexistence of pathogenic Leptospira with other bacteria may be the key factor for its persistence and survival. However, the mechanism of biofilm formation by leptospires needs to be explored to help devise an appropriate control strategy and reduce transmission of leptospires. © FEMS 2015. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  5. Myocarditis, pancreatitis, polyarthritis, mononeuritis multiplex and vasculitis with symmetrical peripheral gangrene of the lower extremities as a rare presentation of leptospirosis: a case report and review of the literature.

    Science.gov (United States)

    Panagopoulos, Periklis; Terzi, Irene; Karanikas, Michail; Galanopoulos, Nikolaos; Maltezos, Efstratios

    2014-05-14

    Leptospirosis is a zoonosis caused by the spirochete, Leptospira interrogans. While most cases of leptospirosis are mild to moderate, the course may be complicated by multiorgan dysfunction. We present a rare case of leptospirosis with acute myocarditis, pancreatitis, polyarthritis, mononeuritis multiplex and severe vasculitis with necrosis of the extremities. A 32-year-old man from Congo presented with high-grade fever, confusion and headache. He developed tachycardia and hypotension followed by electrocardiogram changes and elevation of troponin I levels suggesting myocarditis. A physical examination revealed conjunctival suffusion, polyarthritis of his lower extremities and cutaneous necrosis of his feet due to vasculitis. Laboratory findings included amylase levels 10-fold the upper normal serum levels and thrombocytopenia. The diagnosis was confirmed by a positive leptospira immunoglobulin M, negative immunoglobulin G and a positive rapid agglutination test. Our patient recovered progressively with antimicrobials and supportive care. Because the clinical features and diagnostic findings of leptospirosis are not specific, a high index of suspicion must be maintained for the diagnosis. Serology is the most important tool for accurate and quick diagnosis in order to administer the appropriate therapy.

  6. Serosurvey for selected pathogens in free-ranging American black bears (Ursus americanus) in Maryland, USA.

    Science.gov (United States)

    Bronson, Ellen; Spiker, Harry; Driscoll, Cindy P

    2014-10-01

    American black bears (Ursus americanus) in Maryland, USA, live in forested areas in close proximity to humans and their domestic pets. From 1999 to 2011, we collected 84 serum samples from 63 black bears (18 males; 45 females) in five Maryland counties and tested them for exposure to infectious, including zoonotic, pathogens. A large portion of the bears had antibody to canine distemper virus and Toxoplasma gondii, many at high titers. Prevalences of antibodies to zoonotic agents such as rabies virus and to infectious agents of carnivores including canine adenovirus and canine parvovirus were lower. Bears also had antibodies to vector-borne pathogens common to bears and humans such as West Nile virus, Borrelia burgdorferi, Rickettsia rickettsii, and Anaplasma phagocytophilum. Antibodies were detected to Leptospira interrogans serovars Pomona, Icterohaemorrhagiae, Canicola, Grippotyphosa, and Bratislava. We did not detect antibodies to Brucella canis or Ehrlichia canis. Although this population of Maryland black bears demonstrated exposure to multiple pathogens of concern for humans and domesticated animals, the low levels of clinical disease in this and other free-ranging black bear populations indicate the black bear is likely a spillover host for the majority of pathogens studied. Nevertheless, bear populations living at the human-domestic-wildlife interface with increasing human and domestic animal exposure should continue to be monitored because this population likely serves as a useful sentinel of ecosystem health.

  7. Leptospira spp. in Rodents and Shrews in Germany

    Directory of Open Access Journals (Sweden)

    Anne Mayer-Scholl

    2014-07-01

    Full Text Available Leptospirosis is an acute, febrile disease occurring in humans and animals worldwide. Leptospira spp. are usually transmitted through direct or indirect contact with the urine of infected reservoir animals. Among wildlife species, rodents act as the most important reservoir for both human and animal infection. To gain a better understanding of the occurrence and distribution of pathogenic leptospires in rodent and shrew populations in Germany, kidney specimens of 2973 animals from 11 of the 16 federal states were examined by PCR. Rodent species captured included five murine species (family Muridae, six vole species (family Cricetidae and six shrew species (family Soricidae. The most abundantly trapped animals were representatives of the rodent species Apodemus flavicollis, Clethrionomys glareolus and Microtus agrestis. Leptospiral DNA was amplified in 10% of all animals originating from eight of the 11 federal states. The highest carrier rate was found in Microtus spp. (13%, followed by Apodemus spp. (11% and Clethrionomys spp. (6%. The most common Leptospira genomospecies determined by duplex PCR was L. kirschneri, followed by L. interrogans and L. borgpetersenii; all identified by single locus sequence typing (SLST. Representatives of the shrew species were also carriers of Leptospira spp. In 20% of Crocidura spp. and 6% of the Sorex spp. leptospiral DNA was detected. Here, only the pathogenic genomospecies L. kirschneri was identified.

  8. Comparison of Immunoprotection of Leptospira Recombinant Proteins with conventional vaccine in experimental animals.

    Science.gov (United States)

    Parthiban, M; Kumar, S Senthil; Balachandran, C; Kumanan, K; Aarthi, K S; Nireesha, G

    2015-12-01

    Leptospirosis is a bacterial disease caused by bacteria of the genus Leptospira affecting humans and animals. Untreated leptospirosis may result in severe kidney damage, meningitis, liver failure, respiratory distress, and even death. Virulent leptospirosis can rapidly enter kidney fibroblasts and induce a programmed cell death. Thus, it is a challenge for immunologists to develop an effective and safe leptospirosis vaccine. Here, we compared the commercial canine leptospira vaccine and recombinant proteins (OmpL1 and LipL41) with and without adjuvant in terms of immune response and challenge studies in hamsters and immune response studies alone in experimental dogs. The outer membrane proteins viz., lipL41 and OmpL1 of leptospira interrogans serovars icterohaemorrhagiae were amplified. The primers were designed in such a way that amplified products of OmpL1 and lipL41 were ligated and cloned simultaneously into a single vector. The cloned products were expressed in E. coli BL21 cells. The immunoprotection studies were conducted for both recombinant proteins and commercial vaccine. The challenge experiment studies revealed that combination of both rLip41 and rOmpL1 and commercial vaccine gave 83% and 87% protection, respectively. Histopathological investigation revealed mild sub lethal changes were noticed in liver and kidney in commercially vaccinated group alone. The immune responses against recombinant leptospiral proteins were also demonstrated in dogs.

  9. Leptospirosis in Cattle From Markets of Almaty Province, Kazakhstan

    Directory of Open Access Journals (Sweden)

    Kirkimbayeva Zhumagul

    2015-04-01

    Full Text Available This paper is the first study of the prevalence of leptospirosis in the cattle at slaughter from a rural area of Kazakhstan. Five hundred and seventy three samples of serum, urine, and kidneys from cattle of Alatau, Kazakh white and Auliyekol breed, aged from 2 to 5 years (unknown vaccination status, from the province of Almaty in the South-Eastern region were collected during four years (March 2010 to October 2013. The serological, bacteriological, and molecular analyses were performed. Serum samples were tested with 14 reference Leptospira serovars by microscopic agglutination test (MAT. MAT results showed that 89 (15.53% serum samples had detectable antibodies against seven serovars of L. interrogans at a dilution of ≥1:100. Serovars: Pomona (38.2%, Tarassovi (27.2%, and Kabula (18.8% were the most prevalent and their titres ranged from 100 to 1200. The spirochetes were detected in 11 samples of urine and nine samples of kidneys under dark-field microscope observation. The pure cultures were obtained from three samples. PCR technique confirmed leptospirosis in 23 out of 89 urine samples from cows, which showed the presence of leptospiral antibodies in microagglutination test. The high disease prevalence in cows indicates the high Leptospira contamination in this area. It was concluded that the bovine leptospirosis is an endemic and locally widespread disease in Kazakhstan, and that it may play a role in zoonotic transmission to humans.

  10. Desbordes. Vida, política y estéticas del exceso en Osvaldo Lamborghini y Diamela Eltit

    Directory of Open Access Journals (Sweden)

    María Cecilia Sánchez Idiart

    2016-03-01

    Full Text Available Este artículo se propone analizar los modos como dos ficciones latinoamericanas contemporáneas, Sebregondi retrocede (1973 de Osvaldo Lamborghini e Impuesto a la carne (2010 de Diamela Eltit, problematizan las relaciones entre los saberes sobre los cuerpos y las políticas de gobierno de la vida. En la postulación de un lenguaje que desborda la normatividad del biopoder, estas ficciones interrogan los dispositivos de producción de cuerpos y subjetividades, a la vez que configuran una estética del exceso que reinventa la materialidad de lo viviente a partir de la potencia afectiva de la carne. This article aims to analyze the modes in which two contemporary Latin American fictions, Sebregondi retrocede (1973 by Osvaldo Lamborghini and Impuesto a la carne (2010 by Diamela Eltit, problematize the relationships between knowledge about bodies and politics of government of life. From a language that overflows the normativity of biopower, these fictions interrogate the technologies of production of bodies and subjectivities, at the same time that they configure an aesthetics of excess that reinvents the materiality of the living through the affective potency of the flesh.

  11. Isolation and characterization of new Leptospira genotypes from patients in Mayotte (Indian Ocean.

    Directory of Open Access Journals (Sweden)

    Pascale Bourhy

    Full Text Available BACKGROUND: Leptospirosis has been implicated as a severe and fatal form of disease in Mayotte, a French-administrated territory located in the Comoros archipelago (southwestern Indian Ocean. To date, Leptospira isolates have never been isolated in this endemic region. METHODS AND FINDINGS: Leptospires were isolated from blood samples from 22 patients with febrile illness during a 17-month period after a PCR-based screening test was positive. Strains were typed using hyper-immune antisera raised against the major Leptospira serogroups: 20 of 22 clinical isolates were assigned to serogroup Mini; the other two strains belonged to serogroups Grippotyphosa and Pyrogenes, respectively. These isolates were further characterized using partial sequencing of 16S rRNA and ligB gene, Multi Locus VNTR Analysis (MLVA, and pulsed field gel electrophoresis (PFGE. Of the 22 isolates, 14 were L. borgpetersenii strains, 7 L. kirschneri strains, and 1, belonging to serogoup Pyrogenes, was L. interrogans. Results of the genotyping methods were consistent. MLVA defined five genotypes, whereas PFGE allowed the recognition of additional subgroups within the genotypes. PFGE fingerprint patterns of clinical strains did not match any of the patterns in the reference strains belonging to the same serogroup, suggesting that the strains were novel serovars. CONCLUSIONS: Preliminary PCR screening of blood specimen allowed a high isolation frequency of leptospires among patients with febrile illness. Typing of leptospiral isolates showed that causative agents of leptospirosis in Mayotte have unique molecular features.

  12. Pathogen dynamics and morbidity of striped skunks in the absence of rabies.

    Science.gov (United States)

    Gehrt, Stanley D; Kinsel, Michael J; Anchor, Chris

    2010-04-01

    Parasites have the potential to influence the population dynamics of mammalian hosts, either as a single devastating pathogen or as a community effect. Striped skunks (Mephitis mephitis) are typically host to rabies, which often regulates population numbers. We assessed micro- and macroparasite dynamics in striped skunk populations in the absence of rabies, to determine if a single pathogen, or community, was responsible for a majority of skunk deaths. We monitored mortality due to pathogens, and prevalence of pathogens via serology and necropsy, in two populations of striped skunks in northern Illinois during 1998-2004. Transmissible pathogens requiring direct transmission (i.e., canine distemper virus, canine parvovirus) exhibited high annual variability in prevalence. In contrast, those pathogens employing a more indirect, environmental route of transmission (i.e., Leptospira interrogans and Toxoplasma gondii) appeared to exhibit relatively less annual variability in prevalence. Skunks were diagnosed with infections from an average of 4.08 (SD=2.52, n=32) species of endoparasites, with a range of 1-11. Macroparasite prevalence and intensity did not vary among seasons, or sex or age of host. Severe infections occurred with multiple parasite species, and patterns of aggregation suggested some parasite species, or more likely the parasite community, act as a limiting mechanism in skunk populations.

  13. Seroepidemiology of Infection with Neospora Caninum, Leptospira, and Bovine Herpesvirus Type 1 in Water Buffaloes (Bubalus Bubalis) in Veracruz, Mexico

    Science.gov (United States)

    Romero-Salas, Dora; Alvarado-Esquivel, Cosme; Domínguez-Aguilar, Gladys; Cruz-Romero, Anabel; Ibarra-Priego, Nelly; Barrientos-Salcedo, Carolina; Aguilar-Domínguez, Mariel; Canseco-Sedano, Rodolfo; Espín-Iturbe, Luz Teresa; Sánchez-Anguiano, Luis Francisco; Hernández-Tinoco, Jesús; de León, Adalberto A. Pérez

    2017-01-01

    We aimed to determine the seroprevalence of infection with Neospora caninum, Leptospira, and bovine herpesvirus type 1 and risk factors associated with these infections in water buffaloes in Veracruz State, Mexico. Through a cross-sectional study, 144 water buffaloes (Bubalus bubalis) raised in 5 ranches of Veracruz were examined for anti-N. caninum and anti-bovine herpesvirus type 1 antibodies by enzyme immunoassays, and anti-Leptospira interrogans antibodies by microscopic agglutination test. Of the 144 buffaloes studied, 35 (24.3%) were positive for N. caninum, 50 (34.7%) for Leptospira, and 83 (57.6%) for bovine herpes virus. The frequencies of leptospiral serovars in buffaloes were as follows: 18.7% for Muenchen (n = 27), 10.4% for Hardjo LT (n = 15), 9.0% for Pyrogenes (n = 13), and 4.8% for Icterohaemorrhagiae (n = 7). Seropositive buffaloes were found in all 5 ranches studied. Logistic regression showed that cohabitation of buffaloes with cows was associated with infection with Leptospira (odds ratio [OR], 2.2; 95% confidence interval [CI], 1.04–4.5; P = 0.03) and bovine herpesvirus (OR, 12.0; 95% CI, 4.0–36.2; P < 0.01). This is the first study that provides serological evidence of N. caninum, Leptospira, and bovine herpesvirus type 1 infections in water buffaloes in Mexico. Our findings could be used to enhance preventive measures against these infections. PMID:29403656

  14. de "subirnos al tiempo". La economía del "don"

    Directory of Open Access Journals (Sweden)

    Raúl García Durán

    2007-01-01

    Full Text Available Este trabajo resume las ideas contenidas en el libro -aún inédito- De la miseria de la economía a la plenitud de la fraternidad; o la economía del "don" como alternativa al capitalismo y la economía de mercado. En él se plantean alternativas radicales al capitalismo; particularmente, se ubica al "don" como camino de pensamiento y acción. Se documentan las proposiciones teóricas y aportes de la economía política, la antropología, la historia, para construir la manera en que el don podría contribuir a una reorganización social basada en nuevos-viejos principios. Se interrogan diversas experiencias histórico-antropológicas y su prefiguración actual en un nuevo modelo ético-político-ecológico que abarca las dimensiones local y global.

  15. Seeking the environmental source of Leptospirosis reveals durable bacterial viability in river soils.

    Directory of Open Access Journals (Sweden)

    Roman Thibeaux

    2017-02-01

    Full Text Available Leptospirosis is an important re-emerging infectious disease that affects humans worldwide. Infection occurs from indirect environment-mediated exposure to pathogenic leptospires through contaminated watered environments. The ability of pathogenic leptospires to persist in the aqueous environment is a key factor in transmission to new hosts. Hence, an effort was made to detect pathogenic leptospires in complex environmental samples, to genotype positive samples and to assess leptospiral viability over time.We focused our study on human leptospirosis cases infected with the New Caledonian Leptospira interrogans serovar Pyrogenes. Epidemiologically related to freshwater contaminations, this strain is responsible for ca. 25% of human cases in New Caledonia. We screened soil and water samples retrieved from suspected environmental infection sites for the pathogen-specific leptospiral gene lipL-32. Soil samples from all suspected infection sites tested showed detectable levels of pathogenic leptospiral DNA. More importantly, we demonstrated by viability qPCR that those pathogenic leptospires were viable and persisted in infection sites for several weeks after the index contamination event. Further, molecular phylogenetic analyses of the leptospiral lfb-1 gene successfully linked the identity of environmental Leptospira to the corresponding human-infecting strain.Altogether, this study illustrates the potential of quantitative viability-PCR assay for the rapid detection of viable leptospires in environmental samples, which might open avenues to strategies aimed at assessing environmental risk.

  16. Clases de costura, tejidos y puntadas

    Directory of Open Access Journals (Sweden)

    Carol Dayana Sosa Quintero

    2016-01-01

    Full Text Available Este artículo da cuenta de los ejercicios pedagógicos que en una perspec- tiva epistemológica construccionista han sido planteados desde la unidad de Humanidades y Formación Integral de la Universidad Santo Tomás, Villavicencio, tejiendo narrativas entre estudiantes, docentes y ciudadanos. Construidos en lenguaje simbólico-narrativo, facilitan una hermenéutica pe- dagógica orientada a la comprensión de cuentos, relatos y narraciones, que a su vez interrogan y trasforman la realidad de los participantes. Se desarrolla en parques, plazas, iglesias, barrios, avenidas y monumentos, espacios abiertos a diferentes formas creativas y lúdicas, en las que cobra sentido la recolección de los saberes ancestrales, experiencias de vida y fábulas urbanas, que hacen del caminar del estudiante universitario un costurero único, apasionante y formativo, y proporcionan herramientas para que los estudiantes se apasionen por otros textos, otras lecturas, incluido el diálogo con las comunidades, cuyas experiencias y sueños apoyan esta reflexión pedagógica, invitándolos a comunicarse y releer su mundo desde diversas perspectivas epistemológicas. 

  17. Characterization of Leptospira isolates from humans and the environment in Uruguay.

    Science.gov (United States)

    Meny, Paulina; Menéndez, Clara; Quintero, Jair; Hernández, Elba; Ríos, Cristina; Balassiano, Ilana Teruszkin; Trindade, Camilla Nunes Dos Reis; Vital-Brazil, Juliana Magalhães; Ramos, Tatiane Mendes Varela; Ashfield, Natalia; Feble, Camila; Avila, Esthefani; Schelotto, Felipe; Varela, Gustavo

    2017-12-21

    Laboratory diagnosis of human leptospirosis usually relies on indirect methods exploring specific immune response. Isolation and identification of the involved strains are cumbersome, but can provide biological resources for pathogenic studies and relevant information for guiding prevention and control measures. The aim of the research we are hereby reporting was the characterization of Leptospira isolates obtained from humans and the environment in Uruguay. Blood cultures were performed from early samples of 302 Uruguayan patients, mainly rural workers, and from 36 water samples taken from their living or working environments. Eight human isolates and seven environmental isolates were obtained and analyzed by end point Polymerase Chain Reaction (PCR), Multilocus Variable Number of Tandem Repeat Analysis (MLVA) and other molecular methods. Human isolates corresponded to several serogroups and serovars of Leptospira interrogans and Leptospira kirschneri species, probably reflecting the infection with similar involved Leptospira species and serovars of an extended animal reservoir in rural settings of the country, mostly dedicated to meat and dairy production. Culture-positive patients were older than usually affected workers, and presented signs and symptoms of severe illness. A high organic and circulating bacterial burden may explain an easier positive result from these workers' samples. Environmental isolates were mainly identified as Leptospira biflexa strains, with a single L. meyeri isolate of uncertain significance.

  18. Quantitative investigation of two metallohydrolases by X-ray absorption spectroscopy near-edge spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Zhao, W. [Hefei National Laboratory for Physical Sciences at Microscale and School of Life Sciences, University of Science and Technology of China, Hefei, Anhui 230027 (China); Chu, W.S.; Yang, F.F.; Yu, M.J.; Chen, D.L.; Guo, X.Y. [Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China); Zhou, D.W.; Shi, N. [Hefei National Laboratory for Physical Sciences at Microscale and School of Life Sciences, University of Science and Technology of China, Hefei, Anhui 230027 (China); Marcelli, A. [Istituto Nazionale di Fisica Nucleare, Laboratori Nazionali di Frascati, P.O. Box 13, Frascati 00044 (Italy); Niu, L.W.; Teng, M.K. [Hefei National Laboratory for Physical Sciences at Microscale and School of Life Sciences, University of Science and Technology of China, Hefei, Anhui 230027 (China); Gong, W.M. [Institute of Biophysics, Chinese Academy of Sciences, Beijing 100101 (China); Benfatto, M. [Istituto Nazionale di Fisica Nucleare, Laboratori Nazionali di Frascati, P.O. Box 13, Frascati 00044 (Italy); Wu, Z.Y. [Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China); Istituto Nazionale di Fisica Nucleare, Laboratori Nazionali di Frascati, P.O. Box 13, Frascati 00044 (Italy)], E-mail: wuzy@ihep.ac.cn

    2007-09-21

    The last several years have witnessed a tremendous increase in biological applications using X-ray absorption spectroscopy (BioXAS), thanks to continuous advancements in synchrotron radiation (SR) sources and detector technology. However, XAS applications in many biological systems have been limited by the intrinsic limitations of the Extended X-ray Absorption Fine Structure (EXAFS) technique e.g., the lack of sensitivity to bond angles. As a consequence, the application of the X-ray absorption near-edge structure (XANES) spectroscopy changed this scenario that is now continuously changing with the introduction of the first quantitative XANES packages such as Minut XANES (MXAN). Here we present and discuss the XANES code MXAN, a novel XANES-fitting package that allows a quantitative analysis of experimental data applied to Zn K-edge spectra of two metalloproteins: Leptospira interrogans Peptide deformylase (LiPDF) and acutolysin-C, a representative of snake venom metalloproteinases (SVMPs) from Agkistrodon acutus venom. The analysis on these two metallohydrolases reveals that proteolytic activities are correlated to subtle conformation changes around the zinc ion. In particular, this quantitative study clarifies the occurrence of the LiPDF catalytic mechanism via a two-water-molecules model, whereas in the acutolysin-C we have observed a different proteolytic activity correlated to structural changes around the zinc ion induced by pH variations.

  19. Blood characteristics of San Joaquin kit fox (Vulpes velox macrotis) at Camp Roberts Army National Guard Training Site, California

    Energy Technology Data Exchange (ETDEWEB)

    Standley, W.G.; McCue, P.M.

    1992-09-01

    Hematology, serum chemistry, and prevalence of antibodies against selected, pathogens in a San Joaquin kit fox population (Vulpes velox macrotis) were investigated at Camp Roberts Army National Guard Training Site, California, in 1989 and 1990. Samples from 18 (10 female, 8 male) adult kit foxes were used to establish normal hematology and serum chemistry values for this population. Average values were all within the normal ranges reported for kit foxes in other locations. Three hematology parameters had significant differences between male and female values; males had higher total white blood cell and neutrophil counts, and lower lymphocyte counts. There were no significant differences between serum chemistry values from male and female foxes. Prevalence of antibodies was determined from serum samples from 47 (26 female, 21 male) adult kit foxes and eight (4 female, 4 male) juveniles. Antibodies were detected against five of the eight pathogens tested: canine parvovirus, Toxoplasma gondii Leptospira interrogans, canine distemper virus, and canine hepatitis virus. Antibodies were not detected against Brucella, canis, Coccidioides immitis, or Yersinia pestis.

  20. A novel flagellar sheath protein, FcpA, determines filament coiling, translational motility and virulence for the Leptospira spirochete.

    Science.gov (United States)

    Wunder, Elsio A; Figueira, Cláudio P; Benaroudj, Nadia; Hu, Bo; Tong, Brian A; Trajtenberg, Felipe; Liu, Jun; Reis, Mitermayer G; Charon, Nyles W; Buschiazzo, Alejandro; Picardeau, Mathieu; Ko, Albert I

    2016-08-01

    Leptospira are unique among bacteria based on their helical cell morphology with hook-shaped ends and the presence of periplasmic flagella (PF) with pronounced spontaneous supercoiling. The factors that provoke such supercoiling, as well as the role that PF coiling plays in generating the characteristic hook-end cell morphology and motility, have not been elucidated. We have now identified an abundant protein from the pathogen L. interrogans, exposed on the PF surface, and named it Flagellar-coiling protein A (FcpA). The gene encoding FcpA is highly conserved among Leptospira and was not found in other bacteria. fcpA(-) mutants, obtained from clinical isolates or by allelic exchange, had relatively straight, smaller-diameter PF, and were not able to produce translational motility. These mutants lost their ability to cause disease in the standard hamster model of leptospirosis. Complementation of fcpA restored the wild-type morphology, motility and virulence phenotypes. In summary, we identified a novel Leptospira 36-kDa protein, the main component of the spirochete's PF sheath, and a key determinant of the flagella's coiled structure. FcpA is essential for bacterial translational motility and to enable the spirochete to penetrate the host, traverse tissue barriers, disseminate to cause systemic infection and reach target organs. © 2016 John Wiley & Sons Ltd.

  1. Quantitative investigation of two metallohydrolases by X-ray absorption spectroscopy near-edge spectroscopy

    International Nuclear Information System (INIS)

    Zhao, W.; Chu, W.S.; Yang, F.F.; Yu, M.J.; Chen, D.L.; Guo, X.Y.; Zhou, D.W.; Shi, N.; Marcelli, A.; Niu, L.W.; Teng, M.K.; Gong, W.M.; Benfatto, M.; Wu, Z.Y.

    2007-01-01

    The last several years have witnessed a tremendous increase in biological applications using X-ray absorption spectroscopy (BioXAS), thanks to continuous advancements in synchrotron radiation (SR) sources and detector technology. However, XAS applications in many biological systems have been limited by the intrinsic limitations of the Extended X-ray Absorption Fine Structure (EXAFS) technique e.g., the lack of sensitivity to bond angles. As a consequence, the application of the X-ray absorption near-edge structure (XANES) spectroscopy changed this scenario that is now continuously changing with the introduction of the first quantitative XANES packages such as Minut XANES (MXAN). Here we present and discuss the XANES code MXAN, a novel XANES-fitting package that allows a quantitative analysis of experimental data applied to Zn K-edge spectra of two metalloproteins: Leptospira interrogans Peptide deformylase (LiPDF) and acutolysin-C, a representative of snake venom metalloproteinases (SVMPs) from Agkistrodon acutus venom. The analysis on these two metallohydrolases reveals that proteolytic activities are correlated to subtle conformation changes around the zinc ion. In particular, this quantitative study clarifies the occurrence of the LiPDF catalytic mechanism via a two-water-molecules model, whereas in the acutolysin-C we have observed a different proteolytic activity correlated to structural changes around the zinc ion induced by pH variations

  2. Association between Opisthorchis viverrini and Leptospira spp. infection in endemic Northeast Thailand.

    Science.gov (United States)

    Van, Chinh Dang; Doungchawee, Galayanee; Suttiprapa, Sutas; Arimatsu, Yuji; Kaewkes, Sasithorn; Sripa, Banchob

    2017-08-01

    Opisthorchiasis caused by Opisthorchis viverrini is an important foodborne trematodiasis in Thailand, Laos and Cambodia. Interestingly, the opisthorchiasis endemic region overlaps with an area of leptospirosis emergence. Here we report an association between opisthorchiasis and leptospirosis in Thailand. Of 280 sera collected from villagers living around the Lawa wetland complex in Khon Kaen province, 199 (71%) were seropositive for leptospirosis by immunochromatography. Individuals with O. viverrini infection had a significantly higher rate of leptospirosis than those without (P=0.001). Significant higher leptospirosis prevalence was found in males than females (P=0.002). However, females but not males with O. viverrini infection showed a significantly higher seroprevalence of leptospirosis. Twenty-one of 35 environmental samples from the lake (water, mud and fish skin mucus) were positive for Leptospira spp. DNA sequencing, sequence alignment, and phylogenetic analysis of some positive nested PCR products revealed both pathogenic and intermediate pathogenic strains of Leptospira in the samples. Strikingly, O. viverrini metacercariae from the fish were positive for L. interrogans. These results suggest a close association between opisthorchiasis and leptospirosis. Contact with water, mud or eating raw fish harboring liver fluke metacercariae may be risk factors for Leptospira infection. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  3. Diversification of an emerging pathogen in a biodiversity hotspot: Leptospira in endemic small mammals of Madagascar.

    Science.gov (United States)

    Dietrich, Muriel; Wilkinson, David A; Soarimalala, Voahangy; Goodman, Steven M; Dellagi, Koussay; Tortosa, Pablo

    2014-06-01

    Biodiversity hotspots and associated endemism are ideal systems for the study of parasite diversity within host communities. Here, we investigated the ecological and evolutionary forces acting on the diversification of an emerging bacterial pathogen, Leptospira spp., in communities of endemic Malagasy small mammals. We determined the infection rate with pathogenic Leptospira in 20 species of sympatric rodents (subfamily Nesomyinae) and tenrecids (family Tenrecidae) at two eastern humid forest localities. A multilocus genotyping analysis allowed the characterization of bacterial diversity within small mammals and gave insights into their genetic relationships with Leptospira infecting endemic Malagasy bats (family Miniopteridae and Vespertilionidae). We report for the first time the presence of pathogenic Leptospira in Malagasy endemic small mammals, with an overall prevalence of 13%. In addition, these hosts harbour species of Leptospira (L. kirschneri, L. borgpetersenii and L. borgpetersenii group B) which are different from those reported in introduced rats (L. interrogans) on Madagascar. The diversification of Leptospira on Madagascar can be traced millions of years into evolutionary history, resulting in the divergence of endemic lineages and strong host specificity. These observations are discussed in relation to the relative roles of endemic vs. introduced mammal species in the evolution and epidemiology of Leptospira on Madagascar, specifically how biodiversity and biogeographical processes can shape community ecology of an emerging pathogen and lead to its diversification within native animal communities. © 2014 John Wiley & Sons Ltd.

  4. The Characteristics of Ubiquitous and Unique Leptospira Strains from the Collection of Russian Centre for Leptospirosis

    Science.gov (United States)

    Voronina, Olga L.; Kunda, Marina S.; Aksenova, Ekaterina I.; Ryzhova, Natalia N.; Semenov, Andrey N.; Petrov, Evgeny M.; Didenko, Lubov V.; Lunin, Vladimir G.; Ananyina, Yuliya V.; Gintsburg, Alexandr L.

    2014-01-01

    Background and Aim. Leptospira, the causal agent of leptospirosis, has been isolated from the environment, patients, and wide spectrum of animals in Russia. However, the genetic diversity of Leptospira in natural and anthropurgic foci was not clearly defined. Methods. The recent MLST scheme was used for the analysis of seven pathogenic species. 454 pyrosequencing technology was the base of the whole genome sequencing (WGS). Results. The most wide spread and prevalent Leptospira species in Russia were L. interrogans, L. kirschneri, and L. borgpetersenii. Five STs, common for Russian strains: 37, 17, 199, 110, and 146, were identified as having a longtime and ubiquitous distribution in various geographic areas. Unexpected properties were revealed for the environmental Leptospira strain Bairam-Ali. WGS of this strain genome suggested that it combined the features of the pathogenic and nonpathogenic strains and may be a reservoir of the natural resistance genes. Results of the comparative analysis of rrs and rpoB genes and MLST loci for different Leptospira species strains and phenotypic and serological properties of the strain Bairam-Ali suggested that it represented separate Leptospira species. Conclusions. Thus, the natural and anthropurgic foci supported ubiquitous Leptospira species and the pool of genes important for bacterial adaptivity to various conditions. PMID:25276806

  5. Human Leptospirosis Trends: Northeast Thailand, 2001–2012

    Directory of Open Access Journals (Sweden)

    Wilawan Thipmontree

    2014-08-01

    Full Text Available The objective of this study was to determine the changing trend of leptospirosis over time in Thailand using two prospective hospital-based studies conducted amongst adult patients with acute undifferentiated fever (AUFI admitted to Maharat Nakhon Ratchasima Hospital, Nakhon Ratchasima Province, Thailand between July 2001 to December 2002 and between July 2011 to December 2012. During the first period, leptospirosis (98 patients, 40% and scrub typhus (59 patients, 24.1% were the two major causes of AUFI. In the second period, scrub typhus (137 patients, 28.3% was found to be more common than leptospirosis (61 patients, 12.7%. Amongst patients with leptospirosis, the proportion of male patients and the median age were similar. Leptospira interrogans serogroup Autumnalis was the major infecting serogroup in both study periods. The case fatality rate of leptospirosis was significantly higher in 2011–2012 as compared with the case fatality rate in 2001–2002 (19.7% vs. 6.3%, p < 0.001. In summary, we found that number of leptospirosis cases had decreased over time. This trend is similar to reportable data for leptospirosis complied from passive surveillance by the Ministry of Public Health, Thailand. However, the case fatality rate of severe leptospirosis has increased. Severe lung hemorrhage associated with leptospirosis remained the major cause of death.

  6. Development of a real-time PCR for the detection of pathogenic Leptospira spp. in California sea lions.

    Science.gov (United States)

    Wu, Qingzhong; Prager, Katherine C; Goldstein, Tracey; Alt, David P; Galloway, Renee L; Zuerner, Richard L; Lloyd-Smith, James O; Schwacke, Lori

    2014-08-11

    Several real-time PCR assays are currently used for detection of pathogenic Leptospira spp.; however, few methods have been described for the successful evaluation of clinical urine samples. This study reports a rapid assay for the detection of pathogenic Leptospira spp. in California sea lions Zalophus californianus using real-time PCR with primers and a probe targeting the lipL32 gene. The PCR assay had high analytic sensitivity-the limit of detection was 3 genome copies per PCR volume using L. interrogans serovar Pomona DNA and 100% analytic specificity; it detected all pathogenic leptospiral serovars tested and none of the non-pathogenic Leptospira species (L. biflexa and L. meyeri serovar Semaranga), the intermediate species L. inadai, or the non-Leptospira pathogens tested. Our assay had an amplification efficiency of 1.00. Comparisons between the real-time PCR assay and culture isolation for detection of pathogenic Leptospira spp. in urine and kidney tissue samples from California sea lions showed that samples were more often positive by real-time PCR than by culture methods. Inclusion of an internal amplification control in the real-time PCR assay showed no inhibitory effects in PCR negative samples. These studies indicated that our real-time PCR assay has high analytic sensitivity and specificity for the rapid detection of pathogenic Leptospira species in urine and kidney tissue samples.

  7. High-Resolution Melting Curve Analysis of the 16S Ribosomal Gene to Detect and Identify Pathogenic and Saprophytic Leptospira Species in Colombian Isolates.

    Science.gov (United States)

    Peláez Sánchez, Ronald G; Quintero, Juan Álvaro López; Pereira, Martha María; Agudelo-Flórez, Piedad

    2017-05-01

    AbstractIt is important to identify the circulating Leptospira agent to enhance the performance of serodiagnostic tests by incorporating specific antigens of native species, develop vaccines that take into account the species/serovars circulating in different regions, and optimize prevention and control strategies. The objectives of this study were to develop a polymerase chain reaction (PCR)-high-resolution melting (HRM) assay for differentiating between species of the genus Leptospira and to verify its usefulness in identifying unknown samples to species level. A set of primers from the initial region of the 16S ribosomal gene was designed to detect and differentiate the 22 species of Leptospira . Eleven reference strains were used as controls to establish the reference species and differential melting curves. Twenty-five Colombian Leptospira isolates were studied to evaluate the usefulness of the PCR-HRM assay in identifying unknown samples to species level. This identification was confirmed by sequencing and phylogenetic analysis of the 16S ribosomal gene. Eleven Leptospira species were successfully identified, except for Leptospira meyeri / Leptospira yanagawae because the sequences were 100% identical. The 25 isolates from humans, animals, and environmental water sources were identified as Leptospira santarosai (twelve), Leptospira interrogans (nine), and L. meyeri / L. yanagawae (four). The species verification was 100% concordant between PCR-HRM and phylogenetic analysis of the 16S ribosomal gene. The PCR-HRM assay designed in this study is a useful tool for identifying Leptospira species from isolates.

  8. MAT FOR LEPTOSPIROSIS DIAGNOSIS

    Directory of Open Access Journals (Sweden)

    Esti Rahardianingtyas.

    2014-06-01

    Full Text Available Leptospirosis is a disease caused by bacterial infection leptospira interrogans.Leptospira bacteria is a spiral bacterium with solid strands with two flagella periplasmik.Septicaemic phase patient samples taken from the blood and cerebrospinal fluid, whereassamples taken at phase immune extracted from urine. The diagnosis of leptospirosis occurdirectly or indirectly. Diagnosis is done by directly isolate and identify the causative agents ofthe agent. Diagnosis is done indirectly by detecting specific antibodies from the patient's body.Gold Standard of the diagnosis of leptospirosis is MAT. Mat made by reacting antibodies toleptospira antigen. Positive results seen with clump formed.Key words: Leptospirosis, Leptospirosis Diagnostic, MAT (Microscopic Agglutination Test Leptospirosis merupakan penyakit yang disebabkan karena infeksi bakteri leptospirainterrogans. Bakteri leptospira merupakan bakteri spiral dengan untaian yang padat dengan duaflagella periplasmik. Sampel pasien pada fase septicaemic diambil dari darah dan cairanserebrospinal, sedangkan sampel yang diambil pada fase immune diambil dari urine. Diagnosisleptospirosis dilakukan secara langsung maupun tidak langsung. Diagnosis secara langsungdilakukan dengan cara mengisolasi agen penyebab dan mengidentifikasi agen tersebut. Diagnosissecara tidak langsung dilakukan dengan cara mendeteksi antibodi spesiflk dari dalam tubuhpasien. Gold Standart dari diagnosis leptospirosis adalah MAT. Mat dilakukan dengan caramereaksikan antibodi dengan antigen leptospira. Hasil positif dilihat dengan terbentuk gumpalanagglutinasiKata kunci: Leptospirosis, Leptospira, Leptospirosis Diagnosis.

  9. Solution structure of leptospiral LigA4 Big domain

    International Nuclear Information System (INIS)

    Mei, Song; Zhang, Jiahai; Zhang, Xuecheng; Tu, Xiaoming

    2015-01-01

    Pathogenic Leptospiraspecies express immunoglobulin-like proteins which serve as adhesins to bind to the extracellular matrices of host cells. Leptospiral immunoglobulin-like protein A (LigA), a surface exposed protein containing tandem repeats of bacterial immunoglobulin-like (Big) domains, has been proved to be involved in the interaction of pathogenic Leptospira with mammalian host. In this study, the solution structure of the fourth Big domain of LigA (LigA4 Big domain) from Leptospira interrogans was solved by nuclear magnetic resonance (NMR). The structure of LigA4 Big domain displays a similar bacterial immunoglobulin-like fold compared with other Big domains, implying some common structural aspects of Big domain family. On the other hand, it displays some structural characteristics significantly different from classic Ig-like domain. Furthermore, Stains-all assay and NMR chemical shift perturbation revealed the Ca 2+ binding property of LigA4 Big domain. - Highlights: • Determining the solution structure of a bacterial immunoglobulin-like domain from a surface protein of Leptospira. • The solution structure shows some structural characteristics significantly different from the classic Ig-like domains. • A potential Ca 2+ -binding site was identified by strains-all and NMR chemical shift perturbation.

  10. Crystallization of FcpA from Leptospira, a novel flagellar protein that is essential for pathogenesis.

    Science.gov (United States)

    San Martin, Fabiana; Mechaly, Ariel E; Larrieux, Nicole; Wunder, Elsio A; Ko, Albert I; Picardeau, Mathieu; Trajtenberg, Felipe; Buschiazzo, Alejandro

    2017-03-01

    The protein FcpA is a unique component of the flagellar filament of spirochete bacteria belonging to the genus Leptospira. Although it plays an essential role in translational motility and pathogenicity, no structures of FcpA homologues are currently available in the PDB. Its three-dimensional structure will unveil the novel motility mechanisms that render pathogenic Leptospira particularly efficient at invading and disseminating within their hosts, causing leptospirosis in humans and animals. FcpA from L. interrogans was purified and crystallized, but despite laborious attempts no useful X ray diffraction data could be obtained. This challenge was solved by expressing a close orthologue from the related saprophytic species L. biflexa. Three different crystal forms were obtained: a primitive and a centred monoclinic form, as well as a hexagonal variant. All forms diffracted X-rays to suitable resolutions for crystallographic analyses, with the hexagonal type typically reaching the highest limits of 2.0 Å and better. A variation of the quick-soaking procedure resulted in an iodide derivative that was instrumental for single-wavelength anomalous diffraction methods.

  11. Solution structure of leptospiral LigA4 Big domain

    Energy Technology Data Exchange (ETDEWEB)

    Mei, Song; Zhang, Jiahai [Hefei National Laboratory for Physical Sciences at Microscale, School of Life Sciences, University of Science and Technology of China, Hefei, Anhui 230026 (China); Zhang, Xuecheng [School of Life Sciences, Anhui University, Hefei, Anhui 230039 (China); Tu, Xiaoming, E-mail: xmtu@ustc.edu.cn [Hefei National Laboratory for Physical Sciences at Microscale, School of Life Sciences, University of Science and Technology of China, Hefei, Anhui 230026 (China)

    2015-11-13

    Pathogenic Leptospiraspecies express immunoglobulin-like proteins which serve as adhesins to bind to the extracellular matrices of host cells. Leptospiral immunoglobulin-like protein A (LigA), a surface exposed protein containing tandem repeats of bacterial immunoglobulin-like (Big) domains, has been proved to be involved in the interaction of pathogenic Leptospira with mammalian host. In this study, the solution structure of the fourth Big domain of LigA (LigA4 Big domain) from Leptospira interrogans was solved by nuclear magnetic resonance (NMR). The structure of LigA4 Big domain displays a similar bacterial immunoglobulin-like fold compared with other Big domains, implying some common structural aspects of Big domain family. On the other hand, it displays some structural characteristics significantly different from classic Ig-like domain. Furthermore, Stains-all assay and NMR chemical shift perturbation revealed the Ca{sup 2+} binding property of LigA4 Big domain. - Highlights: • Determining the solution structure of a bacterial immunoglobulin-like domain from a surface protein of Leptospira. • The solution structure shows some structural characteristics significantly different from the classic Ig-like domains. • A potential Ca{sup 2+}-binding site was identified by strains-all and NMR chemical shift perturbation.

  12. Acquisition of negative complement regulators by the saprophyte Leptospira biflexa expressing LigA or LigB confers enhanced survival in human serum.

    Science.gov (United States)

    Castiblanco-Valencia, Mónica M; Fraga, Tatiana R; Breda, Leandro C D; Vasconcellos, Sílvio A; Figueira, Cláudio P; Picardeau, Mathieu; Wunder, Elsio; Ko, Albert I; Barbosa, Angela S; Isaac, Lourdes

    2016-05-01

    Leptospiral immunoglobulin-like (Lig) proteins are surface exposed molecules present in pathogenic but not in saprophytic Leptospira species. We have previously shown that Lig proteins interact with the soluble complement regulators Factor H (FH), FH like-1 (FHL-1), FH related-1 (FHR-1) and C4b Binding Protein (C4BP). In this study, we used the saprophyte L. biflexa serovar Patoc as a surrogate host to address the specific role of LigA and LigB proteins in leptospiral complement evasion. L. biflexa expressing LigA or LigB was able to acquire FH and C4BP. Bound complement regulators retained their cofactor activities of FI in the proteolytic cleavage of C3b and C4b. Moreover, heterologous expression of ligA and ligB genes in the saprophyte L. biflexa enhanced bacterial survival in human serum. Complement deposition on lig-transformed L. biflexa was assessed by flow cytometry analysis. With regard to MAC deposition, L. biflexa expressing LigA or LigB presented an intermediate profile: MAC deposition levels were greater than those found in the pathogenic L. interrogans, but lower than those observed for L. biflexa wildtype. In conclusion, Lig proteins contribute to in vitro control of complement activation on the leptospiral surface, promoting an increased bacterial survival in human serum. Copyright © 2016 European Federation of Immunological Societies. All rights reserved.

  13. The Leptospiral Antigen Lp49 is a Two-Domain Protein with Putative Protein Binding Function

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira Giuseppe,P.; Oliveira Neves, F.; Nascimento, A.; Gomes Guimaraes, B.

    2008-01-01

    Pathogenic Leptospira is the etiological agent of leptospirosis, a life-threatening disease that affects populations worldwide. Currently available vaccines have limited effectiveness and therapeutic interventions are complicated by the difficulty in making an early diagnosis of leptospirosis. The genome of Leptospira interrogans was recently sequenced and comparative genomic analysis contributed to the identification of surface antigens, potential candidates for development of new vaccines and serodiagnosis. Lp49 is a membrane-associated protein recognized by antibodies present in sera from early and convalescent phases of leptospirosis patients. Its crystal structure was determined by single-wavelength anomalous diffraction using selenomethionine-labelled crystals and refined at 2.0 Angstroms resolution. Lp49 is composed of two domains and belongs to the all-beta-proteins class. The N-terminal domain folds in an immunoglobulin-like beta-sandwich structure, whereas the C-terminal domain presents a seven-bladed beta-propeller fold. Structural analysis of Lp49 indicates putative protein-protein binding sites, suggesting a role in Leptospira-host interaction. This is the first crystal structure of a leptospiral antigen described to date.

  14. Detection and characterization of Leptospira spp. isolated from aborted bovine clinical samples

    Directory of Open Access Journals (Sweden)

    Hassan Momtaz

    2011-01-01

    Full Text Available Leptospira is recognized as an important public health problem worldwide, especially in tropical countries, and is a common cause of abortion in dairy and beef herds. The aim of the present study was to detect and characterize Leptospira as the causative agent of abortion in cattle using a PCR-RFLP in Chaharmahal va Bakhtiari and Isfahan provinces, Iran. A total of 220 bovine aborted foetuses and 120 vaginal discharges from an aborted calf were collected from 64 commercial dairy herds. After isolation of 60 Leptospira spp. from samples, RFLP analysis was carried out with HindIII and HaeIII restriction enzymes in reference strains and isolated for characterization. In a total of 340 specimens, 46 (20.9% and 14 (11.66% were identified positive for Leptospira spp. from aborted bovine foetuses and vaginal discharges, respectively. The present results also suggest that L. interrogans serovar hardjo has the highest prevalence in the region under study and L. hardjo is a major pathogen causing bovine abortion in Chaharmahal va Bakhtiari and Isfahan provinces of Iran.

  15. Verdad sublime y madre asesina en Christine V., versión de Marguerite Duras

    Directory of Open Access Journals (Sweden)

    Juliana González Holguín

    2016-01-01

    Full Text Available Todo relato es ficción, versión y, así mismo, verdad, bajo una u otra concepción de la misma, es decir, desde una perspectiva que se enfoca según la intención y la subjetividad de uno o más actores, de uno o más narradores. El texto de Marguerite Duras intitulado Sublime forcément sublime Christine V. involucra, por su contenido y su contexto, varias versiones que contrastan y se interrogan entre sí. La escritora se posiciona de tal manera que, a través de recursos propios del oficio literario, desentraña una verdad que puede no ajustarse a la realidad o al saber, pero que nos enfrenta a los límites de lo pulsional y lo ominoso.

  16. Genotypes of pathogenic Leptospira spp isolated from rodents in Argentina

    Science.gov (United States)

    Loffler, Sylvia Grune; Pavan, Maria Elisa; Vanasco, Bibiana; Samartino, Luis; Suarez, Olga; Auteri, Carmelo; Romero, Graciela; Brihuega, Bibiana

    2014-01-01

    Leptospirosis is the most widespread zoonosis in the world and significant efforts have been made to determine and classify pathogenic Leptospira strains. This zoonosis is maintained in nature through chronic renal infections of carrier animals, with rodents and other small mammals serving as the most important reservoirs. Additionally, domestic animals, such as livestock and dogs, are significant sources of human infection. In this study, a multiple-locus variable-number tandem repeat analysis (MLVA) was applied to genotype 22 pathogenic Leptospira strains isolated from urban and periurban rodent populations from different regions of Argentina. Three MLVA profiles were identified in strains belonging to the species Leptospira interrogans (serovars Icterohaemorrhagiae and Canicola); one profile was observed in serovar Icterohaemorrhagiae and two MLVA profiles were observed in isolates of serovars Canicola and Portlandvere. All strains belonging to Leptospira borgpetersenii serovar Castellonis exhibited the same MLVA profile. Four different genotypes were isolated from urban populations of rodents, including both mice and rats and two different genotypes were isolated from periurban populations. PMID:24676656

  17. Risk of infection and associated influenza-like disease among abattoir workers due to two Leptospira species.

    Science.gov (United States)

    Dreyfus, A; Heuer, C; Wilson, P; Collins-Emerson, J; Baker, M G; Benschop, J

    2015-07-01

    The aims of this study were to determine the annual incidence of infection with Leptospira interrogans serovar Pomona and/or Leptospira borgpetersenii serovar Hardjo and its association with influenza-like illness (ILI) in meat workers in New Zealand. Sera were collected twice, 50-61 weeks apart, from 592 workers at eight abattoirs slaughtering sheep (n = 4), cattle (n = 2) and deer (n = 2), and tested by the microscopic agglutination test for Hardjo and Pomona. Forty-nine (8·3%) participants either seroconverted or had at least a twofold increased serological titre against either serovar. The worker infection risk was higher in sheep abattoirs (11·9%) than in abattoirs processing deer (0%) or cattle (1·2%) (P < 0·01). The annualized risk of mild (ILI) or severe clinical disease attributable to the two Leptospira serovars was 2·7%. This study has demonstrated that meat workers are at substantial risk of infection and clinical disease, suggesting further investigation of infection sources and preventive measures are warranted.

  18. Case Report: A Cluster of Three Leptospirosis Cases in a New York City Abattoir and an Unusual Complication in the Index Case.

    Science.gov (United States)

    Kupferman, Tania; Coffee, Megan P; Eckhardt, Benjamin J

    2017-12-01

    We report the case of a 46-year-old male abattoir worker who developed myalgias, shortness of breath, and irritability 2 weeks after sustaining a laceration to the hand with a knife at work. During his hospital evaluation for septic shock he was noted to be febrile, hypotensive, profoundly jaundiced with aseptic meningitis, and renal failure, and was diagnosed with Leptospirosis interrogans infection confirmed by serum and urine polymerase chain reaction. After standard antibiotic therapy and recovery from severe clinical illness, he developed unilateral orchitis with pyuria secondary to leptospirosis, a well-established complication in the veterinary literature, but of which we offer the first report in humans in the English literature. The case presented was also the index case that uncovered a cluster outbreak of leptospirosis in New York City during the winter of 2016-2017, involving a total of three patients who lived or worked within a block of the abattoir. Two patients survived whereas the third died of pulmonary hemorrhage shortly after seeking medical care.

  19. La educación jurídica como práctica de construcción social: Hacia una reflexión pedagógica

    Directory of Open Access Journals (Sweden)

    Boris Alberto Pinzón Franco

    2010-01-01

    Full Text Available El presente artículo de investigación pretende abordar el estudio del campo de la educación jurídica como criterio desde donde se interrogan las prácticas pedagógicas en la enseñanza del derecho y su relación con el espacio social. El derecho como disciplina en nuestro país considera una tradición de derecho civilista como fuente inmediata de nuestro sistema y cultura jurídica, este presupuesto orienta las formas como se estructuran los modelos de educación jurídica en relación con las prácticas pedagógicas y sentidos del derecho en nuestra sociedad. Hasta el momento, los estudios que abordan el campo de la educación jurídica parten de algunas consideraciones de la forma como se transmiten los conocimientos jurídicos en la enseñanza del derecho, el estudio aborda las diferentes relaciones e interacciones que se establecen en el campo de la educación jurídica como práctica de construcción social.

  20. Disease survey of free-ranging grey brocket deer (Mazama gouazoubira) in the Gran Chaco, Bolivia.

    Science.gov (United States)

    Deem, Sharon L; Noss, Andrew J; Villarroel, Richard; Uhart, Marcela M; Karesh, William B

    2004-01-01

    Samples from 17 free-ranging hunter-killed grey brocket deer (Mazama gouazoubira) in the Gran Chaco, Bolivia, were collected during June-August 1999. All 17 deer appeared to be in good condition at the time of death. Gross necropsies were performed, serum was collected for serologic evaluation of selected infectious disease agents, and feces and ectoparasites were collected for evaluation of internal and external parasites. Serologic tests were positive for antibodies against bovine respiratory syncytial virus and four Leptospira interrogans serovars, with questionable results for epizootic hemorrhagic disease virus serotypes 1 and 2. No antibodies were detected to Anaplasma marginale, Babesia bigemina, Babesia bovis, Babesia odocoilei, bluetongue virus (serotypes 2, 10, 11, 13, and 17), bovine viral diarrhea virus, Brucella abortus, foot-and-mouth disease virus, infectious bovine rhinotracheitis virus, Mycobacterium avium subsp. paratuberculosis, and parainfluenza-3 virus. Sixty-four percent (7/11) of the deer had endoparasites. Amblyomma spp. ticks were found on seven deer, flies of the family Hippoboscidae on six deer, and lice on six deer.

  1. Polymerase chain reaction for the laboratory diagnosis of aseptic meningitis and encephalitis

    Directory of Open Access Journals (Sweden)

    CHESKY MARISA

    2000-01-01

    Full Text Available A protocol for testing cerebrospinal fluid specimens using a range of PCR assays for the diagnosis of central nervous system infection was developed and used to test prospectively 383 specimens. PCR assays were used for the detection of adenovirus, Borrelia burgdorferi, enteroviruses, Epstein Barr virus, cytomegalovirus, herpes simplex virus, human herpes virus type 6, JC virus, Leptospira interrogans, Listeria monocytogenes, lymphocytic choriomeningitis virus, measles virus, mumps virus, Mycobacterium sp., Mycoplasma pneumoniae, Toxoplasma gondii and varicella zoster virus. Of the 383 specimens tested in this study, 46 (12.0% were found to be positive. The microorganisms detected were CMV, enterovirus, Epstein Barr virus, herpes simplex virus, human herpes virus type 6, JC virus, L. monocytogenes, Mycobacterium genus, Toxoplasma gondii and varicella zoster virus. The introduction of the PCR protocol described has improved the diagnosis of a range of central nervous system infections in our laboratory. We believe however that further evaluation of these assays in immunocompromised patients is necessary to better determine the predictive value of positive PCR results in these patient groups.

  2. Serologic survey in a chamois population of Abruzzo

    Directory of Open Access Journals (Sweden)

    Leonardo Gentile

    2000-09-01

    Full Text Available Abstract As part of the Abruzzo National Park wildlife health management program, serum samples from 62 free-living and captive Abruzzo chamois, Rupicapra (pyrenaica ornata, were tested to estimate antibody presence to some pathogenous agents. The serum, drawn during chemical immobilisations for introductions or population study programs, were tested for: bovine herpes virus 1 (BHV-1, parainfluenza virus (PI3, pesti virus, foot and mouth disease virus (FMD type O-A-C, bovine leukemia virus (BLV, ovicaprini lentivirus, encephalomyocarditis virus (EMCV, S-phase brucellae, leptospira interrogans, mycobacterium paratuberculosis, chlamydia psittaci, coxiella burnetii, rickettsia mooseri and conori and toxoplasrna gondii. Twenty-three subjects were found positive to BHV-1 (7/62, pestivirus (6/62, EMCV (8/62, leptospira (5/62 and toxoplasma (4/62. Results did not indicate any active infection but only contact with some pathogenic agents.

  3. Leptospira spp. in Rodents and Shrews in Germany

    Science.gov (United States)

    Mayer-Scholl, Anne; Hammerl, Jens Andre; Schmidt, Sabrina; Ulrich, Rainer G.; Pfeffer, Martin; Woll, Dietlinde; Scholz, Holger C.; Thomas, Astrid; Nöckler, Karsten

    2014-01-01

    Leptospirosis is an acute, febrile disease occurring in humans and animals worldwide. Leptospira spp. are usually transmitted through direct or indirect contact with the urine of infected reservoir animals. Among wildlife species, rodents act as the most important reservoir for both human and animal infection. To gain a better understanding of the occurrence and distribution of pathogenic leptospires in rodent and shrew populations in Germany, kidney specimens of 2973 animals from 11 of the 16 federal states were examined by PCR. Rodent species captured included five murine species (family Muridae), six vole species (family Cricetidae) and six shrew species (family Soricidae). The most abundantly trapped animals were representatives of the rodent species Apodemus flavicollis, Clethrionomys glareolus and Microtus agrestis. Leptospiral DNA was amplified in 10% of all animals originating from eight of the 11 federal states. The highest carrier rate was found in Microtus spp. (13%), followed by Apodemus spp. (11%) and Clethrionomys spp. (6%). The most common Leptospira genomospecies determined by duplex PCR was L. kirschneri, followed by L. interrogans and L. borgpetersenii; all identified by single locus sequence typing (SLST). Representatives of the shrew species were also carriers of Leptospira spp. In 20% of Crocidura spp. and 6% of the Sorex spp. leptospiral DNA was detected. Here, only the pathogenic genomospecies L. kirschneri was identified. PMID:25062275

  4. Serosurvey of ex situ giant pandas (Ailuropoda melanoleuca) and red pandas (Ailurus fulgens) in China with implications for species conservation.

    Science.gov (United States)

    Loeffler, I Kati; Howard, JoGayle; Montali, Richard J; Hayek, Lee-Ann; Dubovi, Edward; Zhang, Zhihe; Yan, Qigui; Guo, Wanzhu; Wildt, David E

    2007-12-01

    Conservation strategies for the giant panda (Ailuropoda melanoleuca) include the development of a self-sustaining ex situ population. This study examined the potential significance of infectious pathogens in giant pandas ex situ. Serologic antibody titers against canine distemper virus (CDV), canine parvovirus (CPV), canine adenovirus (CAV), canine coronavirus (CCV), canine herpesvirus, canine parainfluenza virus (CPIV), Toxoplasma gondii, Neospora caninum, and Leptospira interrogans were measured in 44 samples taken from 19 giant pandas between 1998 and 2003 at the Chengdu Research Base of Giant Panda Breeding in Sichuan, China. Seroassays also included samples obtained in 2003 from eight red pandas (Ailurus fulgens) housed at the same institution. All individuals had been vaccinated with a Chinese canine vaccine that included modified live CDV, CPV, CAV, CCV, and CPIV. Positive antibody titers were found only against CDV, CPV, and T. gondii. Sera were negative for antibodies against the other six pathogens. Results indicate that the quality of the vaccine may not be reliable and that it should not be considered protective or safe in giant pandas and red pandas. Positive antibody titers against T. gondii were found in seven of the 19 giant pandas. The clinical, subclinical, or epidemiologic significance of infection with these pathogens via natural exposure or from modified live vaccines in giant pandas is unknown. Research in this area is imperative to sustaining a viable population of giant pandas and other endangered species.

  5. Enfermedad por meningococo, Neisseria meningitidis: perspectiva epidemiológica, clínica y preventiva Meningococcal disease caused by Neisseria meningitidis: epidemiological, clinical, and preventive perspectives

    Directory of Open Access Journals (Sweden)

    Lourdes Almeida-González

    2004-10-01

    Full Text Available La meningitis bacteriana continúa siendo uno de los grandes problemas de la salud pública mundial. En particular, la infección por Neisseria meningitidis afecta tanto a países desarrollados como subdesarrollados, y se presenta en formas endémicas y epidémicas. La enfermedad meningocóccica se puede manifestar clínicamente no sólo como meningitis, sino con cuadros fulminantes de meningococcemia. La persistencia de N. meningitidis se debe al gran porcentaje de portadores y a la dinámica de transmisión de la bacteria. Aproximadamente 500 millones de personas en el mundo son portadoras de N. meningitidis en la nasofaringe. Los factores de transmisiblidad identificados han sido el tabaquismo activo o pasivo, la presencia de infecciones virales del tracto respiratorio superior, épocas de sequía, y el hacinamiento. Por lo anterior, se han descrito brotes de enfermedad meningocóccica en cuarteles militares, escuelas, cárceles y dormitorios. Algunos determinantes que permiten la invasión sistémica incluyen daños en la mucosa nasofaríngea de portadores, cepas virulentas con formación de cápsula, ausencia de anticuerpos bactericidas y deficiencias del sistema del complemento. El control de la enfermedad meningocóccica en circunstancias endémicas y epidémicas se logra por el tratamiento de casos con antibióticos adecuados (penicilina, ceftriaxona o cloranfenicol, la quimioprofilaxis de contactos cercanos (ciprofloxacina, rifampicina o ceftriaxona, y la vigilancia clínica de éstos. Sin embargo, es fundamental subrayar que la clave para el control efectivo de la enfermedad meningocóccica es la inmunoprofilaxis. Las vacunas disponibles incluyen las de polisacáridos monovalentes o bivalentes (serogrupos A y C, tetravalentes (A, C, Y, W-135, la conjugada (C o la combinada de proteínas de membrana celular y polisacárido (B y C. Recientemente nos hemos visto forzados a establecer planes nacionales de respuesta que incluyen la

  6. Caracterización de aislamientos invasivos de S. pneumoniae, H. influenzae y N. meningitidis en América Latina y el Caribe: SIREVA II, 2000-2005 Characterization of invasive isolates of S. pneumoniae, H. influenzae, and N. meningitidis in Latin America and the Caribbean: SIREVA II, 2000-2005

    Directory of Open Access Journals (Sweden)

    Jean-Marc Gabastou

    2008-07-01

    Full Text Available OBJETIVOS: Analizar las características fenotípicas y la susceptibilidad a antibióticos de las cepas circulantes de Streptococcus pneumoniae, Haemophilus influenzae y Neisseria meningitidis en América Latina y el Caribe entre 2000 y 2005. Se evaluó la cobertura potencial de las vacunas conjugadas. MÉTODOS: Se estudió por métodos convencionales la distribución de los serotipos o serogrupos de 17 303 cepas de S. pneumoniae, 2 782 cepas de H. influenzae y 6 955 cepas de N. meningitidis aisladas de casos de neumonía, meningitis, sepsis, bacteriemias y otros procesos invasivos. Se evaluó la susceptibilidad a los antibióticos de las cepas estudiadas. Los aislamientos procedían de 453 centros centinelas de 19 países de América Latina y 4 del Caribe, como parte del proyecto SIREVA II. RESULTADOS: El serotipo 14 de S. pneumoniae fue el más frecuentemente aislado (21,1%, especialmente en niños menores de 6 años (29,1%. Las coberturas potenciales de las vacunas conjugadas antineumocócicas hepta, nona, deca y tridecavalentes fueron de 59,0%, 73,4%, 76,5% y 85,9%, respectivamente. De los aislamientos, 63,3% eran sensibles a la penicilina. El serotipo b de H. influenzae estuvo presente en 72,2% de los aislamientos en niños menores de 2 años, mientras 8,6% correspondieron a los serotipos a, c, d, e y f; 19,2% resultaron no serotipables. La proporción de cepas de H. influenzae productoras de betalactamasa en aislamientos en niños menores de 2 años fue de 16,3%. Los serogrupos de N. meningitidis más frecuentes fueron el B (69,0% y el C (25,7%; 65,8% y 99,2% de las cepas fueron sensibles a la penicilina y a la rifampicina, respectivamente. CONCLUSIONES: Estos resultados resaltan la importancia de la vigilancia epidemiológica integral de S. pneumoniae, H. influenzae y N. meningitidis en América Latina y el Caribe. La gran heterogeneidad en la distribución de los serotipos de S. pneumoniae en los países estudiados podría reducir la

  7. Detection of leptospires from infected urine and tissue samples in vitro by modified Fontana silver stain Detecção de leptospiras na urina e nos tecidos infectados in vitro por impregnação com prata Fontana modificada

    Directory of Open Access Journals (Sweden)

    Islay Rodríguez

    2013-02-01

    Full Text Available INTRODUCTION: The microbiological diagnosis of leptospirosis comprises bacteriological and serological methods. The former ones allow the direct detection of leptospires and are considered presumptive with the exception of culture. Therefore, they constitute invaluable tools for rapid diagnosis, mainly in samples from deceased subjects. OBJECTIVE: To evaluate a modified Fontana silver staining method in experimentally infected samples. MATERIAL AND METHODS: Human and animal (hamster urine samples were experimentally infected with different strains of Leptospira interrogans sensu lato. Liquid culture medium, leptospira cultures, experimentally infected and non-infected human urine samples, clarified and non-clarified imprints, and clarified and non-clarified suspension smears from tissues of experimentally infected and non-infected hamsters were applied for the ass essment of silver staining. The analytical sensitivity of the assay was compared with dark field microscopy and culture. Other bacterial and fungi species were also used. RESULTS: The modified Fontana silver staining allowed the accurate observation of the well-defined leptospire helical structure. On leptospire cultures from infected human samples, we could observe until (1-10 × 10³ leptospires/ml, higher sensitivity in comparison with direct dark field microscopy and lower in comparison with culture. The best results in tissues were obtained on clarified imprints and non-clarified suspension smears. Morphological and stainable structures compatible with leptospires were not observed in the samples without them. CONCLUSION: This procedure allowed differentiating the characteristic morphology of leptospires. As its application suggests, it consists of a simple and easily conducted procedure with stable reagents.INTRODUÇÃO: O diagnóstico microbiológico da leptospirose inclui métodos bacteriológicos e sorológicos; os primeiros permitem a detecção direta de leptospiras e,

  8. Epidemiology of Leptospirosis in Africa: A Systematic Review of a Neglected Zoonosis and a Paradigm for 'One Health' in Africa.

    Directory of Open Access Journals (Sweden)

    Kathryn J Allan

    Full Text Available Leptospirosis is an important but neglected bacterial zoonosis that has been largely overlooked in Africa. In this systematic review, we aimed to summarise and compare current knowledge of: (1 the geographic distribution, prevalence, incidence and diversity of acute human leptospirosis in Africa; and (2 the geographic distribution, host range, prevalence and diversity of Leptospira spp. infection in animal hosts in Africa.Following Preferred Reporting Items for Systematic Reviews and Meta-analyses (PRISMA guidelines, we searched for studies that described (1 acute human leptospirosis and (2 pathogenic Leptospira spp. infection in animals. We performed a literature search using eight international and regional databases for English and non-English articles published between January 1930 to October 2014 that met out pre-defined inclusion criteria and strict case definitions.We identified 97 studies that described acute human leptospirosis (n = 46 or animal Leptospira infection (n = 51 in 26 African countries. The prevalence of acute human leptospirosis ranged from 2 3% to 19 8% (n = 11 in hospital patients with febrile illness. Incidence estimates were largely restricted to the Indian Ocean islands (3 to 101 cases per 100,000 per year (n = 6. Data from Tanzania indicate that human disease incidence is also high in mainland Africa (75 to 102 cases per 100,000 per year. Three major species (Leptospira borgpetersenii, L. interrogans and L. kirschneri are predominant in reports from Africa and isolates from a diverse range of serogroups have been reported in human and animal infections. Cattle appear to be important hosts of a large number of Leptospira serogroups in Africa, but few data are available to allow comparison of Leptospira infection in linked human and animal populations. We advocate a 'One Health' approach to promote multidisciplinary research efforts to improve understanding of the animal to human transmission of leptospirosis on the

  9. Epidemiology of Leptospirosis in Africa: A Systematic Review of a Neglected Zoonosis and a Paradigm for ‘One Health’ in Africa

    Science.gov (United States)

    Allan, Kathryn J.; Biggs, Holly M.; Halliday, Jo E. B.; Kazwala, Rudovick R.; Maro, Venance P.; Cleaveland, Sarah; Crump, John A.

    2015-01-01

    Background Leptospirosis is an important but neglected bacterial zoonosis that has been largely overlooked in Africa. In this systematic review, we aimed to summarise and compare current knowledge of: (1) the geographic distribution, prevalence, incidence and diversity of acute human leptospirosis in Africa; and (2) the geographic distribution, host range, prevalence and diversity of Leptospira spp. infection in animal hosts in Africa. Methods Following Preferred Reporting Items for Systematic Reviews and Meta-analyses (PRISMA) guidelines, we searched for studies that described (1) acute human leptospirosis and (2) pathogenic Leptospira spp. infection in animals. We performed a literature search using eight international and regional databases for English and non-English articles published between January 1930 to October 2014 that met out pre-defined inclusion criteria and strict case definitions. Results and Discussion We identified 97 studies that described acute human leptospirosis (n = 46) or animal Leptospira infection (n = 51) in 26 African countries. The prevalence of acute human leptospirosis ranged from 2 3% to 19 8% (n = 11) in hospital patients with febrile illness. Incidence estimates were largely restricted to the Indian Ocean islands (3 to 101 cases per 100,000 per year (n = 6)). Data from Tanzania indicate that human disease incidence is also high in mainland Africa (75 to 102 cases per 100,000 per year). Three major species (Leptospira borgpetersenii, L. interrogans and L. kirschneri) are predominant in reports from Africa and isolates from a diverse range of serogroups have been reported in human and animal infections. Cattle appear to be important hosts of a large number of Leptospira serogroups in Africa, but few data are available to allow comparison of Leptospira infection in linked human and animal populations. We advocate a ‘One Health’ approach to promote multidisciplinary research efforts to improve understanding of the animal to human

  10. Doxycycline Attenuates Leptospira-Induced IL-1β by Suppressing NLRP3 Inflammasome Priming

    Directory of Open Access Journals (Sweden)

    Wenlong Zhang

    2017-07-01

    Full Text Available Doxycycline (Dox, a semisynthetic antibiotic, has been reported to exert multiple immunomodulatory effects. Treatment with Dox has a satisfactory curative effect against leptospirosis. In addition to its antibacterial action, we supposed that Dox also modulated immune response in controlling leptospira infection. Using J774A.1 mouse macrophages, the effects of Dox on protein and mRNA levels of IL-1β and TNF-α were investigated after infection with live or sonicated Leptospira interrogans serovar Lai strain Lai (56601. Specifically, the level of IL-1β but not TNF-α was sharply decreased when treated with Dox in leptospira-infected macrophages. Western blot analysis showed that Dox suppressed the activation of leptospira-induced MAPK and NF-κB signaling pathways. Using NLRP3-deficient and NLRC4-deficient mice, the data showed that the expression of leptospira-induced IL-1β was mainly dependent on the presence of NLRP3 inflammasome in macrophages. Meanwhile, Dox suppressed leptospira-induced NLRP3 inflammasome priming with the upregulation of the Na/K-ATPase Pump β1 subunit. The inhibition effect of Dox on IL-1β was also conspicuous in cells with lipopolysaccharide and ATP stimulation. These results were confirmed in vivo, as peritoneal fluids of mice and organs of hamsters expressed less IL-1β after treatment of leptospiral infection with Dox. Our results indicated that Dox also modulated immune response to attenuate leptospira-induced IL-1β by suppressing p38, JNK, p65, and NLRP3 inflammasome priming.

  11. EXPERIENCIAS DE GUERRA DESDE LA VOZ DE LAS MUJERES

    Directory of Open Access Journals (Sweden)

    Elsa Blair

    2003-01-01

    Full Text Available El articulo recoge algunas reflexiones en tormo al trabajode campo realizado con mujeres excombatientes de diversos grupos armados colombianos en el marco de la investigación Mujeres en tiempos de guerra: una mirada a lo femenino en el contexto de los grupos armados colombianos. A partir de una concepción de la guerra como construcción cultural, las autoras interrogan los efectos de la misma sobre su identidad femenina, esto es, lo que la guerra ha representado para ellas como mujeres y los efectos que ha tenido en términos de su identidad genérica. Tras una reflexión inicia en torno a los desafíos éticos planteados por el trabajo de campo, las autoras abordan la problemática de la identidad de género a través de dos vías: por una parte, los campos o "nudos¿ temáticos que amarran las narraciones de mujeres entrevistadas -la familia, la maternidad y los hijos, las relaciones con los "otros", las experiencias de muerte y el dolor de la guerra-; y por otra, la forma particular en que ellas construyen sus relatos sobre su experiencia como combatientes. Por último, a partir de esa mirada analítica sobre la manera como estas mujeres han vivido y significado su experiencia como guerreras, las autoras plantean, algunas conclusiones preliminares en torno a dicha problemática.

  12. Ovine leptospirosis in Brazil

    Directory of Open Access Journals (Sweden)

    SB Lucheis

    2011-01-01

    Full Text Available Leptospirosis is a zoonosis distributed worldwide, endemic mainly in humid subtropical and tropical countries, with epidemic potential. It affects a range of both wild and domestic animals, including sheep, which transport leptospires in their urine and, therefore, can infect other animals and humans who deal with them. Therefore, leptospirosis is characterized as an occupational zoonosis. In individual herds leptospirosis can cause severe economic loss due to miscarriages and outbreaks of mastitis with a significant reduction of milk production. The disease is caused by Leptospira interrogans, which was reclassified into 13 pathogenic species, and distributed into more than 260 serovars classified into 23 serogroups. The clinical signs of infection may vary depending on the serovar and host. In maintenance hosts, antibody production is generally low; there are relatively mild signs of the disease, and a prolonged carrier state with organisms in the kidneys. In incidental hosts, the disease may be more severe, with high titers of circulating antibodies and a very short or nonexistent renal carrier state. In general, young animals with renal and hepatic failure have more serious infections than adults. Several diseases may produce symptoms similar to those of leptospirosis, so that laboratory confirmation, through microscopic agglutination test, for example, is required. The effectiveness of treatment depends on early diagnosis and appropriate therapy, depending on clinical features, since leptospirosis can develop into chronic liver disease and nephropathy, progressing towards death. Improvements in habitation and sanitary conditions, rodent control, vaccination, isolation and treatment of affected animals are the main measures for the control of leptospirosis.

  13. Survey of risk factors for the prevalence of leptospiral infection in horses of Gonbad area

    Directory of Open Access Journals (Sweden)

    omid jaheddashliboroun

    2013-08-01

    Full Text Available Leptospirosis is a world-wide zoonotic infection occurring in animals and humans. Rodents and wild animals are a major source of infection. Clinical signs in animals include fever, heamoglubinuria, jaundice, abortion, mastitis, reduced milk production, reproductive failure and death with periodic ophthalmia, abortion and stillbirths being among its important signs in horses. The main purpose of this study was to investigate the risk factors for the prevalence of leptospiral infection in horses of Gonbad area. This study was conducted on 200 horses in Gonbad area in Iran in order to determine seroprevalence of leptospiral infection. Sera were initially screened at dilution of 1:100 against 7 live serovars of Leptospira interrogans: Pomona, Canicola, Hardjo, Ballom, Icterohaemorrhagiae, AutomenalisandGrippotyphosausing themicroscopic agglutination test. The prevalence of leptospiral infection was 12% in horses. The majority of these infections were seen in horses that live in marsh and semi-marsh conditions and they accounted for 89% of positive samples. The highest number of reactors in horses (58.34% wasdue toserovarCanicola and 33.34% of positive samples were seen in horses with many rodents living in their environment.66.67% of positive samples were seen in horses that were kept In moist and semi moist stables. The highest number of positive samples were seen in 3 to 6 years old animals, in other words prevalence of this disease is raised with increase of age. So according to the results, increasing age, living in marsh environment, moist stable presence of infected dogs and rodents, in environment are some of risks factors for prevalence of leptospiral infection

  14. Determinación de anticuerpos contra patógenos virales y bacterianos seleccionados en la población de cerdos silvestres (Sus scrofa de la Reserva Natural Bahía Samborombón, Argentina

    Directory of Open Access Journals (Sweden)

    B. Carpinetti

    2017-06-01

    Full Text Available Los cerdos silvestres (Sus scrofa descienden de cruzamientos entre cerdos domésticos liberados durante la colonización con jabalíes salvajes euroasiáticos, liberados con propósitos cinegéticos. Son invasivos y su coexistencia con especies domésticas implica riesgos sanitarios. Argentina es considerada libre de fiebre aftosa (FA, peste porcina clásica (PPC y africana (PPA y síndrome reproductivo y respiratorio porcino (PRRS. La enfermedad de Aujeszky (EA y la leptospirosis son endémicas en ciertas áreas del país. El objetivo fue evaluar la presencia de ciertas enfermedades zoonóticas y/o de importancia para la producción animal y la conservación de la biodiversidad en cerdos silvestres de la Bahía de Samborombón. Se capturaron 118 animales. Se tomaron muestras de suero, tonsilas, músculo, intestino delgado, linfonódulos, entre otras. Se estudió la presencia de anticuerpos contra Brucella spp., coronavirus respiratorio porcino, virus de la estomatitis vesicular, de la FA, de la gastroenteritis transmisible porcina (TGEV, de la PPC, PPA, EA, PRRS y Leptospira spp. Se realizaron análisis bacteriológicos para Mycobacterium spp. Los resultados ratificaron la ausencia de las enfermedades exóticas e indicaron que 36 % de los animales presentó anticuerpos contra Leptospira interrogans serovar pomona y 62,5 % contra el virus de la EA. Estos resultados remarcan la importancia del monitoreo de la interfase productiva/silvestre en función de la salud pública, producción animal y conservación de la biodiversidad.

  15. Detection of pathogenic Leptospira species associated with phyllostomid bats (Mammalia: Chiroptera) from Veracruz, Mexico.

    Science.gov (United States)

    Ballados-González, G G; Sánchez-Montes, S; Romero-Salas, D; Colunga Salas, P; Gutiérrez-Molina, R; León-Paniagua, L; Becker, I; Méndez-Ojeda, M L; Barrientos-Salcedo, C; Serna-Lagunes, R; Cruz-Romero, A

    2018-06-01

    The genus Leptospira encompass 22 species of spirochaetes, with ten pathogenic species that have been recorded in more than 160 mammals worldwide. In the last two decades, the numbers of records of these agents associated with bats have increased exponentially, particularly in America. Although order Chiroptera represents the second most diverse order of mammals in Mexico, and leptospirosis represents a human and veterinary problem in the country, few studies have been conducted to identify potential wildlife reservoirs. The aim of this study was to detect the presence and diversity of Leptospira sp. in communities of bats in an endemic state of leptospirosis in Mexico. During January to September 2016, 81 bats of ten species from three localities of Veracruz, Mexico, were collected with mist nets. Kidney samples were obtained from all specimens. For the detection of Leptospira sp., we amplified several genes using specific primers. Amplicons of the expected size were submitted to sequencing, and sequences recovered were compared with those of reference deposited in GenBank using the BLAST tool. To identify their phylogenetic position, we realized a reconstruction using maximum-likelihood (ML) method. Twenty-five samples from three bat species (Artibeus lituratus, Choeroniscus godmani and Desmodus rotundus) showed the presence of Leptospira DNA. Sequences recovered were close to Leptospira noguchii, Leptospira weilii and Leptospira interrogans. Our results include the first record of Leptospira in bats from Mexico and exhibit a high diversity of these pathogens circulating in the state. Due to the finding of a large number of positive wild animals, it is necessary to implement a surveillance system in populations of the positive bats as well as in related species, in order to understand their role as carriers of this bacterial genus. © 2018 Blackwell Verlag GmbH.

  16. Diagnosis of canine leptospirosis by a highly sensitive FRET-PCR targeting the lig genes.

    Directory of Open Access Journals (Sweden)

    Chuanling Xu

    Full Text Available Canine leptospirosis is underdiagnosed due to its wide spectrum of clinical presentations and the lack of a rapid and sensitive test for the accurate diagnosis of acute and chronic infections. In this study, we developed a highly sensitive and specific fluorescence resonance energy transfer (FRET-PCR to detect common pathogenic leptospires in dogs, including Leptospira interrogans serovars Autumnalis, Canicola, Copenhageni (Icterohaemorrhagiae serogroup and Pomona, and Leptospira kirschneri serovar Grippotyphosa. This PCR targets the lig genes, exclusively found in the pathogenic Leptospira species but not in saprophytic species (L. biflexa. A robust, high-stringency step-down real-time platform was coupled to the highly specific detection of leptospiral DNA by fluorescently labeled FRET probes. This enabled the detection of a single copy of the lig gene in a PCR containing DNA from up to 50 µL canine blood or 400 µL urine. Sensitivity determination by use of limiting serial dilutions of extracted leptospiral DNA indicated that the lig FRET-PCR we established was almost 100-fold more sensitive than the widely accepted lipL32 SYBR assay and 10-fold more sensitive than a 16S rRNA TaqMan assay. Application of this method to 207 dogs with potential leptospiral infection enabled us to diagnose three cases of canine leptospirosis characterized by low amounts of leptospiral DNA in body fluids. Detection of canine leptospirosis with the lig FRET-PCR was more sensitive with the lig FRET-PCR than with the 16S rRNA TaqMan PCR, which detected only 2 of the 3 cases, and the lipL32 SYBR PCR, which detected none of the 3 dogs with leptospirosis.

  17. Ontologías de lo común en el pensamiento de Giorgio Agamben y Roberto Esposito: entre ética y política

    Directory of Open Access Journals (Sweden)

    Saidel, Matías

    2013-12-01

    Full Text Available This paper elaborates on Giorgio Agamben’s and Roberto Esposito’s thought on the Community. Both authors interrogate the Common from an impolitical perspective that tries to deconstruct the presuppositions of traditional metaphysics and political philosophy in order to create an affirmative conceptuality in ontological terms. In these authors predominates the recourse to the figure of the community, later considered in the horizon of biopolitics, since life becomes the center of both the power dispositives and today’s forms of political subjectification. The paper asks if these ontological approaches succeed in thinking the common politically or only in ethical terms.El presente trabajo reflexiona sobre el pensamiento de la comunidad en Giorgio Agamben y Roberto Esposito. Ambos interrogan lo común desde una perspectiva impolítica que intenta deconstruir los presupuestos de la metafísica y de la filosofía política tradicionales para poder elaborar una conceptualidad afirmativa en clave ontológica. En estos autores predomina el recurso a la figura de la comunidad, situada luego en el horizonte de la biopolítica, ya que la vida deviene el centro hacia el cual apuntarían los dispositivos de poder y las formas de subjetivación política actuales. El trabajo plantea como interrogante si estos abordajes ontológicos logran dar cuenta plenamente de lo común en términos políticos o sólo éticos.

  18. Regional differences of leptospirosis in Sri Lanka: observations from a flood-associated outbreak in 2011.

    Directory of Open Access Journals (Sweden)

    Suneth B Agampodi

    Full Text Available Leptospirosis is known to be an important cause of weather disaster-related infectious disease epidemics. In 2011, an outbreak of leptospirosis occurred in the relatively dry district of Anuradhapura, Sri Lanka where diagnosis was resisted by local practitioners because leptospirosis was not known in the area and the clinical presentation was considered atypical. To identify the causative Leptospira associated with this outbreak, we carried out a cross-sectional study. Consecutive clinically suspected cases in this district were studied during a two-and-a-half-month period. Of 96 clinically suspected cases, 32 (33.3% were confirmed by qPCR, of which the etiological cause in 26 cases was identified using 16S rDNA sequencing to the species level. Median bacterial load was 4.1 × 10(2/mL (inter-quartile range 3.1-6.1 × 10(2/mL. In contrast to a 2008 Sri Lankan leptospirosis outbreak in the districts of Kegalle, Kandy, and Matale, in which a predominance of Leptospira interrogans serovars Lai and Geyaweera was found, most cases in the 2011 outbreak were caused by Leptospira kirschneri. Seven (21.9% confirmed cases had acute renal failure; five (15.6% had myocarditis; severe thrombocytopenia (<20,000/uL was seen in five (15.6% cases. This outbreak of leptospirosis in the relatively dry zone of Sri Lanka due primarily to L. kirschneri was characterized by markedly different clinical presentations and low leptospiremia. These observations and data demonstrate the public health relevance of molecular diagnostics in such settings, possibly related to the microgeographic variations of different Leptospira species, but of particular value to public health intervention in what appears to have been a regionally neglected tropical disease.

  19. Human leptospirosis caused by a new, antigenically unique Leptospira associated with a Rattus species reservoir in the Peruvian Amazon.

    Directory of Open Access Journals (Sweden)

    Michael A Matthias

    2008-04-01

    Full Text Available As part of a prospective study of leptospirosis and biodiversity of Leptospira in the Peruvian Amazon, a new Leptospira species was isolated from humans with acute febrile illness. Field trapping identified this leptospire in peridomestic rats (Rattus norvegicus, six isolates; R. rattus, two isolates obtained in urban, peri-urban, and rural areas of the Iquitos region. Novelty of this species was proven by serological typing, 16S ribosomal RNA gene sequencing, pulsed-field gel electrophoresis, and DNA-DNA hybridization analysis. We have named this species "Leptospira licerasiae" serovar Varillal, and have determined that it is phylogenetically related to, but genetically distinct from, other intermediate Leptospira such as L. fainei and L. inadai. The type strain is serovar Varillal strain VAR 010(T, which has been deposited into internationally accessible culture collections. By microscopic agglutination test, "Leptospira licerasiae" serovar Varillal was antigenically distinct from all known serogroups of Leptospira except for low level cross-reaction with rabbit anti-L. fainei serovar Hurstbridge at a titer of 1:100. LipL32, although not detectable by PCR, was detectable in "Leptospira licerasiae" serovar Varillal by both Southern blot hybridization and Western immunoblot, although on immunoblot, the predicted protein was significantly smaller (27 kDa than that of L. interrogans and L. kirschneri (32 kDa. Isolation was rare from humans (2/45 Leptospira isolates from 881 febrile patients sampled, but high titers of MAT antibodies against "Leptospira licerasiae" serovar Varillal were common (30% among patients fulfilling serological criteria for acute leptospirosis in the Iquitos region, and uncommon (7% elsewhere in Peru. This new leptospiral species reflects Amazonian biodiversity and has evolved to become an important cause of leptospirosis in the Peruvian Amazon.

  20. A cross-sectional epidemiological study of domestic animals related to human leptospirosis cases in Nicaragua.

    Science.gov (United States)

    Flores, Byron J; Pérez-Sánchez, Tania; Fuertes, Héctor; Sheleby-Elías, Jessica; Múzquiz, José Luis; Jirón, William; Duttmann, Christianne; Halaihel, Nabil

    2017-06-01

    Leptospirosis is one of the most extended zoonosis worldwide and humans become infected most commonly through contact with the urine of carrier animals, either directly or via contaminated water or soil. The aim in this study was to analyse the epidemiological behaviour of Leptospira spp., from domestic animals around the sites of human leptospirosis cases in Nicaragua, from 2007 through 2013. We report the results of a cross-sectional epidemiological study with a non-probability sampling of blood (n=3050) and urine (n=299) from Domestic Animals (DA) around the sites of human leptospirosis cases in Nicaragua. We analysed data obtained through Microscopic Agglutination Test (MAT), in-vitro culture, real time PCR and sequencing of lfb1 locus. Frequencies of 30.31% (95% CI: 28.66-31.95) and 15.38% (95% CI: 11.12-19.64) were obtained from serological test and from in-vitro culture, respectively. Although similar frequencies from serology test (P≥0.05) were found in DA species, in-vitro culture frequencies were significantly higher from bovine, equine and sheep (P<0.05) in comparison with swine and canine species. Ten serogroups of pathogenic Leptospira spp. were encountered, with the highest presence of Icterohaemorrhagiae serogroup 34.65% (95% CI: 29.35-39.94). We identified 7 samples homologous to L. interrogans species Pyrogenes serovar and 3 samples as L. noguchii Louisiana or Panama serovars by analysis of lfb1 sequences. We were able to establish a temporal and spatial correlation from DA and cumulative incidence of human cases. Therefore an effective epidemiological surveillance should be implemented with a specific control program toward DA in order to reduce human leptospirosis incidence. Copyright © 2017 Elsevier B.V. All rights reserved.

  1. Epidemiology of Leptospirosis in Africa: A Systematic Review of a Neglected Zoonosis and a Paradigm for 'One Health' in Africa.

    Science.gov (United States)

    Allan, Kathryn J; Biggs, Holly M; Halliday, Jo E B; Kazwala, Rudovick R; Maro, Venance P; Cleaveland, Sarah; Crump, John A

    2015-01-01

    Leptospirosis is an important but neglected bacterial zoonosis that has been largely overlooked in Africa. In this systematic review, we aimed to summarise and compare current knowledge of: (1) the geographic distribution, prevalence, incidence and diversity of acute human leptospirosis in Africa; and (2) the geographic distribution, host range, prevalence and diversity of Leptospira spp. infection in animal hosts in Africa. Following Preferred Reporting Items for Systematic Reviews and Meta-analyses (PRISMA) guidelines, we searched for studies that described (1) acute human leptospirosis and (2) pathogenic Leptospira spp. infection in animals. We performed a literature search using eight international and regional databases for English and non-English articles published between January 1930 to October 2014 that met out pre-defined inclusion criteria and strict case definitions. We identified 97 studies that described acute human leptospirosis (n = 46) or animal Leptospira infection (n = 51) in 26 African countries. The prevalence of acute human leptospirosis ranged from 2 3% to 19 8% (n = 11) in hospital patients with febrile illness. Incidence estimates were largely restricted to the Indian Ocean islands (3 to 101 cases per 100,000 per year (n = 6)). Data from Tanzania indicate that human disease incidence is also high in mainland Africa (75 to 102 cases per 100,000 per year). Three major species (Leptospira borgpetersenii, L. interrogans and L. kirschneri) are predominant in reports from Africa and isolates from a diverse range of serogroups have been reported in human and animal infections. Cattle appear to be important hosts of a large number of Leptospira serogroups in Africa, but few data are available to allow comparison of Leptospira infection in linked human and animal populations. We advocate a 'One Health' approach to promote multidisciplinary research efforts to improve understanding of the animal to human transmission of leptospirosis on the African

  2. Assessment of clinical pathology and pathogen exposure in sea otters (Enhydra lutris) bordering the threatened population in Alaska

    Science.gov (United States)

    Goldstein, T.; Gill, V.A.; Tuomi, Pamela A.; Monson, Daniel H.; Burdin, A.; Conrad, P.A.; Dunn, J.L.; Field, C.; Johnson, Chad; Jessup, David A.; Bodkin, J.; Doroff, A.M.

    2011-01-01

    Northern sea otter (Enhydra lutris kenyoni) abundance has decreased dramatically over portions of southwest Alaska, USA, since the mid-1980s, and this stock is currently listed as threatened under the Endangered Species Act. In contrast, adjacent populations in south central Alaska, USA, and Russia have been stable to increasing during the same period. Sea otters bordering the area classified in the recent decline were live-captured during 2004–2006 at Bering Island, Russia, and the Kodiak Archipelago, Alaska, USA, to evaluate differences in general health and current exposure status to marine and terrestrial pathogens. Although body condition was lower in animals captured at Bering Island, Russia, than it was at Kodiak, USA, clinical pathology values did not reveal differences in general health between the two regions. Low prevalences of antibodies (>5%) were found in Kodiak, USA, and on Bering Island, Russia, to Toxoplasma gondii, Sarcocystis neurona, and Leptospira interrogans. Exposure to phocine herpesvirus-1 was found in both Kodiak, USA (15.2%), and Bering Island, Russia (2.3%). Antibodies to Brucella spp. were found in 28% of the otters tested on Bering Island, Russia, compared with only 2.7% of the samples from Kodiak, USA. Prevalence of exposure to Phocine distemper virus (PDV) was 41% in Kodiak, USA, but 0% on Bering Island, Russia. Archived sera from southwest and south-central Alaska dating back to 1989 were negative for PDV, indicating exposure occurred in sea otters in Kodiak, USA, in recent years. Because PDV can be highly pathogenic in naïve and susceptible marine mammal populations, tissues should be examined to explore the contribution of this virus to otter deaths. Our results reveal an increase in exposure to pathogens in sea otters in Kodiak, Alaska, USA, since the 1990s.

  3. Household transmission of leptospira infection in urban slum communities.

    Directory of Open Access Journals (Sweden)

    Elves A P Maciel

    2008-01-01

    Full Text Available Leptospirosis, a spirochaetal zoonotic disease, is the cause of epidemics associated with high mortality in urban slum communities. Infection with pathogenic Leptospira occurs during environmental exposures and is traditionally associated with occupational risk activities. However, slum inhabitants reside in close proximity to environmental sources of contamination, suggesting that transmission during urban epidemics occurs in the household environment.A survey was performed to determine whether Leptospira infection clustered within households located in slum communities in the city of Salvador, Brazil. Hospital-based surveillance identified 89 confirmed cases of leptospirosis during an outbreak. Serum samples were obtained from members of 22 households with index cases of leptospirosis and 52 control households located in the same slum communities. The presence of anti-Leptospira agglutinating antibodies was used as a marker for previous infection. In households with index cases, 22 (30% of 74 members had anti-Leptospira antibodies, whereas 16 (8% of 195 members from control households had anti-Leptospira antibodies. Highest titres were directed against L. interrogans serovars of the Icterohaemorrhagiae serogroup in 95% and 100% of the subjects with agglutinating antibodies from case and control households, respectively. Residence in a household with an index case of leptospirosis was associated with increased risk (OR 5.29, 95% CI 2.13-13.12 of having had a Leptospira infection. Increased infection risk was found for all age groups who resided in a household with an index case, including children <15 years of age (P = 0.008.This study identified significant household clustering of Leptospira infection in slum communities where recurrent epidemics of leptospirosis occur. The findings support the hypothesis that the household environment is an important transmission determinant in the urban slum setting. Prevention therefore needs to target

  4. Differences among children, adolescents and adults with severe leptospirosis: A comparative analysis

    Directory of Open Access Journals (Sweden)

    E F Daher

    2014-01-01

    Full Text Available Leptospirosis is a zoonosis of global importance caused by Leptospira interrogans. The aim of this study was to compare the data between children, adolescents and adults with leptospirosis. This is a retrospective study including a total of 373 consecutive patients with leptospirosis, admitted to tertiary hospitals in Northeast of Brazil, from May 1985 to August 2010. The patients were divided into two groups (age ≤21 years and >21 years. The adults were 304 (81.5% of the population, with a mean ge of 41 ± 13 (range 22-84 years. The pediatric group was 16 ± 3 (range 9-21 years. Signs and symptoms where similar between the groups, excepting arrhythmia, which was more frequent in adults and vomiting, more common in children (16% vs. 0%, P = 0.04 and 65% vs. 79%, P = 0.02, respectively. Adult group presented with higher serum urea (137 vs. 97 mg/dl, P = 0.002 and creatinine (4.3 vs. 3.0 mg/dl, P = 0.007. Acute kidney injury (AKI was observed in 80%, mainly in adults (83% vs. 70% P < 0.005. Adults required renal replacement therapy more frequently than children (38% vs. 11%, P < 0.0001. Mortality was higher in adults (14.8% vs. 2.8%, P = 0.005 and in adults with AKI (93% vs. 7%, P < 0.05. There are important differences between the adults and children with leptospirosis. AKI was more frequent in adults and it was associated with increased mortality.

  5. Genomic survey and expression analysis of DNA repair genes in the genus Leptospira.

    Science.gov (United States)

    Martins-Pinheiro, Marinalva; Schons-Fonseca, Luciane; da Silva, Josefa B; Domingos, Renan H; Momo, Leonardo Hiroyuki Santos; Simões, Ana Carolina Quirino; Ho, Paulo Lee; da Costa, Renata M A

    2016-04-01

    Leptospirosis is an emerging zoonosis with important economic and public health consequences and is caused by pathogenic leptospires. The genus Leptospira belongs to the order Spirochaetales and comprises saprophytic (L. biflexa), pathogenic (L. interrogans) and host-dependent (L. borgpetersenii) members. Here, we present an in silico search for DNA repair pathways in Leptospira spp. The relevance of such DNA repair pathways was assessed through the identification of mRNA levels of some genes during infection in animal model and after exposition to spleen cells. The search was performed by comparison of available Leptospira spp. genomes in public databases with known DNA repair-related genes. Leptospires exhibit some distinct and unexpected characteristics, for instance the existence of a redundant mechanism for repairing a chemically diverse spectrum of alkylated nucleobases, a new mutS-like gene and a new shorter version of uvrD. Leptospira spp. shares some characteristics from Gram-positive, as the presence of PcrA, two RecQ paralogs and two SSB proteins; the latter is considered a feature shared by naturally competent bacteria. We did not find a significant reduction in the number of DNA repair-related genes in both pathogenic and host-dependent species. Pathogenic leptospires were enriched for genes dedicated to base excision repair and non-homologous end joining. Their evolutionary history reveals a remarkable importance of lateral gene transfer events for the evolution of the genus. Up-regulation of specific DNA repair genes, including components of SOS regulon, during infection in animal model validates the critical role of DNA repair mechanisms for the complex interplay between host/pathogen.

  6. Neutrophil Extracellular Traps are Involved in the Innate Immune Response to Infection with Leptospira

    Science.gov (United States)

    Scharrig, Emilia; Carestia, Agostina; Ferrer, María F.; Cédola, Maia; Pretre, Gabriela; Drut, Ricardo; Picardeau, Mathieu; Schattner, Mirta; Gómez, Ricardo M.

    2015-01-01

    NETosis is a process by which neutrophils extrude their DNA together with bactericidal proteins that trap and/or kill pathogens. In the present study, we evaluated the ability of Leptospira spp. to induce NETosis using human ex vivo and murine in vivo models. Microscopy and fluorometric studies showed that incubation of human neutrophils with Leptospira interrogans serovar Copenhageni strain Fiocruz L1-130 (LIC) resulted in the release of DNA extracellular traps (NETs). The bacteria number, pathogenicity and viability were relevant factors for induction of NETs, but bacteria motility was not. Entrapment of LIC in the NETs resulted in LIC death; however, pathogenic but not saprophytic Leptospira sp. exerted nuclease activity and degraded DNA. Mice infected with LIC showed circulating NETs after 2 days post-infection (dpi). Depletion of neutrophils with mAb1A8 significantly reduced the amount of intravascular NETs in LIC-infected mice, increasing bacteremia at 3 dpi. Although there was a low bacterial burden, scarce neutrophils and an absence of inflammation in the early stages of infection in the kidney and liver, at the beginning of the leptospiruric phase, the bacterial burden was significantly higher in kidneys of neutrophil-depleted-mice compared to non-depleted and infected mice. Surprisingly, interstitial nephritis was of similar intensity in both groups of infected mice. Taken together, these data suggest that LIC triggers NETs, and that the intravascular formation of these DNA traps appears to be critical not only to prevent early leptospiral dissemination but also to preclude further bacterial burden. PMID:26161745

  7. High Leptospira Diversity in Animals and Humans Complicates the Search for Common Reservoirs of Human Disease in Rural Ecuador.

    Science.gov (United States)

    Barragan, Veronica; Chiriboga, Jorge; Miller, Erin; Olivas, Sonora; Birdsell, Dawn; Hepp, Crystal; Hornstra, Heidie; Schupp, James M; Morales, Melba; Gonzalez, Manuel; Reyes, Soraya; de la Cruz, Carmen; Keim, Paul; Hartskeerl, Rudy; Trueba, Gabriel; Pearson, Talima

    2016-09-01

    Leptospirosis is a zoonotic disease responsible for high morbidity around the world, especially in tropical and low income countries. Rats are thought to be the main vector of human leptospirosis in urban settings. However, differences between urban and low-income rural communities provide additional insights into the epidemiology of the disease. Our study was conducted in two low-income rural communities near the coast of Ecuador. We detected and characterized infectious leptospira DNA in a wide variety of samples using new real time quantitative PCR assays and amplicon sequencing. We detected infectious leptospira in a high percentage of febrile patients (14.7%). In contrast to previous studies on leptospirosis risk factors, higher positivity was not found in rats (3.0%) but rather in cows (35.8%) and pigs (21.1%). Six leptospira species were identified (L. borgpetersenii, L kirschnerii, L santarosai, L. interrogans, L noguchii, and an intermediate species within the L. licerasiae and L. wolffii clade) and no significant differences in the species of leptospira present in each animal species was detected (χ2 = 9.89, adj.p-value = 0.27). A large portion of the world's human population lives in low-income, rural communities, however, there is limited information about leptospirosis transmission dynamics in these settings. In these areas, exposure to peridomestic livestock is particularly common and high prevalence of infectious leptospira in cows and pigs suggest that they may be the most important reservoir for human transmission. Genotyping clinical samples show that multiple species of leptospira are involved in human disease. As these genotypes were also detected in samples from a variety of animals, genotype data must be used in conjunction with epidemiological data to provide evidence of transmission and the importance of different potential leptospirosis reservoirs.

  8. Distribution and Diversity of Pathogenic Leptospira Species in Peri-domestic Surface Waters from South Central Chile.

    Science.gov (United States)

    Mason, Meghan R; Encina, Carolina; Sreevatsan, Srinand; Muñoz-Zanzi, Claudia

    2016-08-01

    Leptospirosis is a neglected zoonosis affecting animals and humans caused by infection with Leptospira. The bacteria can survive outside of hosts for long periods of time in soil and water. While identification of Leptospira species from human cases and animal reservoirs are increasingly reported, little is known about the diversity of pathogenic Leptospira species in the environment and how surveillance of the environment might be used for monitoring and controlling disease. Water samples (n = 104) were collected from the peri-domestic environment of 422 households from farms, rural villages, and urban slums participating in a broader study on the eco-epidemiology of leptospirosis in the Los Rios Region, Chile, between October 2010 and April 2012. The secY region of samples, previously detected as pathogenic Leptospira by PCR, was amplified and sequenced. Sequences were aligned using ClustalW in MEGA, and a minimum spanning tree was created in PHYLOViZ using the goeBURST algorithm to assess sequence similarity. Sequences from four clinical isolates, 17 rodents, and 20 reference strains were also included in the analysis. Overall, water samples contained L. interrogans, L. kirschneri, and L. weilii, with descending frequency. All species were found in each community type. The distribution of the species differed by the season in which the water samples were obtained. There was no evidence that community-level prevalence of Leptospira in dogs, rodents, or livestock influenced pathogen diversity in the water samples. This study reports the presence of pathogenic Leptospira in the peri-domestic environment of households in three community types and the differences in Leptospira diversity at the community level. Systematic environmental surveillance of Leptospira can be used for detecting changes in pathogen diversity and to identify and monitor contaminated areas where an increased risk of human infection exists.

  9. Human leptospirosis in Seychelles: A prospective study confirms the heavy burden of the disease but suggests that rats are not the main reservoir.

    Directory of Open Access Journals (Sweden)

    Leon Biscornet

    2017-08-01

    Full Text Available Leptospirosis is a bacterial zoonosis caused by pathogenic Leptospira for which rats are considered as the main reservoir. Disease incidence is higher in tropical countries, especially in insular ecosystems. Our objectives were to determine the current burden of leptospirosis in Seychelles, a country ranking first worldwide according to historical data, to establish epidemiological links between animal reservoirs and human disease, and to identify drivers of transmission.A total of 223 patients with acute febrile symptoms of unknown origin were enrolled in a 12-months prospective study and tested for leptospirosis through real-time PCR, IgM ELISA and MAT. In addition, 739 rats trapped throughout the main island were investigated for Leptospira renal carriage. All molecularly confirmed positive samples were further genotyped.A total of 51 patients fulfilled the biological criteria of acute leptospirosis, corresponding to an annual incidence of 54.6 (95% CI 40.7-71.8 per 100,000 inhabitants. Leptospira carriage in Rattus spp. was overall low (7.7% but dramatically higher in Rattus norvegicus (52.9% than in Rattus rattus (4.4%. Leptospira interrogans was the only detected species in both humans and rats, and was represented by three distinct Sequence Types (STs. Two were novel STs identified in two thirds of acute human cases while noteworthily absent from rats.This study shows that human leptospirosis still represents a heavy disease burden in Seychelles. Genotype data suggests that rats are actually not the main reservoir for human disease. We highlight a rather limited efficacy of preventive measures so far implemented in Seychelles. This could result from ineffective control measures of excreting animal populations, possibly due to a misidentification of the main contaminating reservoir(s. Altogether, presented data stimulate the exploration of alternative reservoir animal hosts.

  10. Doxycycline Attenuates Leptospira-Induced IL-1β by Suppressing NLRP3 Inflammasome Priming

    Science.gov (United States)

    Zhang, Wenlong; Xie, Xufeng; Wu, Dianjun; Jin, Xuemin; Liu, Runxia; Hu, Xiaoyu; Fu, Yunhe; Ding, Zhuang; Zhang, Naisheng; Cao, Yongguo

    2017-01-01

    Doxycycline (Dox), a semisynthetic antibiotic, has been reported to exert multiple immunomodulatory effects. Treatment with Dox has a satisfactory curative effect against leptospirosis. In addition to its antibacterial action, we supposed that Dox also modulated immune response in controlling leptospira infection. Using J774A.1 mouse macrophages, the effects of Dox on protein and mRNA levels of IL-1β and TNF-α were investigated after infection with live or sonicated Leptospira interrogans serovar Lai strain Lai (56601). Specifically, the level of IL-1β but not TNF-α was sharply decreased when treated with Dox in leptospira-infected macrophages. Western blot analysis showed that Dox suppressed the activation of leptospira-induced MAPK and NF-κB signaling pathways. Using NLRP3-deficient and NLRC4-deficient mice, the data showed that the expression of leptospira-induced IL-1β was mainly dependent on the presence of NLRP3 inflammasome in macrophages. Meanwhile, Dox suppressed leptospira-induced NLRP3 inflammasome priming with the upregulation of the Na/K-ATPase Pump β1 subunit. The inhibition effect of Dox on IL-1β was also conspicuous in cells with lipopolysaccharide and ATP stimulation. These results were confirmed in vivo, as peritoneal fluids of mice and organs of hamsters expressed less IL-1β after treatment of leptospiral infection with Dox. Our results indicated that Dox also modulated immune response to attenuate leptospira-induced IL-1β by suppressing p38, JNK, p65, and NLRP3 inflammasome priming. PMID:28791016

  11. Molecular Survey of Bacterial Zoonotic Agents in Bats from the Country of Georgia (Caucasus.

    Directory of Open Access Journals (Sweden)

    Ying Bai

    Full Text Available Bats are important reservoirs for many zoonotic pathogens. However, no surveys of bacterial pathogens in bats have been performed in the Caucasus region. To understand the occurrence and distribution of bacterial infections in these mammals, 218 bats belonging to eight species collected from four regions of Georgia were examined for Bartonella, Brucella, Leptospira, and Yersinia using molecular approaches. Bartonella DNA was detected in 77 (35% bats from all eight species and was distributed in all four regions. The prevalence ranged 6-50% per bat species. The Bartonella DNA represented 25 unique genetic variants that clustered into 21 lineages. Brucella DNA was detected in two Miniopterus schreibersii bats and in two Myotis blythii bats, all of which were from Imereti (west-central region. Leptospira DNA was detected in 25 (13% bats that included four M. schreibersii bats and 21 M. blythii bats collected from two regions. The Leptospira sequences represented five genetic variants with one of them being closely related to the zoonotic pathogen L. interrogans (98.6% genetic identity. No Yersinia DNA was detected in the bats. Mixed infections were observed in several cases. One M. blythii bat and one M. schreibersii bat were co-infected with Bartonella, Brucella, and Leptospira; one M. blythii bat and one M. schreibersii bat were co-infected with Bartonella and Brucella; 15 M. blythii bats and three M. schreibersii bats were co-infected with Bartonella and Leptospira. Our results suggest that bats in Georgia are exposed to multiple bacterial infections. Further studies are needed to evaluate pathogenicity of these agents to bats and their zoonotic potential.

  12. Experiencias de guerra desde la voz de las mujeres

    Directory of Open Access Journals (Sweden)

    Elsa Bair

    2003-10-01

    Full Text Available El artículo recoge algunas reflexiones en torno al trabajo de campo realizado con mujeres excombatientes de diversos grupos armados colombianos en el marco de la investigación Mujeres en tiempos de guerra: una mirada a lo femenino en el contexto de los grupos armados colombianos. A partir de una concepción de la guerra como construcción cultural, las autoras interrogan los efectos de la misma sobre su identidad femenina, esto es, lo que la guerra ha representado para ellas como mujeres y los efectos que ha tenido en términos de su identidad genérica. Tras una reflexión inicial en torno a los desafíos éticos planteados por el trabajo de campo, las autoras abordan la problemática de la identidad de género a través de dos vías: por una parte, los campos o “nudos” temáticos que amarran las narraciones de las mujeres entrevistadas –la familia, la maternidad y los hijos, las relaciones con los “otros”, las experiencias de muerte y el dolor de la guerra-; y por otra parte, la forma particular en que ellas construyen sus relatos sobre su experiencia como combatientes. Por último, a partir de esa mirada analítica sobre la manera como estas mujeres han vivido y significado su experiencia como guerreras, las autoras plantean algunas conclusiones preliminares en torno a dicha problemática.

  13. Doxycycline Attenuates Leptospira-Induced IL-1β by Suppressing NLRP3 Inflammasome Priming.

    Science.gov (United States)

    Zhang, Wenlong; Xie, Xufeng; Wu, Dianjun; Jin, Xuemin; Liu, Runxia; Hu, Xiaoyu; Fu, Yunhe; Ding, Zhuang; Zhang, Naisheng; Cao, Yongguo

    2017-01-01

    Doxycycline (Dox), a semisynthetic antibiotic, has been reported to exert multiple immunomodulatory effects. Treatment with Dox has a satisfactory curative effect against leptospirosis. In addition to its antibacterial action, we supposed that Dox also modulated immune response in controlling leptospira infection. Using J774A.1 mouse macrophages, the effects of Dox on protein and mRNA levels of IL-1β and TNF-α were investigated after infection with live or sonicated Leptospira interrogans serovar Lai strain Lai (56601). Specifically, the level of IL-1β but not TNF-α was sharply decreased when treated with Dox in leptospira-infected macrophages. Western blot analysis showed that Dox suppressed the activation of leptospira-induced MAPK and NF-κB signaling pathways. Using NLRP3-deficient and NLRC4-deficient mice, the data showed that the expression of leptospira-induced IL-1β was mainly dependent on the presence of NLRP3 inflammasome in macrophages. Meanwhile, Dox suppressed leptospira-induced NLRP3 inflammasome priming with the upregulation of the Na/K-ATPase Pump β1 subunit. The inhibition effect of Dox on IL-1β was also conspicuous in cells with lipopolysaccharide and ATP stimulation. These results were confirmed in vivo , as peritoneal fluids of mice and organs of hamsters expressed less IL-1β after treatment of leptospiral infection with Dox. Our results indicated that Dox also modulated immune response to attenuate leptospira-induced IL-1β by suppressing p38, JNK, p65, and NLRP3 inflammasome priming.

  14. Specialized microbial databases for inductive exploration of microbial genome sequences

    Directory of Open Access Journals (Sweden)

    Cabau Cédric

    2005-02-01

    Full Text Available Abstract Background The enormous amount of genome sequence data asks for user-oriented databases to manage sequences and annotations. Queries must include search tools permitting function identification through exploration of related objects. Methods The GenoList package for collecting and mining microbial genome databases has been rewritten using MySQL as the database management system. Functions that were not available in MySQL, such as nested subquery, have been implemented. Results Inductive reasoning in the study of genomes starts from "islands of knowledge", centered around genes with some known background. With this concept of "neighborhood" in mind, a modified version of the GenoList structure has been used for organizing sequence data from prokaryotic genomes of particular interest in China. GenoChore http://bioinfo.hku.hk/genochore.html, a set of 17 specialized end-user-oriented microbial databases (including one instance of Microsporidia, Encephalitozoon cuniculi, a member of Eukarya has been made publicly available. These databases allow the user to browse genome sequence and annotation data using standard queries. In addition they provide a weekly update of searches against the world-wide protein sequences data libraries, allowing one to monitor annotation updates on genes of interest. Finally, they allow users to search for patterns in DNA or protein sequences, taking into account a clustering of genes into formal operons, as well as providing extra facilities to query sequences using predefined sequence patterns. Conclusion This growing set of specialized microbial databases organize data created by the first Chinese bacterial genome programs (ThermaList, Thermoanaerobacter tencongensis, LeptoList, with two different genomes of Leptospira interrogans and SepiList, Staphylococcus epidermidis associated to related organisms for comparison.

  15. Psicología, bioética y narrativa cinematográfica: un análisis cualitativo de producciones de estudiantes sobre conflictos bioéticos relacionados con la identidad

    Directory of Open Access Journals (Sweden)

    Irene Cambra Badii

    2016-01-01

    Full Text Available En la actualidad, llegan a un público masivo series televisivas en las que se despliegan dilemas bioéticos de la práctica de los profesionales de la salud. En este artículo se analiza cómo ven estudiantes de grado distintas situaciones dilemáticas, sin conocimientos previos; además, se interrogan en las elaboraciones de los estudiantes la cuestión de la identidad en relación con la dimensión genética y simbólica. A través de un enfoque cualitativo y siguiendo la GroundedTheory para el análisis discursivo, realizamos dos etapas de trabajo: , primero, los estudiantes elaboraron escritos sobre la totalidad de los episodios de la serie House; segundo, un grupo focal trabajó con un episodio a fines de indagar si reconocían una situación de ocultamiento filiatorio, y qué proponían que debía hacer el profesional. Todos los escritos de los estudiantes coinciden en su profundidad con base a un material concreto de pocos minutos de duración, aun sin contar con conocimientos previos. En cuanto a la cuestión filiatoria, el trabajo fue complejo ya que la perspectiva psicológica y biomédica entran en conflicto. Así pues, la narrativa cinematográfica incluye la dimensión subjetiva y nos permite abordar situaciones de modo complejo; actúa no solo como estrategia didáctica, sino también como productora de aprendizajes nuevos.

  16. Stroke in central nervous system infections

    Directory of Open Access Journals (Sweden)

    Carod-Artal Francisco

    2008-01-01

    Full Text Available Background: Stroke subtypes and etiology may differ between developing and developed countries. Infections are a relatively common cause of stroke in tropical regions. Objective: To review the main infectious diseases associated with stroke. Discussion: Prevalence of stroke in HIV patients is around 1%. Pathogenic mechanisms include HIV vasculopathy, vasculitis, cardioembolism, acquired hypercoagulability, and the effect of opportunistic infections. Treatment with protease inhibitors has been associated with premature atherosclerotic vascular disease. Emerging viral infections that are associated with stroke include viral hemorrhagic fevers, Japanese encephalitis, dengue, and West Nile virus. Vasculitis involving perforating vessels of the brain is a cerebrovascular complication of tuberculous meningitis. Small, medium, and large arteries of the anterior circulation can be involved. A progressive intracranial arteriopathy after Leptospira interrogans infection has been described, which involves the large intracranial arteries. Cerebrovascular complications of mycosis are associated with large vessel vasculitis, direct vessel damage by invasion or embolization, and subarachnoid hemorrhage due to mycotic aneurysm rupture. Pathological findings of cerebral malaria include diffuse cerebral edema, perivascular ring hemorrhages, white matter necrosis, parenchyma petechial hemorrhages, occlusion of brain vessels, and sequestration of infected erythrocytes in cortical and perforating arteries. Stroke can occur in subarachnoid neurocysticercosis and the lesions in such cases consist mostly of deep lacunar infarctions resulting from endarteritis of small penetrating arteries. Cardiac arrhythmias, congestive heart failure, apical aneurysm, and mural thrombus are the conditions that predispose patients with American trypanosomiasis to cardioembolism. Gnathostoma spinigerum infestation is a cause of hemorrhagic stroke in Asia. Conclusion: Infectious and

  17. Prueba de Elisa indirecta para la detección de anticuerpos IgM para el diagnóstico de Leptospirosis humana

    Directory of Open Access Journals (Sweden)

    Manuel Céspedes Z

    2002-01-01

    Full Text Available Para el diagnóstico temprano de enfermedades con cuadro clínico inespecífico como la leptospirosis, es necesario la confirmación laboratorial mediante pruebas específicas, con la finalidad de que el diagnóstico sea más acertado y rápido. Objetivo: se realizó un estudio comparativo entre la prueba de microaglutinacion (MAT y la prueba de ELISA indirecta estandarizada con un "pool" de antígenos de Leptospira interrogans, para la detección de anticuerpos IgM, en muestras de suero de fase aguda de leptospirosis humana. Materiales y métodos: 40 muestras de pacientes con sospecha clínica y con títulos de 1:100-1:12800 por la prueba de MAT, 80 muestras negativas de pacientes aparentemente sanos con enfermedades como Brucelosis, Sífilis, Tifus murino, Hepatitis B, Fiebre Amarilla, Dengue y Enfermedad de Carrión fueron evaluados por ELISA IgM. Resultados: se obtuvo una sensibilidad de 97,5% y especificidad de 98,75%, no observándose reacción cruzada con otras enfermedades. Conclusión: ELISA IgM validado en el laboratorio es suficiente sensible, específico y de fácil aplicación para el uso como prueba de tamizaje en una infección por Leptospiras con la subsecuente confirmación por MAT.

  18. Structures of Pseudomonas aeruginosa LpxA Reveal the Basis for Its Substrate Selectivity.

    Science.gov (United States)

    Smith, Emmanuel W; Zhang, XiuJun; Behzadi, Cyrus; Andrews, Logan D; Cohen, Frederick; Chen, Yu

    2015-09-29

    In Gram-negative bacteria, the first step of lipid A biosynthesis is catalyzed by UDP-N-acetylglucosamine acyltransferase (LpxA) through the transfer of a R-3-hydroxyacyl chain from the acyl carrier protein (ACP) to the 3-hydroxyl group of UDP-GlcNAc. Previous studies suggest that LpxA is a critical determinant of the acyl chain length found in lipid A, which varies among species of bacteria. In Escherichia coli and Leptospira interrogans, LpxA prefers to incorporate longer R-3-hydroxyacyl chains (C14 and C12, respectively), whereas in Pseudomonas aeruginosa, the enzyme is selective for R-3-hydroxydecanoyl, a 10-hydrocarbon long acyl chain. We now report three P. aeruginosa LpxA crystal structures: apo protein, substrate complex with UDP-GlcNAc, and product complex with UDP-3-O-(R-3-hydroxydecanoyl)-GlcNAc. A comparison between the apo form and complexes identifies key residues that position UDP-GlcNAc appropriately for catalysis and supports the role of catalytic His121 in activating the UDP-GlcNAc 3-hydroxyl group for nucleophilic attack during the reaction. The product-complex structure, for the first time, offers structural insights into how Met169 serves to constrain the length of the acyl chain and thus functions as the so-called hydrocarbon ruler. Furthermore, compared with ortholog LpxA structures, the purported oxyanion hole, formed by the backbone amide group of Gly139, displays a different conformation in P. aeruginosa LpxA, which suggests flexibility of this structural feature important for catalysis and the potential need for substrate-induced conformational change in catalysis. Taken together, the three structures provide valuable insights into P. aeruginosa LpxA catalysis and substrate specificity as well as templates for future inhibitor discovery.

  19. An Extended Multilocus Sequence Typing (MLST Scheme for Rapid Direct Typing of Leptospira from Clinical Samples.

    Directory of Open Access Journals (Sweden)

    Sabrina Weiss

    2016-09-01

    Full Text Available Rapid typing of Leptospira is currently impaired by requiring time consuming culture of leptospires. The objective of this study was to develop an assay that provides multilocus sequence typing (MLST data direct from patient specimens while minimising costs for subsequent sequencing.An existing PCR based MLST scheme was modified by designing nested primers including anchors for facilitated subsequent sequencing. The assay was applied to various specimen types from patients diagnosed with leptospirosis between 2014 and 2015 in the United Kingdom (UK and the Lao Peoples Democratic Republic (Lao PDR. Of 44 clinical samples (23 serum, 6 whole blood, 3 buffy coat, 12 urine PCR positive for pathogenic Leptospira spp. at least one allele was amplified in 22 samples (50% and used for phylogenetic inference. Full allelic profiles were obtained from ten specimens, representing all sample types (23%. No nonspecific amplicons were observed in any of the samples. Of twelve PCR positive urine specimens three gave full allelic profiles (25% and two a partial profile. Phylogenetic analysis allowed for species assignment. The predominant species detected was L. interrogans (10/14 and 7/8 from UK and Lao PDR, respectively. All other species were detected in samples from only one country (Lao PDR: L. borgpetersenii [1/8]; UK: L. kirschneri [1/14], L. santarosai [1/14], L. weilii [2/14].Typing information of pathogenic Leptospira spp. was obtained directly from a variety of clinical samples using a modified MLST assay. This assay negates the need for time-consuming culture of Leptospira prior to typing and will be of use both in surveillance, as single alleles enable species determination, and outbreaks for the rapid identification of clusters.

  20. Brote de legionelosis asociado a un balneario Legionella outbreak at a spa

    Directory of Open Access Journals (Sweden)

    E. Serrano Ibarbia

    2001-06-01

    Full Text Available En 1998 el inicio de la temporada de actividad de un balneario en Gipuzkoa coincidió con la detección de un brote de legionelosis asociado al mismo, lo cual condujo al cierre de la instalación y al estudio epidemiológico -casos y controles- y ambiental oportunos. Se definió como caso toda persona que durante su estancia en el balneario o durante los 10 días siguientes presentará neumonía o un cuadro febril compatible con fiebre de Pontiac.El estudio ambiental incluyó la inspección del balneario y entorno y muestreos de los sistemas sanitarios de agua y de los elementos de hidroterapia.De las 287 personas encuestadas de la Comunidad Autónoma Vasca, el 12.5% cumplían con la definición de caso; 9 casos presentaron neumonía y 26 fiebre de Pontiac. La curva epidémica se inició el 7 de mayo, alcanzando un pico los días 14 y 15 de mayo y finalizando el día 20. El riesgo de enfermar ajustado por edad, sexo y consumo de tabaco se asoció con la duración de la estancia en el balneario (OR=118.5, 95% I.C: 18.7-750.2 y con el uso de una piscina (OR=10.5, 95% I.C: 1.3-82.6. Se detecto L. pneumophila serogrupo1 en recuentos superiores a 103 ufc/l en diversos puntos de la red de hidroterapia y en la ducha de la habitación de uno de los enfermos. El análisis por electroforesis en campos pulsados de una muestra biológica y muestras ambientales permitió la confirmación genotípica. El establecimiento se abrió al público tras realizar un tratamiento de choque y comprobar que transcurridos 15 días no se detectó L. pneumophila en las muestras ambientales.The start of seasonal activity at a spa in Guipuzcoa coincided with the detection of an associated legionnaire outbreak in 1998. This led to the closure of the premises and to the carrying out of opportune environmental and epidemiological studies. The latter included case-control study. A case was defined as a person who, either during his stay or in a period of 10 days thereafter

  1. Detección y caracterización de Escherichia coli productor de toxina Shiga a partir de casos clínicos y de alimentos en Uruguay Detection and characterization of Shiga toxin - producing Escherichia coli from clinical cases and food in Uruguay

    Directory of Open Access Journals (Sweden)

    G. Varela

    2008-06-01

    Full Text Available Establecimos la frecuencia de aislamiento de Escherichia coli productor de toxina Shiga (STEC a partir de muestras clínicas y de alimentos, así como las características fenotípicas y genotípicas de las cepas recuperadas. Se analizaron 198 muestras fecales de niños con diarrea sanguinolenta (DS, 14 muestras fecales de niños con síndrome urémico hemolítico (SUH y 220 muestras de carne picada. También se estudiaron 4 cepas STEC aisladas de alimentos embutidos. Se recuperó STEC de 3 (1,5% de los niños con DS, de 1 (7% niño con SUH y de 4 (1,8% de las muestras de carne picada. Todas las cepas fueron eae y ehxA positivas. Los serotipos detectados fueron: O157:H7 (9 cepas, O26:H11 (2 cepas, O111:NM (1 cepa y O145:HNT (1 cepa. Todas las cepas O157:H7 portaron el subtipo eae-g1; las cepas O26:H11 y O145:HNT portaron el subtipo eae-b1 y la cepa O111:NM portó el subtipo eae-g2/q. Las cepas STEC del mismo serogrupo mostraron alta diversidad genética. En Uruguay STEC no sería agente frecuente de diarrea con sangre en niños. Sin embargo, las cepas recuperadas presentaron los genes asociados con enfermedad severa y 2 de los 3 niños infectados con STEC evolucionaron a SUH. La carne picada y otros alimentos serían vehículos importantes de O157:H7.We have assessed the frequency of Shiga toxin-producing Escherichia coli (STEC in clinical and food samples as well as studied the genotypic and phenotypic characteristics of the recovered strains. One hundred ninety eight fecal samples from children with bloody diarrhea (BD, 14 from children with hemolytic uremic syndrome (HUS, 220 ground beef samples and 4 STEC isolates from other beef-derived products were analyzed. The STEC strains were isolated from 3 (1.5% children with bloody diarrhea, 1 (7% from a child with HUS and 4 (1.8% from ground beef samples. All strains were eae and ehxA positive. The serotypes found were: O157:H7 (9 strains, O26:H11 (2, O111: NM (1 and O145:HNT (1. All O157:H7 STEC

  2. Neumonía aguda de la comunidad y hemorragia pulmonar por leptospirosis en el área metropolitana Buenos Aires Community acquired pneumonia and pulmonary hemorrhage in leptospirosis in the Buenos Aires metropolitan area

    Directory of Open Access Journals (Sweden)

    Alfredo Seijo

    2011-04-01

    Full Text Available El objetivo del trabajo es comunicar los hallazgos epidemiológicos, clínicos y de diagnóstico de la neumonía y hemorragia pulmonar por leptospirosis, en el período enero 2007 a octubre 2009. Un 64% (20/31 de pacientes con diagnóstico de leptospirosis tuvieron neumonía. Quince de ellos (75% presentaron neumonía grave, de los cuales siete (35% desarrollaron hemorragia pulmonar. En diez enfermos (32% el motivo de consulta e inicio del cuadro clínico fue una gastroenteritis secretoria con fiebre y dolor abdominal. La ictericia sólo se manifestó en once pacientes (35%. La técnica de reacción en cadena de la polimerasa (PCR fue útil para el diagnóstico en muestra obtenida post mortem. De un hemocultivo se aisló una cepa clasificada dentro del serogrupo canicola. Se clasificaron las neumonías en tres tipos: neumonías de curso no grave con escasa repercusión general; neumonías graves asociadas a formas clínicas sistémicas con ictericia, insuficiencia renal, trombocitopenia y hemorragia pulmonar; también de curso grave, no asociada a ictericia, insuficiencia renal o trombocitopenia grave. El tratamiento antibiótico iniciado en los primeros días de enfermedad (promedio 3.2 días no tuvo influencia en la evolución de las neumonías graves. Se plantea además considerar tres formas clínicas de leptospirosis: anictérica, ictérica (con sus variantes evolutivas y hemorragia pulmonar.The aim of this paper is to report the epidemiological, clinical and diagnosis findings of pneumonia and pulmonary hemorrhage observed in patients with leptospirosis in the period January 2007 to October 2009. A 64% (20/31 of patients diagnosed with leptospirosis presented pneumonia. Fifteen of them (75% had severe pneumonia, of which seven (35% were pulmonary hemorrhage. In ten patients (32% reason for consultation and clinical early stage was a secretory gastroenteritis with fever and abdominal pain. Jaundice was only expressed in eleven patients (35

  3. Detección de cepas de Neisseria meningitidis resistentes a rifampicina en el Uruguay Detection of rifampicin-resistant strains of Neisseria meningitidis in Uruguay

    Directory of Open Access Journals (Sweden)

    Gabriel Pérez Giffoni

    2011-12-01

    Full Text Available El objetivo de este trabajo fue caracterizar fenotípica y genotípicamente dos aislamientos de Neisseria meningitidis resistentes a rifampicina relacionados con dos eventos independientes de transmisión de enfermedad meningocócica grave que se presentaron en septiembre y octubre de 2010 en Montevideo, Uruguay. Se revisó también la base de datos de la vigilancia nacional de resistencia a los antimicrobianos de los últimos 10 años, para estimar la frecuencia de la particularidad de los meningococos caracterizados. La resistencia a rifampicina se estudió por el método epsilométrico. El serotipo y serosubtipo de los aislamientos se determinaron por ELISA y la caracterización genotípica se realizó por digestión del ADN con NheI y electroforesis en gel con campo pulsátil. Ambos aislamientos eran idénticos, B:2a:P1.5, y su fenotipo no figuraba en la colección de 408 cepas de N. meningitidis aisladas en el Uruguay en los últimos 10 años, con la excepción de dos aislamientos sensibles a rifampicina. Los dos aislamientos estudiados también compartían un pulsotipo único, diferente del de otros dos aislamientos resistentes a rifampicina obtenidos en 2003 y 2007. Por lo tanto, ambos eventos de transmisión fueron causados por una única cepa resistente a rifampicina, que podría haberse introducido al país desde otras regiones o haberse originado por un cambio del serogrupo C al B, como producto de la presión selectiva ejercida por vacunas administradas a la población. Es necesario mantener y extremar la vigilancia. No obstante, en vista de que hasta el momento este tipo de hallazgo ha sido esporádico, no se justifica cambiar el fármaco antimicrobiano que se administra a los contactos para la profilaxis, a menos que se identifique un caso secundario.The objective of this study was to characterize the phenotype and genotype of two isolates of rifampicin-resistant Neisseria meningitidis associated with two independent events

  4. Factors associated with fetal losses in ewe lambs on a New Zealand sheep farm.

    Science.gov (United States)

    Ridler, A L; Vallee, E; Corner, R A; Kenyon, P R; Heuer, C

    2015-11-01

    As part of a production study of ewe lambs on a large farm in the Waikato region of New Zealand in 2011, pregnancy diagnosis was undertaken twice by trans-abdominal ultrasonography at 68-103 and 97-132 days of gestation. At the second pregnancy diagnosis 257/3,790 (6.8%) ewe lambs had evidence of non-viable fetuses or absence of a pregnancy that was present at the previous pregnancy diagnosis (fetal loss). Serum antibody titres for Leptospira interrogans serovar Pomona appeared generally higher in 10 ewe lambs with fetal loss compared with 10 that were still pregnant. Histopathological investigation was not able to confirm that fetal loss was associated with leptospial infection. In the 2012-born cohort of ewe lambs 443 were vaccinated with a bivalent leptospirosis vaccine and 882 unvaccinated. Serum was collected from 124 non-vaccinated ewe lambs between January and December 2013 for measurement of antibodies to Leptospira serovar Pomona and L. borgpetersenii serovar Hardjo-bovis using a microscopic agglutination test (MAT). Less than 5% of these ewe lambs were seropositive until May, but by August 85% and 48% of animals were seropositive to Leptospira serovars Hardjo-bovis and Pomona, respectively. Fetal loss in non-vaccinated ewe lambs was 78/882 (9%) compared with 23/443 (5%) in vaccinated ewe lambs. Combined data from the 2011- and 2012-born ewe lambs (n=5,115) were analysed using a logistic regression model and fetal loss as the dependent variable. In the final model fetal loss was associated with pre-mating bodyweight (p=0.003), weight change from pre-mating to initial pregnancy diagnosis (pewe lambs, there were associations between fetal loss and being seropositive to Leptospira serovar Pomona using titre cut-points of 1:48 and 1:768 (pewe lambs achieving target pre-mating weights and liveweight gains during pregnancy. Infection with Leptospira serovar Pomona was associated with fetal loss in the 2012-born cohort and the possibility of infection with this

  5. Discovery of Novel Leptospirosis Vaccine Candidates Using Reverse and Structural Vaccinology

    Directory of Open Access Journals (Sweden)

    Alan John Alexander McBride

    2017-04-01

    Full Text Available Leptospira spp. are diderm (two membranes bacteria that infect mammals causing leptospirosis, a public health problem with global implications. Thousands of people die every year due to leptospirosis, especially in developing countries with tropical climates. Prophylaxis is difficult due to multiple factors, including the large number of asymptomatic hosts that transmit the bacteria, poor sanitation, increasing numbers of slum dwellers, and the lack of an effective vaccine. Several leptospiral recombinant antigens were evaluated as a replacement for the inactivated (bacterin vaccine; however, success has been limited. A prospective vaccine candidate is likely to be a surface-related protein that can stimulate the host immune response to clear leptospires from blood and organs. In this study, a comprehensive bioinformatics approach based on reverse and structural vaccinology was applied toward the discovery of novel leptospiral vaccine candidates. The Leptospira interrogans serovar Copenhageni strain L1-130 genome was mined in silico for the enhanced identification of conserved β-barrel (βb transmembrane proteins and outer membrane (OM lipoproteins. Orthologs of the prospective vaccine candidates were screened in the genomes of 20 additional Leptospira spp. Three-dimensional structural models, with a high degree of confidence, were created for each of the surface-exposed proteins. Major histocompatibility complex II (MHC-II epitopes were identified, and their locations were mapped on the structural models. A total of 18 βb transmembrane proteins and 8 OM lipoproteins were identified. These proteins were conserved among the pathogenic Leptospira spp. and were predicted to have epitopes for several variants of MHC-II receptors. A structural and functional analysis of the sequence of these surface proteins demonstrated that most βb transmembrane proteins seem to be TonB-dependent receptors associated with transportation. Other proteins

  6. Assessing the impact of tailored biosecurity advice on farmer behaviour and pathogen presence in beef herds in England and Wales.

    Science.gov (United States)

    Cardwell, J M; Van Winden, S; Beauvais, W; Mastin, A; De Glanville, W A; Hardstaff, J; Booth, R E; Fishwick, J; Pfeiffer, D U

    2016-12-01

    The term 'biosecurity' encompasses many measures farmers can take to reduce the risk of pathogen incursion or spread. As the best strategy will vary between settings, veterinarians play an important role in assessing risk and providing advice, but effectiveness requires farmer acceptance and implementation. The aim of this study was to assess the effectiveness of specifically-tailored biosecurity advice packages in reducing endemic pathogen presence on UK beef suckler farms. One hundred and sixteen farms recruited by 10 veterinary practices were followed for three years. Farms were randomly allocated to intervention (receiving specifically-tailored advice, with veterinarians and farmers collaborating to develop an improved biosecurity strategy) or control (receiving general advice) groups. A spreadsheet-based tool was used annually to attribute a score to each farm reflecting risk of entry or spread of bovine viral diarrhoea virus (BVDV), bovine herpesvirus-1 (BHV1), Mycobacterium avium subsp. paratuberculosis (MAP), Leptospira interrogans serovar hardjo (L. hardjo) and Mycobacterium bovis (M. bovis). Objectives of these analyses were to identify evidence of reduction in risk behaviours during the study, as well as evidence of reductions in pathogen presence, as indications of effectiveness. Risk behaviours and pathogen prevalences were examined across study years, and on intervention compared with control farms, using descriptive statistics and multilevel regression. There were significant reductions in risk scores for all five pathogens, regardless of intervention status, in every study year compared with the outset. Animals on intervention farms were significantly less likely than those on control farms to be seropositive for BVDV in years 2 and 3 and for L. hardjo in year 3 of the study. Variations by study year in animal-level odds of seropositivity to BHV1 or MAP were not associated with farm intervention status. All farms had significantly reduced odds of

  7. Interaction of bovine peripheral blood polymorphonuclear cells and Leptospira species; innate responses in the natural bovine reservoir host.

    Directory of Open Access Journals (Sweden)

    Jennifer H Wilson-Welder

    2016-07-01

    Full Text Available Cattle are the reservoir hosts of Leptospira borgpetersenii serovar Hardjo, and can also be reservoir hosts of other Leptospira species such as L. kirschneri, and L. interrogans. As a reservoir host, cattle shed Leptospira, infecting other animals, including humans. Previous studies with human and murine neutrophils have shown activation of neutrophil extracellular trap or NET formation, and upregulation of inflammatory mediators by neutrophils in the presence of Leptospira. Humans, companion animals and most widely studied models of Leptospirosis are of acute infection, hallmarked by systemic inflammatory response, neutrophilia and septicemia. In contrast, cattle exhibit chronic infection with few outward clinical signs aside from reproductive failure. Taking into consideration that there is host species variation in innate immunity, especially in pathogen recognition and response, the interaction of bovine peripheral blood polymorphonuclear cells (PMNs and several Leptospira strains was evaluated. Studies including bovine-adapted strains, human pathogen strains, a saprophyte and inactivated organisms. Incubation of PMNs with Leptospira did induce slight activation of neutrophil NETs, greater than unstimulated cells but less than the quantity from E. coli P4 stimulated PMNs. Very low but significant from non-stimulated, levels of reactive oxygen peroxides were produced in the presence of all Leptospira strains and E. coli P4. Similarly, significant levels of reactive nitrogen intermediaries (NO2 was produced from PMNs when incubated with the Leptospira strains and greater quantities in the presence of E. coli P4. PMNs incubated with Leptospira induced RNA transcripts of IL-1β, MIP-1α, and TNF-α, with greater amounts induced by live organisms when compared to heat-inactivated leptospires. Transcript for inflammatory cytokine IL-8 was also induced, at similar levels regardless of Leptospira strain or viability. However, incubation of

  8. Molecular Typing of Pathogenic Leptospira Serogroup Icterohaemorrhagiae Strains Circulating in China during the Past 50 Years.

    Directory of Open Access Journals (Sweden)

    Cuicai Zhang

    2015-05-01

    Full Text Available Leptospirosis is one of the most important neglected tropical infectious diseases worldwide. Icterohaemorrhagiae has been throughout recent history, and still is, the predominant serogroup of this pathogen in China. However, very little in detail is known about the serovars or genotypes of this serogroup.In this study, 120 epidemic strains from five geographically diverse regions in China collected over a 50 year period (1958~2008, and 8 international reference strains characterized by 16S rRNA sequencing and MLST analysis. 115, 11 and 2 strains were identified as L. interrogans, L. borgpetersenii, and L. kirschneri, respectively. 17 different STs were identified including 69 ST1 strains, 18 ST17, 18 ST128, 9 ST143 and 2 ST209. The remaining 12 strains belonged to 12 different STs. eBURST analysis demonstrated that, among the clonal complexes isolated (CCs, CC1 accounted for 73.3% (88/120 strains representing three STs: ST1, ST128 and ST98. ST1 was the most likely ancestral strain of this CC, followed by singleton CC17 (17/120 and CC143 (11/120. Further analysis of adding 116 serogroup Icterohaemorrhagiae strains in the MLST database and studies previously described using global eBURST analysis and MST dendrogram revealed relatively similar ST clustering patterns with five main CCs and 8 singletons among these 244 strains. CC17 was found to be the most prevalent clone of pathogenic Leptospira circulating worldwide. This is the first time, to our knowledge, that ST1 and ST17 strains were distributed among 4 distinct serovars, indicating a highly complicated relationship between serovars and STs.Our studies demonstrated a high level of genetic diversity in the serogroup Icterohaemorrhagiae strains. Distinct from ST17 or ST37 circulating elsewhere, ST1 included in CC1, has over the past 50 years or so, proven to be the most prevalent ST of pathogenic leptospires isolated in China. Moreover, the complicated relationship between STs and serovars

  9. Isolation of a Seawater Tolerant Leptospira spp. from a Southern Right Whale (Eubalaena australis).

    Science.gov (United States)

    Grune Loffler, Sylvia; Rago, Virginia; Martínez, Mara; Uhart, Marcela; Florin-Christensen, Monica; Romero, Graciela; Brihuega, Bibiana

    2015-01-01

    Leptospirosis is the most widespread zoonotic disease in the world. It is caused by pathogenic spirochetes of the genus Leptospira spp. and is maintained in nature through chronic renal infection of carrier animals. Rodents and other small mammals are the main reservoirs. Information on leptospirosis in marine mammals is scarce; however, cases of leptospirosis have been documented in pinniped populations from the Pacific coast of North America from southern California to British Columbia. We report the isolation of a Leptospira spp. strain, here named Manara, from a kidney sample obtained from a Southern Right Whale (Eubalaena australis) calf, which stranded dead in Playa Manara, Península Valdés, Argentina. This strain showed motility and morphology typical of the genus Leptospira spp. under dark-field microscopy; and grew in Ellinghausen-McCullough-Johnson-Harris (EMJH) medium and Fletcher medium after 90 days of incubation at 28°C. Considering the source of this bacterium, we tested its ability to grow in Fletcher medium diluted with seawater at different percentages (1%, 3%, 5%, 7% and 10% v/v). Bacterial growth was detected 48 h after inoculation of Fletcher medium supplemented with 5% sea water, demonstrating the halophilic nature of the strain Manara. Phylogenetic analysis of 16S rRNA gene sequences placed this novel strain within the radiation of the pathogenic species of the genus Leptospira spp., with sequence similarities within the range 97-100%, and closely related to L. interrogans. Two different PCR protocols targeting genus-specific pathogenic genes (G1-G2, B64I-B64II and LigB) gave positive results, which indicates that the strain Manara is likely pathogenic. Further studies are needed to confirm this possibility as well as determine its serogroup. These results could modify our understanding of the epidemiology of this zoonosis. Until now, the resistance and ability to grow in seawater for long periods of time had been proven for the strain

  10. Temperature and Oxidative Stress as Triggers for Virulence Gene Expression in Pathogenic Leptospira spp.

    Directory of Open Access Journals (Sweden)

    Tricia Fraser

    2017-05-01

    Full Text Available Leptospirosis is a zooanthroponosis aetiologically caused by pathogenic bacteria belonging to the genus, Leptospira. Environmental signals such as increases in temperatures or oxidative stress can trigger response regulatory modes of virulence genes during infection. This study sought to determine the effect of temperature and oxidative stress on virulence associated genes in highly passaged Leptospira borgpeterseneii Jules and L. interrogans Portlandvere. Bacteria were grown in EMJH at 30°C, 37°C, or at 30°C before being transferred to 37°C. A total of 14 virulence-associated genes (fliY, invA, lenA, ligB, lipL32, lipL36, lipL41, lipL45, loa22, lsa21, mce, ompL1, sph2, and tlyC were assessed using endpoint PCR. Transcriptional analyses of lenA, lipL32, lipL41, loa22, sph2 were assessed by quantitative real-time RT-PCR at the temperature conditions. To assess oxidative stress, bacteria were exposed to H2O2 for 30 and 60 min with or without the temperature stress. All genes except ligB (for Portlandvere and ligB and mce (for Jules were detectable in the strains. Quantitatively, temperature stress resulted in significant changes in gene expression within species or between species. Temperature changes were more influential in gene expression for Jules, particularly at 30°C and upshift conditions; at 37°C, expression levels were higher for Portlandvere. However, compared to Jules, where temperature was influential in two of five genes, temperature was an essential element in four of five genes in Portlandvere exposed to oxidative stress. At both low and high oxidative stress levels, the interplay between genetic predisposition (larger genome size and temperature was biased towards Portlandvere particularly at 30°C and upshift conditions. While it is clear that expression of many virulence genes in highly passaged strains of Leptospira are attenuated or lost, genetic predisposition, changes in growth temperature and/or oxidative intensity and

  11. Molecular Typing of Pathogenic Leptospira Serogroup Icterohaemorrhagiae Strains Circulating in China during the Past 50 Years

    Science.gov (United States)

    Zhang, Cuicai; Yang, Huimian; Li, Xiuwen; Cao, Zhiqiang; Zhou, Haijian; Zeng, Linzi; Xu, Jianmin; Xu, Yinghua; Chang, Yung-Fu; Guo, Xiaokui; Zhu, Yongzhang; Jiang, Xiugao

    2015-01-01

    Background Leptospirosis is one of the most important neglected tropical infectious diseases worldwide. Icterohaemorrhagiae has been throughout recent history, and still is, the predominant serogroup of this pathogen in China. However, very little in detail is known about the serovars or genotypes of this serogroup. Methodology/Principal Findings In this study, 120 epidemic strains from five geographically diverse regions in China collected over a 50 year period (1958~2008), and 8 international reference strains characterized by 16S rRNA sequencing and MLST analysis. 115, 11 and 2 strains were identified as L. interrogans, L. borgpetersenii, and L. kirschneri, respectively. 17 different STs were identified including 69 ST1 strains, 18 ST17, 18 ST128, 9 ST143 and 2 ST209. The remaining 12 strains belonged to 12 different STs. eBURST analysis demonstrated that, among the clonal complexes isolated (CCs), CC1 accounted for 73.3% (88/120) strains representing three STs: ST1, ST128 and ST98. ST1 was the most likely ancestral strain of this CC, followed by singleton CC17 (17/120) and CC143 (11/120). Further analysis of adding 116 serogroup Icterohaemorrhagiae strains in the MLST database and studies previously described using global eBURST analysis and MST dendrogram revealed relatively similar ST clustering patterns with five main CCs and 8 singletons among these 244 strains. CC17 was found to be the most prevalent clone of pathogenic Leptospira circulating worldwide. This is the first time, to our knowledge, that ST1 and ST17 strains were distributed among 4 distinct serovars, indicating a highly complicated relationship between serovars and STs. Conclusions/Significance Our studies demonstrated a high level of genetic diversity in the serogroup Icterohaemorrhagiae strains. Distinct from ST17 or ST37 circulating elsewhere, ST1 included in CC1, has over the past 50 years or so, proven to be the most prevalent ST of pathogenic leptospires isolated in China. Moreover, the

  12. Bacterial variations on the methionine salvage pathway

    Directory of Open Access Journals (Sweden)

    Haas Dieter

    2004-03-01

    Full Text Available Abstract Background The thiomethyl group of S-adenosylmethionine is often recycled as methionine from methylthioadenosine. The corresponding pathway has been unravelled in Bacillus subtilis. However methylthioadenosine is subjected to alternative degradative pathways depending on the organism. Results This work uses genome in silico analysis to propose methionine salvage pathways for Klebsiella pneumoniae, Leptospira interrogans, Thermoanaerobacter tengcongensis and Xylella fastidiosa. Experiments performed with mutants of B. subtilis and Pseudomonas aeruginosa substantiate the hypotheses proposed. The enzymes that catalyze the reactions are recruited from a variety of origins. The first, ubiquitous, enzyme of the pathway, MtnA (methylthioribose-1-phosphate isomerase, belongs to a family of proteins related to eukaryotic intiation factor 2B alpha. mtnB codes for a methylthioribulose-1-phosphate dehydratase. Two reactions follow, that of an enolase and that of a phosphatase. While in B. subtilis this is performed by two distinct polypeptides, in the other organisms analyzed here an enolase-phosphatase yields 1,2-dihydroxy-3-keto-5-methylthiopentene. In the presence of dioxygen an aci-reductone dioxygenase yields the immediate precursor of methionine, ketomethylthiobutyrate. Under some conditions this enzyme produces carbon monoxide in B. subtilis, suggesting a route for a new gaseous mediator in bacteria. Ketomethylthiobutyrate is finally transaminated by an aminotransferase that exists usually as a broad specificity enzyme (often able to transaminate aromatic aminoacid keto-acid precursors or histidinol-phosphate. Conclusion A functional methionine salvage pathway was experimentally demonstrated, for the first time, in P. aeruginosa. Apparently, methionine salvage pathways are frequent in Bacteria (and in Eukarya, with recruitment of different polypeptides to perform the needed reactions (an ancestor of a translation initiation factor and Ru

  13. Enero de 1999 a marzo del 2004

    Directory of Open Access Journals (Sweden)

    Juan Carlos Macías Herrera

    2005-01-01

    Full Text Available Objetivos: Describir el comportamiento epidemiológico de la leptospirosis en el departamento del Atlántico (Colombia, de enero de 1999 a marzo del 2004. Metodología: Estudio descriptivo. Se analizaron 970 muestras únicas de pacientes sospechosos de infecciones con Leptospira en el Laboratorio Departamental del Atlántico mediante Aglutinación Microscópica (MAT, usando como antígenos los serovares Icterohemorragiae, Pomona, Canícola, Hardjo, Grippotyphosa y Hardjo-bovis de Leptospira interrogans. Información adicional sobre la clínica de pacientes a través de fichas epidemiológicas y visitas a hospitales, además de datos de precipitación anual, fue obtenida. Resultados: El 9,7% de los casos fueron positivos para Leptospira, siendo los serovares Icterohaemorrhagiae (62% y Hardjo (12,8% los más frecuentes. La mayoría de casos (61%, se presentaron en hombres entre 15 y 45 años de edad y la clínica más común se asoció a fiebre (91,7%, mialgias (72,2%, vómito/nausea (70,8%, cefalea (68,1% e ictericia (63,9%. El 8.6% de los casos asociados a infecciones con el serovar Ictherohemorragiae fueron severos; la sintomatología coincidió con el síndrome de Weil, pero no se registraron fatalidades. En los años 2003(23, 2001(21 y 2002(18 se registró la mayor incidencia de casos, en meses de alta precipitación (Agosto-Noviembre. Los municipios con mayor número de casos fueron Barranquilla (46, Soledad (25, Puerto Colombia (6 y Galapa (6. Conclusiones: La leptospirosis debe tenerse en cuenta dentro del diagnóstico diferencial de otras entidades comunes en la región (fiebre de dengue. Un diligenciamiento completo de la ficha epidemiológica permitirá un estudio más detallado de esta patología, para desarrollar programas de vigilancia y prevención eficaces

  14. Avaliação da contraimunoeletroforese com antígenos dos sorovars icterohaemorrhagiae E patoc no diagnóstico sorológico da leptospirose humana Evaluation of counterimmunoeletrophoresis with the serovars icterohaemorrhagiae and patoc antigens in the diagnosis of human leptospirosis

    Directory of Open Access Journals (Sweden)

    Paulo H. Yasuda

    1991-12-01

    Full Text Available Avaliou-se o desempenho da contraimunoeletroforese (CIE no diagnóstico sorológico da leptospirose humana utilizando três tipos de antígenos derivados da L. interrogans sorovar icterohaemorrhagiae e do sorovar patoc da L. biflexa. Comparou-se os resultados obtidos na CIE com a prova de referência a soroaglutinação microscópica (SAM. Soros pareados de 135 pacientes com leptospirose foram subdivididos em 4 grupos de acordo com os resultados da SAM. Como controle coletou-se sangue de 69 indivíduos sadios. A concordância entre as duas técnicas variou de 92,64 a 94,11%. Os resultados obtidos pela CIE com os antígenos do sorovar icterohaemorrhagiae foram mais favoráveis do que aqueles derivados do patoc. Ressaltam-se as características de elevada sensibilidade detectando anticorpos antileptospiras mais precocemente do que a microaglutinação. As características encontradas no presente estudo credenciam o emprego da CIE como um método útil e prático para o diagnóstico da leptospirose humana na fase aguda da doença.Counterimmunoelectrophoresis (CIE was applied on paired sera from 135 pacients with leptospirosis and on 69 sera from a control group. The sera from pacients were subdivided in 4 groups according to the results obtained by the Microscopic Agglutination Test (MAT. The first samples sera from 58 pacientes were non reagent by MAT. Six monthly samples of sera were taken from 7 patients to follow-up and to determine the level of agglutinin and precipitin antibodies present using MAT and CIE. Serovars icterohaemorrhagie and patoc were used as antigens. Three types of antigens were compared, 1 Triton-X-100 extracted; 2 heat extacted and 3 a pool of them. The CIE using icterohaemorrhagiae derivated antigens types agreed with MAT in 92.64, 92.64 and 94.11% of the leptospirosis sera. The patoc antigens types reacted with the control group in 7.24, 86.95 and 84.05% of the samples, and consequently were eliminated from the present

  15. Alteraciones histopatológicas en ratas naturalmente infectadas con Leptospira

    Directory of Open Access Journals (Sweden)

    Piedad Agudelo-Flórez

    2013-08-01

    Full Text Available Introducción. Los hallazgos histopatológicos ocasionados por Leptospira spp. han sido poco estudiados en poblaciones de roedores naturalmente infectados. Objetivo. Describir la histopatología renal asociada con las infecciones naturalmente adquiridas en un grupo de roedores capturados en el área urbana de Medellín, Colombia. Materiales y métodos. Se llevaron a cabo coloraciones de hematoxilina y eosina de los riñones de 254 roedores recolectados en el área de estudio. Las muestras positivas se procesaron con la coloración de Warthin-Starry y mediante reacción en cadena de la polimerasa (PCR-LipL32. Results. Se observaron cambios histopatológicos con hematoxilina y eosina en 51 riñones de roedores, que consistieron en infiltrado inflamatorio con linfoplasmocitos e histiocitos. Se utilizó coloración de Warthin-Starry y PCR-LipL32 en 67 muestras de riñón que incluyeron las 51 muestras que tuvieron cambios detectables por hematoxilina y eosina y 16 de 203 (8 % muestras con resultados negativos. Ocho de las muestras positivas por hematoxilina y eosina (15,7 % también fueron positivas por la coloración de Warthin-Starry. Las muestras negativas por hematoxilina y eosina (8 % también fueron negativas con la coloración de Warthin-Starry. Tres de las ocho muestras positivas por esta última, también lo fueron por cultivo. Además, 47 (92,1 % muestras positivas por hematoxilina y eosina fueron positivas por PCR. Del grupo de 16 negativos por hematoxilina y eosina, 11 (68,8 % fueron positivos por PCR. De las muestras positivas por PCR, 11 también lo fueron por cultivo (23,4 %. Siete muestras fueron positivas por PCR y Warthin-Starry y tres lo fueron por PCR, Warthin-Starry y cultivo. Todos los fragmentos de la PCR-LipL32 fueron secuenciados y mostraron secuencias específicas de L. interrogans. Conclusiones. Se confirmó la infección por Leptospira y la única lesión presente en el reservorio atribuible fue la nefritis intersticial

  16. Isolation of a Seawater Tolerant Leptospira spp. from a Southern Right Whale (Eubalaena australis.

    Directory of Open Access Journals (Sweden)

    Sylvia Grune Loffler

    Full Text Available Leptospirosis is the most widespread zoonotic disease in the world. It is caused by pathogenic spirochetes of the genus Leptospira spp. and is maintained in nature through chronic renal infection of carrier animals. Rodents and other small mammals are the main reservoirs. Information on leptospirosis in marine mammals is scarce; however, cases of leptospirosis have been documented in pinniped populations from the Pacific coast of North America from southern California to British Columbia. We report the isolation of a Leptospira spp. strain, here named Manara, from a kidney sample obtained from a Southern Right Whale (Eubalaena australis calf, which stranded dead in Playa Manara, Península Valdés, Argentina. This strain showed motility and morphology typical of the genus Leptospira spp. under dark-field microscopy; and grew in Ellinghausen-McCullough-Johnson-Harris (EMJH medium and Fletcher medium after 90 days of incubation at 28°C. Considering the source of this bacterium, we tested its ability to grow in Fletcher medium diluted with seawater at different percentages (1%, 3%, 5%, 7% and 10% v/v. Bacterial growth was detected 48 h after inoculation of Fletcher medium supplemented with 5% sea water, demonstrating the halophilic nature of the strain Manara. Phylogenetic analysis of 16S rRNA gene sequences placed this novel strain within the radiation of the pathogenic species of the genus Leptospira spp., with sequence similarities within the range 97-100%, and closely related to L. interrogans. Two different PCR protocols targeting genus-specific pathogenic genes (G1-G2, B64I-B64II and LigB gave positive results, which indicates that the strain Manara is likely pathogenic. Further studies are needed to confirm this possibility as well as determine its serogroup. These results could modify our understanding of the epidemiology of this zoonosis. Until now, the resistance and ability to grow in seawater for long periods of time had been proven

  17. Shedding and seroprevalence of pathogenic Leptospira spp. in sheep and cattle at a New Zealand Abattoir.

    Science.gov (United States)

    Fang, F; Collins-Emerson, J M; Cullum, A; Heuer, C; Wilson, P R; Benschop, J

    2015-06-01

    A cross-sectional study was carried out on sheep and cattle slaughtered at a New Zealand abattoir from September to November 2010 to investigate the supplier-specific shedding rate, renal carriage rate and seroprevalence of leptospires. In the 2008/2009 season, this abattoir experienced three human leptospirosis cases from 20 staff, of which two were hospitalized. Urine, kidney and blood samples were collected from carcasses of 399 sheep (six suppliers, 17 slaughter lines) and 146 cattle (three suppliers, 22 slaughter lines). The urine and kidney samples were tested by quantitative real-time PCR (qPCR), while serum samples (from coagulated blood samples) were tested by microscopic agglutination test (MAT). In total, 27% (73/274; 95% CI: 18-37) of urine samples tested positive by qPCR. Species-specific shedding rates (prevalence of positive urine qPCR) were 31% (95% CI: 17-48) for sheep and 21% (95% CI: 14-30) for cattle. For 545 kidney samples tested, 145 were qPCR positive (27%; 95% CI: 17-39). The average prevalence of kidney qPCR positivity was 29% (95% CI: 17-45) for sheep and 21% (95% CI: 15-28) for cattle. Three hundred and thirty of 542 sampled sheep and cattle had antibodies against Leptospira borgpetersenii serovar Hardjobovis (Hardjobovis) and/or Leptospira interrogans serovar Pomona (Pomona), based on reciprocal MAT titre ≥1 : 48 (overall seroprevalence of 61%; 95% CI: 48-73). Seroprevalence was 57% (95% CI: 40-72) for sheep and 73% (95% CI: 59-83) for cattle. Among the seropositive animals, 41% (70/170; 95% CI: 30-54) were shedding (tested positive by urine qPCR) and 42% (137/330; 95% CI: 30-54) had renal carriage (tested positive by kidney qPCR). Some risk management options for abattoirs or farms to prevent human leptospirosis infections include vaccination of maintenance hosts, the use of personal protective equipment, and the application of urine qPCR to detect shedding status of stock as surveillance and as an alert. © 2014 Blackwell Verlag

  18. Leptospirosis en el Perú: I. Identificación de las cepas de leptospiras presentes en el perro y el gato e incidencia de la infección

    Directory of Open Access Journals (Sweden)

    Arístides Herrer

    1958-12-01

    Full Text Available Durante 1955 a 1957 se han realizado investigaciones acerca de la leptospirosis en el perro y el gato en la ciudad de Lima con la finalidad de determinar las cepas serológicas que infectan a dichos animales y la incidencia de la infección en relación con diversos factores. Todos los gatos y la mayoría de los perros estudiados procedían de la ciudad de Lima y sus inmediaciones; el resto de los perros, habían sido enviados a Lima procedentes de diversas localidades que se hallan a lo largo de la Costa. Las investigaciones efectuadas en dichos animales consisten en: a reacciones serológicas de aglutinación-lisis, en las que se empleó 11 cepas diferentes de leptospiras; b cultivos de la sangre y el riñón; y c observaciones al campo oscuro del triturado de riñón. Los principales resultados obtenidos son los siguientes: 1. De 444 perros en los que se realizaran las reacciones serológicas, en 206 (46.4% se ha verificado la presencia de anticuerpos a título que varió entre 1:100 a 1:30,000. Los anticuerpos verificados correspondieron casi en su totalidad a L. canícola Ruebush (84.5%, y L. icterohaemorrhagiae AB Winjberg (11.6%. 2. De los 206 perros con reacción serológica positiva, 66 (32% reaccionaron simultáneamente frente a dos cepas y 11 (5.3% frente a tres. En tales reacciones cruzadas la cepa L. ballum fue la que ofreció resultados positivos con mayor frecuencia (78.0% 3. En cuanto al título de los anticuerpos, en 154 casos (74.8% fue entre 1:100 y 1:300; en 49 (23.8%, entre 1:1,000 y 1:3,000; y en los tres restantes (1.4%, entre 1:10,000 y 1:30,000. 4. A semejanza de lo que sucede en otras partes, la incidencia de la leptospirosis canina es mayor durante los meses de temperatura más elevada (enero-marzo, del mismo modo, la incidencia es más alta en los animales machos (50% que en las hembras (35.9%. Ambos datos han sido obtenidos a base de los cultivos de riñón. 5. En 435 perros se hicieron cultivos de riñón y, en 113

  19. Enfermedad neumocócica invasiva en niños de la Región de Murcia Invasive pneumococcal disease in children in the region of Murcia, Spain

    Directory of Open Access Journals (Sweden)

    M.I. Espín

    2002-10-01

    Full Text Available Objetivo: La disponibilidad de una vacuna neumocócica conjugada plantea la necesidad de conocer la incidencia y características de la enfermedad neumocócica invasiva en niños de la Región de Murcia, con la finalidad de obtener información que pueda ser de utilidad para establecer adecuadamente las indicaciones de vacunación. Métodos: Se ha realizado una búsqueda retrospectiva de casos de enfermedad invasiva por Streptococcus pneumoniae en menores de 15 años de edad atendidos en hospitales de la Región de Murcia durante el período 1991-2000. Las fuentes de datos utilizadas han sido las bases de datos de los Servicios de Microbiología, el Conjunto Mínimo de Datos Básicos, registro de altas pediátricas y Registro EDO. Resultados: La tasa de incidencia para el período 1996-2000 fue, para los menores de 1 año, de 18,25 por 10(5 personas-año en el caso de enfermedad invasiva (10,6 para meningitis; para los menores de 2 años, de 13,6 para enfermedad invasiva (6 para meningitis; para menores de 5 años, de 8,9 (1,35 para meningitis, y para los menores de 15 años, de 3,7 (1,3 para meningitis. El 28% de los casos presentaba factores de riesgo. Las complicaciones alcanzaron el 35,2% y las secuelas el 5%. La letalidad fue del 11,8%. Los serogrupos prevalentes fueron el 19, el 6, el 18, el 5, el 14 y el 23. Conclusiones: El alto porcentaje de casos con factores de riesgo de enfermedad neumocócica invasiva aconseja la implantación de programas de vacunación dirigidos a todos los niños con factores de riesgo. La incidencia de enfermedad neumocócica invasiva encontrada en la Región de Murcia difiere de la de otras zonas geográficas; sin embargo, la incidencia de meningitis es similar a la de otros estudios. La gravedad de la enfermedad justifica la realización de estudios coste-efectividad para valorar la posible incorporación de la vacuna en el calendario vacunal.Objective: Because of the availability of a conjugate pneumococcal

  20. Meningococcal carriage in the African meningitis belt

    Science.gov (United States)

    2013-01-01

    êcher le portage pharyngé devrait être déterminé. Pour résoudre ce problème, le consortium MenAfriCar (Consortium Africain du Portage Méningococcique) a été établi en 2009 pour étudier le mode de portage du méningocoque dans les pays de la ceinture africaine de la méningite avant et après l’ introduction de PsA-TT. Cet article décrit comment le consortium a été établi, ses objectifs et les méthodes de laboratoire et de terrain standardisées qui ont été utilisées pour atteindre ces objectifs. L’ expérience du consortium MenAfriCar aidera à planifier les futures études sur l’ épidémiologie du portage du méningocoque dans les pays de la ceinture africaine de la méningite et d’ ailleurs. Se está utilizando una vacuna meningocócica conjugada (MenAfriVac™) de polisacárido del serogrupo A / tétano toxoide (PsA-TT) en países del cinturón Africano de meningitis. Las experiencias obtenidas con otras vacunas conjugadas polisacárido/proteína han demostrado que una parte importante de su éxito se debe a su habilidad para prevenir la colonización faríngea de los portadores, acabando por lo tanto con la transmisión, y a la de inducir la protección de rebaño. Si PsA-TT ha de cumplir el objetivo de prevenir epidemias, debe ser capaz de prevenir el estado de portador faríngeo, al igual que la enfermedad invasiva por meningococo, y para ello es necesario determinar si la PsA-TT puede prevenir la colonización faríngea. Con el fin de abordar esta cuestión se estableció un consorcio africano en el 2009 - el MenAfriCar (African Meningococcal Carriage Consortium) – para investigar los patrones del estado de portador de meningococo en países del cinturón Africano de la meningitis, antes y después de la introducción de PsA-TT. Este artículo describe como se estableció el consorcio, sus objetivos y los métodos estandarizados de campo y de laboratorio que se utilizaron para alcanzarlos. La experiencia del consorcio MenAfriCar ayudar