Sgobba, Stefano; Samain, Valerie; Libeyre, Paul; Cecillon, Alexandre; Dawid, J
2014-01-01
The ITER Magnet System includes a set of 18 superconducting correction coils (CC) which are used to compensate the error field modes arising from geometrical deviations caused by manufacturing and assembly tolerances. The turn and ground insulation are electrically insulated with a multi-layer fiberglass polyimide interleaved composite, impregnated with epoxy resin using vacuum pressure impregnation (VPI). Adequate high voltage insulation (5 kV), mechanical strength and rigidity of the winding pack should be achieved after impregnation and curing of the insulation system. VPI is an effective process to avoid defects such dry spots and incomplete wet out. This insulation technology has also been developed since several years for application to large superconducting coils and more recently to ITER CC. It allows the coils to be impregnated without impacting on their functional characteristics. One of the critical challenges associated with the construction of the CC is the qualification of the VPI insulation. Se...
Complete genome sequence of Capnocytophaga ochracea type strain (VPI 2845T)
Energy Technology Data Exchange (ETDEWEB)
Mavromatis, Konstantinos; Gronow, Sabine; Saunders, Elizabeth; Land, Miriam; Lapidus, Alla; Copeland, Alex; Glavina Del Rio, Tijana; Nolan, Matt; Lucas, Susan; Chen, Feng; Tice1, Hope; Cheng, Jan-Fang; Bruce, David; Goodwin, Lynne; Pitluck, Sam; Pati, Amrita; Ivanova, Natalia; Chen, Amy; Palaniappan, Krishna; Chain, Patrick; Hauser, Loren; Chang, Yun-Juan; Jefferies, Cynthia C.; Brettin, Thomas; Detter, John C.; Han, Cliff; Bristow, James; Goker, Markus; Rohde, Manfred; Eisen, Jonathan A.; Markowitz, Victor; Kyrpides, Nikos C.; Klenk, Hans-Peter; Hugenholtz, Philip
2009-05-20
Capnocytophaga ochracea (Prevot et al. 1956) Leadbetter et al. 1982 is the type species of the genus Capnocytophaga. It is of interest because of its location in the Flavobacteriaceae, a genomically yet uncharted family within the order Flavobacteriales. The species grows as fusiform to rod shaped cells which tend to form clumps and are able to move by gliding. C. ochracea is known as a capnophilic organism with the ability to grow under anaerobic as well as under aerobic conditions (oxygen concentration larger than 15percent), here only in the presence of 5percent CO2. Strain VPI 2845T, the type strain of the species, is portrayed in this report as a gliding, Gram-negative bacterium, originally isolated from a human oral cavity. Here we describe the features of this organism, together with the complete genome sequence, and annotation. This is the first completed genome sequence from the flavobacterial genus Capnocytophaga, and the 2,612,925 bp long single replicon genome with its 2193 protein-coding and 59 RNA genes is a part of the Genomic Encyclopedia of Bacteria and Archaea project.
VPI-NECM, Nuclear Engineering Program Collection for College Training
International Nuclear Information System (INIS)
Honomichl, Jiri; Kulikowska, Teresa; Szczesna, Barbara
1991-01-01
1 - Description of problem or function: The VPI Modules consist of 6 independent programs designed to calculate: module FARCON - neutron slowing down and epithermal group constants, module SLOCON - thermal neutron spectrum and group constants, module DISFAC - slow neutron disadvantage factors, module ODOG - solution of a one group neutron diffusion equation, module ODMUG - three group critically problem, module FUELBURN - fuel burnup in slow neutron fission reactors. 2 - Method of solution: Module FARCON solves the diffusion equation for a homogeneous medium composed of N isotopes, in 33 groups in fast and resonance energy region. The solution in the thermal energy region carried out by module SLOCON is based on the Wigner-Wilkins approximation and applies the Runge-Kutta method. The burnup calculations are carried out in 3 energy groups. Only Xe-135 and Sm-149 are treated directly. All the other fission products are represented by 2 pseudo isotopes. Module ODOG solves the finite difference diffusion equation by a direct method. Module ODMUG uses the Chebyshev acceleration of outer iterations. It gives a possibility to calculate a critical boron concentration. 3 - Restrictions on the complexity of the problem: It is assumed that the elementary reactor cell consists of the fuel rod surrounded by water. The library data are limited to isotopes typical for water power reactors. The reactor can be treated in one dimension only, i.e. as a slab, sphere or cylinder with one-dimensional symmetry
Complete genome sequence of Capnocytophaga ochracea type strain (VPI 2845T)
Energy Technology Data Exchange (ETDEWEB)
Mavromatis, K [U.S. Department of Energy, Joint Genome Institute; Gronow, Sabine [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Saunders, Elizabeth H [Los Alamos National Laboratory (LANL); Land, Miriam L [ORNL; Lapidus, Alla L. [U.S. Department of Energy, Joint Genome Institute; Copeland, A [U.S. Department of Energy, Joint Genome Institute; Glavina Del Rio, Tijana [U.S. Department of Energy, Joint Genome Institute; Nolan, Matt [U.S. Department of Energy, Joint Genome Institute; Lucas, Susan [U.S. Department of Energy, Joint Genome Institute; Chen, Feng [U.S. Department of Energy, Joint Genome Institute; Bruce, David [Los Alamos National Laboratory (LANL); Tice, Hope [U.S. Department of Energy, Joint Genome Institute; Cheng, Jan-Fang [U.S. Department of Energy, Joint Genome Institute; Goodwin, Lynne A. [Los Alamos National Laboratory (LANL); Pitluck, Sam [U.S. Department of Energy, Joint Genome Institute; Pati, Amrita [U.S. Department of Energy, Joint Genome Institute; Ivanova, N [U.S. Department of Energy, Joint Genome Institute; Chen, Amy [U.S. Department of Energy, Joint Genome Institute; Palaniappan, Krishna [U.S. Department of Energy, Joint Genome Institute; Chain, Patrick S. G. [Lawrence Livermore National Laboratory (LLNL); Hauser, Loren John [ORNL; Chang, Yun-Juan [ORNL; Jeffries, Cynthia [Oak Ridge National Laboratory (ORNL); Brettin, Thomas S [ORNL; Detter, J. Chris [U.S. Department of Energy, Joint Genome Institute; Han, Cliff [Los Alamos National Laboratory (LANL); Bristow, James [U.S. Department of Energy, Joint Genome Institute; Goker, Markus [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Eisen, Jonathan [U.S. Department of Energy, Joint Genome Institute; Markowitz, Victor [U.S. Department of Energy, Joint Genome Institute; Kyrpides, Nikos C [U.S. Department of Energy, Joint Genome Institute; Klenk, Hans-Peter [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Hugenholtz, Philip [U.S. Department of Energy, Joint Genome Institute
2009-01-01
Capnocytophaga ochracea (Pr vot et al. 1956) Leadbetter et al. 1982 is the type species of the genus Capnocytophaga. It is of interest because of its location in the Flavobacteriaceae, a genomically not yet charted family within the order Flavobacteriales. The species grows as fusiform to rod shaped cells which tend to form clumps and are able to move by gliding. C. ochracea is known as a capnophilic (CO2-requiring) organism with the ability to grow under anaerobic as well as aerobic conditions (oxygen concentration larger than 15%), here only in the presence of 5% CO2. Strain VPI 2845T, the type strain of the species, is portrayed in this report as a gliding, Gram-negative bacterium, originally isolated from a human oral cavity. Here we describe the features of this organism, together with the complete genome se-quence, and annotation. This is the first completed genome sequence from the flavobacterial genus Capnocytophaga, and the 2,612,925 bp long single replicon genome with its 2193 protein-coding and 59 RNA genes is a part of the Genomic Encyclopedia of Bacteria and Archaea project.
Estimating strategic interactions in petroleum exploration
International Nuclear Information System (INIS)
Lin, C.-Y. Cynthia
2009-01-01
When individual petroleum-producing firms make their exploration decisions, information externalities and extraction externalities may lead them to interact strategically with their neighbors. If they do occur, strategic interactions in exploration would lead to a loss in both firm profit and government royalty revenue. Since these strategic interactions would be inefficient, changes in the government offshore leasing policy would need to be considered. The possibility of strategic interactions thus poses a concern to policy-makers and affects the optimal government policy. This paper examines whether these inefficient strategic interactions take place in U.S. federal lands in the Gulf of Mexico. In particular, it analyzes whether a firm's exploration decisions depend on the decisions of firms owning neighboring tracts of land. A discrete response model of a firm's exploration timing decision that uses variables based on the timing of a neighbor's lease term as instruments for the neighbor's decision is employed. The results suggest that strategic interactions do not actually take place, at least not in exploration, and therefore that the current parameters of the government offshore leasing policy do not lead to inefficient petroleum exploration. (author)
Three-body interactions and the elastic constants of hcp solid 4He
Barnes, Ashleigh L.; Hinde, Robert J.
2017-09-01
The effect of three-body interactions on the elastic properties of hexagonal close packed solid 4He is investigated using variational path integral (VPI) Monte Carlo simulations. The solid's nonzero elastic constants are calculated, at T = 0 K and for a range of molar volumes from 7.88 cm3/mol to 20.78 cm3/mol, from the bulk modulus and the three pure shear constants C0, C66, and C44. Three-body interactions are accounted for using our recently reported perturbative treatment based on the nonadditive three-body potential of Cencek et al. Previous studies have attempted to account for the effect of three-body interactions on the elastic properties of solid 4He; however, these calculations have treated zero point motions using either the Einstein or Debye approximations, which are insufficient in the molar volume range where solid 4He is characterized as a quantum solid. Our VPI calculations allow for a more accurate treatment of the zero point motions which include atomic correlation. From these calculations, we find that agreement with the experimental bulk modulus is significantly improved when three-body interactions are considered. In addition, three-body interactions result in non-negligible differences in the calculated pure shear constants and nonzero elastic constants, particularly at higher densities, where differences of up to 26.5% are observed when three-body interactions are included. We compare to the available experimental data and find that our results are generally in as good or better agreement with experiment as previous theoretical investigations.
Interactive Network Exploration with Orange
Directory of Open Access Journals (Sweden)
Miha Štajdohar
2013-04-01
Full Text Available Network analysis is one of the most widely used techniques in many areas of modern science. Most existing tools for that purpose are limited to drawing networks and computing their basic general characteristics. The user is not able to interactively and graphically manipulate the networks, select and explore subgraphs using other statistical and data mining techniques, add and plot various other data within the graph, and so on. In this paper we present a tool that addresses these challenges, an add-on for exploration of networks within the general component-based environment Orange.
Interactive Exploration Robots: Human-Robotic Collaboration and Interactions
Fong, Terry
2017-01-01
For decades, NASA has employed different operational approaches for human and robotic missions. Human spaceflight missions to the Moon and in low Earth orbit have relied upon near-continuous communication with minimal time delays. During these missions, astronauts and mission control communicate interactively to perform tasks and resolve problems in real-time. In contrast, deep-space robotic missions are designed for operations in the presence of significant communication delay - from tens of minutes to hours. Consequently, robotic missions typically employ meticulously scripted and validated command sequences that are intermittently uplinked to the robot for independent execution over long periods. Over the next few years, however, we will see increasing use of robots that blend these two operational approaches. These interactive exploration robots will be remotely operated by humans on Earth or from a spacecraft. These robots will be used to support astronauts on the International Space Station (ISS), to conduct new missions to the Moon, and potentially to enable remote exploration of planetary surfaces in real-time. In this talk, I will discuss the technical challenges associated with building and operating robots in this manner, along with lessons learned from research conducted with the ISS and in the field.
Lewis, Elise C.
2011-01-01
This study was designed to explore the relationships between users and interactive images. Three factors were identified and provided different perspectives on how users interact with images: image utility, information-need, and images with varying levels of interactivity. The study used a mixed methodology to gain a more comprehensive…
Internet of tangibles : exploring the interaction-attention continuum
Angelini, Leonardo; Mugellini, Elena; Khaled, Omar Abou; Couture, Nadine; Van Den Hoven, Elise; Bakker, Saskia
2018-01-01
There is an increasing interest in the HCI research community to design richer user interactions with the Internet of Things (IoT). This studio will allow exploring the design of tangible interaction with the IoT, what we call Internet of Tangibles. In particular, we aim at investigating the full
Young Pianists Exploring Improvisation Using Interactive Music Technology
Rowe, Victoria; Triantafyllaki, Angeliki; Anagnostopoulou, Xristina
2015-01-01
The use of music technology in the enhancement of young pianists' musical improvisations has been scarcely explored in instrumental music teaching and learning research. In the present study, 19 piano pupils aged 6-10 from the UK and Greece used an interactive improvisation system called Musical Interaction Relying On Reflexion (MIROR)-Impro for…
COMPARISON OF CLASSICAL AND INTERACTIVE MULTI-ROBOT EXPLORATION STRATEGIES IN POPULATED ENVIRONMENTS
Directory of Open Access Journals (Sweden)
Nassim Kalde
2015-06-01
Full Text Available Multi-robot exploration consists in coordinating robots for mapping an unknown environment. It raises several issues concerning task allocation, robot control, path planning and communication. We study exploration in populated environments, in which pedestrian flows can severely impact performances. However, humans have adaptive skills for taking advantage of these flows while moving. Therefore, in order to exploit these human abilities, we propose a novel exploration strategy that explicitly allows for human-robot interactions. Our model for exploration in populated environments combines the classical frontier-based strategy with our interactive approach. We implement interactions where robots can locally choose a human guide to follow and define a parametric heuristic to balance interaction and frontier assignments. Finally, we evaluate to which extent human presence impacts our exploration model in terms of coverage ratio, travelled distance and elapsed time to completion.
Rozendaal, Marco; Bekker, Tilde; Vermeeren, Arnold; Kanis, Marije; Aprile, Walter; van der Helm, Aadjan; Middendorf, Wouter
2012-01-01
Ambient Intelligent environments are interactive environments that sense human behaviour and can respond intelligently. This workshop explores how interactive environments can be designed with persuasive quality, influencing human experience and behaviour. The workshop follows a
Interactive visual exploration and analysis of origin-destination data
Ding, Linfang; Meng, Liqiu; Yang, Jian; Krisp, Jukka M.
2018-05-01
In this paper, we propose a visual analytics approach for the exploration of spatiotemporal interaction patterns of massive origin-destination data. Firstly, we visually query the movement database for data at certain time windows. Secondly, we conduct interactive clustering to allow the users to select input variables/features (e.g., origins, destinations, distance, and duration) and to adjust clustering parameters (e.g. distance threshold). The agglomerative hierarchical clustering method is applied for the multivariate clustering of the origin-destination data. Thirdly, we design a parallel coordinates plot for visualizing the precomputed clusters and for further exploration of interesting clusters. Finally, we propose a gradient line rendering technique to show the spatial and directional distribution of origin-destination clusters on a map view. We implement the visual analytics approach in a web-based interactive environment and apply it to real-world floating car data from Shanghai. The experiment results show the origin/destination hotspots and their spatial interaction patterns. They also demonstrate the effectiveness of our proposed approach.
Interactive methods for exploring particle simulation data
Energy Technology Data Exchange (ETDEWEB)
Co, Christopher S.; Friedman, Alex; Grote, David P.; Vay, Jean-Luc; Bethel, E. Wes; Joy, Kenneth I.
2004-05-01
In this work, we visualize high-dimensional particle simulation data using a suite of scatter plot-based visualizations coupled with interactive selection tools. We use traditional 2D and 3D projection scatter plots as well as a novel oriented disk rendering style to convey various information about the data. Interactive selection tools allow physicists to manually classify ''interesting'' sets of particles that are highlighted across multiple, linked views of the data. The power of our application is the ability to correspond new visual representations of the simulation data with traditional, well understood visualizations. This approach supports the interactive exploration of the high-dimensional space while promoting discovery of new particle behavior.
Exploring interaction with 3D volumetric displays
Grossman, Tovi; Wigdor, Daniel; Balakrishnan, Ravin
2005-03-01
Volumetric displays generate true volumetric 3D images by actually illuminating points in 3D space. As a result, viewing their contents is similar to viewing physical objects in the real world. These displays provide a 360 degree field of view, and do not require the user to wear hardware such as shutter glasses or head-trackers. These properties make them a promising alternative to traditional display systems for viewing imagery in 3D. Because these displays have only recently been made available commercially (e.g., www.actuality-systems.com), their current use tends to be limited to non-interactive output-only display devices. To take full advantage of the unique features of these displays, however, it would be desirable if the 3D data being displayed could be directly interacted with and manipulated. We investigate interaction techniques for volumetric display interfaces, through the development of an interactive 3D geometric model building application. While this application area itself presents many interesting challenges, our focus is on the interaction techniques that are likely generalizable to interactive applications for other domains. We explore a very direct style of interaction where the user interacts with the virtual data using direct finger manipulations on and around the enclosure surrounding the displayed 3D volumetric image.
Interactive Exploration for Image Retrieval
Directory of Open Access Journals (Sweden)
Jérôme Fournier
2005-08-01
Full Text Available We present a new version of our content-based image retrieval system RETIN. It is based on adaptive quantization of the color space, together with new features aiming at representing the spatial relationship between colors. Color analysis is also extended to texture. Using these powerful indexes, an original interactive retrieval strategy is introduced. The process is based on two steps for handling the retrieval of very large image categories. First, a controlled exploration method of the database is presented. Second, a relevance feedback method based on statistical learning is proposed. All the steps are evaluated by experiments on a generalist database.
Interactively exploring optimized treatment plans
International Nuclear Information System (INIS)
Rosen, Isaac; Liu, H. Helen; Childress, Nathan; Liao Zhongxing
2005-01-01
Purpose: A new paradigm for treatment planning is proposed that embodies the concept of interactively exploring the space of optimized plans. In this approach, treatment planning ignores the details of individual plans and instead presents the physician with clinical summaries of sets of solutions to well-defined clinical goals in which every solution has been optimized in advance by computer algorithms. Methods and materials: Before interactive planning, sets of optimized plans are created for a variety of treatment delivery options and critical structure dose-volume constraints. Then, the dose-volume parameters of the optimized plans are fit to linear functions. These linear functions are used to show in real time how the target dose-volume histogram (DVH) changes as the DVHs of the critical structures are changed interactively. A bitmap of the space of optimized plans is used to restrict the feasible solutions. The physician selects the critical structure dose-volume constraints that give the desired dose to the planning target volume (PTV) and then those constraints are used to create the corresponding optimized plan. Results: The method is demonstrated using prototype software, Treatment Plan Explorer (TPEx), and a clinical example of a patient with a tumor in the right lung. For this example, the delivery options included 4 open beams, 12 open beams, 4 wedged beams, and 12 wedged beams. Beam directions and relative weights were optimized for a range of critical structure dose-volume constraints for the lungs and esophagus. Cord dose was restricted to 45 Gy. Using the interactive interface, the physician explored how the tumor dose changed as critical structure dose-volume constraints were tightened or relaxed and selected the best compromise for each delivery option. The corresponding treatment plans were calculated and compared with the linear parameterization presented to the physician in TPEx. The linear fits were best for the maximum PTV dose and worst
Toward a systematic exploration of nano-bio interactions
Energy Technology Data Exchange (ETDEWEB)
Bai, Xue; Liu, Fang; Liu, Yin; Li, Cong; Wang, Shenqing [School of Chemistry and Chemical Engineering, Shandong University, Jinan (China); Zhou, Hongyu [School of Environmental Science and Technology, Shandong University, Jinan (China); Wang, Wenyi; Zhu, Hao [Department of Chemistry, Rutgers University, Camden, NJ (United States); The Rutgers Center for Computational and Integrative Biology, Rutgers University, Camden, NJ (United States); Winkler, David A., E-mail: d.winkler@latrobe.edu.au [CSIRO Manufacturing, Bag 10, Clayton South MDC 3169 (Australia); Monash Institute of Pharmaceutical Sciences, 392 Royal Parade, Parkville 3052 (Australia); Latrobe Institute for Molecular Science, Bundoora 3083 (Australia); School of Chemical and Physical Sciences, Flinders University, Bedford Park 5042 (Australia); Yan, Bing, E-mail: drbingyan@yahoo.com [School of Chemistry and Chemical Engineering, Shandong University, Jinan (China); School of Environmental Science and Technology, Shandong University, Jinan (China)
2017-05-15
Many studies of nanomaterials make non-systematic alterations of nanoparticle physicochemical properties. Given the immense size of the property space for nanomaterials, such approaches are not very useful in elucidating fundamental relationships between inherent physicochemical properties of these materials and their interactions with, and effects on, biological systems. Data driven artificial intelligence methods such as machine learning algorithms have proven highly effective in generating models with good predictivity and some degree of interpretability. They can provide a viable method of reducing or eliminating animal testing. However, careful experimental design with the modelling of the results in mind is a proven and efficient way of exploring large materials spaces. This approach, coupled with high speed automated experimental synthesis and characterization technologies now appearing, is the fastest route to developing models that regulatory bodies may find useful. We advocate greatly increased focus on systematic modification of physicochemical properties of nanoparticles combined with comprehensive biological evaluation and computational analysis. This is essential to obtain better mechanistic understanding of nano-bio interactions, and to derive quantitatively predictive and robust models for the properties of nanomaterials that have useful domains of applicability. - Highlights: • Nanomaterials studies make non-systematic alterations to nanoparticle properties. • Vast nanomaterials property spaces require systematic studies of nano-bio interactions. • Experimental design and modelling are efficient ways of exploring materials spaces. • We advocate systematic modification and computational analysis to probe nano-bio interactions.
Toward a systematic exploration of nano-bio interactions
International Nuclear Information System (INIS)
Bai, Xue; Liu, Fang; Liu, Yin; Li, Cong; Wang, Shenqing; Zhou, Hongyu; Wang, Wenyi; Zhu, Hao; Winkler, David A.; Yan, Bing
2017-01-01
Many studies of nanomaterials make non-systematic alterations of nanoparticle physicochemical properties. Given the immense size of the property space for nanomaterials, such approaches are not very useful in elucidating fundamental relationships between inherent physicochemical properties of these materials and their interactions with, and effects on, biological systems. Data driven artificial intelligence methods such as machine learning algorithms have proven highly effective in generating models with good predictivity and some degree of interpretability. They can provide a viable method of reducing or eliminating animal testing. However, careful experimental design with the modelling of the results in mind is a proven and efficient way of exploring large materials spaces. This approach, coupled with high speed automated experimental synthesis and characterization technologies now appearing, is the fastest route to developing models that regulatory bodies may find useful. We advocate greatly increased focus on systematic modification of physicochemical properties of nanoparticles combined with comprehensive biological evaluation and computational analysis. This is essential to obtain better mechanistic understanding of nano-bio interactions, and to derive quantitatively predictive and robust models for the properties of nanomaterials that have useful domains of applicability. - Highlights: • Nanomaterials studies make non-systematic alterations to nanoparticle properties. • Vast nanomaterials property spaces require systematic studies of nano-bio interactions. • Experimental design and modelling are efficient ways of exploring materials spaces. • We advocate systematic modification and computational analysis to probe nano-bio interactions.
Interactive Data Exploration for High-Performance Fluid Flow Computations through Porous Media
Perovic, Nevena
2014-09-01
© 2014 IEEE. Huge data advent in high-performance computing (HPC) applications such as fluid flow simulations usually hinders the interactive processing and exploration of simulation results. Such an interactive data exploration not only allows scientiest to \\'play\\' with their data but also to visualise huge (distributed) data sets in both an efficient and easy way. Therefore, we propose an HPC data exploration service based on a sliding window concept, that enables researches to access remote data (available on a supercomputer or cluster) during simulation runtime without exceeding any bandwidth limitations between the HPC back-end and the user front-end.
GHOST : exploring the subtleties 'of' and 'interaction with' shape-changing interfaces
Kwak, M.
2014-01-01
This research explores how to design for the aesthetics of interaction with shape-changing interfaces from a phenomenological point of view. Using shape-change as both in- and output we want to explore it as a new layer of communication between (systems) of intelligent products and people. We
Borghetti, C.; Beaven, A.; Pugliese, R.
2015-01-01
The study presented in this article aims to explore if and how intercultural learning may take place in students' class interaction. It is grounded in the assumption that interculturality is not a clear-cut feature inherent to interactions occurring when individuals with presumed different linguistic and cultural/national backgrounds talk to each…
Modeling and Simulation for Exploring Human-Robot Team Interaction Requirements
Energy Technology Data Exchange (ETDEWEB)
Dudenhoeffer, Donald Dean; Bruemmer, David Jonathon; Davis, Midge Lee
2001-12-01
Small-sized and micro-robots will soon be available for deployment in large-scale forces. Consequently, the ability of a human operator to coordinate and interact with largescale robotic forces is of great interest. This paper describes the ways in which modeling and simulation have been used to explore new possibilities for human-robot interaction. The paper also discusses how these explorations have fed implementation of a unified set of command and control concepts for robotic force deployment. Modeling and simulation can play a major role in fielding robot teams in actual missions. While live testing is preferred, limitations in terms of technology, cost, and time often prohibit extensive experimentation with physical multi-robot systems. Simulation provides insight, focuses efforts, eliminates large areas of the possible solution space, and increases the quality of actual testing.
Carpenter, Megan R; Rozovsky, Sharon; Boyd, E Fidelma
2015-12-14
Pathogenicity islands (PAIs) are mobile integrated genetic elements (MIGEs) that contain a diverse range of virulence factors and are essential in the evolution of pathogenic bacteria. PAIs are widespread among bacteria and integrate into the host genome, commonly at a tRNA locus, via integrase-mediated site-specific recombination. The excision of PAIs is the first step in the horizontal transfer of these elements and is not well understood. In this study, we examined the role of recombination directionality factors (RDFs) and their relationship with integrases in the excision of two PAIs essential for Vibrio cholerae host colonization: Vibrio pathogenicity island 1 (VPI-1) and VPI-2. VPI-1 does not contain an RDF, which allowed us to answer the question of whether RDFs are an absolute requirement for excision. We found that an RDF was required for efficient excision of VPI-2 but not VPI-1 and that RDFs can induce excision of both islands. Expression data revealed that the RDFs act as transcriptional repressors to both VPI-1- and VPI-2-encoded integrases. We demonstrated that the RDFs Vibrio excision factor A (VefA) and VefB bind at the attachment sites (overlapping the int promoter region) of VPI-1 and VPI-2, thus supporting this mode of integrase repression. In addition, V. cholerae RDFs are promiscuous due to their dual functions of promoting excision of both VPI-1 and VPI-2 and acting as negative transcriptional regulators of the integrases. This is the first demonstration of cross talk between PAIs mediated via RDFs which reveals the complex interactions that occur between separately acquired MIGEs. Deciphering the mechanisms of pathogenicity island excision is necessary for understanding the evolution and spread of these elements to their nonpathogenic counterparts. Such mechanistic insight would assist in predicting the mobility of uncharacterized genetic elements. This study identified extensive RDF-mediated cross talk between two nonhomologous VPIs and
Interactive Building Design Space Exploration Using Regionalized Sensitivity Analysis
DEFF Research Database (Denmark)
Østergård, Torben; Jensen, Rasmus Lund; Maagaard, Steffen
2017-01-01
simulation inputs are most important and which have negligible influence on the model output. Popular sensitivity methods include the Morris method, variance-based methods (e.g. Sobol’s), and regression methods (e.g. SRC). However, all these methods only address one output at a time, which makes it difficult...... in combination with the interactive parallel coordinate plot (PCP). The latter is an effective tool to explore stochastic simulations and to find high-performing building designs. The proposed methods help decision makers to focus their attention to the most important design parameters when exploring......Monte Carlo simulations combined with regionalized sensitivity analysis provide the means to explore a vast, multivariate design space in building design. Typically, sensitivity analysis shows how the variability of model output relates to the uncertainties in models inputs. This reveals which...
PERSEUS-HUB: Interactive and Collective Exploration of Large-Scale Graphs
Directory of Open Access Journals (Sweden)
Di Jin
2017-07-01
Full Text Available Graphs emerge naturally in many domains, such as social science, neuroscience, transportation engineering, and more. In many cases, such graphs have millions or billions of nodes and edges, and their sizes increase daily at a fast pace. How can researchers from various domains explore large graphs interactively and efficiently to find out what is ‘important’? How can multiple researchers explore a new graph dataset collectively and “help” each other with their findings? In this article, we present Perseus-Hub, a large-scale graph mining tool that computes a set of graph properties in a distributed manner, performs ensemble, multi-view anomaly detection to highlight regions that are worth investigating, and provides users with uncluttered visualization and easy interaction with complex graph statistics. Perseus-Hub uses a Spark cluster to calculate various statistics of large-scale graphs efficiently, and aggregates the results in a summary on the master node to support interactive user exploration. In Perseus-Hub, the visualized distributions of graph statistics provide preliminary analysis to understand a graph. To perform a deeper analysis, users with little prior knowledge can leverage patterns (e.g., spikes in the power-law degree distribution marked by other users or experts. Moreover, Perseus-Hub guides users to regions of interest by highlighting anomalous nodes and helps users establish a more comprehensive understanding about the graph at hand. We demonstrate our system through the case study on real, large-scale networks.
Streptomyces exploration is triggered by fungal interactions and volatile signals.
Jones, Stephanie E; Ho, Louis; Rees, Christiaan A; Hill, Jane E; Nodwell, Justin R; Elliot, Marie A
2017-01-03
It has long been thought that the life cycle of Streptomyces bacteria encompasses three developmental stages: vegetative hyphae, aerial hyphae and spores. Here, we show interactions between Streptomyces and fungi trigger a previously unobserved mode of Streptomyces development. We term these Streptomyces cells 'explorers', for their ability to adopt a non-branching vegetative hyphal conformation and rapidly transverse solid surfaces. Fungi trigger Streptomyces exploratory growth in part by altering the composition of the growth medium, and Streptomyces explorer cells can communicate this exploratory behaviour to other physically separated streptomycetes using an airborne volatile organic compound (VOC). These results reveal that interkingdom interactions can trigger novel developmental behaviours in bacteria, here, causing Streptomyces to deviate from its classically-defined life cycle. Furthermore, this work provides evidence that VOCs can act as long-range communication signals capable of propagating microbial morphological switches.
White, Jonathan R.
2017-01-01
Computer-assisted language learning (CALL) has greatly enhanced the realm of online social interaction and behavior. In language classrooms, it allows the opportunity for students to enhance their learning experiences. "Exploration of Textual Interactions in CALL Learning Communities: Emerging Research and Opportunities" is an ideal…
Interactive (statistical) visualisation and exploration of a billion objects with vaex
Breddels, M. A.
2017-06-01
With new catalogues arriving such as the Gaia DR1, containing more than a billion objects, new methods of handling and visualizing these data volumes are needed. We show that by calculating statistics on a regular (N-dimensional) grid, visualizations of a billion objects can be done within a second on a modern desktop computer. This is achieved using memory mapping of hdf5 files together with a simple binning algorithm, which are part of a Python library called vaex. This enables efficient exploration or large datasets interactively, making science exploration of large catalogues feasible. Vaex is a Python library and an application, which allows for interactive exploration and visualization. The motivation for developing vaex is the catalogue of the Gaia satellite, however, vaex can also be used on SPH or N-body simulations, any other (future) catalogues such as SDSS, Pan-STARRS, LSST, etc. or other tabular data. The homepage for vaex is http://vaex.astro.rug.nl.
Interactive visual exploration of a trillion particles
Schatz, Karsten
2017-03-10
We present a method for the interactive exploration of tera-scale particle data sets. Such data sets arise from molecular dynamics, particle-based fluid simulation, and astrophysics. Our visualization technique provides a focus+context view of the data that runs interactively on commodity hardware. The method is based on a hybrid multi-scale rendering architecture, which renders the context as a hierarchical density volume. Fine details in the focus are visualized using direct particle rendering. In addition, clusters like dark matter halos can be visualized as semi-transparent spheres enclosing the particles. Since the detail data is too large to be stored in main memory, our approach uses an out-of-core technique that streams data on demand. Our technique is designed to take advantage of a dual-GPU configuration, in which the workload is split between the GPUs based on the type of data. Structural features in the data are visually enhanced using advanced rendering and shading techniques. To allow users to easily identify interesting locations even in overviews, both the focus and context view use color tables to show data attributes on the respective scale. We demonstrate that our technique achieves interactive performance on a one trillionpar-ticle data set from the DarkSky simulation.
Exploring the roles of interaction and flow in explaining nurses' e-learning acceptance.
Cheng, Yung-Ming
2013-01-01
To provide safe and competent patient care, it is very important that medical institutions should provide nurses with continuing education by using appropriate learning methods. As compared to traditional learning, electronic learning (e-learning) is a more flexible method for nurses' in-service learning. Hence, e-learning is expected to play a pivotal role in providing continuing education for nurses. This study's purpose was to explore the role and relevance of interaction factors, intrinsic motivator (i.e., flow), and extrinsic motivators (i.e., perceived usefulness (PU) and perceived ease of use (PEOU)) in explaining nurses' intention to use the e-learning system. Based on the technology acceptance model (TAM) with the flow theory, this study's research model presents three types of interaction factors, learner-system interaction, instructor-learner interaction, and learner-learner interaction to construct an extended TAM to explore nurses' intention to use the e-learning system. Sample data were gathered from nurses at two regional hospitals in Taiwan. A total of 320 questionnaires were distributed, 254 (79.375%) questionnaires were returned. Consequently, 218 usable questionnaires were analyzed in this study, with a usable response rate of 68.125%. First, confirmatory factor analysis was used to develop the measurement model. Second, to explore the causal relationships among all constructs, the structural model for the research model was tested by using structural equation modeling. First, learner-system interaction, instructor-learner interaction, and learner-learner interaction respectively had significant effects on PU, PEOU, and flow. Next, flow had significant effects on PU and PEOU, and PEOU had a significant effect on PU. Finally, the effects of flow, PU, and PEOU on intention to use were significant. Synthetically speaking, learner-system interaction, instructor-learner interaction, and learner-learner interaction can indirectly make significant
Interactive exploration of tokamak turbulence simulations in virtual reality
International Nuclear Information System (INIS)
Kerbel, G.D.; Pierce, T.; Milovich, J.L.; Shumaker, D.E.
1996-01-01
We have developed an immersive visualization system designed for interactive data exploration as an integral part of our computing environment for studying tokamak turbulence. This system of codes can reproduce the results of simulations visually for scrutiny in real time, interactively and with more realism than ever before. At peak performance, the VR system can present for view some 400 coordinated images per second. The long term vision this approach targets is a open-quote holodeck-like close-quote virtual-reality environment in which one can explore gyrofluid or gyrokinetic plasma simulations interactively and in real time, visually, with concurrent simulations of experimental diagnostic devices. In principle, such a open-quote virtual tokamak close-quote computed environment could be as all encompassing or as focussed as one likes, in terms of the physics involved. The computing framework in one within which a group of researchers can work together to produce a real and identifiable product with easy access to all contributions. This could be our version of NASA's next generation Numerical Wind Tunnel. The principal purpose of this VR capability for Numerical Tokamak simulation is to provide interactive visual experience to help create new ways of understanding aspects of the convective transport processes operating in tokamak fusion experiments. The effectiveness of the visualization method is strongly dependent on the density of frame-to-frame correlation. Below a threshold of this quantity, short term visual memory does not bridge the gap between frames well enough for there to exist a strong visual connection. Above the threshold, evolving structures appear clearly. The visualizations show the 3D structure of vortex evolution and the gyrofluid motion associated with it. We discovered that it was very helpful for visualizing the cross field flows to compress the virtual world in the toroidal angle
Kolbe, Michaela; Marty, Adrian; Seelandt, Julia; Grande, Bastian
2016-01-01
We submit that interaction patterns within healthcare teams should be more comprehensively explored during debriefings in simulation-based training because of their importance for clinical performance. We describe how circular questions can be used for that purpose. Circular questions are based on social constructivism. They include a variety of systemic interviewing methods. The goals of circular questions are to explore the mutual dependency of team members' behavior and recurrent behavior patterns, to generate information, to foster perspective taking, to "fluidize" problems, and to put actions into relational contexts. We describe the nature of circular questions, the benefits they offer, and ways of applying them during debriefings.
Exploration of Metagenome Assemblies with an Interactive Visualization Tool
Energy Technology Data Exchange (ETDEWEB)
Cantor, Michael; Nordberg, Henrik; Smirnova, Tatyana; Andersen, Evan; Tringe, Susannah; Hess, Matthias; Dubchak, Inna
2014-07-09
Metagenomics, one of the fastest growing areas of modern genomic science, is the genetic profiling of the entire community of microbial organisms present in an environmental sample. Elviz is a web-based tool for the interactive exploration of metagenome assemblies. Elviz can be used with publicly available data sets from the Joint Genome Institute or with custom user-loaded assemblies. Elviz is available at genome.jgi.doe.gov/viz
Fabric-circle-slider: Prototype Exploring the Interaction Aesthetic of Contextual Integration
Zimmerman, J.; Hurst, A.K.; Peeters, M.M.R.
2007-01-01
Abstract Traditionally, designers have explored the aesthetics of interaction through the relationship between the product form and the activity people use it for. However, in the increasing complexity of interconnected and multi-activity devices in the home, aesthetics have been sacrificed in a
van Kollenburg, J.W.M.; Bogers, S.J.A.; Rutjes, H.; Deckers, E.J.L.; Frens, J.W.; Hummels, C.C.M.
2018-01-01
This paper presents a designerly exploration of the potential values of parent-tracked baby data in interactions between parents and healthcare professionals (HCPs). Where previous work has used parent-tracked data as part of the solution to a problem, we contribute by starting our design
Görg, Carsten; Liu, Zhicheng; Kihm, Jaeyeon; Choo, Jaegul; Park, Haesun; Stasko, John
2013-10-01
Investigators across many disciplines and organizations must sift through large collections of text documents to understand and piece together information. Whether they are fighting crime, curing diseases, deciding what car to buy, or researching a new field, inevitably investigators will encounter text documents. Taking a visual analytics approach, we integrate multiple text analysis algorithms with a suite of interactive visualizations to provide a flexible and powerful environment that allows analysts to explore collections of documents while sensemaking. Our particular focus is on the process of integrating automated analyses with interactive visualizations in a smooth and fluid manner. We illustrate this integration through two example scenarios: an academic researcher examining InfoVis and VAST conference papers and a consumer exploring car reviews while pondering a purchase decision. Finally, we provide lessons learned toward the design and implementation of visual analytics systems for document exploration and understanding.
Yan Bingsheng; Li Lihua; Sun Hongtao
2017-01-01
This article explored the effect of instrumental interaction and relational interaction on consumer engagement (community engagement and brand engagement) among community members. The mediating effect of E-social capital was investigated as well. The research results showed that: both instrumental interaction and interpersonal interaction promote the formation of E-social capital (online trust and online reciprocity); online trust plays a partial mediating role between community interaction (...
Peer-to-Peer Human-Robot Interaction for Space Exploration
Fong, Terrence; Nourbakhsh, Illah
2004-01-01
NASA has embarked on a long-term program to develop human-robot systems for sustained, affordable space exploration. To support this mission, we are working to improve human-robot interaction and performance on planetary surfaces. Rather than building robots that function as glorified tools, our focus is to enable humans and robots to work as partners and peers. In this paper. we describe our approach, which includes contextual dialogue, cognitive modeling, and metrics-based field testing.
Exploring Plant Co-Expression and Gene-Gene Interactions with CORNET 3.0.
Van Bel, Michiel; Coppens, Frederik
2017-01-01
Selecting and filtering a reference expression and interaction dataset when studying specific pathways and regulatory interactions can be a very time-consuming and error-prone task. In order to reduce the duplicated efforts required to amass such datasets, we have created the CORNET (CORrelation NETworks) platform which allows for easy access to a wide variety of data types: coexpression data, protein-protein interactions, regulatory interactions, and functional annotations. The CORNET platform outputs its results in either text format or through the Cytoscape framework, which is automatically launched by the CORNET website.CORNET 3.0 is the third iteration of the web platform designed for the user exploration of the coexpression space of plant genomes, with a focus on the model species Arabidopsis thaliana. Here we describe the platform: the tools, data, and best practices when using the platform. We indicate how the platform can be used to infer networks from a set of input genes, such as upregulated genes from an expression experiment. By exploring the network, new target and regulator genes can be discovered, allowing for follow-up experiments and more in-depth study. We also indicate how to avoid common pitfalls when evaluating the networks and how to avoid over interpretation of the results.All CORNET versions are available at http://bioinformatics.psb.ugent.be/cornet/ .
Visual exploration and analysis of human-robot interaction rules
Zhang, Hui; Boyles, Michael J.
2013-01-01
We present a novel interaction paradigm for the visual exploration, manipulation and analysis of human-robot interaction (HRI) rules; our development is implemented using a visual programming interface and exploits key techniques drawn from both information visualization and visual data mining to facilitate the interaction design and knowledge discovery process. HRI is often concerned with manipulations of multi-modal signals, events, and commands that form various kinds of interaction rules. Depicting, manipulating and sharing such design-level information is a compelling challenge. Furthermore, the closed loop between HRI programming and knowledge discovery from empirical data is a relatively long cycle. This, in turn, makes design-level verification nearly impossible to perform in an earlier phase. In our work, we exploit a drag-and-drop user interface and visual languages to support depicting responsive behaviors from social participants when they interact with their partners. For our principal test case of gaze-contingent HRI interfaces, this permits us to program and debug the robots' responsive behaviors through a graphical data-flow chart editor. We exploit additional program manipulation interfaces to provide still further improvement to our programming experience: by simulating the interaction dynamics between a human and a robot behavior model, we allow the researchers to generate, trace and study the perception-action dynamics with a social interaction simulation to verify and refine their designs. Finally, we extend our visual manipulation environment with a visual data-mining tool that allows the user to investigate interesting phenomena such as joint attention and sequential behavioral patterns from multiple multi-modal data streams. We have created instances of HRI interfaces to evaluate and refine our development paradigm. As far as we are aware, this paper reports the first program manipulation paradigm that integrates visual programming
TreePlus: interactive exploration of networks with enhanced tree layouts.
Lee, Bongshin; Parr, Cynthia S; Plaisant, Catherine; Bederson, Benjamin B; Veksler, Vladislav D; Gray, Wayne D; Kotfila, Christopher
2006-01-01
Despite extensive research, it is still difficult to produce effective interactive layouts for large graphs. Dense layout and occlusion make food webs, ontologies, and social networks difficult to understand and interact with. We propose a new interactive Visual Analytics component called TreePlus that is based on a tree-style layout. TreePlus reveals the missing graph structure with visualization and interaction while maintaining good readability. To support exploration of the local structure of the graph and gathering of information from the extensive reading of labels, we use a guiding metaphor of "Plant a seed and watch it grow." It allows users to start with a node and expand the graph as needed, which complements the classic overview techniques that can be effective at (but often limited to) revealing clusters. We describe our design goals, describe the interface, and report on a controlled user study with 28 participants comparing TreePlus with a traditional graph interface for six tasks. In general, the advantage of TreePlus over the traditional interface increased as the density of the displayed data increased. Participants also reported higher levels of confidence in their answers with TreePlus and most of them preferred TreePlus.
Exploring classical Greek construction problems with interactive geometry software
Meskens, Ad
2017-01-01
In this book the classical Greek construction problems are explored in a didactical, enquiry based fashion using Interactive Geometry Software. The book traces the history of these problems, stating them in modern terminology. By focusing on constructions and the use of GeoGebra the reader is confronted with the same problems that ancient mathematicians once faced. The reader can step into the footsteps of Euclid, Viète and Cusanus amongst others and then by experimenting and discovering geometric relationships far exceed their accomplishments. Exploring these problems with the neusis-method lets him discover a class of interesting curves. By experimenting he will gain a deeper understanding of how mathematics is created. More than 100 exercises guide him through methods which were developed to try and solve the problems. The exercises are at the level of undergraduate students and only require knowledge of elementary Euclidean geometry and pre-calculus algebra. It is especially well-suited for those student...
PDB-Explorer: a web-based interactive map of the protein data bank in shape space.
Jin, Xian; Awale, Mahendra; Zasso, Michaël; Kostro, Daniel; Patiny, Luc; Reymond, Jean-Louis
2015-10-23
The RCSB Protein Data Bank (PDB) provides public access to experimentally determined 3D-structures of biological macromolecules (proteins, peptides and nucleic acids). While various tools are available to explore the PDB, options to access the global structural diversity of the entire PDB and to perceive relationships between PDB structures remain very limited. A 136-dimensional atom pair 3D-fingerprint for proteins (3DP) counting categorized atom pairs at increasing through-space distances was designed to represent the molecular shape of PDB-entries. Nearest neighbor searches examples were reported exemplifying the ability of 3DP-similarity to identify closely related biomolecules from small peptides to enzyme and large multiprotein complexes such as virus particles. The principle component analysis was used to obtain the visualization of PDB in 3DP-space. The 3DP property space groups proteins and protein assemblies according to their 3D-shape similarity, yet shows exquisite ability to distinguish between closely related structures. An interactive website called PDB-Explorer is presented featuring a color-coded interactive map of PDB in 3DP-space. Each pixel of the map contains one or more PDB-entries which are directly visualized as ribbon diagrams when the pixel is selected. The PDB-Explorer website allows performing 3DP-nearest neighbor searches of any PDB-entry or of any structure uploaded as protein-type PDB file. All functionalities on the website are implemented in JavaScript in a platform-independent manner and draw data from a server that is updated daily with the latest PDB additions, ensuring complete and up-to-date coverage. The essentially instantaneous 3DP-similarity search with the PDB-Explorer provides results comparable to those of much slower 3D-alignment algorithms, and automatically clusters proteins from the same superfamilies in tight groups. A chemical space classification of PDB based on molecular shape was obtained using a new atom-pair 3
Directory of Open Access Journals (Sweden)
Yan Bingsheng
2017-01-01
Full Text Available This article explored the effect of instrumental interaction and relational interaction on consumer engagement (community engagement and brand engagement among community members. The mediating effect of E-social capital was investigated as well. The research results showed that: both instrumental interaction and interpersonal interaction promote the formation of E-social capital (online trust and online reciprocity; online trust plays a partial mediating role between community interaction (instrumental interaction, relational interaction and community engagement, but the influence of online reciprocity on community engagement is not significant; community engagement leads to brand engagement. The findings enrich the theories of brand community and consumer engagement and contribute to the virtual community management.
Bhuskute, Aditi; Skirko, Jonathan R; Roth, Christina; Bayoumi, Ahmed; Durbin-Johnson, Blythe; Tollefson, Travis T
2017-09-01
Patients with cleft palate and other causes of velopharyngeal insufficiency (VPI) suffer adverse effects on social interactions and communication. Measurement of these patient-reported outcomes is needed to help guide surgical and nonsurgical care. To further validate the VPI Effects on Life Outcomes (VELO) instrument, measure the change in quality of life (QOL) after speech surgery, and test the association of change in speech with change in QOL. Prospective descriptive cohort including children and young adults undergoing speech surgery for VPI in a tertiary academic center. Participants completed the validated VELO instrument before and after surgical treatment. The main outcome measures were preoperative and postoperative VELO scores and the perceptual speech assessment of speech intelligibility. The VELO scores are divided into subscale domains. Changes in VELO after surgery were analyzed using linear regression models. VELO scores were analyzed as a function of speech intelligibility adjusting for age and cleft type. The correlation between speech intelligibility rating and VELO scores was estimated using the polyserial correlation. Twenty-nine patients (13 males and 16 females) were included. Mean (SD) age was 7.9 (4.1) years (range, 4-20 years). Pharyngeal flap was used in 14 (48%) cases, Furlow palatoplasty in 12 (41%), and sphincter pharyngoplasty in 1 (3%). The mean (SD) preoperative speech intelligibility rating was 1.71 (1.08), which decreased postoperatively to 0.79 (0.93) in 24 patients who completed protocol (P Speech Intelligibility was correlated with preoperative and postoperative total VELO score (P speech intelligibility. Speech surgery improves VPI-specific quality of life. We confirmed validation in a population of untreated patients with VPI and included pharyngeal flap surgery, which had not previously been included in validation studies. The VELO instrument provides patient-specific outcomes, which allows a broader understanding of the
Crabby Interactions: Fifth Graders Explore Human Impact on the Blue Crab Population
Jeffery, Tonya D.; McCollough, Cherie A.; Moore, Kim
2016-01-01
This article describes a two-day lesson in which fifth-grade students took on the role of marine biology scientists, using their critical-thinking and problem-solving skills to explore human impact on the blue crab ecosystem. The purpose of "Crabby Interactions" was to help students understand the impact of human activities on the local…
Interactive Exploration for Continuously Expanding Neuron Databases.
Li, Zhongyu; Metaxas, Dimitris N; Lu, Aidong; Zhang, Shaoting
2017-02-15
This paper proposes a novel framework to help biologists explore and analyze neurons based on retrieval of data from neuron morphological databases. In recent years, the continuously expanding neuron databases provide a rich source of information to associate neuronal morphologies with their functional properties. We design a coarse-to-fine framework for efficient and effective data retrieval from large-scale neuron databases. In the coarse-level, for efficiency in large-scale, we employ a binary coding method to compress morphological features into binary codes of tens of bits. Short binary codes allow for real-time similarity searching in Hamming space. Because the neuron databases are continuously expanding, it is inefficient to re-train the binary coding model from scratch when adding new neurons. To solve this problem, we extend binary coding with online updating schemes, which only considers the newly added neurons and update the model on-the-fly, without accessing the whole neuron databases. In the fine-grained level, we introduce domain experts/users in the framework, which can give relevance feedback for the binary coding based retrieval results. This interactive strategy can improve the retrieval performance through re-ranking the above coarse results, where we design a new similarity measure and take the feedback into account. Our framework is validated on more than 17,000 neuron cells, showing promising retrieval accuracy and efficiency. Moreover, we demonstrate its use case in assisting biologists to identify and explore unknown neurons. Copyright © 2017 Elsevier Inc. All rights reserved.
Elastic meson-nucleon partial wave scattering analyses
International Nuclear Information System (INIS)
Arndt, R.A.
1986-01-01
Comprehensive analyses of π-n elastic scattering data below 1100 MeV(Tlab), and K+p scattering below 3 GeV/c(Plab) are discussed. Also discussed is a package of computer programs and data bases (scattering data, and solution files) through which users can ''explore'' these interactions in great detail; this package is known by the acronym SAID (for Scattering Analysis Interactive Dialin) and is accessible on VAX backup tapes, or by dialin to the VPI computers. The π-n, and k+p interactions will be described as seen through the SAID programs. A procedure will be described for generating an interpolating array from any of the solutions encoded in SAID; this array can then be used through a fortran callable subroutine (supplied as part of SAID) to give excellent amplitude reconstructions over a broad kinematic range
Explicit Instructional Interactions: Exploring the Black Box of a Tier 2 Mathematics Intervention
Doabler, Christian T.; Clarke, Ben; Stoolmiller, Mike; Kosty, Derek B.; Fien, Hank; Smolkowski, Keith; Baker, Scott K.
2017-01-01
A critical aspect of intervention research is investigating the active ingredients that underlie intensive interventions and their theories of change. This study explored the rate of instructional interactions within treatment groups to determine whether they offered explanatory power of an empirically validated Tier 2 kindergarten mathematics…
Exploring user-producer interaction in an online community : The case of Habbo Hotel
Slot, M.
2009-01-01
This article attempts to explore the user-producer interaction in the online community of Habbo Hotel. Based on desk research, interviews, an online survey among more than 3000 Habbo Hotel users in The Netherlands and online discussion groups with 45 Habbos, three specific issues that illustrate the
Exploring solidarity and consensus in English as lingua franca interactions
DEFF Research Database (Denmark)
Kappa, Katherine
2016-01-01
The purpose of this paper is two-fold: (1) to problematise the overly affiliative interpretations of English as lingua franca (ELF) interactions across all contexts and combinations of people, and demonstrate instances where this is not the case; (2) to explore the role of laughables and laughter...... divergence in social norms is treated as if it were the case but not confirmed. These instances are dealt with through laughables and laughter sequences. Sequential analysis of these naturally occurring audio-recorded conversations indicate that participants make salient and orient to what...
iELM—a web server to explore short linear motif-mediated interactions
Weatheritt, Robert J.; Jehl, Peter; Dinkel, Holger; Gibson, Toby J.
2012-01-01
The recent expansion in our knowledge of protein–protein interactions (PPIs) has allowed the annotation and prediction of hundreds of thousands of interactions. However, the function of many of these interactions remains elusive. The interactions of Eukaryotic Linear Motif (iELM) web server provides a resource for predicting the function and positional interface for a subset of interactions mediated by short linear motifs (SLiMs). The iELM prediction algorithm is based on the annotated SLiM classes from the Eukaryotic Linear Motif (ELM) resource and allows users to explore both annotated and user-generated PPI networks for SLiM-mediated interactions. By incorporating the annotated information from the ELM resource, iELM provides functional details of PPIs. This can be used in proteomic analysis, for example, to infer whether an interaction promotes complex formation or degradation. Furthermore, details of the molecular interface of the SLiM-mediated interactions are also predicted. This information is displayed in a fully searchable table, as well as graphically with the modular architecture of the participating proteins extracted from the UniProt and Phospho.ELM resources. A network figure is also presented to aid the interpretation of results. The iELM server supports single protein queries as well as large-scale proteomic submissions and is freely available at http://i.elm.eu.org. PMID:22638578
Interactive exploration of large-scale time-varying data using dynamic tracking graphs
Widanagamaachchi, W.
2012-10-01
Exploring and analyzing the temporal evolution of features in large-scale time-varying datasets is a common problem in many areas of science and engineering. One natural representation of such data is tracking graphs, i.e., constrained graph layouts that use one spatial dimension to indicate time and show the "tracks" of each feature as it evolves, merges or disappears. However, for practical data sets creating the corresponding optimal graph layouts that minimize the number of intersections can take hours to compute with existing techniques. Furthermore, the resulting graphs are often unmanageably large and complex even with an ideal layout. Finally, due to the cost of the layout, changing the feature definition, e.g. by changing an iso-value, or analyzing properly adjusted sub-graphs is infeasible. To address these challenges, this paper presents a new framework that couples hierarchical feature definitions with progressive graph layout algorithms to provide an interactive exploration of dynamically constructed tracking graphs. Our system enables users to change feature definitions on-the-fly and filter features using arbitrary attributes while providing an interactive view of the resulting tracking graphs. Furthermore, the graph display is integrated into a linked view system that provides a traditional 3D view of the current set of features and allows a cross-linked selection to enable a fully flexible spatio-temporal exploration of data. We demonstrate the utility of our approach with several large-scale scientific simulations from combustion science. © 2012 IEEE.
Fast interactive exploration of 4D MRI flow data
Hennemuth, A.; Friman, O.; Schumann, C.; Bock, J.; Drexl, J.; Huellebrand, M.; Markl, M.; Peitgen, H.-O.
2011-03-01
1- or 2-directional MRI blood flow mapping sequences are an integral part of standard MR protocols for diagnosis and therapy control in heart diseases. Recent progress in rapid MRI has made it possible to acquire volumetric, 3-directional cine images in reasonable scan time. In addition to flow and velocity measurements relative to arbitrarily oriented image planes, the analysis of 3-dimensional trajectories enables the visualization of flow patterns, local features of flow trajectories or possible paths into specific regions. The anatomical and functional information allows for advanced hemodynamic analysis in different application areas like stroke risk assessment, congenital and acquired heart disease, aneurysms or abdominal collaterals and cranial blood flow. The complexity of the 4D MRI flow datasets and the flow related image analysis tasks makes the development of fast comprehensive data exploration software for advanced flow analysis a challenging task. Most existing tools address only individual aspects of the analysis pipeline such as pre-processing, quantification or visualization, or are difficult to use for clinicians. The goal of the presented work is to provide a software solution that supports the whole image analysis pipeline and enables data exploration with fast intuitive interaction and visualization methods. The implemented methods facilitate the segmentation and inspection of different vascular systems. Arbitrary 2- or 3-dimensional regions for quantitative analysis and particle tracing can be defined interactively. Synchronized views of animated 3D path lines, 2D velocity or flow overlays and flow curves offer a detailed insight into local hemodynamics. The application of the analysis pipeline is shown for 6 cases from clinical practice, illustrating the usefulness for different clinical questions. Initial user tests show that the software is intuitive to learn and even inexperienced users achieve good results within reasonable processing
Coaching the exploration and exploitation in active learning for interactive video retrieval.
Wei, Xiao-Yong; Yang, Zhen-Qun
2013-03-01
Conventional active learning approaches for interactive video/image retrieval usually assume the query distribution is unknown, as it is difficult to estimate with only a limited number of labeled instances available. Thus, it is easy to put the system in a dilemma whether to explore the feature space in uncertain areas for a better understanding of the query distribution or to harvest in certain areas for more relevant instances. In this paper, we propose a novel approach called coached active learning that makes the query distribution predictable through training and, therefore, avoids the risk of searching on a completely unknown space. The estimated distribution, which provides a more global view of the feature space, can be used to schedule not only the timing but also the step sizes of the exploration and the exploitation in a principled way. The results of the experiments on a large-scale data set from TRECVID 2005-2009 validate the efficiency and effectiveness of our approach, which demonstrates an encouraging performance when facing domain-shift, outperforms eight conventional active learning methods, and shows superiority to six state-of-the-art interactive video retrieval systems.
Choi, Insook
2018-01-01
Sonification is an open-ended design task to construct sound informing a listener of data. Understanding application context is critical for shaping design requirements for data translation into sound. Sonification requires methodology to maintain reproducibility when data sources exhibit non-linear properties of self-organization and emergent behavior. This research formalizes interactive sonification in an extensible model to support reproducibility when data exhibits emergent behavior. In the absence of sonification theory, extensibility demonstrates relevant methods across case studies. The interactive sonification framework foregrounds three factors: reproducible system implementation for generating sonification; interactive mechanisms enhancing a listener's multisensory observations; and reproducible data from models that characterize emergent behavior. Supramodal attention research suggests interactive exploration with auditory feedback can generate context for recognizing irregular patterns and transient dynamics. The sonification framework provides circular causality as a signal pathway for modeling a listener interacting with emergent behavior. The extensible sonification model adopts a data acquisition pathway to formalize functional symmetry across three subsystems: Experimental Data Source, Sound Generation, and Guided Exploration. To differentiate time criticality and dimensionality of emerging dynamics, tuning functions are applied between subsystems to maintain scale and symmetry of concurrent processes and temporal dynamics. Tuning functions accommodate sonification design strategies that yield order parameter values to render emerging patterns discoverable as well as rehearsable, to reproduce desired instances for clinical listeners. Case studies are implemented with two computational models, Chua's circuit and Swarm Chemistry social agent simulation, generating data in real-time that exhibits emergent behavior. Heuristic Listening is introduced
Directory of Open Access Journals (Sweden)
Insook Choi
2018-04-01
Full Text Available Sonification is an open-ended design task to construct sound informing a listener of data. Understanding application context is critical for shaping design requirements for data translation into sound. Sonification requires methodology to maintain reproducibility when data sources exhibit non-linear properties of self-organization and emergent behavior. This research formalizes interactive sonification in an extensible model to support reproducibility when data exhibits emergent behavior. In the absence of sonification theory, extensibility demonstrates relevant methods across case studies. The interactive sonification framework foregrounds three factors: reproducible system implementation for generating sonification; interactive mechanisms enhancing a listener's multisensory observations; and reproducible data from models that characterize emergent behavior. Supramodal attention research suggests interactive exploration with auditory feedback can generate context for recognizing irregular patterns and transient dynamics. The sonification framework provides circular causality as a signal pathway for modeling a listener interacting with emergent behavior. The extensible sonification model adopts a data acquisition pathway to formalize functional symmetry across three subsystems: Experimental Data Source, Sound Generation, and Guided Exploration. To differentiate time criticality and dimensionality of emerging dynamics, tuning functions are applied between subsystems to maintain scale and symmetry of concurrent processes and temporal dynamics. Tuning functions accommodate sonification design strategies that yield order parameter values to render emerging patterns discoverable as well as rehearsable, to reproduce desired instances for clinical listeners. Case studies are implemented with two computational models, Chua's circuit and Swarm Chemistry social agent simulation, generating data in real-time that exhibits emergent behavior. Heuristic
Exploring complex miRNA-mRNA interactions with Bayesian networks by splitting-averaging strategy
Directory of Open Access Journals (Sweden)
Liu Lin
2009-12-01
Full Text Available Abstract Background microRNAs (miRNAs regulate target gene expression by controlling their mRNAs post-transcriptionally. Increasing evidence demonstrates that miRNAs play important roles in various biological processes. However, the functions and precise regulatory mechanisms of most miRNAs remain elusive. Current research suggests that miRNA regulatory modules are complicated, including up-, down-, and mix-regulation for different physiological conditions. Previous computational approaches for discovering miRNA-mRNA interactions focus only on down-regulatory modules. In this work, we present a method to capture complex miRNA-mRNA interactions including all regulatory types between miRNAs and mRNAs. Results We present a method to capture complex miRNA-mRNA interactions using Bayesian network structure learning with splitting-averaging strategy. It is designed to explore all possible miRNA-mRNA interactions by integrating miRNA-targeting information, expression profiles of miRNAs and mRNAs, and sample categories. We also present an analysis of data sets for epithelial and mesenchymal transition (EMT. Our results show that the proposed method identified all possible types of miRNA-mRNA interactions from the data. Many interactions are of tremendous biological significance. Some discoveries have been validated by previous research, for example, the miR-200 family negatively regulates ZEB1 and ZEB2 for EMT. Some are consistent with the literature, such as LOX has wide interactions with the miR-200 family members for EMT. Furthermore, many novel interactions are statistically significant and worthy of validation in the near future. Conclusions This paper presents a new method to explore the complex miRNA-mRNA interactions for different physiological conditions using Bayesian network structure learning with splitting-averaging strategy. The method makes use of heterogeneous data including miRNA-targeting information, expression profiles of miRNAs and
Lexén, Annika; Bejerholm, Ulrika
2016-07-01
Not all people with severe mental illness who attend Individual Placement and Support (IPS) gain and keep their jobs or work full time. Research has indicated a relationship between social disabilities and work performance in this group, and that support provided is often directed towards the social work environment. However, relationships between social skills performed in an authentic work setting and vocational outcomes have not been explored. To explore relationships between social communication and interaction skills and vocational outcomes among IPS service users in a Swedish context. Twenty-nine participants were appraised with the Assessment of Communication and Interaction Skills (ACIS-S) instrument, and their vocational data were registered. Correlations were estimated using Spearman's rho test with Bonferroni corrections at item level. Better communication and interaction skills were significantly correlated with increased working hours (rs = 0.64) and higher income (rs = 0.45). Increased working hours were related to assuming postures, asking questions, sharing information, and sustaining conversation in an appropriate manner. The results indicate that occupational therapists need to focus on social skills and accommodation of the social work environment in order to promote sustainable working careers among people with severe mental illness.
Cruzeiro, Vinícius Wilian D.; Roitberg, Adrian; Polfer, Nicolas C.
2016-01-01
In this work we are going to present how an interactive platform can be used as a powerful tool to allow students to better explore a foundational problem in quantum chemistry: the application of the variational method to the dihydrogen molecule using simple Gaussian trial functions. The theoretical approach for the hydrogen atom is quite…
Towards Interactive Visual Exploration of Parallel Programs using a Domain-Specific Language
Klein, Tobias; Bruckner, Stefan; Grö ller, M. Eduard; Hadwiger, Markus; Rautek, Peter
2016-01-01
The use of GPUs and the massively parallel computing paradigm have become wide-spread. We describe a framework for the interactive visualization and visual analysis of the run-time behavior of massively parallel programs, especially OpenCL kernels. This facilitates understanding a program's function and structure, finding the causes of possible slowdowns, locating program bugs, and interactively exploring and visually comparing different code variants in order to improve performance and correctness. Our approach enables very specific, user-centered analysis, both in terms of the recording of the run-time behavior and the visualization itself. Instead of having to manually write instrumented code to record data, simple code annotations tell the source-to-source compiler which code instrumentation to generate automatically. The visualization part of our framework then enables the interactive analysis of kernel run-time behavior in a way that can be very specific to a particular problem or optimization goal, such as analyzing the causes of memory bank conflicts or understanding an entire parallel algorithm.
Towards Interactive Visual Exploration of Parallel Programs using a Domain-Specific Language
Klein, Tobias
2016-04-19
The use of GPUs and the massively parallel computing paradigm have become wide-spread. We describe a framework for the interactive visualization and visual analysis of the run-time behavior of massively parallel programs, especially OpenCL kernels. This facilitates understanding a program\\'s function and structure, finding the causes of possible slowdowns, locating program bugs, and interactively exploring and visually comparing different code variants in order to improve performance and correctness. Our approach enables very specific, user-centered analysis, both in terms of the recording of the run-time behavior and the visualization itself. Instead of having to manually write instrumented code to record data, simple code annotations tell the source-to-source compiler which code instrumentation to generate automatically. The visualization part of our framework then enables the interactive analysis of kernel run-time behavior in a way that can be very specific to a particular problem or optimization goal, such as analyzing the causes of memory bank conflicts or understanding an entire parallel algorithm.
VIGOR: Interactive Visual Exploration of Graph Query Results.
Pienta, Robert; Hohman, Fred; Endert, Alex; Tamersoy, Acar; Roundy, Kevin; Gates, Chris; Navathe, Shamkant; Chau, Duen Horng
2018-01-01
Finding patterns in graphs has become a vital challenge in many domains from biological systems, network security, to finance (e.g., finding money laundering rings of bankers and business owners). While there is significant interest in graph databases and querying techniques, less research has focused on helping analysts make sense of underlying patterns within a group of subgraph results. Visualizing graph query results is challenging, requiring effective summarization of a large number of subgraphs, each having potentially shared node-values, rich node features, and flexible structure across queries. We present VIGOR, a novel interactive visual analytics system, for exploring and making sense of query results. VIGOR uses multiple coordinated views, leveraging different data representations and organizations to streamline analysts sensemaking process. VIGOR contributes: (1) an exemplar-based interaction technique, where an analyst starts with a specific result and relaxes constraints to find other similar results or starts with only the structure (i.e., without node value constraints), and adds constraints to narrow in on specific results; and (2) a novel feature-aware subgraph result summarization. Through a collaboration with Symantec, we demonstrate how VIGOR helps tackle real-world problems through the discovery of security blindspots in a cybersecurity dataset with over 11,000 incidents. We also evaluate VIGOR with a within-subjects study, demonstrating VIGOR's ease of use over a leading graph database management system, and its ability to help analysts understand their results at higher speed and make fewer errors.
International Nuclear Information System (INIS)
Nishio, Machiko; Tsurudome, Masato; Ito, Morihiro; Kawano, Mitsuo; Komada, Hiroshi; Ito, Yasuhiko
2003-01-01
It is commonly accepted that the temperature-sensitive phenotype of Sendai virus (SeV) persistently infected cells is caused by the M and/or HN proteins. Expression level of the L, M, HN, and V proteins is extremely low in L929 cells persistently infected with SeVpi (L929/SeVpi cells) incubated at 38 deg. C. The HN protein quickly disappears in L929/SeVpi cells following a temperature shift up to 38 deg. C, and pulse-chase experiments show that the Lpi, HNpi, and Mpi proteins are unstable at 38 deg. C. Following a temperature shift either upward or downward, M protein is translocated into the nucleus and then localizes to the perinuclear region. None of virus-specific polypeptides are detected in the cells primarily infected with SeVpi and incubated at 38 deg. C and virus proteins are not pulse-labeled at 38 deg. C, indicating that temperature-sensitive step is at an early stage of infection. The Mpi protein is transiently located in the nucleus of the SeVpi primarily infected cells. Recombinant SeVs possessing the HNpi or/and Mpi proteins are not temperature-sensitive. The HN protein is expressed at very low levels and the F protein localizes to the perinuclear region in rSeV(Mpi)-infected cells incubated at 38 deg. C for 18 h. rSeVs having the Mpi protein exhibit lower cytotoxicity and are incapable of establishing persistent infection. Amino acid 116 of the Mpi protein is related to the nuclear translocation and lower cytopathogenesis, whereas aa183 is involved in the interaction between M protein and viral glycoproteins
Energy Technology Data Exchange (ETDEWEB)
Zhu, Jie [Virginia Polytechnic Inst. and State Univ. (Virginia Tech), Blacksburg, VA (United States). Dept. of Chemistry; Usov, Pavel M. [Virginia Polytechnic Inst. and State Univ. (Virginia Tech), Blacksburg, VA (United States). Dept. of Chemistry; Xu, Wenqian [Argonne National Lab. (ANL), Argonne, IL (United States). Advanced Photon Source (APS) and X-ray Science Division; Celis-Salazar, Paula J. [Virginia Polytechnic Inst. and State Univ. (Virginia Tech), Blacksburg, VA (United States). Dept. of Chemistry; Lin, Shaoyang [Virginia Polytechnic Inst. and State Univ. (Virginia Tech), Blacksburg, VA (United States). Dept. of Chemistry; Kessinger, Matthew C. [Virginia Polytechnic Inst. and State Univ. (Virginia Tech), Blacksburg, VA (United States). Dept. of Chemistry; Landaverde-Alvarado, Carlos [Virginia Polytechnic Inst. and State Univ. (Virginia Tech), Blacksburg, VA (United States). Dept. of Chemical Engineering and Macromolecules Innovation Inst.; Cai, Meng [Virginia Polytechnic Inst. and State Univ. (Virginia Tech), Blacksburg, VA (United States). Dept. of Chemistry; May, Ann M. [Virginia Polytechnic Inst. and State Univ. (Virginia Tech), Blacksburg, VA (United States). Dept. of Chemistry; Slebodnick, Carla [Virginia Polytechnic Inst. and State Univ. (Virginia Tech), Blacksburg, VA (United States). Dept. of Chemistry; Zhu, Dunru [Nanjing Univ. of Technology (China). State Key Lab. of Materials-Oriented Chemical Engineering (MCE) and College of Chemical Engineering; Senanayake, Sanjaya D. [Brookhaven National Lab. (BNL), Upton, NY (United States). Dept. of Chemistry; Morris, Amanda J. [Virginia Polytechnic Inst. and State Univ. (Virginia Tech), Blacksburg, VA (United States). Dept. of Chemistry and Macromolecules Innovation Inst.
2017-12-22
Metal-organic frameworks (MOFs) have shown great promise in catalysis, mainly due to their high content of active centers, large internal surface areas, tunable pore size, and versatile chemical functionalities. However, it is a challenge to rationally design and construct MOFs that can serve as highly stable and reusable heterogeneous catalysts. Here two new robust 3D porous metal-cyclam-based zirconium MOFs, denoted VPI-100 (Cu) and VPI-100 (Ni), have been prepared by a modulated synthetic strategy. The frameworks are assembled by eight-connected Zr-6 clusters and metallocyclams as organic linkers. Importantly, the cyclam core has accessible axial coordination sites for guest interactions and maintains the electronic properties exhibited by the parent cyclam ring. The VPI-100 MOFs exhibit excellent chemical stability in various organic and aqueous solvents over a wide pH range and show high CO2 uptake capacity (up to similar to 9.83 wt% adsorption at 273 K under 1 atm). Moreover, VPI-100 MOFs demonstrate some of the highest reported catalytic activity values (turnover frequency and conversion efficiency) among Zr-based MOFs for the chemical fixation of CO2 with epoxides, including sterically hindered epoxides. The MOFs, which bear dual catalytic sites (Zr and Cu/Ni), enable chemistry not possible with the cyclam ligand under the same conditions and can be used as recoverable stable heterogeneous catalysts without losing performance.
DEFF Research Database (Denmark)
Ravn, Susanne
Based on an evaluation of a national dance project in Denmark, this paper explores how the sensing and moving body is essentially shaped in the mutual affaires of interaction. The national project, running from 2014-2017, was led by The Dancehalls, funded by 2.7 mill. Euro, and involved more than...
Directory of Open Access Journals (Sweden)
C. Eichler
2015-12-01
Full Text Available Improving the understanding of strongly correlated quantum many-body systems such as gases of interacting atoms or electrons is one of the most important challenges in modern condensed matter physics, materials research, and chemistry. Enormous progress has been made in the past decades in developing both classical and quantum approaches to calculate, simulate, and experimentally probe the properties of such systems. In this work, we use a combination of classical and quantum methods to experimentally explore the properties of an interacting quantum gas by creating experimental realizations of continuous matrix product states—a class of states that has proven extremely powerful as a variational ansatz for numerical simulations. By systematically preparing and probing these states using a circuit quantum electrodynamics system, we experimentally determine a good approximation to the ground-state wave function of the Lieb-Liniger Hamiltonian, which describes an interacting Bose gas in one dimension. Since the simulated Hamiltonian is encoded in the measurement observable rather than the controlled quantum system, this approach has the potential to apply to a variety of models including those involving multicomponent interacting fields. Our findings also hint at the possibility of experimentally exploring general properties of matrix product states and entanglement theory. The scheme presented here is applicable to a broad range of systems exploiting strong and tunable light-matter interactions.
Shelton, Catharyn C.; Warren, Annie E.; Archambault, Leanna M.
2016-01-01
This study explores interactive digital storytelling in a university hybrid course. Digital stories leverage imagery and narrative-based content to explore concepts, while appealing to millennials. When digital storytelling is used as the main source of course content, tensions arise regarding how to engage and support student learning while…
Braun, C.H.J.M.
2013-01-01
This article explores the nature of long-term interactions between bureaucrats and interest groups by examining two behavioral logics associated with stability in public policy making. In addition to the implicit short-term strategic choices that usually feature in resource-exchange explanations of
Seok Lyoo, Won; Wook Cha, Jin; Young Kwak, Kun; Jae Lee, Young; Yong Jeon, Han; Sik Chung, Yong; Kyun Noh, Seok
2010-06-01
To prepare Poly(vinyl pivalate/vinyl acetate) [P(VPi/VAc)] microspheres with radiopacity, the suspension copolymerization approach in the presence of aqueous radiopaque nanoparticles was used. After, The P(VPi/VAc) microspheres with radiopacity were saponified in heterogeneous system, and then P(VPi/VAc) microspheres without aggregates were converted to s-PVA/P(VPi/VAc) microspheres of skin/core structure through the heterogeneous surface saponification. Radiopacity of microspheres was confirmed with Computed tomography (CT).
Lin, Yu-Tzu; Chen, Ming-Puu; Chang, Chia-Hu; Chang, Pu-Chen
2017-01-01
The benefits of social learning have been recognized by existing research. To explore knowledge distribution in social learning and its effects on learning achievement, we developed a social learning platform and explored students' behaviors of peer interactions by the proposed algorithms based on social network analysis. An empirical study was…
Roberts, Amy; LoCasale-Crouch, Jennifer; Hamre, Bridget; DeCoster, Jamie
2016-01-01
Research Findings: This study explored the role Head Start teachers' (n = 355) depressive symptoms play in their interactions with children and in children's (n = 2,203) social-emotional development, specifically changes in children's problem behaviors and social skills as reported by parents and teachers during the preschool year. Results of the…
Exploring governmentality as interaction
DEFF Research Database (Denmark)
Fahnøe, Kristian
from an interactionistic perspective, based on Goffman’s dramaturgy. The focal point is how Goffman's concepts of interaction order, rituals, role and role performance might be an point of entry for studying the techniques the self and the techniques of domination through which governmentality operates...
Huang, Juyang
2002-08-01
Experimental evidences have indicated that cholesterol may adapt highly regular lateral distributions (i.e., superlattices) in a phospholipid bilayer. We investigated the formations of superlattices at cholesterol mole fraction of 0.154, 0.25, 0.40, and 0.5 using Monte Carlo simulation. We found that in general, conventional pairwise-additive interactions cannot produce superlattices. Instead, a multibody (nonpairwise) interaction is required. Cholesterol superlattice formation reveals that although the overall interaction between cholesterol and phospholipids is favorable, it contains two large opposing components: an interaction favoring cholesterol-phospholipid mixing and an unfavorable acyl chain multibody interaction that increases nonlinearly with the number of cholesterol contacts. The magnitudes of interactions are in the order of kT. The physical origins of these interactions can be explained by our umbrella model. They most likely come from the requirement for polar phospholipid headgroups to cover the nonpolar cholesterol to avoid the exposure of cholesterol to water and from the sharp decreasing of acyl chain conformation entropy due to cholesterol contact. This study together with our previous work demonstrate that the driving force of cholesterol-phospholipid mixing is a hydrophobic interaction, and multibody interactions dominate others over a wide range of cholesterol concentration.
Krehl, Claudia; Sharples, Sarah
2012-01-01
The paper investigates the requirements for multimodal interaction on mobile devices in an end-to-end journey context. Traditional interfaces are deemed cumbersome and inefficient for exchanging information with the user. Multimodal interaction provides a different user-centred approach allowing for more natural and intuitive interaction between humans and computers. It is especially suitable for mobile interaction as it can overcome additional constraints including small screens, awkward keypads, and continuously changing settings - an inherent property of mobility. This paper is based on end-to-end journeys where users encounter several contexts during their journeys. Interviews and focus groups explore the requirements for multimodal interaction design for mobile devices by examining journey stages and identifying the users' information needs and sources. Findings suggest that multimodal communication is crucial when users multitask. Choosing suitable modalities depend on user context, characteristics and tasks.
Visual exploration of movement and event data with interactive time masks
Directory of Open Access Journals (Sweden)
Natalia Andrienko
2017-03-01
Full Text Available We introduce the concept of time mask, which is a type of temporal filter suitable for selection of multiple disjoint time intervals in which some query conditions fulfil. Such a filter can be applied to time-referenced objects, such as events and trajectories, for selecting those objects or segments of trajectories that fit in one of the selected time intervals. The selected subsets of objects or segments are dynamically summarized in various ways, and the summaries are represented visually on maps and/or other displays to enable exploration. The time mask filtering can be especially helpful in analysis of disparate data (e.g., event records, positions of moving objects, and time series of measurements, which may come from different sources. To detect relationships between such data, the analyst may set query conditions on the basis of one dataset and investigate the subsets of objects and values in the other datasets that co-occurred in time with these conditions. We describe the desired features of an interactive tool for time mask filtering and present a possible implementation of such a tool. By example of analysing two real world data collections related to aviation and maritime traffic, we show the way of using time masks in combination with other types of filters and demonstrate the utility of the time mask filtering. Keywords: Data visualization, Interactive visualization, Interaction technique
Acoustic analysis of voice in children with cleft palate and velopharyngeal insufficiency.
Villafuerte-Gonzalez, Rocio; Valadez-Jimenez, Victor M; Hernandez-Lopez, Xochiquetzal; Ysunza, Pablo Antonio
2015-07-01
Acoustic analysis of voice can provide instrumental data concerning vocal abnormalities. These findings can be used for monitoring clinical course in cases of voice disorders. Cleft palate severely affects the structure of the vocal tract. Hence, voice quality can also be also affected. To study whether the main acoustic parameters of voice, including fundamental frequency, shimmer and jitter are significantly different in patients with a repaired cleft palate, as compared with normal children without speech, language and voice disorders. Fourteen patients with repaired unilateral cleft lip and palate and persistent or residual velopharyngeal insufficiency (VPI) were studied. A control group was assembled with healthy volunteer subjects matched by age and gender. Hypernasality and nasal emission were perceptually assessed in patients with VPI. Size of the gap as assessed by videonasopharyngoscopy was classified in patients with VPI. Acoustic analysis of voice including Fundamental frequency (F0), shimmer and jitter were compared between patients with VPI and control subjects. F0 was significantly higher in male patients as compared with male controls. Shimmer was significantly higher in patients with VPI regardless of gender. Moreover, patients with moderate VPI showed a significantly higher shimmer perturbation, regardless of gender. Although future research regarding voice disorders in patients with VPI is needed, at the present time it seems reasonable to include strategies for voice therapy in the speech and language pathology intervention plan for patients with VPI. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.
SOSPEX, an interactive tool to explore SOFIA spectral cubes
Fadda, Dario; Chambers, Edward T.
2018-01-01
We present SOSPEX (SOFIA SPectral EXplorer), an interactive tool to visualize and analyze spectral cubes obtained with the FIFI-LS and GREAT instruments onboard the SOFIA Infrared Observatory. This software package is written in Python 3 and it is available either through Github or Anaconda.Through this GUI it is possible to explore directly the spectral cubes produced by the SOFIA pipeline and archived in the SOFIA Science Archive. Spectral cubes are visualized showing their spatial and spectral dimensions in two different windows. By selecting a part of the spectrum, the flux from the corresponding slice of the cube is visualized in the spatial window. On the other hand, it is possible to define apertures on the spatial window to show the corresponding spectral energy distribution in the spectral window.Flux isocontours can be overlapped to external images in the spatial window while line names, atmospheric transmission, or external spectra can be overplotted on the spectral window. Atmospheric models with specific parameters can be retrieved, compared to the spectra and applied to the uncorrected FIFI-LS cubes in the cases where the standard values give unsatisfactory results. Subcubes can be selected and saved as FITS files by cropping or cutting the original cubes. Lines and continuum can be fitted in the spectral window saving the results in Jyson files which can be reloaded later. Finally, in the case of spatially extended observations, it is possible to compute spectral momenta as a function of the position to obtain velocity dispersion maps or velocity diagrams.
[The study of assessing methods for velopharyngeal function in patients with operated cleft palate
Zhang, Z Y; Yuan, W H; Xia, J; Liu, H
1994-03-01
This paper describes the study and quantitative analysis of velopharyngeal function in 103 patients with operated cleft palate using NPF,vedio-camera system and computer.The percentange of semi-circluar and circular closure patterns after surgery was distinct higher in VPI group than in VPC group,but coronary closure pattern was significant lower in VPI group than in VPC group(P<0.05).We compared the results of different operative age by VPI after surgery.The results showed that postoperative RVPI was in direct proportion to operated age.VPI in the group less than 3 years of age.VPI in the group less than 3 years of age was 28.57%,but in the group of over 7 years of age was 96.43%.Both showed significant difference(P<0.01).
Interaction Challenges in Human-Robot Space Exploration
Fong, Terrence; Nourbakhsh, Illah
2005-01-01
In January 2004, NASA established a new, long-term exploration program to fulfill the President's Vision for U.S. Space Exploration. The primary goal of this program is to establish a sustained human presence in space, beginning with robotic missions to the Moon in 2008, followed by extended human expeditions to the Moon as early as 2015. In addition, the program places significant emphasis on the development of joint human-robot systems. A key difference from previous exploration efforts is that future space exploration activities must be sustainable over the long-term. Experience with the space station has shown that cost pressures will keep astronaut teams small. Consequently, care must be taken to extend the effectiveness of these astronauts well beyond their individual human capacity. Thus, in order to reduce human workload, costs, and fatigue-driven error and risk, intelligent robots will have to be an integral part of mission design.
An Interactive Visualization Framework to Support Exploration and Analysis of TBI/PTSD Clinical Data
2017-05-01
to (1) extend our interactive visual analytic framework which combines multiple clinical measurements to allow it to be used to explore large...18. NUMBER OF PAGES 16 19a. NAME OF RESPONSIBLE PERSON a. REPORT b. ABSTRACT c. THIS PAGE 19b. TELEPHONE NUMBER (include area code) jmolstre...stress disorder (PTSD) and complex comorbid conditions. See attached paper for more information about VISXplore. Figure 1: Screenshot of our VisXplore
Exploring overlapping functional units with various structure in protein interaction networks.
Directory of Open Access Journals (Sweden)
Xiao-Fei Zhang
Full Text Available Revealing functional units in protein-protein interaction (PPI networks are important for understanding cellular functional organization. Current algorithms for identifying functional units mainly focus on cohesive protein complexes which have more internal interactions than external interactions. Most of these approaches do not handle overlaps among complexes since they usually allow a protein to belong to only one complex. Moreover, recent studies have shown that other non-cohesive structural functional units beyond complexes also exist in PPI networks. Thus previous algorithms that just focus on non-overlapping cohesive complexes are not able to present the biological reality fully. Here, we develop a new regularized sparse random graph model (RSRGM to explore overlapping and various structural functional units in PPI networks. RSRGM is principally dominated by two model parameters. One is used to define the functional units as groups of proteins that have similar patterns of connections to others, which allows RSRGM to detect non-cohesive structural functional units. The other one is used to represent the degree of proteins belonging to the units, which supports a protein belonging to more than one revealed unit. We also propose a regularizer to control the smoothness between the estimators of these two parameters. Experimental results on four S. cerevisiae PPI networks show that the performance of RSRGM on detecting cohesive complexes and overlapping complexes is superior to that of previous competing algorithms. Moreover, RSRGM has the ability to discover biological significant functional units besides complexes.
The care-planning conference: Exploring aspects of person-centred interactions.
Jobe, Ingela; Lindberg, Birgitta; Nordmark, Sofi; Engström, Åsa
2018-04-01
The aim of this study was to describe the care-planning conference from the participants' and researchers' perspectives, focusing on exploring aspects of person-centred interactions. A single-instrumental, qualitative case study design was used describing a care-planning conference taking place in the home of an older woman and her daughter. Data collection consisted of observation and digital recording of the care-planning conference and individual interviews with all the participants before and after the conference. Data were analysed in several phases: first, a narrative description followed by a general description and, thereafter, qualitative content analysis. The findings revealed that the care-planning conference conducted had no clear purpose and did not fulfil all parts of the planning process. Three themes emerged related to aspects of person-centred interactions. The theme "expectations meet reality" showed different expectations, and participants could not really connect during the conference. The theme "navigate without a map" revealed health professionals' lack of knowledge about the care-planning process. The theme "lose the forest for the trees" described that the conference was conducted only as part of the health professionals' duties. Management and healthcare professionals cannot automatically assume that they are delivering person-centred care. Healthcare professionals need to be sensitive to the context, use the knowledge and tools available and continuously evaluate and reassess the work carried out.
Creating and Exploring Huge Parameter Spaces: Interactive Evolution as a Tool for Sound Generation
DEFF Research Database (Denmark)
Dahlstedt, Palle
2001-01-01
In this paper, a program is presented that applies interactive evolution to sound generation, i.e., preferred individuals are repeatedly selected from a population of genetically bred sound objects, created with various synthesis and pattern generation algorithms. This simplifies aural exploration...... applications. It is also shown how this technique can be used to simplify sound design in standard hardware synthesizers, a task normally avoided by most musicians, due to the required amount of technical understanding....
Visual-perceptual impairment in children with cerebral palsy: a systematic review.
Ego, Anne; Lidzba, Karen; Brovedani, Paola; Belmonti, Vittorio; Gonzalez-Monge, Sibylle; Boudia, Baya; Ritz, Annie; Cans, Christine
2015-04-01
Visual perception is one of the cognitive functions often impaired in children with cerebral palsy (CP). The aim of this systematic literature review was to assess the frequency of visual-perceptual impairment (VPI) and its relationship with patient characteristics. Eligible studies were relevant papers assessing visual perception with five common standardized assessment instruments in children with CP published from January 1990 to August 2011. Of the 84 studies selected, 15 were retained. In children with CP, the proportion of VPI ranged from 40% to 50% and the mean visual perception quotient from 70 to 90. None of the studies reported a significant influence of CP subtype, IQ level, side of motor impairment, neuro-ophthalmological outcomes, or seizures. The severity of neuroradiological lesions seemed associated with VPI. The influence of prematurity was controversial, but a lower gestational age was more often associated with lower visual motor skills than with decreased visual-perceptual abilities. The impairment of visual perception in children with CP should be considered a core disorder within the CP syndrome. Further research, including a more systematic approach to neuropsychological testing, is needed to explore the specific impact of CP subgroups and of neuroradiological features on visual-perceptual development. © 2015 The Authors. Developmental Medicine & Child Neurology © 2015 Mac Keith Press.
Crew roles and interactions in scientific space exploration
Love, Stanley G.; Bleacher, Jacob E.
2013-10-01
Future piloted space exploration missions will focus more on science than engineering, a change which will challenge existing concepts for flight crew tasking and demand that participants with contrasting skills, values, and backgrounds learn to cooperate as equals. In terrestrial space flight analogs such as Desert Research And Technology Studies, engineers, pilots, and scientists can practice working together, taking advantage of the full breadth of all team members' training to produce harmonious, effective missions that maximize the time and attention the crew can devote to science. This paper presents, in a format usable as a reference by participants in the field, a successfully tested crew interaction model for such missions. The model builds upon the basic framework of a scientific field expedition by adding proven concepts from aviation and human space flight, including expeditionary behavior and cockpit resource management, cooperative crew tasking and adaptive leadership and followership, formal techniques for radio communication, and increased attention to operational considerations. The crews of future space flight analogs can use this model to demonstrate effective techniques, learn from each other, develop positive working relationships, and make their expeditions more successful, even if they have limited time to train together beforehand. This model can also inform the preparation and execution of actual future space flights.
Crew Roles and Interactions in Scientific Space Exploration
Love, Stanley G.; Bleacher, Jacob E.
2013-01-01
Future piloted space exploration missions will focus more on science than engineering, a change which will challenge existing concepts for flight crew tasking and demand that participants with contrasting skills, values, and backgrounds learn to cooperate as equals. In terrestrial space flight analogs such as Desert Research And Technology Studies, engineers, pilots, and scientists can practice working together, taking advantage of the full breadth of all team members training to produce harmonious, effective missions that maximize the time and attention the crew can devote to science. This paper presents, in a format usable as a reference by participants in the field, a successfully tested crew interaction model for such missions. The model builds upon the basic framework of a scientific field expedition by adding proven concepts from aviation and human spaceflight, including expeditionary behavior and cockpit resource management, cooperative crew tasking and adaptive leadership and followership, formal techniques for radio communication, and increased attention to operational considerations. The crews of future spaceflight analogs can use this model to demonstrate effective techniques, learn from each other, develop positive working relationships, and make their expeditions more successful, even if they have limited time to train together beforehand. This model can also inform the preparation and execution of actual future spaceflights.
Chowdhary, Rajesh
2012-04-06
Background: Protein interaction networks (PINs) specific within a particular context contain crucial information regarding many cellular biological processes. For example, PINs may include information on the type and directionality of interaction (e.g. phosphorylation), location of interaction (i.e. tissues, cells), and related diseases. Currently, very few tools are capable of deriving context-specific PINs for conducting exploratory analysis. Results: We developed a literature-based online system, Context-specific Protein Network Miner (CPNM), which derives context-specific PINs in real-time from the PubMed database based on a set of user-input keywords and enhanced PubMed query system. CPNM reports enriched information on protein interactions (with type and directionality), their network topology with summary statistics (e.g. most densely connected proteins in the network; most densely connected protein-pairs; and proteins connected by most inbound/outbound links) that can be explored via a user-friendly interface. Some of the novel features of the CPNM system include PIN generation, ontology-based PubMed query enhancement, real-time, user-queried, up-to-date PubMed document processing, and prediction of PIN directionality. Conclusions: CPNM provides a tool for biologists to explore PINs. It is freely accessible at http://www.biotextminer.com/CPNM/. © 2012 Chowdhary et al.
Chowdhary, Rajesh; Tan, Sin Lam; Zhang, Jinfeng; Karnik, Shreyas; Bajic, Vladimir B.; Liu, Jun S.
2012-01-01
Background: Protein interaction networks (PINs) specific within a particular context contain crucial information regarding many cellular biological processes. For example, PINs may include information on the type and directionality of interaction (e.g. phosphorylation), location of interaction (i.e. tissues, cells), and related diseases. Currently, very few tools are capable of deriving context-specific PINs for conducting exploratory analysis. Results: We developed a literature-based online system, Context-specific Protein Network Miner (CPNM), which derives context-specific PINs in real-time from the PubMed database based on a set of user-input keywords and enhanced PubMed query system. CPNM reports enriched information on protein interactions (with type and directionality), their network topology with summary statistics (e.g. most densely connected proteins in the network; most densely connected protein-pairs; and proteins connected by most inbound/outbound links) that can be explored via a user-friendly interface. Some of the novel features of the CPNM system include PIN generation, ontology-based PubMed query enhancement, real-time, user-queried, up-to-date PubMed document processing, and prediction of PIN directionality. Conclusions: CPNM provides a tool for biologists to explore PINs. It is freely accessible at http://www.biotextminer.com/CPNM/. © 2012 Chowdhary et al.
de Bruijn, G.J.; Kroeze, W.; Oenema, O.; Brug, J.
2008-01-01
The additive and interactive effects of habit strength in the explanation of saturated fat intake were explored within the framework of the Theory of Planned Behaviour (TPB). Cross-sectional data were gathered in a Dutch adult sample (n = 764) using self-administered questionnaires and analyzed
Directory of Open Access Journals (Sweden)
Pengdong Zhang
2018-01-01
Full Text Available Benefiting from recent advantages in location-aware technologies, movement data are becoming ubiquitous. Hence, numerous research topics with respect to movement data have been undertaken. Yet, the research of dynamic interactions in movement data is still in its infancy. In this paper, we propose a hybrid approach combining the multi-temporal scale spatio-temporal network (MTSSTN and the continuous triangular model (CTM for exploring dynamic interactions in movement data. The approach mainly includes four steps: first, the relative trajectory calculus (RTC is used to derive three types of interaction patterns; second, for each interaction pattern, a corresponding MTSSTN is generated; third, for each MTSSTN, the interaction intensity measures and three centrality measures (i.e., degree, betweenness and closeness are calculated; finally, the results are visualized at multiple temporal scales using the CTM and analyzed based on the generated CTM diagrams. Based on the proposed approach, three distinctive aims can be achieved for each interaction pattern at multiple temporal scales: (1 exploring the interaction intensities between any two individuals; (2 exploring the interaction intensities among multiple individuals, and (3 exploring the importance of each individual and identifying the most important individuals. The movement data obtained from a real football match are used as a case study to validate the effectiveness of the proposed approach. The results demonstrate that the proposed approach is useful in exploring dynamic interactions in football movement data and discovering insightful information.
Shim, Hongjin; Oh, Poong; Song, Hyunjin; Lee, Yeonkyung
2015-03-01
This study explores whether, and how, motivations for two screen viewing predicted social interaction behaviors and subsequent viewing intention of TV programs. A total of 453 respondents who responded that they use social networking sites (SNSs) via smartphones and actively watch entertainment programs completed an online survey questionnaire. In agreement with uses and gratifications assumptions, motivations for TSV predicted distinctive sets of social interaction behaviors, which mediated the influence of motivations on viewing intentions. Respondents' two screen viewing was meaningfully related with social interaction, engagement with programs, information seeking, and passing time. Results suggest that two screen viewing could provide shared experiences nourishing social capital and reintegrate TV audiences by social adhesive resulting from TV with SNSs.
The esa earth explorer land surface processes and interactions mission
Labandibar, Jean-Yves; Jubineau, Franck; Silvestrin, Pierluigi; Del Bello, Umberto
2017-11-01
The European Space Agency (ESA) is defining candidate missions for Earth Observation. In the class of the Earth Explorer missions, dedicated to research and pre-operational demonstration, the Land Surface Processes and Interactions Mission (LSPIM) will acquire the accurate quantitative measurements needed to improve our understanding of the nature and evolution of biosphere-atmosphere interactions and to contribute significantly to a solution of the scaling problems for energy, water and carbon fluxes at the Earth's surface. The mission is intended to provide detailed observations of the surface of the Earth and to collect data related to ecosystem processes and radiation balance. It is also intended to address a range of issues important for environmental monitoring, renewable resources assessment and climate models. The mission involves a dedicated maneuvering satellite which provides multi-directional observations for systematic measurement of Land Surface BRDF (BiDirectional Reflectance Distribution Function) of selected sites on Earth. The satellite carries an optical payload : PRISM (Processes Research by an Imaging Space Mission), a multispectral imager providing reasonably high spatial resolution images (50 m over 50 km swath) in the whole optical spectral domain (from 450 nm to 2.35 μm with a resolution close to 10 nm, and two thermal bands from 8.1 to 9.1 μm). This paper presents the results of the Phase A study awarded by ESA, led by ALCATEL Space Industries and concerning the design of LSPIM.
van Veen, S H C M; van Kleef, R C; van de Ven, W P M M; van Vliet, R C J A
2018-02-01
This study explores the predictive power of interaction terms between the risk adjusters in the Dutch risk equalization (RE) model of 2014. Due to the sophistication of this RE-model and the complexity of the associations in the dataset (N = ~16.7 million), there are theoretically more than a million interaction terms. We used regression tree modelling, which has been applied rarely within the field of RE, to identify interaction terms that statistically significantly explain variation in observed expenses that is not already explained by the risk adjusters in this RE-model. The interaction terms identified were used as additional risk adjusters in the RE-model. We found evidence that interaction terms can improve the prediction of expenses overall and for specific groups in the population. However, the prediction of expenses for some other selective groups may deteriorate. Thus, interactions can reduce financial incentives for risk selection for some groups but may increase them for others. Furthermore, because regression trees are not robust, additional criteria are needed to decide which interaction terms should be used in practice. These criteria could be the right incentive structure for risk selection and efficiency or the opinion of medical experts. Copyright © 2017 John Wiley & Sons, Ltd.
Speech Outcomes after Tonsillectomy in Patients with Known Velopharyngeal Insufficiency
Directory of Open Access Journals (Sweden)
L. M. Paulson
2012-01-01
Full Text Available Introduction. Controversy exists over whether tonsillectomy will affect speech in patients with known velopharyngeal insufficiency (VPI, particularly in those with cleft palate. Methods. All patients seen at the OHSU Doernbecher Children's Hospital VPI clinic between 1997 and 2010 with VPI who underwent tonsillectomy were reviewed. Speech parameters were assessed before and after tonsillectomy. Wilcoxon rank-sum testing was used to evaluate for significance. Results. A total of 46 patients with VPI underwent tonsillectomy during this period. Twenty-three had pre- and postoperative speech evaluation sufficient for analysis. The majority (87% had a history of cleft palate. Indications for tonsillectomy included obstructive sleep apnea in 11 (48% and staged tonsillectomy prior to pharyngoplasty in 10 (43%. There was no significant difference between pre- and postoperative speech intelligibility or velopharyngeal competency in this population. Conclusion. In this study, tonsillectomy in patients with VPI did not significantly alter speech intelligibility or velopharyngeal competence.
Directory of Open Access Journals (Sweden)
Parrish Jodi R
2006-04-01
Full Text Available Abstract Background Biological processes are mediated by networks of interacting genes and proteins. Efforts to map and understand these networks are resulting in the proliferation of interaction data derived from both experimental and computational techniques for a number of organisms. The volume of this data combined with the variety of specific forms it can take has created a need for comprehensive databases that include all of the available data sets, and for exploration tools to facilitate data integration and analysis. One powerful paradigm for the navigation and analysis of interaction data is an interaction graph or map that represents proteins or genes as nodes linked by interactions. Several programs have been developed for graphical representation and analysis of interaction data, yet there remains a need for alternative programs that can provide casual users with rapid easy access to many existing and emerging data sets. Description Here we describe a comprehensive database of Drosophila gene and protein interactions collected from a variety of sources, including low and high throughput screens, genetic interactions, and computational predictions. We also present a program for exploring multiple interaction data sets and for combining data from different sources. The program, referred to as the Interaction Map (IM Browser, is a web-based application for searching and visualizing interaction data stored in a relational database system. Use of the application requires no downloads and minimal user configuration or training, thereby enabling rapid initial access to interaction data. IM Browser was designed to readily accommodate and integrate new types of interaction data as it becomes available. Moreover, all information associated with interaction measurements or predictions and the genes or proteins involved are accessible to the user. This allows combined searches and analyses based on either common or technique-specific attributes
Directory of Open Access Journals (Sweden)
Deonarain Brijlall
2012-12-01
Full Text Available This article reports on an exploration of teachers’ views on the meaning of mathematical representations in a democratic South Africa. We explored teachers’ conceptions of ‘mathematical representations’ as a means to promote dialogue and negotiation. These conceptions helped us to gauge how these teachers viewed representations in mathematics. Semi-structured questionnaires were administered to 76 high school mathematics teachers who were registered for an upgrading mathematics education qualification at a South African university. Common themes in teacher conceptions of representations were investigated as part of an inductive analysis of the written responses, which were considered in terms of practices that support dialogue and negotiation. Findings suggest that these conceptions are in line with progressive notions of classroom interactions such as the inquiry cooperation model. Furthermore, the findings suggest that teachers can support the development of classroom environments that promote democratic values.
Exploring sonic interaction design and presence: Natural Interactive Walking in Porto
DEFF Research Database (Denmark)
Nordahl, Rolf; Serafin, Stefania; Fontana, Frederico
2009-01-01
In this paper we report on the results of a three days workshop whose goal was to combine interactive sounds and soundscape design to simulate the sensation of walking in a specific location of Porto. We discuss advantages and disadvantages of the different solutions proposed in terms of the tech......In this paper we report on the results of a three days workshop whose goal was to combine interactive sounds and soundscape design to simulate the sensation of walking in a specific location of Porto. We discuss advantages and disadvantages of the different solutions proposed in terms...... of the technology used, and issues of how sonic interaction combined with soundscape design affects presence in virtual environments....
Directory of Open Access Journals (Sweden)
Shirlee-ann Knight
2011-03-01
Full Text Available ABSTRACT A common criticism directed at Davis’ (1986; 1989 Technology Acceptance Model relates to its failure to adequately frame the “experienced” user’s ongoing adoption and exploitation of information technologies. Given the pervasive nature of technology into individual users’ ongoing, everyday communication and information interactions, along with the “new adopter” becoming an increasingly rare entity, the TAM is in danger of becoming a somewhat obsolete framework for investigating user-technology interaction. Presented is a critical analysis of the development and current state of the TAM, followed by a proposed addition to the existing Perceived Usefulness (PU and Perceived Ease of Use (PEoU TAM constructs. The paper contends that the inclusion of a Perception of Interaction (PoI construct allows researchers to develop an investigative framework which facilitates an exploration of users’ ongoing perceptions of the predictability of their technology interaction processes.
DEFF Research Database (Denmark)
Löwgren, Jonas; Eriksen, Mette Agger; Linde, Per
2006-01-01
We report an ongoing study of palpable computing to support surgical rehabilitation, in the general field of interaction design for ubiquitous computing. Through explorative design, fieldwork and participatory design techniques, we explore the design principle of explicit interaction as an interp...
Rivest, Sonia; Bédard, Yvan; Proulx, Marie-Josée; Nadeau, Martin; Hubert, Frederic; Pastor, Julien
To support their analytical processes, today's organizations deploy data warehouses and client tools such as OLAP (On-Line Analytical Processing) to access, visualize, and analyze their integrated, aggregated and summarized data. Since a large part of these data have a spatial component, better client tools are required to take full advantage of the geometry of the spatial phenomena or objects being analyzed. With this regard, Spatial OLAP (SOLAP) technology offers promising possibilities. A SOLAP tool can be defined as "a type of software that allows rapid and easy navigation within spatial databases and that offers many levels of information granularity, many themes, many epochs and many display modes synchronized or not: maps, tables and diagrams" [Bédard, Y., Proulx, M.J., Rivest, S., 2005. Enrichissement du OLAP pour l'analyse géographique: exemples de réalisation et différentes possibilités technologiques. In: Bentayeb, F., Boussaid, O., Darmont, J., Rabaseda, S. (Eds.), Entrepôts de Données et Analyse en ligne, RNTI B_1. Paris: Cépaduès, pp. 1-20]. SOLAP tools offer a new user interface and are meant to be client applications sitting on top of multi-scale spatial data warehouses or datacubes. As they are based on the multidimensional paradigm, they facilitate the interactive spatio-temporal exploration of data. The purpose of this paper is to discuss how SOLAP concepts support spatio-temporal exploration of data and then to present the geovisualization, interactivity, and animation features of the SOLAP software developed by our research group. This paper first reviews the general concepts behind OLAP and SOLAP systems. This is followed by a discussion of how these SOLAP concepts support spatio-temporal exploration of data. In the subsequent section, SOLAP software is introduced along with features that enable geovisualization, interactivity and animation.
Exploring Interaction Space as Abstraction Mechanism for Task-Based User Interface Design
DEFF Research Database (Denmark)
Nielsen, C. M.; Overgaard, M.; Pedersen, M. B.
2007-01-01
Designing a user interface is often a complex undertaking. Model-based user interface design is an approach where models and mappings between them form the basis for creating and specifying the design of a user interface. Such models usually include descriptions of the tasks of the prospective user......, but there is considerable variation in the other models that are employed. This paper explores the extent to which the notion of interaction space is useful as an abstraction mechanism to reduce the complexity of creating and specifying a user interface design. We present how we designed a specific user interface through...... mechanism that can help user interface designers exploit object-oriented analysis results and reduce the complexity of designing a user interface....
Exploring multimodal robotic interaction through storytelling for aphasics
Mubin, O.; Al Mahmud, A.; Abuelma'atti, O.; England, D.
2008-01-01
In this poster, we propose the design of a multimodal robotic interaction mechanism that is intended to be used by Aphasics for storytelling. Through limited physical interaction, mild to moderate aphasic people can interact with a robot that may help them to be more active in their day to day
Lee, Chi-Feng; You, Pei-Yun; Lin, Ying-Chiao; Hsu, Tsai-Ling; Cheng, Pi-Yun; Wu, Yu-Xuan; Tseng, Chi-Shun; Chen, Sheng-Wen; Chang, Huey-Por; Lin, Yang-Wei
2015-01-01
The proposed experiment can help students to understand the factors involved in the stability of gold nanoparticles (Au NPs) by exploring the adsorption interaction between Au NPs and various substances. The students in this study found that the surface plasmon resonance band of Au NP solutions underwent a red shift (i.e., from 520 to 650 nm)…
Classroom interactions: exploring the practices of high- and low-expectation teachers.
Rubie-Davies, Christine M
2007-06-01
Early research exploring teacher expectations concentrated on the dyadic classroom interactions of teachers with individual students. More recent studies have shown whole class factors to have more significance in portraying teachers' expectations. Recently teachers having high or low expectations for all their students have been identified. The aim of the current investigation was to explore whether the classroom exchanges of high- and low-expectation teachers differed substantially and might be considered a mechanism for teachers' expectations. The participants were 12 primary school teachers from eight schools who had been identified as having expectations for their students' learning that were either significantly above or below the children's achievement level. The teachers formed three groups called high-expectation, low-expectation and average-progress teachers. The participants were observed twice in the academic year during half-hour reading lessons. Two people observed each lesson, one completing a structured observation protocol and the other a running record and audiotape. In contrast to the average progress and low expectation teachers, the high-expectation teachers spent more time providing a framework for students' learning, provided their students with more feedback, questioned their students using more higher-order questions, and managed their students' behaviour more positively. There appear to be important differences in the classroom environments for the students of high-expectation, average-progress and low-expectation teachers. The differences apply to both the instructional and socioemotional environments of the classroom. Such disparities may act as mechanisms for teacher expectation effects.
Directory of Open Access Journals (Sweden)
Merel M. Jung
2017-06-01
Full Text Available Animallike robot companions such as robotic seal Paro are increasingly used in dementia care due to the positive effects that interaction with these robots can have on the well-being of these patients. Touch is one of the most important interaction modalities for patients with dementia and can be a natural way to interact with animallike robots. To advance the development of animallike robots, we explored in what ways people with dementia could benefit from interaction with an animallike robot with more advanced touch recognition capabilities and which touch gestures would be important in their interaction with Paro. In addition, we explored which other target groups might benefit from interaction with animallike robots with more advanced interaction capabilities. In this study, we administered a questionnaire and conducted interviews with two groups of health-care providers who all worked in a geriatric psychiatry department. One group used Paro in their work (i.e., the expert group; n = 5 while the other group had no experience with the use of animallike robot (i.e., the layman group; n = 4. The results showed that health-care providers perceived Paro as an effective intervention to improve the well-being of people with dementia. Examples of usages for Paro that were mentioned were providing distraction, interrupting problematic behaviors, and stimulating communication. Furthermore, the care providers indicated that people with dementia (would use mostly positive forms of touch and speech to interact with Paro. Paro’s auditory responses were criticized because they can overstimulate the patients. In addition, the care providers argued that social interactions with Paro are currently limited and therefore the robot does not meet the needs of a broader audience such as healthy elderly people who still live in their own homes. The development of robot pets with more advanced social capabilities such as touch and speech recognition might
KNOWNET: Exploring Interactive Knowledge Networking across Insurance Supply Chains
Directory of Open Access Journals (Sweden)
Susan Grant
2014-01-01
Full Text Available Social media has become an extremely powerful phenomenon with millions of users who post status updates, blog, links and pictures on social networking sites such as Facebook, LinkedIn, and Twitter. However, social networking has so far spread mainly among consumers. Businesses are only now beginning to acknowledge the benefits of using social media to enhance employee and supplier collaboration to support new ideas and innovation through knowledge sharing across functions and organizational boundaries. Many businesses are still trying to understand the various implications of integrating internal communication systems with social media tools and private collaboration and networking platforms. Indeed, a current issue in organizations today is to explore the value of social media mechanisms across a range of functions within their organizations and across their supply chains.The KNOWNET project (an EC funded Marie Curie IAPP seeks to assess the value of social networking for knowledge exchange across Insurance supply chains. A key objective of the project being to develop and build a web based interactive environment - a Supplier Social Network or SSN, to support and facilitate exchange of good ideas, insights, knowledge, innovations etc across a diverse group of suppliers within a multi level supply chain within the Insurance sector.
Exploring Poetry through Interactive Computer Programs.
Nimchinsky, Howard; Camp, Jocelyn
The goal of a project was to design, test, and evaluate several computer programs that allow students in introductory literature and poetry courses to explore a poem in detail and, through a dialogue with the program, to develop their own interpretation of it. Computer programs were completed on poems by Robert Frost and W.H. Auden. Both programs…
Shim, Hyo Sup; Park, In Kyu; Lee, Chang Young; Chung, Kyung Young
2009-08-01
The next revision to the TNM classification for lung cancer (the seventh edition) is scheduled to be released in 2009. However, the definition of visceral pleural invasion (VPI), which is a non-size-based T2 descriptor, still lacks in detail, and its validation is not included. We analyzed 1046 cases of non-small cell lung cancer (NSCLC) with T1, T2, or T3 diseases from 1990 to 2005, and subclassified into p0-p3 according to the degrees of pleural invasion. Survival analyses were performed using Kaplan-Meier method. Then, all patients were subdivided into nine groups according to tumor size and pleural invasion, and we compared survival differences, primarily focusing on T2a and T2b diseases according to the seventh edition. There was no survival difference between patients with p1 and p2, thus we regarded p1 or p2 as VPI. There was survival difference between two groups, which are expected to be classified as T2b. The behavior of tumors larger than 5cm but 7cm or less with VPI was similar to T3 tumors. VPI is a poor prognostic factor of NSCLC, and the penetration through the elastic layer of the visceral pleura regardless of its exposure on the pleural surface (pl and p2) should be defined as VPI. This study also indicates that VPI influences T stage dependent on tumor size, and it can be suggested that tumors of larger than 5cm but 7cm or less with VPI should be upgraded to T3 stage.
Directory of Open Access Journals (Sweden)
Huimin Zhang
2018-04-01
Full Text Available Androgen receptor (AR is a key target in the discovery of anti-PCa (Prostate Cancer drugs. Recently, a novel cyclopeptide Diffusa Cyclotide-3 (DC3, isolated from Hedyotisdiffusa, has been experimentally demonstrated to inhibit the survival and growth of LNCap cells, which typically express T877A-mutated AR, the most frequently detected point mutation of AR in castration-resistant prostate cancer (CRPC. But the interaction mechanism between DC3 and AR is not clear. Here in this study we aim to explore the possible binding mode of DC3 to T877A-mutated AR from molecular perspective. Firstly, homology modeling was employed to construct the three-dimensional structure of the cyclopeptide DC3 using 2kux.1.A as the template. Then molecular docking, molecular dynamics (MD simulations, and molecular mechanics/generalized Born surface area (MM-GBSA methods were performed to determine the bind site and explore the detailed interaction mechanism of DC3-AR complex. The obtained results suggested that the site formed by H11, loop888-893, and H12 (site 2 was the most possible position of DC3 binding to AR. Besides, hydrogen bonds, hydrophobic, and electrostatic interactions play dominant roles in the recognition and combination of DC3-AR complex. The essential residues dominant in each interaction were specifically revealed. This work facilitates our understanding of the interaction mechanism of DC3 binding to AR at the molecular level and contributes to the rational cyclopeptide drug design for prostate cancer.
Keith C. Heyde; Warren C. Ruder
2015-01-01
The microbiome?s underlying dynamics play an important role in regulating the behavior and health of its host. In order to explore the details of these interactions, we created an in silico model of a living microbiome, engineered with synthetic biology, that interfaces with a biomimetic, robotic host. By analytically modeling and computationally simulating engineered gene networks in these commensal communities, we reproduced complex behaviors in the host. We observed that robot movements de...
Exploring NAD+ metabolism in host-pathogen interactions.
Mesquita, Inês; Varela, Patrícia; Belinha, Ana; Gaifem, Joana; Laforge, Mireille; Vergnes, Baptiste; Estaquier, Jérôme; Silvestre, Ricardo
2016-03-01
Nicotinamide adenine dinucleotide (NAD(+)) is a vital molecule found in all living cells. NAD(+) intracellular levels are dictated by its synthesis, using the de novo and/or salvage pathway, and through its catabolic use as co-enzyme or co-substrate. The regulation of NAD(+) metabolism has proven to be an adequate drug target for several diseases, including cancer, neurodegenerative or inflammatory diseases. Increasing interest has been given to NAD(+) metabolism during innate and adaptive immune responses suggesting that its modulation could also be relevant during host-pathogen interactions. While the maintenance of NAD(+) homeostatic levels assures an adequate environment for host cell survival and proliferation, fluctuations in NAD(+) or biosynthetic precursors bioavailability have been described during host-pathogen interactions, which will interfere with pathogen persistence or clearance. Here, we review the double-edged sword of NAD(+) metabolism during host-pathogen interactions emphasizing its potential for treatment of infectious diseases.
DEFF Research Database (Denmark)
Harirchi, Gouya; Chaminade, Cristina
2014-01-01
User–producer interactions have been recognized as important for innovation. With the rapid growth of emerging economies’ markets, and an increasing degree of technological sophistication of both users and producers in those markets, user–producer interaction is becoming global. Using original firm......-level data, this paper explores how collaboration with users in different income regions affects the degree of innovations’ novelty. We find that collaborating with international users is positively related to higher degrees of novelty. Furthermore, firms in low- and middle income countries will benefit more...... from south–south user collaboration than a south–north one....
Directory of Open Access Journals (Sweden)
Bingjie Hu
2014-08-01
Full Text Available Structure-based computational methods have been widely used in exploring protein-ligand interactions, including predicting the binding ligands of a given protein based on their structural complementarity. Compared to other protein and ligand representations, the advantages of a surface representation include reduced sensitivity to subtle changes in the pocket and ligand conformation and fast search speed. Here we developed a novel method named PL-PatchSurfer (Protein-Ligand PatchSurfer. PL-PatchSurfer represents the protein binding pocket and the ligand molecular surface as a combination of segmented surface patches. Each patch is characterized by its geometrical shape and the electrostatic potential, which are represented using the 3D Zernike descriptor (3DZD. We first tested PL-PatchSurfer on binding ligand prediction and found it outperformed the pocket-similarity based ligand prediction program. We then optimized the search algorithm of PL-PatchSurfer using the PDBbind dataset. Finally, we explored the utility of applying PL-PatchSurfer to a larger and more diverse dataset and showed that PL-PatchSurfer was able to provide a high early enrichment for most of the targets. To the best of our knowledge, PL-PatchSurfer is the first surface patch-based method that treats ligand complementarity at protein binding sites. We believe that using a surface patch approach to better understand protein-ligand interactions has the potential to significantly enhance the design of new ligands for a wide array of drug-targets.
Hu, Bingjie; Zhu, Xiaolei; Monroe, Lyman; Bures, Mark G; Kihara, Daisuke
2014-08-27
Structure-based computational methods have been widely used in exploring protein-ligand interactions, including predicting the binding ligands of a given protein based on their structural complementarity. Compared to other protein and ligand representations, the advantages of a surface representation include reduced sensitivity to subtle changes in the pocket and ligand conformation and fast search speed. Here we developed a novel method named PL-PatchSurfer (Protein-Ligand PatchSurfer). PL-PatchSurfer represents the protein binding pocket and the ligand molecular surface as a combination of segmented surface patches. Each patch is characterized by its geometrical shape and the electrostatic potential, which are represented using the 3D Zernike descriptor (3DZD). We first tested PL-PatchSurfer on binding ligand prediction and found it outperformed the pocket-similarity based ligand prediction program. We then optimized the search algorithm of PL-PatchSurfer using the PDBbind dataset. Finally, we explored the utility of applying PL-PatchSurfer to a larger and more diverse dataset and showed that PL-PatchSurfer was able to provide a high early enrichment for most of the targets. To the best of our knowledge, PL-PatchSurfer is the first surface patch-based method that treats ligand complementarity at protein binding sites. We believe that using a surface patch approach to better understand protein-ligand interactions has the potential to significantly enhance the design of new ligands for a wide array of drug-targets.
Improving diagnostic accuracy in aortic prosthetic graft infection
Saleem, Rani
2017-01-01
Vaatprothese infecties (VPI) komen relatief weinig voor, echter het klinisch beloop ervan kent hoge morbiditeit en mortaliteit. Derhalve worden bij de implantatie van vaatprotheses diverse preventieve maatregelen genomen om VPI te voorkomen. Ondanks preventieve maatregelen blijft prothesemateriaal
Exploring pathway interactions in insulin resistant mouse liver
Kelder, T.; Eijssen, L.; Kleemann, R.; Erk, M. van; Kooistra, T.; Evelo, C.
2011-01-01
Background: Complex phenotypes such as insulin resistance involve different biological pathways that may interact and influence each other. Interpretation of related experimental data would be facilitated by identifying relevant pathway interactions in the context of the dataset.Results: We
Kurtz, N.; Marks, N.; Cooper, S. K.
2014-12-01
Scientific ocean drilling through the International Ocean Discovery Program (IODP) has contributed extensively to our knowledge of Earth systems science. However, many of its methods and discoveries can seem abstract and complicated for students. Collaborations between scientists and educators/artists to create accurate yet engaging demonstrations and activities have been crucial to increasing understanding and stimulating interest in fascinating geological topics. One such collaboration, which came out of Expedition 345 to the Hess Deep Rift, resulted in an interactive lab to explore sampling rocks from the usually inacessible lower oceanic crust, offering an insight into the geological processes that form the structure of the Earth's crust. This Hess Deep Interactive Lab aims to explain several significant discoveries made by oceanic drilling utilizing images of actual thin sections and core samples recovered from IODP expeditions. . Participants can interact with a physical model to learn about the coring and drilling processes, and gain an understanding of seafloor structures. The collaboration of this lab developed as a need to explain fundamental notions of the ocean crust formed at fast-spreading ridges. A complementary interactive online lab can be accessed at www.joidesresolution.org for students to engage further with these concepts. This project explores the relationship between physical and on-line models to further understanding, including what we can learn from the pros and cons of each.
Roche Allred, Zahilyn D.; Tai, Heeyoung; Bretz, Stacey Lowery; Page, Richard C.
2017-01-01
Students' understandings of foundational concepts such as noncovalent interactions, pH and pK[subscript a] are crucial for success in undergraduate biochemistry courses. We developed a guided-inquiry activity to aid students in making connections between noncovalent interactions and pH/pK[subscript a]. Students explore these concepts by examining…
Exploring Social Outcomes of Interactions between University ...
African Journals Online (AJOL)
In the context of social integration theory, this paper explores the social ... families and by extension allowing for modest cross-cultural learning's and exchanges. ... In the negative domain, the outcomes include conflicts between students and ...
Tieben, R.; Bekker, M.M.; Schouten, B.A.M.
2011-01-01
We explore the concepts of curiosity and interaction: how can we elicit curiosity in public spaces through interactive systems? We have developed a model consisting of five curiosity-evoking principles. In an iterative design research approach, we have explored the design implementations of these
White, Molly E.; Hyatt, Andrew J.
2016-01-01
The Orion Multi-Purpose Crew Vehicle (MPCV) Reaction Control System (RCS) is critical to guide the vehicle along the desired trajectory during re--entry. However, this system has a significant impact on the convective heating environment to the spacecraft. Heating augmentation from the jet interaction (JI) drives thermal protection system (TPS) material selection and thickness requirements for the spacecraft. This paper describes the heating environment from the RCS on the afterbody of the Orion MPCV during Orion's first flight test, Exploration Flight Test 1 (EFT-1). These jet plumes interact with the wake of the crew capsule and cause an increase in the convective heating environment. Not only is there widespread influence from the jet banks, there may also be very localized effects. The firing history during EFT-1 will be summarized to assess which jet bank interaction was measured during flight. Heating augmentation factors derived from the reconstructed flight data will be presented. Furthermore, flight instrumentation across the afterbody provides the highest spatial resolution of the region of influence of the individual jet banks of any spacecraft yet flown. This distribution of heating augmentation across the afterbody will be derived from the flight data. Additionally, trends with possible correlating parameters will be investigated to assist future designs and ground testing programs. Finally, the challenges of measuring JI, applying this data to future flights and lessons learned will be discussed.
Guided interaction exploration in artifact-centric process models
van Eck, M.L.; Sidorova, N.; van der Aalst, W.M.P.
2017-01-01
Artifact-centric process models aim to describe complex processes as a collection of interacting artifacts. Recent development in process mining allow for the discovery of such models. However, the focus is often on the representation of the individual artifacts rather than their interactions. Based
CSIR Research Space (South Africa)
Mashingaidze, F
2013-09-01
Full Text Available EXPLORATION OF THE BIOMACROMOLECULAR INTERACTIONS OF AN INTERPENETRATING PROTEO-SACCHARIDE HYDROGEL NETWORK AT THE MUCOSAL INTERFACE 1Felix Mashingaidze, 1Yahya E. Choonara, 1Pradeep Kumar, 1Lisa C. du Toit, 2Vinesh Maharaj, 3Eckhart Buchmann, 4Valence M..., Department of Biosciences, Meiring Naud_e Road, Brummeria, Pretoria, South Africa 3University of the Witwatersrand, Faculty of Health Sciences, Department of Obstetrics and Gynecology, 7 York Road, Parktown, 2193, Johannesburg, South Africa 4St. John’s...
"Barter", "Deals", "Bribes" and "Threats": Exploring Sibling Interactions
McIntosh, Ian; Punch, Samantha
2009-01-01
This article investigates forms of strategic interaction between siblings during childhood. The authors argue that these interactions, characterized by notions of reciprocity, equivalence and constructions of fairness, are worked out in relation to responsibility, power, knowledge and sibling status. Birth order and age are not experienced as…
Factors associated with successful establishment of breastfeeding in very preterm infants
DEFF Research Database (Denmark)
Zachariassen, G; Faerk, J; Grytter, C
2010-01-01
To describe feeding practices at hospital discharge in relation to characteristics of the very preterm infants (VPI) and their mothers.......To describe feeding practices at hospital discharge in relation to characteristics of the very preterm infants (VPI) and their mothers....
Pate, Christina M.; Maras, Melissa A.; Whitney, Stephen D.; Bradshaw, Catherine P.
2017-01-01
Internalizing mental health issues are a significant developmental and clinical concern during adolescence, but rarely identified as a problem among school staff. Using data from the National Longitudinal Study of Adolescent Health, this study examined the associations between adolescent emotional distress, school connectedness, and educational achievement by exploring potential mechanistic and interactive roles of perceived school connectedness on the emotion–education association. Emotional distress was negatively associated with adolescents’ perceptions of belonging to school, which, in turn, may negatively influence educational achievement. School connectedness also had both additive and multiplicative interaction effects on the emotion–education relationship. Results support previous evidence of school connectedness as a protective factor for adolescents with internalizing mental health concerns, although much of the work to date has focused on externalizing problems. This study informs our understanding of how, why, and for whom emotional problems influence educational outcomes in light of social support in the school context. PMID:28947921
Repercussão da exposição à violência por parceiro íntimo no comportamento dos filhos
Directory of Open Access Journals (Sweden)
Julia Garcia Durand
2011-04-01
Full Text Available OBJETIVO: Analisar a associação entre a exposição à violência por parceiro íntimo (VPI contra a mulher com desajustes comportamentais e problemas escolares entre os filhos. MÉTODOS: Inquérito populacional participante do WHO Multicountry Study on Violence Against Women, com 790 mulheres que coabitam com filhos de cinco a 12 anos, residentes no Município de São Paulo, SP, e na Zona da Mata de Pernambuco. Foram realizados três modelos múltiplos para estimar a força da associação entre variáveis explanatórias de apoio social e comunitário, eventos de vida estressantes, fatores sociodemográficos e gravidade da VPI, entre outras. Os modelos incluíram três respectivos desfechos: número de problemas de comportamento; agressividade; e interrupção abandono ou repetência escolar. RESULTADOS: A exposição à VPI física e/ou sexual grave esteve associada à ocorrência de problemas escolares, de problemas de comportamento em geral e de comportamentos agressivos na análise de regressão logística univariada. A exposição à VPI grave manteve-se associada à ocorrência de três ou mais problemas de comportamento entre seus filhos, independentemente do transtorno mental comum, da baixa escolaridade, de a mãe (avó ter sido vítima de VPI física e do apoio social e comunitário nos modelos de regressão logística múltiplos. A VPI grave esteve associada ao comportamento agressivo e aos problemas escolares, depois do ajuste por outras variáveis sociodemográficas, entre outras. O estado de saúde mental materna constituiu-se em fator mediador da relação entre a exposição à VPI e os problemas de comportamento, sobretudo agressividade. CONCLUSÕES: A VPI grave afeta o comportamento dos filhos e deve ser incluída na assistência à saúde das crianças em idade escolar, por meio de intervenções conjuntas entre crianças e mães.
Interaction matters? : exploring interactive music as a reminder to break sedentary office time
Ren, X.; Lu, Y.; Visser, V.J.J.; Le, P.D.Huy; van den Burg, R.
2017-01-01
This paper presents a within-subject field test (n=24) with Flow platform, a smart cushion that uses interactive music to motivate office workers to break excessive sedentary time. In this study, we compared continuous music and interactive music as reminders to inform sedentary time by every
Banerjee, Arundhati; Ray, Sujay
2016-01-01
Structural basis for exploration into MDM2 and MDM2-DHFR interaction plays a vital role in analyzing the obstruction in folate metabolism, nonsynthesis of purines, and further epigenetic regulation in Homo sapiens. Therefore, it leads to suppression of normal cellular behavior and malignancy. This has been earlier documented via yeast two-hybrid assays. So, with a novel outlook, this study explores the molecular level demonstration of the best satisfactory MDM2 model selection after performing manifold modeling techniques. Z-scores and other stereochemical features were estimated for comparison. Further, protein-protein docking was executed with MDM2 and the experimentally validated X-ray crystallographic DHFR. Residual disclosure from the best suited simulated protein complex disclosed 18 side chain and 3 ionic interactions to strongly accommodate MDM2 protein into the pocket-like zone in DHFR due to the positive environment by charged residues. Lysine residues from MDM2 played a predominant role. Moreover, evaluation from varied energy calculations, folding rate, and net area for solvent accessibility implied the active participation of MDM2 with DHFR. Fascinatingly, conformational transitions from coils to helices and β-sheets after interaction with DHFR affirm the conformational strength and firmer interaction of human MDM2-DHFR. Therefore, this probe instigates near-future clinical research and interactive computational investigations with mutations.
Directory of Open Access Journals (Sweden)
Arundhati Banerjee
2016-01-01
Full Text Available Structural basis for exploration into MDM2 and MDM2-DHFR interaction plays a vital role in analyzing the obstruction in folate metabolism, nonsynthesis of purines, and further epigenetic regulation in Homo sapiens. Therefore, it leads to suppression of normal cellular behavior and malignancy. This has been earlier documented via yeast two-hybrid assays. So, with a novel outlook, this study explores the molecular level demonstration of the best satisfactory MDM2 model selection after performing manifold modeling techniques. Z-scores and other stereochemical features were estimated for comparison. Further, protein-protein docking was executed with MDM2 and the experimentally validated X-ray crystallographic DHFR. Residual disclosure from the best suited simulated protein complex disclosed 18 side chain and 3 ionic interactions to strongly accommodate MDM2 protein into the pocket-like zone in DHFR due to the positive environment by charged residues. Lysine residues from MDM2 played a predominant role. Moreover, evaluation from varied energy calculations, folding rate, and net area for solvent accessibility implied the active participation of MDM2 with DHFR. Fascinatingly, conformational transitions from coils to helices and β-sheets after interaction with DHFR affirm the conformational strength and firmer interaction of human MDM2-DHFR. Therefore, this probe instigates near-future clinical research and interactive computational investigations with mutations.
Exploring Verbalization and Collaboration of Constructive Interaction with Children
DEFF Research Database (Denmark)
Als, Benedikte Skibsted; Jensen, Janne Jul; Skov, Mikael B.
2005-01-01
Constructive interaction provides natural thinking-aloud as test subjects collaborate in pairs to solve tasks. Since children may face difficulties in following instructions for a standard think-aloud test, constructive interaction has been suggested as evaluation method when usability testing...... with children. However, the relationship between think-aloud and constructive interaction is still poorly understood. We present an experiment that compares think-aloud and constructive interaction in usability testing. The experiment involves 60 children with three setups where children apply think......-aloud, and constructive interaction in acquainted and non-acquainted pairs. Our results show that the pairing of children had impact on how the children collaborated in pairs and how they would afterward assess the testing sessions. In some cases, we found that acquainted dyads would perform well as they would more...
Remote Data Exploration with the Interactive Data Language (IDL)
Galloy, Michael
2013-01-01
A difficulty for many NASA researchers is that often the data to analyze is located remotely from the scientist and the data is too large to transfer for local analysis. Researchers have developed the Data Access Protocol (DAP) for accessing remote data. Presently one can use DAP from within IDL, but the IDL-DAP interface is both limited and cumbersome. A more powerful and user-friendly interface to DAP for IDL has been developed. Users are able to browse remote data sets graphically, select partial data to retrieve, import that data and make customized plots, and have an interactive IDL command line session simultaneous with the remote visualization. All of these IDL-DAP tools are usable easily and seamlessly for any IDL user. IDL and DAP are both widely used in science, but were not easily used together. The IDL DAP bindings were incomplete and had numerous bugs that prevented their serious use. For example, the existing bindings did not read DAP Grid data, which is the organization of nearly all NASA datasets currently served via DAP. This project uniquely provides a fully featured, user-friendly interface to DAP from IDL, both from the command line and a GUI application. The DAP Explorer GUI application makes browsing a dataset more user-friendly, while also providing the capability to run user-defined functions on specified data. Methods for running remote functions on the DAP server were investigated, and a technique for accomplishing this task was decided upon.
An interactive graphical tool for exploring sequential dependencies in categorical data
International Nuclear Information System (INIS)
Fitzgerald, M.
1997-01-01
As monitoring and data storage devices have become cheaper and more readily available, it has become common practice to establish automated monitoring processes which collect enormous amounts of data. For example, in a waste storage facility, waste from several different sources may be combined and stored in a single storage container. Within this unit, many different types of chemical and microbiological reactions may take place over the course of time, not all of which are completely understood. Thus, it is important to monitor the levels of several different chemical compounds within the system, in order to ensure that the waste is being stored safely. The monitoring devices record any anomalous behavior of the system, such as when the presence of a certain chemical compound exceeds some prescribed expectation, the pressure within the container increases beyond a tolerance threshold, the temperature drops more than .5 degree, etc. These monitoring systems may thus collect large quantities of data in fairly short periods of time. The challenge is then to utilize these massive data sets to bring about an understanding of the process and discover potential avenues of intervention. This report describes an interactive graphical tool, written in XLISP-STAT, for exploratory data analysis of dependencies in sequences of categorical data. Both global and local views of the dependency structure can be insightful, and allowing the user the flexibility to change critical parameters and switch between views in a simple, interactive, point-and-click environment can make the task of exploring dependencies among a large number of categories feasible and lead to a better understanding of the sequential properties of the data
Harris, Fiona M; Maxwell, Margaret; O'Connor, Rory; Coyne, James C; Arensman, Ella; Coffey, Claire; Koburger, Nicole; Gusmão, Ricardo; Costa, Susana; Székely, András; Cserhati, Zoltan; McDaid, David; van Audenhove, Chantal; Hegerl, Ulrich
2016-03-15
The Medical Research Council (MRC) Framework for complex interventions highlights the need to explore interactions between components of complex interventions, but this has not yet been fully explored within complex, non-pharmacological interventions. This paper draws on the process evaluation data of a suicide prevention programme implemented in four European countries to illustrate the synergistic interactions between intervention levels in a complex programme, and to present our method for exploring these. A realist evaluation approach informed the process evaluation, which drew on mixed methods, longitudinal case studies. Data collection consisted of 47 semi-structured interviews, 12 focus groups, one workshop, fieldnoted observations of six programme meetings and 20 questionnaires (delivered at six month intervals to each of the four intervention sites). Analysis drew on the framework approach, facilitated by the use of QSR NVivo (v10). Our qualitative approach to exploring synergistic interactions (QuaSIC) also developed a matrix of hypothesised synergies that were explored within one workshop and two waves of data collection. All four implementation countries provided examples of synergistic interactions that added value beyond the sum of individual intervention levels or components in isolation. For instance, the launch ceremony of the public health campaign (a level 3 intervention) in Ireland had an impact on the community-based professional training, increasing uptake and visibility of training for journalists in particular. In turn, this led to increased media reporting of OSPI activities (monitored as part of the public health campaign) and also led to wider dissemination of editorial guidelines for responsible reporting of suicidal acts. Analysis of the total process evaluation dataset also revealed the new phenomenon of the OSPI programme acting as a catalyst for externally generated (and funded) activity that shared the goals of suicide prevention
Directory of Open Access Journals (Sweden)
Fiona M. Harris
2016-03-01
Full Text Available Abstract Background The Medical Research Council (MRC Framework for complex interventions highlights the need to explore interactions between components of complex interventions, but this has not yet been fully explored within complex, non-pharmacological interventions. This paper draws on the process evaluation data of a suicide prevention programme implemented in four European countries to illustrate the synergistic interactions between intervention levels in a complex programme, and to present our method for exploring these. Methods A realist evaluation approach informed the process evaluation, which drew on mixed methods, longitudinal case studies. Data collection consisted of 47 semi-structured interviews, 12 focus groups, one workshop, fieldnoted observations of six programme meetings and 20 questionnaires (delivered at six month intervals to each of the four intervention sites. Analysis drew on the framework approach, facilitated by the use of QSR NVivo (v10. Our qualitative approach to exploring synergistic interactions (QuaSIC also developed a matrix of hypothesised synergies that were explored within one workshop and two waves of data collection. Results All four implementation countries provided examples of synergistic interactions that added value beyond the sum of individual intervention levels or components in isolation. For instance, the launch ceremony of the public health campaign (a level 3 intervention in Ireland had an impact on the community-based professional training, increasing uptake and visibility of training for journalists in particular. In turn, this led to increased media reporting of OSPI activities (monitored as part of the public health campaign and also led to wider dissemination of editorial guidelines for responsible reporting of suicidal acts. Analysis of the total process evaluation dataset also revealed the new phenomenon of the OSPI programme acting as a catalyst for externally generated (and funded
“Exploring High Energy Interactions with CMS at the LHC”
Energy Technology Data Exchange (ETDEWEB)
Sulak, Lawrence R. [; Boston Univ., MA (United States)
2016-08-01
This High Energy Physics research project achieved its goal of exploring high-energy interactions with 7, 8 and 13 TeV data accumulated by CMS at the Energy Frontier. For the original hadron calorimeter (HCAL) and for its upgrade during Long Shutdown 1 (LS1), the PI helped propose and implement the upgrading the phototubes, new electronics, and fast timing of the hadronic forward (HF) and hadronic outer (HO) calorimeters of CMS, projects which he had forcefully advocated since the inception of CMS. The PI and his colleagues Prof. J. Rohlf and chief electronics engineer E. Hazen, his post-docs A. Heister and S. Girgis, and his graduate students (P. Lawson and D. Arcaro) contributed software tools used in perfecting of μTCA and Advanced Mezzanine Card (AMC13) electronics, the PC board that provides clock, timing and DAQ service for HCAL (and now many other subdetectors and central systems in the upgraded CMS detector). This Task reaped the benefits of these hardware contributions 1) to hermiticity for missing energy searches, and 2) to forward tagging jets for Vector Boson Fusion processes by analyzing and publishing early data, including that for the Higgs discovery and for exotic and supersymmetric searches.
Exploring The Moon through a 21st Century Learning Environment of Interactive Whiteboards
Runyon, C. J.; Hall, C.; Joyner, E.; Meyer, H. M.
2012-12-01
Lunar exploration has an important role to play in inspiring students to hone their skills and understanding, as well as encouraging them to pursue careers in science, technology engineering and math (STEM). Many of NASA's current lunar educational materials do not dynamically engage the whole learner or effectively address 21st Century skills. We present examples of several dynamic lunar science activities for use on interactive white boards. These activities are replicable and incorporate NASA mission-derived sampling and analysis techniques. Building on a highly visual and tactile workforce, it is imperative that today's classrooms keep up with technologies that are the media of modern life. Interactive white boards offer a coordinated curricula and supporting resources that are immediately usable in most classrooms across America. Our dynamic classroom materials are rich in scientific processes, meet the national standards of learning in STEM, and are teacher-vetted for content and usability. Incorporating educational activities created from the NASA Lunar Science Institute team activities, the Moon Mineralogy Mapper (M3) Educator's Guide, and more current NASA lunar missions, we offer three dynamic modules for use on an interactive white board. SMART activities implement the mastery teaching model, employing instructional strategies so that all students can achieve the same level of learning. Our goal is to provide educators with multiple resources for teaching their students about the Moon and engaging their interest in pursuing STEM in the future. In addition to background information, inquiry-oriented lessons allow students to gather information and data directly through the Internet. For example, with the return of high resolution/high spatial data from M3/Chandrayaan-1, we can now better identify, discern and understand the compositional variations on the lunar surface. Data and analysis techniques from the M3 imaging spectrometer are incorporated into
Cognitive Styles and Educational-Vocational Preferences and Selection
Osipow, Samuel H.
1969-01-01
Vocational Preference Inventory (VPI) and other instruments administered to 365 students, both undecided and in various interest fields, revealed several differences in cognitive style. No differences regarding cognitive style variations and VPI high-point codes or ease of vocational selection were observed. (Author/CJ)
piRNA Profiling of Dengue Virus Type 2-Infected Asian Tiger Mosquito and Midgut Tissues
Directory of Open Access Journals (Sweden)
Yanhai Wang
2018-04-01
Full Text Available The Asian tiger mosquito, Aedes albopictus, is a competent vector for the majority of arboviruses. The mosquito innate immune response is a primary determinant for arthropod-borne virus transmission, and the midgut is the first barrier to pathogen transmission. Mosquito antiviral immunity is primarily mediated by the small interfering RNA pathway. However, the roles that the P-element induced wimpy testis (PIWI-interacting RNA (piRNA pathway play in antiviral immunity in Ae. albopictus and its midgut still need further exploration. This study aimed to explore the profiles of both viral-derived and host-originated piRNAs in the whole body and midgut infected with Dengue virus 2 (DENV-2 in Ae. albopictus, and to elucidate gene expression profile differences of the PIWI protein family between adult females and their midguts. A deep sequencing-based method was used to identify and analyze small non-coding RNAs, especially the piRNA profiles in DENV-2-infected Ae. albopictus and its midgut. The top-ranked, differentially-expressed piRNAs were further validated using Stem-loop qRT-PCR. Bioinformatics analyses and reverse-transcription PCR (RT-PCR methods were used to detect PIWI protein family members, and their expression profiles. DENV-2 derived piRNAs (vpiRNA, 24–30 nts were observed in both infected Ae. albopictus and its midgut; however, only vpiRNA in the whole-body library had a weak preference for adenine at position 10 (10A in the sense molecules as a feature of secondary piRNA. These vpiRNAs were not equally distributed, instead they were derived from a few specific regions of the genome, especially several hot spots, and displayed an obvious positive strand bias. We refer to the differentially expressed host piRNAs after DENV infection as virus-induced host endogenous piRNAs (vepiRNAs. However, we found that vepiRNAs were abundant in mosquito whole-body tissue, but deficient in the midgut. A total of eleven PIWI family genes were
Sagar, Pallavi; Nimkin, Katherine
2015-02-01
In the past decade, there has been increased utilization of magnetic resonance imaging (MRI) in evaluating and understanding velopharyngeal insufficiency (VPI). To our knowledge, none of the prior studies with MRI has simultaneously linked the audio recordings of speech during cine MRI acquisition with the corresponding images and created a video for evaluating VPI. To develop an MRI protocol with static and cine sequences during phonation to evaluate for VPI in children and compare the findings to nasopharyngoscopy and videofluoroscopy. Five children, ages 8-16 years, with known VPI, who had previously undergone nasopharyngoscopy and videofluoroscopy, were included. MRI examination was performed on a 3-T Siemens scanner. Anatomical data was obtained using an isotropic T2-weighted 3-D SPACE sequence with multiplanar reformation capability. Dynamic data was obtained using 2-D FLASH cine sequences of the airway in three imaging planes during phonation. Audio recordings were captured by a MRI compatible optical microphone. All five cases had MRI and nasopharyngoscopy and four had videofluoroscopy performed. VPI was identified by MRI in all five patients. The location and severity of the velopharyngeal gap, closure pattern, velar size and shape and levator veli palatini (LVP) muscle were identified in all patients. MRI was superior in visualizing the integrity of the LVP muscle. MRI was unable to identify hemipalatal weakness in one case. In a case of stress-induced VPI, occurring only during clarinet playing, cine MRI demonstrated discordant findings of a velopharyngeal gap during phonatory tasks but not with instrument playing. Overall, there was satisfactory correlation among MRI, nasopharyngoscopy and videofluoroscopy findings. Cine MRI of the airway during speech is a noninvasive, well-tolerated diagnostic imaging tool that has the potential to serve as a guide prior to and after surgical correction of VPI. MRI provided superior anatomical detail of the levator
International Nuclear Information System (INIS)
Sagar, Pallavi; Nimkin, Katherine
2015-01-01
In the past decade, there has been increased utilization of magnetic resonance imaging (MRI) in evaluating and understanding velopharyngeal insufficiency (VPI). To our knowledge, none of the prior studies with MRI has simultaneously linked the audio recordings of speech during cine MRI acquisition with the corresponding images and created a video for evaluating VPI. To develop an MRI protocol with static and cine sequences during phonation to evaluate for VPI in children and compare the findings to nasopharyngoscopy and videofluoroscopy. Five children, ages 8-16 years, with known VPI, who had previously undergone nasopharyngoscopy and videofluoroscopy, were included. MRI examination was performed on a 3-T Siemens scanner. Anatomical data was obtained using an isotropic T2-weighted 3-D SPACE sequence with multiplanar reformation capability. Dynamic data was obtained using 2-D FLASH cine sequences of the airway in three imaging planes during phonation. Audio recordings were captured by a MRI compatible optical microphone. All five cases had MRI and nasopharyngoscopy and four had videofluoroscopy performed. VPI was identified by MRI in all five patients. The location and severity of the velopharyngeal gap, closure pattern, velar size and shape and levator veli palatini (LVP) muscle were identified in all patients. MRI was superior in visualizing the integrity of the LVP muscle. MRI was unable to identify hemipalatal weakness in one case. In a case of stress-induced VPI, occurring only during clarinet playing, cine MRI demonstrated discordant findings of a velopharyngeal gap during phonatory tasks but not with instrument playing. Overall, there was satisfactory correlation among MRI, nasopharyngoscopy and videofluoroscopy findings. Cine MRI of the airway during speech is a noninvasive, well-tolerated diagnostic imaging tool that has the potential to serve as a guide prior to and after surgical correction of VPI. MRI provided superior anatomical detail of the levator
Energy Technology Data Exchange (ETDEWEB)
Sagar, Pallavi; Nimkin, Katherine [Massachusetts General Hospital, Department of Radiology, Division of Pediatric Radiology, Boston, MA (United States)
2014-08-16
In the past decade, there has been increased utilization of magnetic resonance imaging (MRI) in evaluating and understanding velopharyngeal insufficiency (VPI). To our knowledge, none of the prior studies with MRI has simultaneously linked the audio recordings of speech during cine MRI acquisition with the corresponding images and created a video for evaluating VPI. To develop an MRI protocol with static and cine sequences during phonation to evaluate for VPI in children and compare the findings to nasopharyngoscopy and videofluoroscopy. Five children, ages 8-16 years, with known VPI, who had previously undergone nasopharyngoscopy and videofluoroscopy, were included. MRI examination was performed on a 3-T Siemens scanner. Anatomical data was obtained using an isotropic T2-weighted 3-D SPACE sequence with multiplanar reformation capability. Dynamic data was obtained using 2-D FLASH cine sequences of the airway in three imaging planes during phonation. Audio recordings were captured by a MRI compatible optical microphone. All five cases had MRI and nasopharyngoscopy and four had videofluoroscopy performed. VPI was identified by MRI in all five patients. The location and severity of the velopharyngeal gap, closure pattern, velar size and shape and levator veli palatini (LVP) muscle were identified in all patients. MRI was superior in visualizing the integrity of the LVP muscle. MRI was unable to identify hemipalatal weakness in one case. In a case of stress-induced VPI, occurring only during clarinet playing, cine MRI demonstrated discordant findings of a velopharyngeal gap during phonatory tasks but not with instrument playing. Overall, there was satisfactory correlation among MRI, nasopharyngoscopy and videofluoroscopy findings. Cine MRI of the airway during speech is a noninvasive, well-tolerated diagnostic imaging tool that has the potential to serve as a guide prior to and after surgical correction of VPI. MRI provided superior anatomical detail of the levator
Directory of Open Access Journals (Sweden)
Eric A Yen
2014-05-01
Full Text Available Protein complexes are not static, but rather highly dynamic with subunits that undergo 1-dimensional diffusion with respect to each other. Interactions within protein complexes are modulated through regulatory inputs that alter interactions and introduce new components and deplete existing components through exchange. While it is clear that the structure and function of any given protein complex is coupled to its dynamical properties, it remains a challenge to predict the possible conformations that complexes can adopt. Protein-fragment Complementation Assays detect physical interactions between protein pairs constrained to ≤8 nm from each other in living cells. This method has been used to build networks composed of 1000s of pair-wise interactions. Significantly, these networks contain a wealth of dynamic information, as the assay is fully reversible and the proteins are expressed in their natural context. In this study, we describe a method that extracts this valuable information in the form of predicted conformations, allowing the user to explore the conformational landscape, to search for structures that correlate with an activity state, and estimate the abundance of conformations in the living cell. The generator is based on a Markov Chain Monte Carlo simulation that uses the interaction dataset as input and is constrained by the physical resolution of the assay. We applied this method to an 18-member protein complex composed of the seven core proteins of the budding yeast Arp2/3 complex and 11 associated regulators and effector proteins. We generated 20,480 output structures and identified conformational states using principle component analysis. We interrogated the conformation landscape and found evidence of symmetry breaking, a mixture of likely active and inactive conformational states and dynamic exchange of the core protein Arc15 between core and regulatory components. Our method provides a novel tool for prediction and
International Nuclear Information System (INIS)
Chynoweth, Katie M.; Polisensky, Emil; Holley-Bockelmann, Kelly; Langston, Glen I.
2011-01-01
We combine high-resolution N-body simulations with deep observations of neutral hydrogen (H I) in nearby galaxy groups in order to explore two well-known theories of H I cloud formation: H I stripping by galaxy interactions and dark-matter minihalos with embedded H I gas. This paper presents new data from three galaxy groups-Canes Venatici I, NGC 672, and NGC 45-and assembles data from our previous galaxy group campaign to generate a rich H I cloud archive to compare to our simulated data. We find no H I clouds in the Canes Venatici I, NGC 672, or NGC 45 galaxy groups. We conclude that H I clouds in our detection space are most likely to be generated through recent, strong galaxy interactions. We find no evidence of H I clouds associated with dark-matter halos above M HI ∼ 10 6 M sun , within ±700 km s -1 of galaxies, and within 50 kpc projected distance of galaxies.
Black-White Differences on the Vocational Preference Inventory
Doughtie, Eugene B.; And Others
1976-01-01
The Vocational Preference Inventory (VPI) was administered to black and white undergraduates. The overall VPI profiles of the two groups were significantly different. The black students scored higher on the Social, Conventional, Enterprising, Self-Control, Status, and Infrequency scales. The white students scored higher on the Masculinity scale.…
31P magnetization transfer measurements of Pi→ATP flux in exercising human muscle.
Sleigh, Alison; Savage, David B; Williams, Guy B; Porter, David; Carpenter, T Adrian; Brindle, Kevin M; Kemp, Graham J
2016-03-15
Fundamental criticisms have been made over the use of (31)P magnetic resonance spectroscopy (MRS) magnetization transfer estimates of inorganic phosphate (Pi)→ATP flux (VPi-ATP) in human resting skeletal muscle for assessing mitochondrial function. Although the discrepancy in the magnitude of VPi-ATP is now acknowledged, little is known about its metabolic determinants. Here we use a novel protocol to measure VPi-ATP in human exercising muscle for the first time. Steady-state VPi-ATP was measured at rest and over a range of exercise intensities and compared with suprabasal oxidative ATP synthesis rates estimated from the initial rates of postexercise phosphocreatine resynthesis (VATP). We define a surplus Pi→ATP flux as the difference between VPi-ATP and VATP. The coupled reactions catalyzed by the glycolytic enzymes GAPDH and phosphoglycerate kinase (PGK) have been shown to catalyze measurable exchange between ATP and Pi in some systems and have been suggested to be responsible for this surplus flux. Surplus VPi-ATP did not change between rest and exercise, even though the concentrations of Pi and ADP, which are substrates for GAPDH and PGK, respectively, increased as expected. However, involvement of these enzymes is suggested by correlations between absolute and surplus Pi→ATP flux, both at rest and during exercise, and the intensity of the phosphomonoester peak in the (31)P NMR spectrum. This peak includes contributions from sugar phosphates in the glycolytic pathway, and changes in its intensity may indicate changes in downstream glycolytic intermediates, including 3-phosphoglycerate, which has been shown to influence the exchange between ATP and Pi catalyzed by GAPDH and PGK. Copyright © 2016 the American Physiological Society.
Interactive visual exploration of a trillion particles
Schatz, Karsten; Mü ller, Christoph; Krone, Michael; Schneider, Jens; Reina, Guido; Ertl, Thomas
2017-01-01
users to easily identify interesting locations even in overviews, both the focus and context view use color tables to show data attributes on the respective scale. We demonstrate that our technique achieves interactive performance on a one trillionpar
The Omics Dashboard for interactive exploration of gene-expression data.
Paley, Suzanne; Parker, Karen; Spaulding, Aaron; Tomb, Jean-Francois; O'Maille, Paul; Karp, Peter D
2017-12-01
The Omics Dashboard is a software tool for interactive exploration and analysis of gene-expression datasets. The Omics Dashboard is organized as a hierarchy of cellular systems. At the highest level of the hierarchy the Dashboard contains graphical panels depicting systems such as biosynthesis, energy metabolism, regulation and central dogma. Each of those panels contains a series of X-Y plots depicting expression levels of subsystems of that panel, e.g. subsystems within the central dogma panel include transcription, translation and protein maturation and folding. The Dashboard presents a visual read-out of the expression status of cellular systems to facilitate a rapid top-down user survey of how all cellular systems are responding to a given stimulus, and to enable the user to quickly view the responses of genes within specific systems of interest. Although the Dashboard is complementary to traditional statistical methods for analysis of gene-expression data, we show how it can detect changes in gene expression that statistical techniques may overlook. We present the capabilities of the Dashboard using two case studies: the analysis of lipid production for the marine alga Thalassiosira pseudonana, and an investigation of a shift from anaerobic to aerobic growth for the bacterium Escherichia coli. © The Author(s) 2017. Published by Oxford University Press on behalf of Nucleic Acids Research.
Explore the interactive design of touch interface Webpage
Directory of Open Access Journals (Sweden)
JIANG Zhen
2014-12-01
Full Text Available With the arrival of the era of mobile touch,website HTML,CSS and JavaScript building have been changed.Especially the functional development of hypertext markup language HTML5 and touch interface not only enhances the speed of the Website,but also creates amazing user experiences.Therefore,now Webpage design focus on the transmission of information at the same time,more concerns itself about the personalized and interactive design of users,including visual experience,browsing expect and psychological interaction,etc.
Exploring Market State and Stock Interactions on the Minute Timescale.
Directory of Open Access Journals (Sweden)
Lei Tan
Full Text Available A stock market is a non-stationary complex system. The stock interactions are important for understanding the state of the market. However, our knowledge on the stock interactions on the minute timescale is limited. Here we apply the random matrix theory and methods in complex networks to study the stock interactions and sector interactions. Further, we construct a new kind of cross-correlation matrix to investigate the correlation between the stock interactions at different minutes within one trading day. Based on 50 million minute-to-minute price data in the Shanghai stock market, we discover that the market states in the morning and afternoon are significantly different. The differences mainly exist in three aspects, i.e. the co-movement of stock prices, interactions of sectors and correlation between the stock interactions at different minutes. In the afternoon, the component stocks of sectors are more robust and the structure of sectors is firmer. Therefore, the market state in the afternoon is more stable. Furthermore, we reveal that the information of the sector interactions can indicate the financial crisis in the market, and the indicator based on the empirical data in the afternoon is more effective.
Exploring Market State and Stock Interactions on the Minute Timescale.
Tan, Lei; Chen, Jun-Jie; Zheng, Bo; Ouyang, Fang-Yan
2016-01-01
A stock market is a non-stationary complex system. The stock interactions are important for understanding the state of the market. However, our knowledge on the stock interactions on the minute timescale is limited. Here we apply the random matrix theory and methods in complex networks to study the stock interactions and sector interactions. Further, we construct a new kind of cross-correlation matrix to investigate the correlation between the stock interactions at different minutes within one trading day. Based on 50 million minute-to-minute price data in the Shanghai stock market, we discover that the market states in the morning and afternoon are significantly different. The differences mainly exist in three aspects, i.e. the co-movement of stock prices, interactions of sectors and correlation between the stock interactions at different minutes. In the afternoon, the component stocks of sectors are more robust and the structure of sectors is firmer. Therefore, the market state in the afternoon is more stable. Furthermore, we reveal that the information of the sector interactions can indicate the financial crisis in the market, and the indicator based on the empirical data in the afternoon is more effective.
US Agency for International Development — The Foreign Aid Explorer shows the multi-dimensional picture of U.S. foreign assistance through a highly visual and interactive website. The website makes it easy...
ENTREPRENEURSHIP AS SOCIAL INTERACTION
DEFF Research Database (Denmark)
Larsen, Henry; Lima, Patricia; Olsen, Bente
2013-01-01
This paper aims to explore how entrepreneurs work with innovation; to explore and develop attention points in understanding entrepreneurship as social processes of interaction between people. Through interviews and engagement with entrepreneurs and key stakeholders, their actual social practices...... entrepreneurship as socially constructed through local interactions between players and identify key themes in these interactions within the organisation, such as leadership, becoming part of the initiative and trust/mistrust. By doing so, this paper contributes to an understanding of entrepreneurship as social...... and the influence on the progress as innovators are explored. It is focused on a new local activity in a Danish town, named the I-factory which has within a year gathered almost 40 entrepreneurs. As a part of the interaction, there were created activities to encourage even more collaboration. We see...
Streptomyces Exploration: Competition, Volatile Communication and New Bacterial Behaviours.
Jones, Stephanie E; Elliot, Marie A
2017-07-01
Streptomyces bacteria are prolific producers of specialized metabolites, and have a well studied, complex life cycle. Recent work has revealed a new type of Streptomyces growth termed 'exploration' - so named for the ability of explorer cells to rapidly traverse solid surfaces. Streptomyces exploration is stimulated by fungal interactions, and is associated with the production of an alkaline volatile organic compound (VOC) capable of inducing exploration by other streptomycetes. Here, we examine Streptomyces exploration from the perspectives of interkingdom interactions, pH-induced morphological switches, and VOC-mediated communication. The phenotypic diversity that can be revealed through microbial interactions and VOC exposure is providing us with insight into novel modes of microbial development, and an opportunity to exploit VOCs to stimulate desired microbial behaviours. Copyright © 2017 Elsevier Ltd. All rights reserved.
Brigdan, Matthew; Hill, Michael D; Jagdev, Abhijeet; Kamal, Noreen
2018-01-01
The ESCAPE (Endovascular Treatment for Small Core and Anterior Circulation Proximal Occlusion With Emphasis on Minimizing CT to Recanalization Times) randomized clinical trial collected a large diverse data set. However, it is difficult to fully understand the effects of the study on certain patient groups and disease progression. We developed and evaluated an interactive visualization of the ESCAPE trial data. We iteratively designed an interactive visualization using Python's Bokeh software library. The design was evaluated through a user study, which quantitatively evaluated its efficiency and accuracy against traditional modified Rankin Scalegraphic. Qualitative feedback was also evaluated. The novel interactive visualization of the ESCAPE data are publicly available at http://escapevisualization.herokuapp.com/. There was no difference in the efficiency and accuracy when comparing the use of the novel with the traditional visualization. However, users preferred the novel visualization because it allowed for greater exploration. Some insights obtained through exploration of the ESCAPE data are presented. Novel interactive visualizations can be applied to acute stroke trial data to allow for greater exploration of the results. URL: http://www.clinicaltrials.gov. Unique identifier: NCT01778335. © 2017 American Heart Association, Inc.
Game Mechanics and Bodily Interactions: Designing Interactive Technologies for Sports Training
DEFF Research Database (Denmark)
Jensen, Mads Møller
and enjoyment. Thus, despite being two coexisting research areas, they do not extend or contribute to one another per se. However, bridging this gap by combining skill acquisition knowledge from sports training technologies with motivational game mechanics from bodily games holds great potential for designing...... and developing relevant and engaging training experiences. I term this combination interactive sports training games. This dissertation bridges this gap by exploring how to design and develop bodily interactions that leverage the quality and engagement of sports training by using game mechanics, but also how...... to identify and avoid the pitfalls and challenges that emerge in the process. It further explores how competition can be facilitated in bodily games and how it affects players. These explorations are done by designing, developing and evaluating innovative interactive sports training games. The results...
Bach, Benjamin; Sicat, Ronell; Beyer, Johanna; Cordeil, Maxime; Pfister, Hanspeter
2018-01-01
We report on a controlled user study comparing three visualization environments for common 3D exploration. Our environments differ in how they exploit natural human perception and interaction capabilities. We compare an augmented-reality head-mounted display (Microsoft HoloLens), a handheld tablet, and a desktop setup. The novel head-mounted HoloLens display projects stereoscopic images of virtual content into a user's real world and allows for interaction in-situ at the spatial position of the 3D hologram. The tablet is able to interact with 3D content through touch, spatial positioning, and tangible markers, however, 3D content is still presented on a 2D surface. Our hypothesis is that visualization environments that match human perceptual and interaction capabilities better to the task at hand improve understanding of 3D visualizations. To better understand the space of display and interaction modalities in visualization environments, we first propose a classification based on three dimensions: perception, interaction, and the spatial and cognitive proximity of the two. Each technique in our study is located at a different position along these three dimensions. We asked 15 participants to perform four tasks, each task having different levels of difficulty for both spatial perception and degrees of freedom for interaction. Our results show that each of the tested environments is more effective for certain tasks, but that generally the desktop environment is still fastest and most precise in almost all cases.
Bach, Benjamin
2017-08-29
We report on a controlled user study comparing three visualization environments for common 3D exploration. Our environments differ in how they exploit natural human perception and interaction capabilities. We compare an augmented-reality head-mounted display (Microsoft HoloLens), a handheld tablet, and a desktop setup. The novel head-mounted HoloLens display projects stereoscopic images of virtual content into a user\\'s real world and allows for interaction in-situ at the spatial position of the 3D hologram. The tablet is able to interact with 3D content through touch, spatial positioning, and tangible markers, however, 3D content is still presented on a 2D surface. Our hypothesis is that visualization environments that match human perceptual and interaction capabilities better to the task at hand improve understanding of 3D visualizations. To better understand the space of display and interaction modalities in visualization environments, we first propose a classification based on three dimensions: perception, interaction, and the spatial and cognitive proximity of the two. Each technique in our study is located at a different position along these three dimensions. We asked 15 participants to perform four tasks, each task having different levels of difficulty for both spatial perception and degrees of freedom for interaction. Our results show that each of the tested environments is more effective for certain tasks, but that generally the desktop environment is still fastest and most precise in almost all cases.
Exploring the Technical Adequacy of the Family Interaction Inventory.
Robinson, Christopher S.; And Others
There are no available measures that assess family interaction from a comprehensive theoretical perspective. This study reports analyses of the measurement integrity of scores from a measure developed to offer a comprehensive assessment. The preliminary version of the Family Interaction Inventory (FII) is a 24-scale instrument with 5 items per…
Yu, Bowen; Doraiswamy, Harish; Chen, Xi; Miraldi, Emily; Arrieta-Ortiz, Mario Luis; Hafemeister, Christoph; Madar, Aviv; Bonneau, Richard; Silva, Cláudio T
2014-12-01
Elucidation of transcriptional regulatory networks (TRNs) is a fundamental goal in biology, and one of the most important components of TRNs are transcription factors (TFs), proteins that specifically bind to gene promoter and enhancer regions to alter target gene expression patterns. Advances in genomic technologies as well as advances in computational biology have led to multiple large regulatory network models (directed networks) each with a large corpus of supporting data and gene-annotation. There are multiple possible biological motivations for exploring large regulatory network models, including: validating TF-target gene relationships, figuring out co-regulation patterns, and exploring the coordination of cell processes in response to changes in cell state or environment. Here we focus on queries aimed at validating regulatory network models, and on coordinating visualization of primary data and directed weighted gene regulatory networks. The large size of both the network models and the primary data can make such coordinated queries cumbersome with existing tools and, in particular, inhibits the sharing of results between collaborators. In this work, we develop and demonstrate a web-based framework for coordinating visualization and exploration of expression data (RNA-seq, microarray), network models and gene-binding data (ChIP-seq). Using specialized data structures and multiple coordinated views, we design an efficient querying model to support interactive analysis of the data. Finally, we show the effectiveness of our framework through case studies for the mouse immune system (a dataset focused on a subset of key cellular functions) and a model bacteria (a small genome with high data-completeness).
Exploring Conditions to Enhance Student/Host Family Interaction Abroad
Knight, Susan M.; Schmidt-Rinehart, Barbara C.
2010-01-01
This study investigates the role of task-based learning in the study abroad experience in order to enhance interaction with the host family. Tasks were incorporated into a Family Interaction Journal and implemented under four evolving, though different, conditions over a 5-year period. The conditions were: (1) home campus administered/student…
Energy Technology Data Exchange (ETDEWEB)
Spacek, M. [First Faculty of Medicine and General Teaching Hospital, Second Clinical Department of Cardiovascular Surgery, Prague (Czech Republic); Na Homolce Hospital, Department of Vascular Surgery, Prague (Czech Republic); Belohlavek, O.; Votrubova, J. [PET Centre, Na Homolce Hospital, Department of Nuclear Medicine, Prague (Czech Republic); Sebesta, P.; Stadler, P. [Na Homolce Hospital, Department of Vascular Surgery, Prague (Czech Republic)
2009-05-15
Vascular prosthesis infection (VPI) is a life-threatening complication that occurs in 0.5-5% of prostheses. Low-grade infections in non-acute patients are a diagnostic challenge requiring a new method with good diagnostic accuracy. The aim of this work was to define the accuracy of {sup 18}F-FDG PET/CT in these settings and to identify essential parameters of the evaluation. PET/CT was performed prospectively in 76 consecutive patients with a total of 96 vascular prosthetic grafts in which infection was suspected. PET/CT scans were analysed in terms of the presence and intensity of focal and diffuse FDG uptake, the presence of an anastomotic pseudoaneurysm, the presence of an irregular boundary of infiltration, a combination of these, and the uptake ratio between the graft and blood background. The gold standard was based on operative/histopathological finding or a clinical follow up of >6 months. Among the various assessed parameters only focal FDG uptake and an irregular graft boundary were significant predictors of VPI. Focal intense FDG uptake together with an irregular boundary of the lesion on CT scan predicted VPI with 97% probability, while smooth lesion boundaries and no focal FDG uptake predicted a probability of VPI of less than 5%. Even in lesions with nondiagnostic inhomogeneous focal FDG uptake (18/96) an irregular boundary effectively helped in decision-making with a probability of 28% (smooth) or 77% (irregular) for VPI. PET/CT gave reliable results with an accuracy >95% in 75% of prostheses. PET/CT can identify those prostheses (25% of prosthesis) for which its diagnostic accuracy is diminished to 70-75%. In our series PET/CT was an excellent diagnostic modality for suspected VPI. (orig.)
C1-2 vertebral anomalies in 22q11.2 microdeletion syndrome
Energy Technology Data Exchange (ETDEWEB)
Konen, Osnat; Armstrong, Derek; Padfield, Nancy; Blaser, Susan [Hospital for Sick Children, Diagnostic Imaging, Toronto (Canada); Clarke, Howard [Hospital for Sick Children, Plastic Surgery, Toronto (Canada); Weksberg, Rosanna [Hospital for Sick Children, Clinical and Metabolic Genetics, Toronto (Canada)
2008-07-15
Chromosome 22q11.2 microdeletion syndrome (22q11DS) is characterized by cleft palate, cardiac anomalies, characteristic facies, high prevalence of skeletal anomalies and learning disability. To evaluate the prevalence of craniovertebral junction anomalies in children with 22q11DS and compare these findings to those in nonsyndromic children with velopharyngeal insufficiency (VPI). Sequential CT scans performed for presurgical carotid assessment in 76 children (45 children positive for chromosome 22q11.2 deletion and 31 negative for the deletion) with VPI were retrospectively evaluated for assessment of C1-2 anomalies. C1-2 vertebral anomalies, specifically midline C1 defects, uptilted or upswept posterior elements of C2 and fusions of C2-3, were nearly universal in our cohort of 22q11DS patients with VPI. They were strikingly absent in the majority of non-22q11DS patients with VPI. C1-2 vertebral anomalies, particularly those listed above, are important radiographic markers for 22q11DS. (orig.)
C1-2 vertebral anomalies in 22q11.2 microdeletion syndrome
International Nuclear Information System (INIS)
Konen, Osnat; Armstrong, Derek; Padfield, Nancy; Blaser, Susan; Clarke, Howard; Weksberg, Rosanna
2008-01-01
Chromosome 22q11.2 microdeletion syndrome (22q11DS) is characterized by cleft palate, cardiac anomalies, characteristic facies, high prevalence of skeletal anomalies and learning disability. To evaluate the prevalence of craniovertebral junction anomalies in children with 22q11DS and compare these findings to those in nonsyndromic children with velopharyngeal insufficiency (VPI). Sequential CT scans performed for presurgical carotid assessment in 76 children (45 children positive for chromosome 22q11.2 deletion and 31 negative for the deletion) with VPI were retrospectively evaluated for assessment of C1-2 anomalies. C1-2 vertebral anomalies, specifically midline C1 defects, uptilted or upswept posterior elements of C2 and fusions of C2-3, were nearly universal in our cohort of 22q11DS patients with VPI. They were strikingly absent in the majority of non-22q11DS patients with VPI. C1-2 vertebral anomalies, particularly those listed above, are important radiographic markers for 22q11DS. (orig.)
Thompson, Claire; Cummins, Steven; Brown, Tim; Kyle, Rosemary
2013-01-01
Despite a sustained academic interest in the environmental determinants of diet, relatively little is known about the ways in which individuals interact with their neighbourhood food environment and the use of its most important element, the supermarket. This qualitative study explores how residents of deprived neighbourhoods shop for food and how the supermarket environment influences their choices. Go-along interviews were conducted with 26 residents of Sandwell, a uniformly deprived metropolitan borough in the West Midlands, UK. Routine approaches to food shopping are characterised in terms of planning and reliance on the supermarket environment. Four distinct routines are identified: chaotic and reactive; working around the store; item-by-item; and restricted and budgeted. This suggests that residents of deprived neighbourhoods do not have uniform responses to food environments. Responses to supermarket environments appear to be mediated by levels of individual autonomy. A better understanding of how residents of deprived neighbourhoods interact with their food environment may help optimise environmental interventions aimed at improving physical access to food in these places. Copyright © 2012 Elsevier Ltd. All rights reserved.
Exploring the Interactions between Asian Culture (Confucianism) and Creativity
Kim, Kyung Hee
2007-01-01
According to Csikszentmihalyi (1988), creativity is a very complex interaction among a person, a field, and a culture. In keeping with this approach, a look at Asian culture in relation to its impact on creativity is in order. While people may vary in their native capacity for creativity, it is in the individual's interaction with the macrocosm…
Documentation of Appliances & Interaction Devices
DEFF Research Database (Denmark)
2004-01-01
The interaction devices and appliances explored in the WorkSPACE project, address spatial computing in the context of work. We have developed and explored a range of appliances and interaction devices. The scope has been to develop tools for support of collaboration by mixing digital and physical...
Exploring the tutor-student interaction in a blended university course
Directory of Open Access Journals (Sweden)
Krasnova Tatiana
2016-01-01
Full Text Available A meaningful tutor-student interaction requires a new insight into pedagogical principles and proper implementation of modern teaching strategies. This paper aims to contribute to the understanding of online tutoring in blended learning settings and the impact of the tutor-student interaction on the learning process. The article reports on the results of the study on students’ evaluation of the tutor’s role and the tutor-student interaction in a blended university course. The findings show that professional tutoring and the effective tutor-student interaction help students to improve their learning efficacy and to have a greater personal responsibility for their outcomes.
Applicability of neutrino beams to Earth exploration
International Nuclear Information System (INIS)
Dolgoshein, B.A.; Kalinovskij, A.N.
1985-01-01
The projects on applicability of neutrino beams from high energy accelerators for geological exploration and study of the Earth structure are discussed. The GENIUS (Geological Exploration by Neutrino Induced Underground Sound) project is among them. It covers detecting and studying space-time characteristics of acoustic signal arising in case of neutrino interaction with Earth depth rocks discussed. The GEMINI (Geological Exploration with Muons Induced by neutrino interactions) project represents one more possibility for using geotron neutrino beam for the purpose of geological exploration. The GEOSCAN project represents the possibility for applying high energy neutrino beams for the purpose of the Earth translusence to determine the changes in the density of internal part of the Earth. The necessity of detailed investigations of the problem of applicability of neutrino beams in the field of the Earth exploration is pointed out
We can predict postpalatoplasty velopharyngeal insufficiency in cleft palate patients.
Leclerc, Jacques E; Godbout, Audrey; Arteau-Gauthier, Isabelle; Lacour, Sophie; Abel, Kati; McConnell, Elisa-Maude
2014-02-01
To find an anatomical measurement of the cleft palate (or a calculated parameter) that predicts the occurrence of velopharyngeal insufficiency (VPI) after palatal cleft repair. Retrospective cohort study. Charts were reviewed from cleft palate patients who underwent palatoplasty by the Von Langenbeck technique for isolated cleft palate or Bardach two-flap palatoplasty for cleft lip-palate. Seven anatomical cleft parameters were prospectively measured during the palatoplasty procedure. Three blinded speech-language pathologists retrospectively scored the clinically assessed VPI at 4 years of age. The recommendation of pharyngoplasty was also used as an indicator of VPI. From 1993 to 2008, 67 patients were enrolled in the study. The best predicting parameter was the ratio a/(30 - b1), in which a is defined as the posterior gap between the soft palate and the posterior pharyngeal wall and b1 is the width of the cleft at the hard palate level. An a/(30 - b1) ratio >0.7 to 0.8 is associated with a higher risk of developing VPI (relative risk = 2.2-5.1, sensitivity = 72%-81%, P cleft at the hard palate level and the posterior gap between the soft palate and the posterior pharyngeal wall were found to be the most significant parameters in predicting VPI. The best correlation was obtained with the ratio a/(30 - b1). 4. Copyright © 2013 The American Laryngological, Rhinological and Otological Society, Inc.
What you say matters: exploring visual-verbal interactions in visual working memory.
Mate, Judit; Allen, Richard J; Baqués, Josep
2012-01-01
The aim of this study was to explore whether the content of a simple concurrent verbal load task determines the extent of its interference on memory for coloured shapes. The task consisted of remembering four visual items while repeating aloud a pair of words that varied in terms of imageability and relatedness to the task set. At test, a cue appeared that was either the colour or the shape of one of the previously seen objects, with participants required to select the object's other feature from a visual array. During encoding and retention, there were four verbal load conditions: (a) a related, shape-colour pair (from outside the experimental set, i.e., "pink square"); (b) a pair of unrelated but visually imageable, concrete, words (i.e., "big elephant"); (c) a pair of unrelated and abstract words (i.e., "critical event"); and (d) no verbal load. Results showed differential effects of these verbal load conditions. In particular, imageable words (concrete and related conditions) interfered to a greater degree than abstract words. Possible implications for how visual working memory interacts with verbal memory and long-term memory are discussed.
Energy Technology Data Exchange (ETDEWEB)
Oi, Takao; Mitome, Ryota; Yanase, Satoshi [Sophia Univ., Tokyo (Japan). Faculty of Science and Technology
2017-06-01
H/D and {sup 12}C/{sup 13}C vapour pressure isotope effects (VPIEs) in liquid fluoroform (CHF{sub 3}) were studied at the MPW1PW91/6-31 ++ G(d) level of theory. The CHF{sub 3} monomer and CHF{sub 3} molecules surrounded by other CHF{sub 3} molecules in every direction in CHF{sub 3} clusters were used as model molecules of vapour and liquid CHF{sub 3}. Although experimental results in which the vapour pressure of liquid {sup 12}CHF{sub 3} is higher than that of liquid {sup 12}CDF{sub 3} and the vapour pressure of liquid {sup 13}CHF{sub 3} is higher than that of liquid {sup 12}CHF{sub 3} between 125 and 212 K were qualitatively reproduced, the present calculations overestimated the H/D VPIE and underestimated the {sup 12}C/{sup 13}C VPIE. Temperature-dependent intermolecular interactions between hydrogen and fluorine atoms of neighbouring molecules were required to explain the temperature dependences of both H/D and {sup 12}C/{sup 13}C VPIEs.
Exploring the tutor-student interaction in a blended university course
Krasnova, Tatiana Ivanovna; Popova, Anna
2016-01-01
A meaningful tutor-student interaction requires a new insight into pedagogical principles and proper implementation of modern teaching strategies. This paper aims to contribute to the understanding of online tutoring in blended learning settings and the impact of the tutor-student interaction on the learning process. The article reports on the results of the study on students’ evaluation of the tutor’s role and the tutor-student interaction in a blended university course. The findings show th...
Exploring drug-target interaction networks of illicit drugs.
Atreya, Ravi V; Sun, Jingchun; Zhao, Zhongming
2013-01-01
Drug addiction is a complex and chronic mental disease, which places a large burden on the American healthcare system due to its negative effects on patients and their families. Recently, network pharmacology is emerging as a promising approach to drug discovery by integrating network biology and polypharmacology, allowing for a deeper understanding of molecular mechanisms of drug actions at the systems level. This study seeks to apply this approach for investigation of illicit drugs and their targets in order to elucidate their interaction patterns and potential secondary drugs that can aid future research and clinical care. In this study, we extracted 188 illicit substances and their related information from the DrugBank database. The data process revealed 86 illicit drugs targeting a total of 73 unique human genes, which forms an illicit drug-target network. Compared to the full drug-target network from DrugBank, illicit drugs and their target genes tend to cluster together and form four subnetworks, corresponding to four major medication categories: depressants, stimulants, analgesics, and steroids. External analysis of Anatomical Therapeutic Chemical (ATC) second sublevel classifications confirmed that the illicit drugs have neurological functions or act via mechanisms of stimulants, opioids, and steroids. To further explore other drugs potentially having associations with illicit drugs, we constructed an illicit-extended drug-target network by adding the drugs that have the same target(s) as illicit drugs to the illicit drug-target network. After analyzing the degree and betweenness of the network, we identified hubs and bridge nodes, which might play important roles in the development and treatment of drug addiction. Among them, 49 non-illicit drugs might have potential to be used to treat addiction or have addictive effects, including some results that are supported by previous studies. This study presents the first systematic review of the network
Genome Sequence of Vibrio cholerae Strain O1 Ogawa El Tor, Isolated in Mexico, 2013
Díaz-Quiñonez, José Alberto; Hernández-Monroy, Irma; López-Martínez, Irma; Ortiz-Alcántara, Joanna; González-Durán, Elizabeth; Ruiz-Matus, Cuitláhuac; Kuri-Morales, Pablo; Ramírez-González, José Ernesto
2014-01-01
We present the draft genome sequence of Vibrio cholerae InDRE 3140 recovered in 2013 during a cholera outbreak in Mexico. The genome showed the Vibrio 7th pandemic islands VSP1 and VSP2, the pathogenic islands VPI-1 and VPI-2, the integrative and conjugative element SXT/R391 (ICE-SXT), and both prophages CTXφ and RS1φ.
Active Learning for Autonomous Intelligent Agents: Exploration, Curiosity, and Interaction
Lopes, Manuel; Montesano, Luis
2014-01-01
In this survey we present different approaches that allow an intelligent agent to explore autonomous its environment to gather information and learn multiple tasks. Different communities proposed different solutions, that are in many cases, similar and/or complementary. These solutions include active learning, exploration/exploitation, online-learning and social learning. The common aspect of all these approaches is that it is the agent to selects and decides what information to gather next. ...
Glycodendrimers: tools to explore multivalent galectin-1 interactions
Directory of Open Access Journals (Sweden)
Jonathan M. Cousin
2015-05-01
Full Text Available Four generations of lactose-functionalized polyamidoamine (PAMAM were employed to further the understanding of multivalent galectin-1 mediated interactions. Dynamic light scattering and fluorescence microscopy were used to study the multivalent interaction of galectin-1 with the glycodendrimers in solution, and glycodendrimers were observed to organize galectin-1 into nanoparticles. In the presence of a large excess of galectin-1, glycodendrimers nucleated galectin-1 into nanoparticles that were remarkably homologous in size (400–500 nm. To understand augmentation of oncologic cellular aggregation by galectin-1, glycodendrimers were used in cell-based assays with human prostate carcinoma cells (DU145. The results revealed that glycodendrimers provided competitive binding sites for galectin-1, which diverted galectin-1 from its typical function in cellular aggregation of DU145 cells.
Tominski, Christian
2015-01-01
Visualization has become a valuable means for data exploration and analysis. Interactive visualization combines expressive graphical representations and effective user interaction. Although interaction is an important component of visualization approaches, much of the visualization literature tends to pay more attention to the graphical representation than to interaction.The goal of this work is to strengthen the interaction side of visualization. Based on a brief review of general aspects of interaction, we develop an interaction-oriented view on visualization. This view comprises five key as
Directory of Open Access Journals (Sweden)
Sarah Donegan
Full Text Available Treatment by covariate interactions can be explored in reviews using interaction analyses (e.g., subgroup analysis. Such analyses can provide information on how the covariate modifies the treatment effect and is an important methodological approach for personalising medicine. Guidance exists regarding how to apply such analyses but little is known about whether authors follow the guidance.Using published recommendations, we developed criteria to assess how well interaction analyses were designed, applied, interpreted, and reported. The Cochrane Database of Systematic Reviews was searched (8th August 2013. We applied the criteria to the most recently published review, with an accessible protocol, for each Cochrane Review Group. We excluded review updates, diagnostic test accuracy reviews, withdrawn reviews, and overviews of reviews. Data were summarised regarding reviews, covariates, and analyses.Each of the 52 included reviews planned or did interaction analyses; 51 reviews (98% planned analyses and 33 reviews (63% applied analyses. The type of analysis planned and the type subsequently applied (e.g., sensitivity or subgroup analysis was discrepant in 24 reviews (46%. No review reported how or why each covariate had been chosen; 22 reviews (42% did state each covariate a priori in the protocol but no review identified each post-hoc covariate as such. Eleven reviews (21% mentioned five covariates or less. One review reported planning to use a method to detect interactions (i.e., interaction test for each covariate; another review reported applying the method for each covariate. Regarding interpretation, only one review reported whether an interaction was detected for each covariate and no review discussed the importance, or plausibility, of the results, or the possibility of confounding for each covariate.Interaction analyses in Cochrane Reviews can be substantially improved. The proposed criteria can be used to help guide the reporting and
Diachronic Perspective and Interaction
DEFF Research Database (Denmark)
Marchetti, Emanuela; Valente, Andrea
. An ongoing participatory inquiry is being conducted, to explore deeper forms of learning and communication for historical museums. Our hypothesis is that the diachronic perspective on historical processes, defined as social interaction within the environment through time, is a key missing element....... Although this interaction style may appeal to teachers, as it reminds of school teaching, it has several disadvantages: a dialogue never occurs between adults and children, who listen in silence, hence it becomes hard to evaluate what has being learnt and how deeply, and finally it is not very engaging....... Explorations of more interactive representations of the diachronic perspective, through play and tangible interaction, may foster a dialogue with young visitors. Therefore, a new interactive installation is being designed, intended as a tool to enrich learning, allowing children to experience historical...
Large, David R; Clark, Leigh; Quandt, Annie; Burnett, Gary; Skrypchuk, Lee
2017-09-01
Given the proliferation of 'intelligent' and 'socially-aware' digital assistants embodying everyday mobile technology - and the undeniable logic that utilising voice-activated controls and interfaces in cars reduces the visual and manual distraction of interacting with in-vehicle devices - it appears inevitable that next generation vehicles will be embodied by digital assistants and utilise spoken language as a method of interaction. From a design perspective, defining the language and interaction style that a digital driving assistant should adopt is contingent on the role that they play within the social fabric and context in which they are situated. We therefore conducted a qualitative, Wizard-of-Oz study to explore how drivers might interact linguistically with a natural language digital driving assistant. Twenty-five participants drove for 10 min in a medium-fidelity driving simulator while interacting with a state-of-the-art, high-functioning, conversational digital driving assistant. All exchanges were transcribed and analysed using recognised linguistic techniques, such as discourse and conversation analysis, normally reserved for interpersonal investigation. Language usage patterns demonstrate that interactions with the digital assistant were fundamentally social in nature, with participants affording the assistant equal social status and high-level cognitive processing capability. For example, participants were polite, actively controlled turn-taking during the conversation, and used back-channelling, fillers and hesitation, as they might in human communication. Furthermore, participants expected the digital assistant to understand and process complex requests mitigated with hedging words and expressions, and peppered with vague language and deictic references requiring shared contextual information and mutual understanding. Findings are presented in six themes which emerged during the analysis - formulating responses; turn-taking; back
DEFF Research Database (Denmark)
Clemensen, Nana
2016-01-01
In Hang'ombe Village in rural Zambia, the relative lack of physical boundaries between the activities of family members allow children to observe the actions and discussions of adults on close hand, exposing them to the ambiguities of daily life. Children explore these ambiguities in their intera...... in their interactions, testing social roles and conventions. This article explores the vigilance and creative agency displayed by Hang'ombe children, in an environment spurring their acquisition of distinct social and discursive skills.......In Hang'ombe Village in rural Zambia, the relative lack of physical boundaries between the activities of family members allow children to observe the actions and discussions of adults on close hand, exposing them to the ambiguities of daily life. Children explore these ambiguities...
Stensæth, Karette
2013-08-07
The point of departure in this text is the ongoing qualitative interdisciplinary research project RHYME (www.RHYME.no), which addresses the lack of health-promoting interactive and musical Information and Communications Technology (ICT) for families with children with severe disabilities. The project explores a new treatment paradigm based on collaborative, tangible, interactive net-based musical "smart things" with multimedia capabilities. The goal in RHYME is twofold: (1) to reduce isolation and passivity, and (2) to promote health and well-being. Co-creation is suggested as a possible path to achieving these goals, by evoking feelings, for example, or accommodating the needs to act and to create social relations; co-creation also motivates users to communicate and collaborate within (new) social relations. This article engages co-creation by incorporating aspects connected to interaction design and the field of music and health. Empirical observations will be referred to. The research question is as follows: What might co-creation imply for families of children with disabilities when musical and interactive tangibles are used as health-promoting implements?
Directory of Open Access Journals (Sweden)
Julia Garcia Durand
2011-04-01
Full Text Available OBJETIVO: Analisar a associação entre a exposição à violência por parceiro íntimo (VPI contra a mulher com desajustes comportamentais e problemas escolares entre os filhos. MÉTODOS: Inquérito populacional participante do WHO Multicountry Study on Violence Against Women, com 790 mulheres que coabitam com filhos de cinco a 12 anos, residentes no Município de São Paulo, SP, e na Zona da Mata de Pernambuco. Foram realizados três modelos múltiplos para estimar a força da associação entre variáveis explanatórias de apoio social e comunitário, eventos de vida estressantes, fatores sociodemográficos e gravidade da VPI, entre outras. Os modelos incluíram três respectivos desfechos: número de problemas de comportamento; agressividade; e interrupção abandono ou repetência escolar. RESULTADOS: A exposição à VPI física e/ou sexual grave esteve associada à ocorrência de problemas escolares, de problemas de comportamento em geral e de comportamentos agressivos na análise de regressão logística univariada. A exposição à VPI grave manteve-se associada à ocorrência de três ou mais problemas de comportamento entre seus filhos, independentemente do transtorno mental comum, da baixa escolaridade, de a mãe (avó ter sido vítima de VPI física e do apoio social e comunitário nos modelos de regressão logística múltiplos. A VPI grave esteve associada ao comportamento agressivo e aos problemas escolares, depois do ajuste por outras variáveis sociodemográficas, entre outras. O estado de saúde mental materna constituiu-se em fator mediador da relação entre a exposição à VPI e os problemas de comportamento, sobretudo agressividade. CONCLUSÕES: A VPI grave afeta o comportamento dos filhos e deve ser incluída na assistência à saúde das crianças em idade escolar, por meio de intervenções conjuntas entre crianças e mães.OBJETIVO: Analizar la asociación entre la exposición a la violencia por pareja íntima (VPI
Interactive cinema : engagement and interaction
Vosmeer, M.; Schouten, B.; Mitchell, A.
2014-01-01
Technologies that were initially developed to be applied within the domain of video games are currently being used in experiments to explore their meaning and possibilities for cinema and cinema audiences. In this position paper we examine how narrativity, interactivity and engagement are mutually
Readability of online patient education materials for velopharyngeal insufficiency.
Xie, Deborah X; Wang, Ray Y; Chinnadurai, Sivakumar
2018-01-01
Evaluate the readability of online and mobile application health information about velopharyngeal insufficiency (VPI). Top website and mobile application results for search terms "velopharyngeal insufficiency", "velopharyngeal dysfunction", "VPI", and "VPD" were analyzed. Readability was determined using 10 algorithms with Readability Studio Professional Edition (Oleander Software Ltd; Vandalia, OH). Subgroup analysis was performed based on search term and article source - academic hospital, general online resource, peer-reviewed journal, or professional organization. 18 unique articles were identified. Overall mean reading grade level was a 12.89 ± 2.9. The highest reading level among these articles was 15.47-approximately the level of a college senior. Articles from "velopharyngeal dysfunction" had the highest mean reading level (13.73 ± 2.11), above "velopharyngeal insufficiency" (12.30 ± 1.56) and "VPI" (11.66 ± 1.70). Articles from peer-reviewed journals had the highest mean reading level (15.35 ± 2.79), while articles from academic hospitals had the lowest (12.81 ± 1.66). There were statistically significant differences in reading levels between the different search terms (P reading level guidelines, online patient education materials for VPI are disseminated with language too complex for most readers. There is also a lack of VPI-related mobile application data available for patients. Patients will benefit if future updates to websites and disseminated patient information are undertaken with health literacy in mind. Future studies will investigate patient comprehension of these materials. Copyright © 2017 Elsevier B.V. All rights reserved.
Incidence of Speech-Correcting Surgery in Children With Isolated Cleft Palate.
Gustafsson, Charlotta; Heliövaara, Arja; Leikola, Junnu; Rautio, Jorma
2018-01-01
Speech-correcting surgeries (pharyngoplasty) are performed to correct velopharyngeal insufficiency (VPI). This study aimed to analyze the need for speech-correcting surgery in children with isolated cleft palate (ICP) and to determine differences among cleft extent, gender, and primary technique used. In addition, we assessed the timing and number of secondary procedures performed and the incidence of operated fistulas. Retrospective medical chart review study from hospital archives and electronic records. These comprised the 423 consecutive nonsyndromic children (157 males and 266 females) with ICP treated at the Cleft Palate and Craniofacial Center of Helsinki University Hospital during 1990 to 2016. The total incidence of VPI surgery was 33.3% and the fistula repair rate, 7.8%. Children with cleft of both the hard and soft palate (n = 300) had a VPI secondary surgery rate of 37.3% (fistula repair rate 10.7%), whereas children with only cleft of the soft palate (n = 123) had a corresponding rate of 23.6% (fistula repair rate 0.8%). Gender and primary palatoplasty technique were not considered significant factors in need for VPI surgery. The majority of VPI surgeries were performed before school age. One fifth of patients receiving speech-correcting surgery had more than one subsequent procedure. The need for speech-correcting surgery and fistula repair was related to the severity of the cleft. Although the majority of the corrective surgeries were done before the age of 7 years, a considerable number were performed at a later stage, necessitating long-term observation.
Short Paper: Design Tools, Hybridization Exploring Intuitive Interaction
Wendrich, Robert E.; Kuhlen, Torsten; Coquillart, Sabine; Interrante, Victoria
2010-01-01
Design and Design Engineering is about making abstract representations often based on fuzzy notions, ideas or prerequisite requirements with the use of various design tools. This paper introduces an interactive hybrid design tool to assist and support singular design activity or multiple
Exploring Science Through Polar Exploration
Pfirman, S. L.; Bell, R. E.; Zadoff, L.; Kelsey, R.
2003-12-01
Exploring the Poles is a First Year Seminar course taught at Barnard College, Columbia University. First Year Seminars are required of incoming students and are designed to encourage critical analysis in a small class setting with focused discussion. The class links historical polar exploration with current research in order to: introduce non-scientists to the value of environmental science through polar literature; discuss issues related to venturing into the unknown that are of relevance to any discipline: self-reliance, leadership, preparation, decisions under uncertainty; show students the human face of science; change attitudes about science and scientists; use data to engage students in exploring/understanding the environment and help them learn to draw conclusions from data; integrate research and education. These goals are met by bringing analysis of early exploration efforts together with a modern understanding of the polar environment. To date to class has followed the efforts of Nansen in the Fram, Scott and Amundsen in their race to the pole, and Shackleton's Endurance. As students read turn-of-the-century expedition journals, expedition progress is progressively revealed on an interactive map showing the environmental context. To bring the exploration process to life, students are assigned to expedition teams for specific years and the fates of the student "expeditions" are based on their own decisions. For example, in the Arctic, they navigate coastal sea ice and become frozen into the ice north of Siberia, re-creating Nansen's polar drift. Fates of the teams varied tremendously: some safely emerged at Fram Strait in 4 years, while others nearly became hopelessly lost in the Beaufort Gyre. Students thus learn about variability in the current polar environment through first hand experience, enabling them to appreciate the experiences, decisions, and, in some cases, the luck, of polar explorers. Evaluation by the Columbia Center for New Media, Teaching
Directory of Open Access Journals (Sweden)
Gulsym S. Manasova
2016-05-01
3Communal Health Protection Institution “Maternity Hospital №5”, Odessa, Ukraine Аbstract The article presents the results of calcium-phosphorus homeostasis study in pregnant women with verified perinatal infection (VPI and osteopenic syndrome. Materials and methods. 3 groups of pregnant women were examined in dynamics. There were 192 patients with VPI and clinical and/or ultrasound manifestations of infections (I-A, 43 patients had VPI without manifestations of infection (I-B; 128 healthy women constituted the control group (II. The content of general and ionized calcium, phosphorus in blood, and urinarium calcium excretion were defined by photometric method; bone tissue state was examined by ultrasound densitometry. Results. The reduction of total and ionized calcium concentration took place with increasing gestational age ((1,89 ± 0,03 and (1,67 ± 0,05 mmol / l and control ((2,41 ± 0,02 in the 2nd, (2,16 ± 0,03 - in the 3rd trimester (p <0,001 groups. Calcium levels in healthy women remained within the physiological concentrations, whereas calcium decrease was significant already in the 2nd trimester at VPI. BMD conformed osteoporosis in 9,78% of the women under observation with the VPI already at the initial examination and osteopenic syndrome (OPS was identified in 71,91% of women. In the control group OPS was diagnosed in only 23,43% of the patients. Conclusions. Blood calcium concentration is characterized by decrease and depends on increasing gestational age in all groups; calcium level is significantly lower at infected patients. Evidently, elevation of VPI pregnant women calcium needs is not compensated by the mechanisms of physiological adaptation, as against healthy women. Reduced of bone mineral density at infected womwn is characterized by more pronounced and rapid changes in comparison with the same indexes in the group of healthy pregnant women. Perinatal infection is one of risk factor for osteoporosis development in
Directory of Open Access Journals (Sweden)
Jan Peters-Anders
2017-05-01
Full Text Available This paper investigates the extent to which a mobile data source can be utilised to generate new information intelligence for decision-making in smart city planning processes. In this regard, the Mobility Explorer framework is introduced and applied to the City of Vienna (Austria by using anonymised mobile phone data from a mobile phone service provider. This framework identifies five necessary elements that are needed to develop complex planning applications. As part of the investigation and experiments a new dynamic software tool, called Mobility Explorer, has been designed and developed based on the requirements of the planning department of the City of Vienna. As a result, the Mobility Explorer enables city stakeholders to interactively visualise the dynamic diurnal population distribution, mobility patterns and various other complex outputs for planning needs. Based on the experiences during the development phase, this paper discusses mobile data issues, presents the visual interface, performs various user-defined analyses, demonstrates the application’s usefulness and critically reflects on the evaluation results of the citizens’ motion exploration that reveal the great potential of mobile phone data in smart city planning but also depict its limitations. These experiences and lessons learned from the Mobility Explorer application development provide useful insights for other cities and planners who want to make informed decisions using mobile phone data in their city planning processes through dynamic visualisation of Call Data Record (CDR data.
The social interaction of return to work explored from co-workers experiences.
Tjulin, Åsa; MacEachen, Ellen; Stiwne, Elinor Edvardsson; Ekberg, Kerstin
2011-01-01
The objective was to explore the role and contribution of co-workers in the return-to-work process. The social interaction of co-workers in the return-to-work process are analysed within the framework of the Swedish national and local employer organisational return-to-work policies. An exploratory qualitative method was used, consisting of open-ended interviews with 33 workplace actors across seven work units. Organisational return-to-work policies were collected from the three public sector employers. The key findings that emerged during analysis showed that some co-workers have a more work-task oriented approach towards the return-to-work process, whilst others had a more social relational approach. In both situations, the social relations worked hand in hand with job tasks (how task were allocated, and how returning workers were supported by others) and could make or break the return-to-work process. A suggestion for improvement of return-to-work models and policies is the need to take into account the social relations amongst workplace actors, especially involving co-workers when planning for return-to-work interventions. Otherwise the proper attention to work arrangements, social communication and the role of co-workers in the return-to-work process might not be seen.
DEFF Research Database (Denmark)
Lawson, Lartey; Nielsen, Kurt
2005-01-01
We discuss individual learning by interactive benchmarking using stochastic frontier models. The interactions allow the user to tailor the performance evaluation to preferences and explore alternative improvement strategies by selecting and searching the different frontiers using directional...... in the suggested benchmarking tool. The study investigates how different characteristics on dairy farms influences the technical efficiency....
Measuring the coolness of interactive products
DEFF Research Database (Denmark)
Bruun, Anders; Raptis, Dimitrios; Kjeldskov, Jesper
2016-01-01
Coolness has recently started to be explored as a design goal for interactive products from practitioners as well as researchers within human–computer interaction (HCI), but there is still a need to further operationalise the concept and explore how we can measure it. Our contribution in this paper...
Exploring Genetic Suppression Interactions on a Global Scale
van Leeuwen, Jolanda; Pons, Carles; Mellor, Joseph C.; Yamaguchi, Takafumi N.; Friesen, Helena; Koschwanez, John; Ušaj, Mojca Mattiazzi; Pechlaner, Maria; Takar, Mehmet; Ušaj, Matej; VanderSluis, Benjamin; Andrusiak, Kerry; Bansal, Pritpal; Baryshnikova, Anastasia; Boone, Claire
2016-01-01
Genetic suppression occurs when the phenotypic defects caused by a mutation in a particular gene are rescued by a mutation in a second gene. To explore the principles of genetic suppression, we examined both literature-curated and unbiased experimental data, involving systematic genetic mapping and whole-genome sequencing, to generate a large-scale suppression network among yeast genes. Most suppression pairs identified novel relationships among functionally related genes, providing new insig...
Interactive and Approachable Web-Based Tools for Exploring Global Geophysical Data Records
Croteau, M. J.; Nerem, R. S.; Merrifield, M. A.; Thompson, P. R.; Loomis, B. D.; Wiese, D. N.; Zlotnicki, V.; Larson, J.; Talpe, M.; Hardy, R. A.
2017-12-01
Making global and regional data accessible and understandable for non-experts can be both challenging and hazardous. While data products are often developed with end users in mind, the ease of use of these data can vary greatly. Scientists must take care to provide detailed guides for how to use data products to ensure users are not incorrectly applying data to their problem. For example, terrestrial water storage data from the Gravity Recovery and Climate Experiment (GRACE) satellite mission is notoriously difficult for non-experts to access and correctly use. However, allowing these data to be easily accessible to scientists outside the GRACE community is desirable because this would allow that data to see much wider-spread use. We have developed a web-based interactive mapping and plotting tool that provides easy access to geophysical data. This work presents an intuitive method for making such data widely accessible to experts and non-experts alike, making the data approachable and ensuring proper use of the data. This tool has proven helpful to experts by providing fast and detailed access to the data. Simultaneously, the tool allows non-experts to gain familiarity with the information contained in the data and access to that information for both scientific studies and public use. In this presentation, we discuss the development of this tool and application to both GRACE and ocean altimetry satellite missions, and demonstrate the capabilities of the tool. Focusing on the data visualization aspects of the tool, we showcase our integrations of the Mapbox API and the D3.js data-driven web document framework. We then explore the potential of these tools in other web-based visualization projects, and how incorporation of such tools into science can improve the presentation of research results. We demonstrate how the development of an interactive and exploratory resource can enable further layers of exploratory and scientific discovery.
Catala, Alejandro; Theune, Mariët; Sylla, Cristina; Ribeiro, Pedro; Nunes, Nuno; Oakley, Ian; Nisi, Valentina
2017-01-01
This workshop aims to explore challenges and potential opportunities in bringing interactive digital storytelling into the realm of tangible and embodied interaction. To this end, experts from both fields are invited to present and discuss their ideas. Besides fostering discussion and potential
MaGnET: Malaria Genome Exploration Tool.
Sharman, Joanna L; Gerloff, Dietlind L
2013-09-15
The Malaria Genome Exploration Tool (MaGnET) is a software tool enabling intuitive 'exploration-style' visualization of functional genomics data relating to the malaria parasite, Plasmodium falciparum. MaGnET provides innovative integrated graphic displays for different datasets, including genomic location of genes, mRNA expression data, protein-protein interactions and more. Any selection of genes to explore made by the user is easily carried over between the different viewers for different datasets, and can be changed interactively at any point (without returning to a search). Free online use (Java Web Start) or download (Java application archive and MySQL database; requires local MySQL installation) at http://malariagenomeexplorer.org joanna.sharman@ed.ac.uk or dgerloff@ffame.org Supplementary data are available at Bioinformatics online.
Interacting dark sector with transversal interaction
Energy Technology Data Exchange (ETDEWEB)
Chimento, Luis P.; Richarte, Martín G. [Departamento de Física, Facultad de Ciencias Exactas y Naturales, Universidad de Buenos Aires and IFIBA, CONICET, Ciudad Universitaria, Pabellón I, Buenos Aires 1428 (Argentina)
2015-03-26
We investigate the interacting dark sector composed of dark matter, dark energy, and dark radiation for a spatially flat Friedmann-Robertson-Walker (FRW) background by introducing a three-dimensional internal space spanned by the interaction vector Q and solve the source equation for a linear transversal interaction. Then, we explore a realistic model with dark matter coupled to a scalar field plus a decoupled radiation term, analyze the amount of dark energy in the radiation era and find that our model is consistent with the recent measurements of cosmic microwave background anisotropy coming from Planck along with the future constraints achievable by CMBPol experiment.
Wee, Jieun; Lee, Joonhwan
2017-01-01
It is widely accepted that people tend to associate more and feel closer to those who share similar attributes with themselves. Most of the research on the phenomenon has been carried out in face-to-face contexts. However, it is necessary to study the phenomenon in computer-mediated contexts as well. Exploring Facebook is important in that friendships within the network indicate a broader spectrum of friends, ranging from complete strangers to confiding relations. Also, since diverse communication methods are available on Facebook, which method a user adopts to interact with a "friend" could influence the quality of the relationship, i.e. intimacy. Thus, current research aims to test whether people in computer-mediated contexts do perceive more intimacy toward friends who share similar traits, and further, aims to examine which interaction methods influence the closeness of relationship by collecting activity data of users on Facebook. Results from current study show traits related to intimacy in the online context of Facebook. Moreover, in addition to the interaction type itself, direction of the interaction influenced how intimate users feel towards their friends. Overall findings suggest that further investigation on the dynamics of online communication methods used in developing and maintaining relationships is necessary.
Directory of Open Access Journals (Sweden)
Jieun Wee
Full Text Available It is widely accepted that people tend to associate more and feel closer to those who share similar attributes with themselves. Most of the research on the phenomenon has been carried out in face-to-face contexts. However, it is necessary to study the phenomenon in computer-mediated contexts as well. Exploring Facebook is important in that friendships within the network indicate a broader spectrum of friends, ranging from complete strangers to confiding relations. Also, since diverse communication methods are available on Facebook, which method a user adopts to interact with a "friend" could influence the quality of the relationship, i.e. intimacy. Thus, current research aims to test whether people in computer-mediated contexts do perceive more intimacy toward friends who share similar traits, and further, aims to examine which interaction methods influence the closeness of relationship by collecting activity data of users on Facebook. Results from current study show traits related to intimacy in the online context of Facebook. Moreover, in addition to the interaction type itself, direction of the interaction influenced how intimate users feel towards their friends. Overall findings suggest that further investigation on the dynamics of online communication methods used in developing and maintaining relationships is necessary.
Wee, Jieun; Lee, Joonhwan
2017-01-01
It is widely accepted that people tend to associate more and feel closer to those who share similar attributes with themselves. Most of the research on the phenomenon has been carried out in face-to-face contexts. However, it is necessary to study the phenomenon in computer-mediated contexts as well. Exploring Facebook is important in that friendships within the network indicate a broader spectrum of friends, ranging from complete strangers to confiding relations. Also, since diverse communication methods are available on Facebook, which method a user adopts to interact with a “friend” could influence the quality of the relationship, i.e. intimacy. Thus, current research aims to test whether people in computer-mediated contexts do perceive more intimacy toward friends who share similar traits, and further, aims to examine which interaction methods influence the closeness of relationship by collecting activity data of users on Facebook. Results from current study show traits related to intimacy in the online context of Facebook. Moreover, in addition to the interaction type itself, direction of the interaction influenced how intimate users feel towards their friends. Overall findings suggest that further investigation on the dynamics of online communication methods used in developing and maintaining relationships is necessary. PMID:28453526
Genome Sequence of Vibrio cholerae Strain O1 Ogawa El Tor, Isolated in Mexico, 2013.
Díaz-Quiñonez, José Alberto; Hernández-Monroy, Irma; López-Martínez, Irma; Ortiz-Alcántara, Joanna; González-Durán, Elizabeth; Ruiz-Matus, Cuitláhuac; Kuri-Morales, Pablo; Ramírez-González, José Ernesto
2014-10-30
We present the draft genome sequence of Vibrio cholerae InDRE 3140 recovered in 2013 during a cholera outbreak in Mexico. The genome showed the Vibrio 7th pandemic islands VSP1 and VSP2, the pathogenic islands VPI-1 and VPI-2, the integrative and conjugative element SXT/R391 (ICE-SXT), and both prophages CTXφ and RS1φ. Copyright © 2014 Díaz-Quiñonez et al.
2013-01-01
The point of departure in this text is the ongoing qualitative interdisciplinary research project RHYME (www.RHYME.no), which addresses the lack of health-promoting interactive and musical Information and Communications Technology (ICT) for families with children with severe disabilities. The project explores a new treatment paradigm based on collaborative, tangible, interactive net-based musical “smart things” with multimedia capabilities. The goal in RHYME is twofold: (1) to reduce isolation and passivity, and (2) to promote health and well-being. Co-creation is suggested as a possible path to achieving these goals, by evoking feelings, for example, or accommodating the needs to act and to create social relations; co-creation also motivates users to communicate and collaborate within (new) social relations. This article engages co-creation by incorporating aspects connected to interaction design and the field of music and health. Empirical observations will be referred to. The research question is as follows: What might co-creation imply for families of children with disabilities when musical and interactive tangibles are used as health-promoting implements? PMID:23930992
Wermker, Kai; Lünenbürger, Henning; Joos, Ulrich; Kleinheinz, Johannes; Jung, Susanne
2014-07-01
Velopharyngeal insufficiency (VPI) can be caused by a variety of disorders. The most common cause of VPI is the association with cleft palate. The aim of this study was to evaluate the effectiveness of different surgical techniques for cleft palate patients with VPI: (1) velopharyngoplasty with an inferiorly based posterior pharyngeal flap (VPP posterior, Schönborn-Rosenthal), and (2) combination of VPP posterior and push-back operation (Dorrance). 41 subjects (26 females, 15 males) with VPI were analysed. Hypernasality was judged subjectively and nasalance data were assessed objectively using the NasalView system preoperative and 6 months postoperative. Subjective analysis showed improved speech results regarding hypernasality for all OP-techniques with good results for VPP posterior and VPP posterior combined with push-back with success rates of 94.4% and 87.7%, respectively. Objective analysis showed a statistically significant reduction of nasalance for both VPP posterior and VPP posterior combined with push-back (p push-back. Based on our findings, both VPP posterior and VPP posterior combined with push-back showed good results in correction of hypernasality in cleft patients with velopharyngeal insufficiency. Copyright © 2013 European Association for Cranio-Maxillo-Facial Surgery. Published by Elsevier Ltd. All rights reserved.
Current Controversies in Diagnosis and Management of Cleft Palate and Velopharyngeal Insufficiency
Ysunza, Pablo Antonio; Repetto, Gabriela M.; Pamplona, Maria Carmen; Calderon, Juan F.; Shaheen, Kenneth; Chaiyasate, Konkgrit; Rontal, Matthew
2015-01-01
Background. One of the most controversial topics concerning cleft palate is the diagnosis and treatment of velopharyngeal insufficiency (VPI). Objective. This paper reviews current genetic aspects of cleft palate, imaging diagnosis of VPI, the planning of operations for restoring velopharyngeal function during speech, and strategies for speech pathology treatment of articulation disorders in patients with cleft palate. Materials and Methods. An updated review of the scientific literature concerning genetic aspects of cleft palate was carried out. Current strategies for assessing and treating articulation disorders associated with cleft palate were analyzed. Imaging procedures for assessing velopharyngeal closure during speech were reviewed, including a recent method for performing intraoperative videonasopharyngoscopy. Results. Conclusions from the analysis of genetic aspects of syndromic and nonsyndromic cleft palate and their use in its diagnosis and management are presented. Strategies for classifying and treating articulation disorders in patients with cleft palate are presented. Preliminary results of the use of multiplanar videofluoroscopy as an outpatient procedure and intraoperative endoscopy for the planning of operations which aimed to correct VPI are presented. Conclusion. This paper presents current aspects of the diagnosis and management of patients with cleft palate and VPI including 3 main aspects: genetics and genomics, speech pathology and imaging diagnosis, and surgical management. PMID:26273595
Current Controversies in Diagnosis and Management of Cleft Palate and Velopharyngeal Insufficiency
Directory of Open Access Journals (Sweden)
Pablo Antonio Ysunza
2015-01-01
Full Text Available Background. One of the most controversial topics concerning cleft palate is the diagnosis and treatment of velopharyngeal insufficiency (VPI. Objective. This paper reviews current genetic aspects of cleft palate, imaging diagnosis of VPI, the planning of operations for restoring velopharyngeal function during speech, and strategies for speech pathology treatment of articulation disorders in patients with cleft palate. Materials and Methods. An updated review of the scientific literature concerning genetic aspects of cleft palate was carried out. Current strategies for assessing and treating articulation disorders associated with cleft palate were analyzed. Imaging procedures for assessing velopharyngeal closure during speech were reviewed, including a recent method for performing intraoperative videonasopharyngoscopy. Results. Conclusions from the analysis of genetic aspects of syndromic and nonsyndromic cleft palate and their use in its diagnosis and management are presented. Strategies for classifying and treating articulation disorders in patients with cleft palate are presented. Preliminary results of the use of multiplanar videofluoroscopy as an outpatient procedure and intraoperative endoscopy for the planning of operations which aimed to correct VPI are presented. Conclusion. This paper presents current aspects of the diagnosis and management of patients with cleft palate and VPI including 3 main aspects: genetics and genomics, speech pathology and imaging diagnosis, and surgical management.
Insight: Exploring Hidden Roles in Collaborative Play
Directory of Open Access Journals (Sweden)
Tricia Shi
2015-06-01
Full Text Available This paper looks into interaction modes between players in co-located, collaborative games. In particular, hidden traitor games, in which one or more players is secretly working against the group mission, has the effect of increasing paranoia and distrust between players, so this paper looks into the opposite of a hidden traitor – a hidden benefactor. Rather than sabotaging the group mission, the hidden benefactor would help the group achieve the end goal while still having a reason to stay hidden. The paper explores what games with such a role can look like and how the role changes player interactions. Finally, the paper addresses the divide between video game and board game interaction modes; hidden roles are not common within video games, but they are of growing prevalence in board games. This fact, combined with the exploration of hidden benefactors, reveals that hidden roles is a mechanic that video games should develop into in order to match board games’ complexity of player interaction modes.
Designing for Interactional Empowerment
Ståhl, Anna
2014-01-01
This thesis further defines how to reach Interactional Empowerment through design for users. Interactional Empowerment is an interaction design program within the general area of affective interaction, focusing on the users’ ability to reflect, express themselves and engage in profound meaning-making. This has been explored through design of three systems eMoto, Affective Diary and Affective Health, which all mirror users’ emotions or bodily reactions in interaction in some way. From these ...
Social Foundations of Human Space Exploration
Dator, James A
2012-01-01
Social Foundations of Human Space Exploration presents a uniquely human perspective on the quest to explore space and to understand the universe through the lens of the arts, humanities, and social sciences. It considers early stories about the universe in various cultures; recent space fiction; the origins and cultural rationale for the space age; experiences of humans in space and their emerging interactions with robots and artificial intelligence; how humans should treat environments and alien life; and the alternative futures of space exploration and settlement.
Responses to interracial interactions over time.
Plant, E Ashby
2004-11-01
The current work tested and expanded on Plant and Devine's (2003) model of the antecedents and implications of interracial anxiety by examining people's experiences with interracial interactions at two time points. Study 1 explored non-Black people's responses to interactions with Black people and Study 2 explored Black people's responses to interactions with White people. Non-Black participants' expectancies about coming across as biased in interracial interactions and Black participants' expectancies about White people's bias predicted their interracial anxiety and whether they had positive interactions with outgroup members during the 2 weeks between assessments. Across both studies, interracial anxiety predicted the desire to avoid interactions with outgroup members. In addition, participants who were personally motivated to respond without prejudice reported more positive expectancies. The findings are discussed in terms of the implications for understanding the course and quality of interracial interactions.
Exploring pedestrian movement patterns
Orellana, D.A.
2012-01-01
The main objective of this thesis is to develop an approach for exploring, analysing and interpreting movement patterns of pedestrians interacting with the environment. This objective is broken down in sub-objectives related to four research questions. A case study of the movement of visitors in a
Earthworms, Dirt, and Rotten Leaves: An Exploration in Ecology.
McLaughlin, Molly
1994-01-01
This article provides a model for inviting children to "an exploration in ecology" by observing earthworms. It gives reasons to explore earthworms and guides the investigator through a detailed examination of the worms to answer 21 observation questions. Explores the ways in which earthworms interact with their environment. (LZ)
Exploring cultural factors in human-robot interaction : A matter of personality?
Weiss, Astrid; Evers, Vanessa
2011-01-01
This paper proposes an experimental study to investigate task-dependence and cultural-background dependence of the personality trait attribution on humanoid robots. In Human-Robot Interaction, as well as in Human-Agent Interaction research, the attribution of personality traits towards intelligent
Noble, Joshua
2012-01-01
Ready to create rich interactive experiences with your artwork, designs, or prototypes? This is the ideal place to start. With this hands-on guide, you'll explore several themes in interactive art and design-including 3D graphics, sound, physical interaction, computer vision, and geolocation-and learn the basic programming and electronics concepts you need to implement them. No previous experience is necessary. You'll get a complete introduction to three free tools created specifically for artists and designers: the Processing programming language, the Arduino microcontroller, and the openFr
Mishra, S. K.; Ding, D.; Rapolu, U.
2012-12-01
Human activity is intricately linked to the quality and quantity of water resources. Although many studies have examined water-human interaction, the complexity of such coupled systems is not well understood largely because of gaps in our knowledge of water-cycle processes which are heavily influenced by socio-economic drivers. On this context, this team has investigated connections among agriculture, policy, climate, land use/land cover, and water quality in Iowa over the past couple of years. To help explore these connections the team is developing a variety of cyber infrastructure tools that facilitate the collection, analysis and visualization of data, and the simulation of system dynamics. In an ongoing effort, the prototype system is applied to Clear Creek watershed, an agricultural dominating catchment in Iowa in the US Midwest, to understand water-human processes relevant to management decisions by farmers regarding agro ecosystems. The primary aim of this research is to understand the connections that exist among the agricultural and biofuel economy, land use/land cover change, and water quality. To help explore these connections an agent-based model (ABM) of land use change has been developed that simulates the decisions made by farmers given alternative assumptions about market forces, farmer characteristics, and water quality regulations. The SWAT model was used to simulate the impact of these decisions on the movement of sediment, nitrogen, and phosphorus across the landscape. The paper also demonstrate how through the use of this system researchers can, for example, search for scenarios that lead to desirable socio-economic outcomes as well as preserve water quantity and quality.
Exploration Medical System Technical Architecture Overview
Cerro, J.; Rubin, D.; Mindock, J.; Middour, C.; McGuire, K.; Hanson, A.; Reilly, J.; Burba, T.; Urbina, M.
2018-01-01
The Exploration Medical Capability (ExMC) Element Systems Engineering (SE) goals include defining the technical system needed to support medical capabilities for a Mars exploration mission. A draft medical system architecture was developed based on stakeholder needs, system goals, and system behaviors, as captured in an ExMC concept of operations document and a system model. This talk will discuss a high-level view of the medical system, as part of a larger crew health and performance system, both of which will support crew during Deep Space Transport missions. Other mission components, such as the flight system, ground system, caregiver, and patient, will be discussed as aspects of the context because the medical system will have important interactions with each. Additionally, important interactions with other aspects of the crew health and performance system are anticipated, such as health & wellness, mission task performance support, and environmental protection. This talk will highlight areas in which we are working with other disciplines to understand these interactions.
Rovers, A.F.; Essen, van H.A.
2006-01-01
A new method for researching haptic interaction styles is presented, based on a layered interaction model and a classification of existing devices. The method is illustrated by designing a new foot interaction device. The aim of which is to enhance non-verbal communication over a computer network. A
Energy Technology Data Exchange (ETDEWEB)
Erba, P.A. [University of Pisa, and University Hospital of Pisa, Regional Center of Nuclear Medicine, Department of Translational Research and Advanced Technology in Medicine, Pisa (Italy); University of Pisa, Regional Center of Nuclear Medicine, Pisa (Italy); Leo, G. [ASL Lecce, U.O. Gestione Rapporti Convenzionali, U.O. Chirurgia Generale, Lecce, Pisa (Italy); University of Pisa, and University Hospital of Pisa, Division of Vascular Surgery, Department of Translational Research and Advanced Technology in Medicine, Pisa (Italy); Sollini, M. [Az. Osp. S.Maria Nuova - IRCCS Reggio Emilia, Nuclear Medicine Unit, Department of Oncology and Advanced Technology, Reggio Emilia (Italy); Tascini, C.; Menichetti, F. [University Hospital of Pisa, Division of Infectious Diseases, Pisa (Italy); Boni, R.; Lazzeri, E.; Mariani, G. [University of Pisa, and University Hospital of Pisa, Regional Center of Nuclear Medicine, Department of Translational Research and Advanced Technology in Medicine, Pisa (Italy); Berchiolli, R.N.; Ferrari, M. [University of Pisa, and University Hospital of Pisa, Division of Vascular Surgery, Department of Translational Research and Advanced Technology in Medicine, Pisa (Italy)
2014-02-15
In this study we evaluated the diagnostic performance of {sup 99m}Tc-HMPAO-leucocyte ({sup 99m}Tc-HMPAO-WBC) scintigraphy in a consecutive series of 55 patients (46 men and 9 women, mean age 71 ± 9 years, range 50 - 88 years) with a suspected late or a low-grade late vascular prosthesis infection (VPI), also comparing the diagnostic accuracy of WBC with that of other radiological imaging methods. All patients suspected of having VPI underwent clinical examination, blood tests, microbiology, US and CT, and were classified according to the Fitzgerald criteria. A final diagnosis of VPI was established in 47 of the 55 patients, with microbiological confirmation after surgical removal of the prosthesis in 36 of the 47. In the 11 patients with major contraindications to surgery, the final diagnosis was based on microbiology and clinical follow-up of at least 18 months. {sup 99m}Tc-HMPAO-WBC planar, SPECT and SPECT/CT imaging identified VPI in 43 of 47 patients (20 of these also showed infection at extra-prosthetic sites). In the remaining eight patients without VPI, different sites of infections were found. The use of SPECT/CT images led to a significant reduction in the number of false-positive findings in 37 % of patients (sensitivity and specificity 100 %, versus 85.1 % and 62.5 % for stand-alone SPECT). Sensitivity and specificity were 34 % and 75 % for US, 48.9 % and 83.3 % for CT, and 68.1 % and 62.5 % for the FitzGerald classification. Perioperative mortality was 5.5 %, mid-term mortality 12 %, and long-term mortality 27 %. Survival rates were similar in patients treated with surgery and antimicrobial therapy compared to patients treated with antimicrobial therapy alone (61 % versus 63 %, respectively), while infection eradication at 12 months was significantly higher following surgery (83.3 % versus 45.5 %). {sup 99m}Tc-HMPAO-WBC SPECT/CT is useful for detecting, localizing and defining the extent of graft infection in patients with late and low-grade late VPI
Erba, P A; Leo, G; Sollini, M; Tascini, C; Boni, R; Berchiolli, R N; Menichetti, F; Ferrari, M; Lazzeri, E; Mariani, G
2014-02-01
In this study we evaluated the diagnostic performance of (99m)Tc-HMPAO-leucocyte ((99m)Tc-HMPAO-WBC) scintigraphy in a consecutive series of 55 patients (46 men and 9 women, mean age 71 ± 9 years, range 50 - 88 years) with a suspected late or a low-grade late vascular prosthesis infection (VPI), also comparing the diagnostic accuracy of WBC with that of other radiological imaging methods. All patients suspected of having VPI underwent clinical examination, blood tests, microbiology, US and CT, and were classified according to the Fitzgerald criteria. A final diagnosis of VPI was established in 47 of the 55 patients, with microbiological confirmation after surgical removal of the prosthesis in 36 of the 47. In the 11 patients with major contraindications to surgery, the final diagnosis was based on microbiology and clinical follow-up of at least 18 months. (99m)Tc-HMPAO-WBC planar, SPECT and SPECT/CT imaging identified VPI in 43 of 47 patients (20 of these also showed infection at extra-prosthetic sites). In the remaining eight patients without VPI, different sites of infections were found. The use of SPECT/CT images led to a significant reduction in the number of false-positive findings in 37% of patients (sensitivity and specificity 100 %, versus 85.1% and 62.5% for stand-alone SPECT). Sensitivity and specificity were 34% and 75% for US, 48.9% and 83.3% for CT, and 68.1% and 62.5% for the FitzGerald classification. Perioperative mortality was 5.5%, mid-term mortality 12%, and long-term mortality 27%. Survival rates were similar in patients treated with surgery and antimicrobial therapy compared to patients treated with antimicrobial therapy alone (61% versus 63%, respectively), while infection eradication at 12 months was significantly higher following surgery (83.3% versus 45.5%). (99m)Tc-HMPAO-WBC SPECT/CT is useful for detecting, localizing and defining the extent of graft infection in patients with late and low-grade late VPI with inconclusive
International Nuclear Information System (INIS)
Erba, P.A.; Leo, G.; Sollini, M.; Tascini, C.; Menichetti, F.; Boni, R.; Lazzeri, E.; Mariani, G.; Berchiolli, R.N.; Ferrari, M.
2014-01-01
In this study we evaluated the diagnostic performance of 99m Tc-HMPAO-leucocyte ( 99m Tc-HMPAO-WBC) scintigraphy in a consecutive series of 55 patients (46 men and 9 women, mean age 71 ± 9 years, range 50 - 88 years) with a suspected late or a low-grade late vascular prosthesis infection (VPI), also comparing the diagnostic accuracy of WBC with that of other radiological imaging methods. All patients suspected of having VPI underwent clinical examination, blood tests, microbiology, US and CT, and were classified according to the Fitzgerald criteria. A final diagnosis of VPI was established in 47 of the 55 patients, with microbiological confirmation after surgical removal of the prosthesis in 36 of the 47. In the 11 patients with major contraindications to surgery, the final diagnosis was based on microbiology and clinical follow-up of at least 18 months. 99m Tc-HMPAO-WBC planar, SPECT and SPECT/CT imaging identified VPI in 43 of 47 patients (20 of these also showed infection at extra-prosthetic sites). In the remaining eight patients without VPI, different sites of infections were found. The use of SPECT/CT images led to a significant reduction in the number of false-positive findings in 37 % of patients (sensitivity and specificity 100 %, versus 85.1 % and 62.5 % for stand-alone SPECT). Sensitivity and specificity were 34 % and 75 % for US, 48.9 % and 83.3 % for CT, and 68.1 % and 62.5 % for the FitzGerald classification. Perioperative mortality was 5.5 %, mid-term mortality 12 %, and long-term mortality 27 %. Survival rates were similar in patients treated with surgery and antimicrobial therapy compared to patients treated with antimicrobial therapy alone (61 % versus 63 %, respectively), while infection eradication at 12 months was significantly higher following surgery (83.3 % versus 45.5 %). 99m Tc-HMPAO-WBC SPECT/CT is useful for detecting, localizing and defining the extent of graft infection in patients with late and low-grade late VPI with inconclusive
Varela, P.; Costa, M. F.
2015-04-01
The exploration process leading to the understanding of physical phenomena, such as light and its interaction with matter, raises great interest and curiosity in children. However, in most primary schools, children rarely have the opportunity to conduct science activities in which they can engage in an enquiry process even if by the action of the teacher. In this context, we have organised several in-service teacher training courses and carried out several pedagogic interventions in Portuguese primary schools, with the aim of promoting inquiry- based science education. This article describes one of those projects, developed with a class of the third grade, which explored the curricular topic “Light Experiments”. Various activities were planned and implemented, during a total of ten hours spread over five lessons. The specific objectives of this paper are: to illustrate and analyse the teaching and learning process promoted in the classroom during the exploration of one of these lessons, and to assess children's learning three weeks after the lessons. The results suggest that children made significant learning which persisted. We conclude discussing some processes that stimulated children’ learning, including the importance of teacher questioning in scaffolding children's learning and some didactic implications for teacher training.
Ragan-Kelley, M.; Perez, F.; Granger, B.; Kluyver, T.; Ivanov, P.; Frederic, J.; Bussonnier, M.
2014-12-01
IPython has provided terminal-based tools for interactive computing in Python since 2001. The notebook document format and multi-process architecture introduced in 2011 have expanded the applicable scope of IPython into teaching, presenting, and sharing computational work, in addition to interactive exploration. The new architecture also allows users to work in any language, with implementations in Python, R, Julia, Haskell, and several other languages. The language agnostic parts of IPython have been renamed to Jupyter, to better capture the notion that a cross-language design can encapsulate commonalities present in computational research regardless of the programming language being used. This architecture offers components like the web-based Notebook interface, that supports rich documents that combine code and computational results with text narratives, mathematics, images, video and any media that a modern browser can display. This interface can be used not only in research, but also for publication and education, as notebooks can be converted to a variety of output formats, including HTML and PDF. Recent developments in the Jupyter project include a multi-user environment for hosting notebooks for a class or research group, a live collaboration notebook via Google Docs, and better support for languages other than Python.
Antiproton-nucleus interaction
International Nuclear Information System (INIS)
Gibbs, W.R.
1984-01-01
Several facets of antinucleon-nucleus interactions are explored. The topics treated are: coherent interactions, production of unusual states and particles in the nuclear medium, and the creation of extreme states of matter by antimatter annihilation. It is found that temperatures of the magnitude necessary to achieve the predicted quark-gluon phase transition are obtained. 20 references
Exploring the interaction between flows and composition in reactive distillation
DEFF Research Database (Denmark)
Estrada-Villagrana, A.D.; Bogle, I. David L.; Cisneros, Eduardo Salvador P.
1999-01-01
In this paper a new equilibrium approach is used to simulate the closed loop behaviour of the MTBE production process to study the interactions between flows and composition. This will facilitate the application of the existing methods for analysis of distillation systems. Results show that the o......In this paper a new equilibrium approach is used to simulate the closed loop behaviour of the MTBE production process to study the interactions between flows and composition. This will facilitate the application of the existing methods for analysis of distillation systems. Results show...
García-Santos, Glenda; Madruga de Brito, Mariana; Höllermann, Britta; Taft, Linda; Almoradie, Adrian; Evers, Mariele
2018-06-01
Understanding the interactions between water resources and its social dimensions is crucial for an effective and sustainable water management. The identification of sensitive control variables and feedback loops of a specific human-hydro-scape can enhance the knowledge about the potential factors and/or agents leading to the current water resources and ecosystems situation, which in turn supports the decision-making process of desirable futures. Our study presents the utility of a system dynamics modeling approach for water management and decision-making for the case of a forest ecosystem under risk of wildfires. We use the pluralistic water research concept to explore different scenarios and simulate the emergent behaviour of water interception and net precipitation after a wildfire in a forest ecosystem. Through a case study, we illustrate the applicability of this new methodology.
Zhou, Zhigang; Li, Yumin
2009-10-01
As a tumor suppressor, p53 plays an important role in cancer suppression. The biological function of p53 as a tumor suppressor is disabled when it binds to S100B. Developing the ligands to block the S100B-p53 interaction has been proposed as one of the most important approaches to the development of anti-cancer agents. We screened a small compound library against the binding interface of S100B and p53 to identify potential compounds to interfere with the interaction. The ligand-binding effect on the S100B-p53 interaction was explored by molecular dynamics at the atomic level. The results show that the ligand bound between S100B and p53 propels the two proteins apart by about 2 Å compared to the unligated S100B-p53 complex. The binding affinity of S100B and p53 decreases by 8.5-14.6 kcal/mol after a ligand binds to the interface from the original unligated state of the S100B-p53 complex. Ligand-binding interferes with the interaction of S100B and p53. Such interference could impact the association of S100B and p53, which would free more p53 protein from the pairing with S100B and restore the biological function of p53 as a tumor suppressor. The analysis of the binding mode and ligand structural features would facilitate our effort to identify and design ligands to block S100B-p53 interaction effectively. The results from the work suggest that developing ligands targeting the interface of S100B and p53 could be a promising approach to recover the normal function of p53 as a tumor suppressor.
Photoboarding : Exploring service interactions with acting-out and storyboarding
Van der Lugt, R.; Postma, C.E.; Stappers, P.J.
2012-01-01
In conceptualising services, the design team has to consider a complex set of related factors, including user experience, situation, infrastructure and person-to-person interactions. For this they need a shared language that crosses disciplinary boundaries and and avoids jargon. In the film
DEFF Research Database (Denmark)
Tanev, Stoyan
2014-01-01
Actor-network theory (ANT) has established itself as a valuable resource for the analysis of technology innovation and adoption. One of the main reasons for the success of the Innovation Translation Model (a specific instantiation of ANT) is the fact that it fits very well the emerging dominance...... challenges. This is why in this special issue we have focused on exploring, in parallel to ANT, other approaches that have also proven valuable in studying technology adoption and human-technology interaction. Some of these approaches share significant common ground with ANT. They also diverge in some......, Design in-use, Practice theory, Innovation diffusion, Consumer innovativeness and Activity theory....
Blended Interaction Spaces for Collaborative Design
DEFF Research Database (Denmark)
Dalsgaard, Peter; Halskov, Kim; Klokmose, Clemens Nylandsted
During the past five years, we have explored the use, potentials and challenges of Blended Interaction spaces. In addition, we have a long background in developing and exploring methods for collaborative design. In this workshop paper, we give an overview of our work and present our visions...... and ongoing research in developing Blended Interaction spaces for collaborative design. We then identify key themes and challenges pertinent for the workshop....
Directory of Open Access Journals (Sweden)
Michael Poulsen
Full Text Available Mutualistic associations are shaped by the interplay of cooperation and conflict among the partners involved, and it is becoming increasingly clear that within many mutualisms multiple partners simultaneously engage in beneficial interactions. Consequently, a more complete understanding of the dynamics within multipartite mutualism communities is essential for understanding the origin, specificity, and stability of mutualisms. Fungus-growing ants cultivate fungi for food and maintain antibiotic-producing Pseudonocardia actinobacteria on their cuticle that help defend the cultivar fungus from specialized parasites. Within both ant-fungus and ant-bacterium mutualisms, mixing of genetically distinct strains can lead to antagonistic interactions (i.e., competitive conflict, which may prevent the ants from rearing multiple strains of either of the mutualistic symbionts within individual colonies. The success of different ant-cultivar-bacterium combinations could ultimately be governed by antagonistic interactions between the two mutualists, either as inhibition of the cultivar by Pseudonocardia or vice versa. Here we explore cultivar-Pseudonocardia antagonism by evaluating in vitro interactions between strains of the two mutualists, and find frequent antagonistic interactions both from cultivars towards Pseudonocardia and vice versa. To test whether such in vitro antagonistic interactions affect ant colonies in vivo, we performed sub-colony experiments using species of Acromyrmex leaf-cutting ants. We created novel ant-fungus-bacterium pairings in which there was antagonism from one, both, or neither of the ants' microbial mutualists, and evaluated the effect of directional antagonism on cultivar biomass and Pseudonocardia abundance on the cuticle of workers within sub-colonies. Despite the presence of frequent in vitro growth suppression between cultivars and Pseudonocardia, antagonism from Pseudonocardia towards the cultivar did not reduce sub
iCanPlot: visual exploration of high-throughput omics data using interactive Canvas plotting.
Directory of Open Access Journals (Sweden)
Amit U Sinha
Full Text Available Increasing use of high throughput genomic scale assays requires effective visualization and analysis techniques to facilitate data interpretation. Moreover, existing tools often require programming skills, which discourages bench scientists from examining their own data. We have created iCanPlot, a compelling platform for visual data exploration based on the latest technologies. Using the recently adopted HTML5 Canvas element, we have developed a highly interactive tool to visualize tabular data and identify interesting patterns in an intuitive fashion without the need of any specialized computing skills. A module for geneset overlap analysis has been implemented on the Google App Engine platform: when the user selects a region of interest in the plot, the genes in the region are analyzed on the fly. The visualization and analysis are amalgamated for a seamless experience. Further, users can easily upload their data for analysis--which also makes it simple to share the analysis with collaborators. We illustrate the power of iCanPlot by showing an example of how it can be used to interpret histone modifications in the context of gene expression.
StreamExplorer: A Multi-Stage System for Visually Exploring Events in Social Streams.
Wu, Yingcai; Chen, Zhutian; Sun, Guodao; Xie, Xiao; Cao, Nan; Liu, Shixia; Cui, Weiwei
2017-10-18
Analyzing social streams is important for many applications, such as crisis management. However, the considerable diversity, increasing volume, and high dynamics of social streams of large events continue to be significant challenges that must be overcome to ensure effective exploration. We propose a novel framework by which to handle complex social streams on a budget PC. This framework features two components: 1) an online method to detect important time periods (i.e., subevents), and 2) a tailored GPU-assisted Self-Organizing Map (SOM) method, which clusters the tweets of subevents stably and efficiently. Based on the framework, we present StreamExplorer to facilitate the visual analysis, tracking, and comparison of a social stream at three levels. At a macroscopic level, StreamExplorer uses a new glyph-based timeline visualization, which presents a quick multi-faceted overview of the ebb and flow of a social stream. At a mesoscopic level, a map visualization is employed to visually summarize the social stream from either a topical or geographical aspect. At a microscopic level, users can employ interactive lenses to visually examine and explore the social stream from different perspectives. Two case studies and a task-based evaluation are used to demonstrate the effectiveness and usefulness of StreamExplorer.Analyzing social streams is important for many applications, such as crisis management. However, the considerable diversity, increasing volume, and high dynamics of social streams of large events continue to be significant challenges that must be overcome to ensure effective exploration. We propose a novel framework by which to handle complex social streams on a budget PC. This framework features two components: 1) an online method to detect important time periods (i.e., subevents), and 2) a tailored GPU-assisted Self-Organizing Map (SOM) method, which clusters the tweets of subevents stably and efficiently. Based on the framework, we present StreamExplorer
Bridge, Donna J; Cohen, Neal J; Voss, Joel L
2017-08-01
Memory can profoundly influence new learning, presumably because memory optimizes exploration of to-be-learned material. Although hippocampus and frontoparietal networks have been implicated in memory-guided exploration, their specific and interactive roles have not been identified. We examined eye movements during fMRI scanning to identify neural correlates of the influences of memory retrieval on exploration and learning. After retrieval of one object in a multiobject array, viewing was strategically directed away from the retrieved object toward nonretrieved objects, such that exploration was directed toward to-be-learned content. Retrieved objects later served as optimal reminder cues, indicating that exploration caused memory to become structured around the retrieved content. Hippocampal activity was associated with memory retrieval, whereas frontoparietal activity varied with strategic viewing patterns deployed after retrieval, thus providing spatiotemporal dissociation of memory retrieval from memory-guided learning strategies. Time-lagged fMRI connectivity analyses indicated that hippocampal activity predicted frontoparietal activity to a greater extent for a condition in which retrieval guided exploration occurred than for a passive control condition in which exploration was not influenced by retrieval. This demonstrates network-level interaction effects specific to influences of memory on strategic exploration. These findings show how memory guides behavior during learning and demonstrate distinct yet interactive hippocampal-frontoparietal roles in implementing strategic exploration behaviors that determine the fate of evolving memory representations.
Bridge, Donna J.; Cohen, Neal J.; Voss, Joel L.
2017-01-01
Memory can profoundly influence new learning, presumably because memory optimizes exploration of to-be-learned material. Although hippocampus and frontoparietal networks have been implicated in memory-guided exploration, their specific and interactive roles have not been identified. We examined eye movements during fMRI scanning to identify neural correlates of the influences of memory retrieval on exploration and learning. Following retrieval of one object in a multi-object array, viewing was strategically directed away from the retrieved object toward non-retrieved objects, such that exploration was directed towards to-be-learned content. Retrieved objects later served as optimal reminder cues, indicating that exploration caused memory to become structured around the retrieved content. Hippocampal activity was associated with memory retrieval whereas frontoparietal activity varied with strategic viewing patterns deployed following retrieval, thus providing spatiotemporal dissociation of memory retrieval from memory-guided learning strategies. Time-lagged fMRI connectivity analyses indicated that hippocampal activity predicted frontoparietal activity to a greater extent for a condition in which retrieval guided exploration than for a passive control condition in which exploration was not influenced by retrieval. This demonstrates network-level interaction effects specific to influences of memory on strategic exploration. These findings show how memory guides behavior during learning and demonstrate distinct yet interactive hippocampal-frontoparietal roles in implementing strategic exploration behaviors that determine the fate of evolving memory representations. PMID:28471729
Visual Workflows for Oil and Gas Exploration
Hollt, Thomas
2013-01-01
For planning the operations of off-shore structures we present a novel integrated visualization system that enables interactive visual analysis of ensemble simulations used in ocean forecasting, i.e, simulations of sea surface elevation. Changes in sea surface elevation are a good indicator for the movement of loop current eddies. Our visualization approach enables their interactive exploration and analysis. We enable analysis of the spatial domain, for planning the placement of structures, as well as detailed exploration of the temporal evolution at any chosen position, for the prediction of critical ocean states that require the shutdown of rig operations. We illustrate this using a real-world simulation of the Gulf of Mexico.
Yang, Darren
2016-01-01
Molecular interactions between cellular components such as proteins and nucleic acids govern the fundamental processes of living systems. Technological advancements in the past decade have allowed the characterization of these molecular interactions at the single-molecule level with high temporal and spatial resolution. Simultaneously, progress in computer simulation has enabled theoretical research at the atomistic level, assisting in the interpretation of experimental results. This thesi...
Geospace exploration project: Arase (ERG)
Miyoshi, Y.; Kasaba, Y.; Shinohara, I.; Takashima, T.; Asamura, K.; Matsumoto, H.; Higashio, N.; Mitani, T.; Kasahara, S.; Yokota, S.; Wang, S.; Kazama, Y.; Kasahara, Y.; Yagitani, S.; Matsuoka, A.; Kojima, H.; Katoh, Y.; Shiokawa, K.; Seki, K.; Fujimoto, M.; Ono, T.; ERG project Group
2017-06-01
The ERG (Exploration of energization and Radiation in Geospace) is Japanese geospace exploration project. The project focuses on relativistic electron acceleration mechanism of the outer belt and dynamics of space storms in the context of the cross-energy coupling via wave-particle interactions. The project consists of the satellite observation team, the ground-based network observation team, and integrated-data analysis/simulation team. The satellite was launched on December 20 2016 and has been nicknamed, “Arase”. This paper describes overview of the project and future plan for observations.
Interacting steps with finite-range interactions: Analytical approximation and numerical results
Jaramillo, Diego Felipe; Téllez, Gabriel; González, Diego Luis; Einstein, T. L.
2013-05-01
We calculate an analytical expression for the terrace-width distribution P(s) for an interacting step system with nearest- and next-nearest-neighbor interactions. Our model is derived by mapping the step system onto a statistically equivalent one-dimensional system of classical particles. The validity of the model is tested with several numerical simulations and experimental results. We explore the effect of the range of interactions q on the functional form of the terrace-width distribution and pair correlation functions. For physically plausible interactions, we find modest changes when next-nearest neighbor interactions are included and generally negligible changes when more distant interactions are allowed. We discuss methods for extracting from simulated experimental data the characteristic scale-setting terms in assumed potential forms.
Exploring the Interactions on an Online Narrative Writing Platform
Annamalai, Nagaletchimee; Eng, Tan Kok; Abdullah, Amelia; Sivagurunathan, Sorojini
2015-01-01
Purpose: This paper reports a study that investigated the interactions of six students learning to write narrative essays on an online narrative writing platform (ONWP). Participants were six students and a teacher from an urban Chinese Secondary School in the northern region of Malaysia. Methodology: The qualitative data used in this study were…
Miller, M. K.; Rossiter, A.; Spitzer, W.
2016-12-01
The Exploratorium, a hands-on science museum, explores local environmental conditions of San Francisco Bay to connect audiences to the larger global implications of ocean acidification and climate change. The work is centered in the Fisher Bay Observatory at Pier 15, a glass-walled gallery sited for explorations of urban San Francisco and the Bay. Interactive exhibits, high-resolution data visualizations, and mediated activities and conversations communicate to public audiences the impacts of excess carbon dioxide in the atmosphere and ocean. Through a 10-year education partnership with NOAA and two environmental literacy grants funded by its Office of Education, the Exploratorium has been part of two distinct but complementary strategies to increase climate literacy beyond traditional classroom settings. We will discuss two projects that address the ways complex scientific information can be transformed into learning opportunities for the public, providing information citizens can use for decision-making in their personal lives and their communities. The Visualizing Change project developed "visual narratives" that combine scientific visualizations and other images with story telling about the science and potential solutions of climate impacts on the ocean. The narratives were designed to engage curiosity and provide the public with hopeful and useful information to stimulate solutions-oriented behavior rather than to communicate despair about climate change. Training workshops for aquarium and museum docents prepare informal educators to use the narratives and help them frame productive conversations with the pubic. The Carbon Networks project, led by the Exploratorium, uses local and Pacific Rim data to explore the current state of climate change and ocean acidification. The Exploratorium collects and displays local ocean and atmosphere data as a member of the Central and Northern California Ocean Observing System and as an observing station for NOAA's Pacific
Earth Trek...Explore Your Environment.
Environmental Protection Agency, Washington, DC. Office of Public Affairs.
This booklet for children emphasizes the exploration and protection of the environment. An introduction discusses the interaction between humankind and the environment, emphasizing that the earth is a closed system. Chapter 1, "Mission: Protect the Water," addresses human dependence on water, water pollution, and water treatment. Chapter…
Ethics in the business of petroleum exploration
International Nuclear Information System (INIS)
Spoelhof, P.R.
1992-01-01
This paper is intended to emphasize the importance of high standards of conduct to individuals and companies in the business of petroleum exploration. The questions to be addressed include: What are ethics and how do they relate to professionalism? What are the bases for ethical behavior?; and What are some typical ethical issues in the exploration business? Ethics comprise a set of standards that control and measure relationships between individuals and companies in social and business interactions. These standards apply to questions of whether folks have done the moral right by the other person, whatever the nature of their interaction might be. The means of granting rights to others are included in the mores of society. These are the unwritten, yet valid, rules that dictate, for example, how bargaining is conducted between buyer and seller or how properly to greet people of different social stature. Mores constitute the protocol and etiquette of personal and business interaction
Fundis, A.; Cook, M.; Sutton, K.; Garson, S.; Poulton, S.; Munro, S.
2016-02-01
By sparking interest in scientific inquiry and engineering design at a young age through exposure to ocean exploration and innovative technologies, and building on that interest throughout students' educational careers, the Ocean Exploration Trust (OET) aims to motivate more students to be lifelong learners and pursue careers in STEM fields. Utilizing research conducted aboard Exploration Vessel Nautilus, the ship's associated technologies, and shore-based facilities at the University of Rhode Island — including the Graduate School of Oceanography and the Inner Space Center — we guide students to early career professionals through a series of educational programs focused on STEM disciplines and vocational skills. OET also raises public awareness of ocean exploration and research through a growing online presence, live streaming video, and interactions with the team aboard the ship 24 hours a day via the Nautilus Live website (www.nautiluslive.org). Annually, our outreach efforts bring research launched from Nautilus to tens of millions worldwide and allow the public, students, and scientists to participate in expeditions virtually from shore. We share the Nautilus Exploration Program's strategies, successes, and lessons learned for a variety of our education and outreach efforts including: 1) enabling global audiences access to live ocean exploration online and via social media; 2) engaging onshore audiences in live and interactive conversations with scientists and engineers on board; 3) engaging young K-12 learners in current oceanographic research via newly developed lessons and curricula; 4) onshore and offshore professional development opportunities for formal and informal educators; 5) programs and authentic research opportunities for high school, undergraduate, and graduate students onshore and aboard Nautilus; and 6) collaborative opportunities for early career and seasoned researchers to participate virtually in telepresence-enabled, interdisciplinary
DEFF Research Database (Denmark)
Hansen, Thomas Riisgaard
2007-01-01
Web pages are designed to be displayed on a single screen, but as more and more screens are being introduced in our surroundings a burning question becomes how to design, interact, and display web pages on multiple devices and displays. In this paper I present the SpaceExplorer prototype, which...... is able to display standard HTML web pages on multiple displays with only a minor modification to the language. Based on the prototype a number of different examples are presented and discussed and some preliminary findings are presented....
Proxemic Mobile Collocated Interactions
DEFF Research Database (Denmark)
Porcheron, Martin; Lucero, Andrés; Quigley, Aaron
2016-01-01
and their digital devices (i.e. the proxemic relationships). Building on the ideas of proxemic interactions, this workshop is motivated by the concept of ‘proxemic mobile collocated interactions’, to harness new or existing technologies to create engaging and interactionally relevant experiences. Such approaches......Recent research on mobile collocated interactions has been looking at situations in which collocated users engage in collaborative activities using their mobile devices. However, existing practices fail to fully account for the culturally-dependent spatial relationships between people...... in exploring proxemics and mobile collocated interactions....
Two interacting Hofstadter butterflies
International Nuclear Information System (INIS)
Barelli, A.; Bellissard, J.; Jacquod, P.
1997-01-01
The problem of two interacting particles in a quasiperiodic potential is addressed. Using analytical and numerical methods, we explore the spectral properties and eigenstates structure from the weak to the strong interaction case. More precisely, a semiclassical approach based on noncommutative geometry techniques is used to understand the intricate structure of such a spectrum. An interaction induced localization effect is furthermore emphasized. We discuss the application of our results on a two-dimensional model of two particles in a uniform magnetic field with on-site interaction. copyright 1997 The American Physical Society
Narrative Cognition in Interactive Systems
DEFF Research Database (Denmark)
Bruni, Luis Emilio; Baceviciute, Sarune; Arief, Mohammed
2014-01-01
In this article we explore some of the methodological problems related to characterizing cognitive aspects of involvement with interactive narratives using well known EEG/ERP techniques. To exemplify this, we construct an experimental EEG-ERP set-up with an interactive narrative that considers th...
Multi-surface Interaction in the WILD Room
DEFF Research Database (Denmark)
Beaudouin-Lafon, Michel; Chapuis, Olivier; Eagan, James R.
2012-01-01
The WILD (wall-sized interaction with large datasets) room serves as a testbed for exploring the next generation of interactive systems by distributing interaction across diverse computing devices, enabling multiple users to easily and seamlessly create, share, and manipulate digital content...
Exploring the use of glossy light volumes for interactive global illumination
CSIR Research Space (South Africa)
Duvenhage, B
2010-06-01
Full Text Available . raytracing. Arvo used backward raytracing to render caustics which could not efficiently be simulated using the high fidelity forward raytracing and radiosity rendering techniques of the time. Similar to what Heckbert and Hanrahan proposed and did, Watt... graphics and interactive tech- niques, ACM, New York, NY, USA, 119–127. HECKBERT, P. 1990. Adaptive radiosity textures for bidirectional ray tracing. In SIGGRAPH ’90: Proceedings of the 17th annual conference on Computer graphics and interactive...
Martinez, Katherine; McDonald, Courtney
2017-11-01
Familial violence poses a serious public health concern and has therefore received a considerable amount of attention from academics and practitioners alike. Research within this field has found that parent-to-parent and parent-to-child violence often occur simultaneously and are especially prevalent within households that suffer from social and environmental stressors. Sibling violence and its relationship to these other forms of familial violence has received considerably less attention, largely related to the widely held belief that sibling violence is natural, especially for boys. Using the Scale of Negative Family Interactions (SNFI), parent-to-child and sibling-to-sibling violence is investigated. Specifically, the relationship between participants' gender and sexual identities and their reports of familial violence are explored to better understand participants' gendered and sexed experiences. Data suggest that gender and sexual minorities may have a unique experience of familial violence, although further research is needed in this area.
Exploring Interactions in L2 Blogging: Metadiscourse in Philippine Investigative Journalism Blogs
Directory of Open Access Journals (Sweden)
Veronico Nogales Tarrayo
2014-09-01
Full Text Available Although metadiscourse has been examined in different genres, such as academic papers, newspaper editorials, school textbooks, and the like, still relatively little attention has been given to the discourse of cyber-genres, particularly blogs or weblogs. Using Hyland’s (2005 model, this paper examined the interactive and the interactional metadiscourse in Philippine investigative journalism blogs where English is used as a second language or L2. The corpus analyzed was taken from 20 investigative journalism blogs published in http://pcij.org/blog/, the official website of the Philippine Center for Investigative Journalism (PCIJ blogs. Based on the findings of the study, it can be inferred that there is much evidence in the use of metadiscourse in Philippine investigative journalism blogs; thus, the use of metadiscourse as an appropriate linguistic resource is supplemental and essential. The data revealed that the investigative journalism blogs have a higher frequency of use of interactive resources, allowing writers to organize and structure their propositions so that the text becomes more coherent to the readers. Among the five categories of interactive resources, the use of evidentials has the highest frequency. As regards the use of interactional resources, hedges are the most frequent. The findings of the study likewise provide pedagogical implications for ESL writing.
Interactive Exploration of Big Scientific Data: New Representations and Techniques.
Hjelmervik, Jon M; Barrowclough, Oliver J D
2016-01-01
Although splines have been in popular use in CAD for more than half a century, spline research is still an active field, driven by the challenges we are facing today within isogeometric analysis and big data. Splines are likely to play a vital future role in enabling effective big data exploration techniques in 3D, 4D, and beyond.
Virtual reality and planetary exploration
McGreevy, Michael W.
Exploring planetary environments is central to NASA's missions and goals. A new computing technology called Virtual Reality has much to offer in support of planetary exploration. This technology augments and extends human presence within computer-generated and remote spatial environments. Historically, NASA has been a leader in many of the fundamental concepts and technologies that comprise Virtual Reality. Indeed, Ames Research Center has a central role in the development of this rapidly emerging approach to using computers. This ground breaking work has inspired researchers in academia, industry, and the military. Further, NASA's leadership in this technology has spun off new businesses, has caught the attention of the international business community, and has generated several years of positive international media coverage. In the future, Virtual Reality technology will enable greatly improved human-machine interactions for more productive planetary surface exploration. Perhaps more importantly, Virtual Reality technology will democratize the experience of planetary exploration and thereby broaden understanding of, and support for, this historic enterprise.
Virtual reality and planetary exploration
Mcgreevy, Michael W.
1992-01-01
Exploring planetary environments is central to NASA's missions and goals. A new computing technology called Virtual Reality has much to offer in support of planetary exploration. This technology augments and extends human presence within computer-generated and remote spatial environments. Historically, NASA has been a leader in many of the fundamental concepts and technologies that comprise Virtual Reality. Indeed, Ames Research Center has a central role in the development of this rapidly emerging approach to using computers. This ground breaking work has inspired researchers in academia, industry, and the military. Further, NASA's leadership in this technology has spun off new businesses, has caught the attention of the international business community, and has generated several years of positive international media coverage. In the future, Virtual Reality technology will enable greatly improved human-machine interactions for more productive planetary surface exploration. Perhaps more importantly, Virtual Reality technology will democratize the experience of planetary exploration and thereby broaden understanding of, and support for, this historic enterprise.
Artistic explorations of the brain
Fetz, Eberhard E.
2012-01-01
The symbiotic relationships between art and the brain begin with the obvious fact that brain mechanisms underlie the creation and appreciation of art. Conversely, many spectacular images of neural structures have remarkable aesthetic appeal. But beyond its fascinating forms, the many functions performed by brain mechanisms provide a profound subject for aesthetic exploration. Complex interactions in the tangled neural networks in our brain miraculously generate coherent behavior and cognition. Neuroscientists tackle these phenomena with specialized methodologies that limit the scope of exposition and are comprehensible to an initiated minority. Artists can perform an end run around these limitations by representing the brain's remarkable functions in a manner that can communicate to a wide and receptive audience. This paper explores the ways that brain mechanisms can provide a largely untapped subject for artistic exploration. PMID:22347178
Exploring the Quality of Teacher-Child Interactions: The Soka Discourse in Practice
Ikegami, Kiiko; Rivalland, Corine
2016-01-01
Numerous research has shown that quality of interactions between early childhood teachers and children contribute significantly to children's holistic development. Most literature on this topic comes from developed/Western countries and little is known about the kind of interactions occurring within the Soka kindergarten model. This article, based…
Steindl, Christina; Jonas, Eva
2015-01-01
In social interactions, individuals may sometimes pursue their own interests at the expense of their interaction partner. Such self-interested behaviors impose a threat to the interaction partner's freedom to act. The current article investigates this threat in the context of interdependence and reactance theory. We explore how vested interests influence reactance process stages of an advisor-client interaction. We aim to explore the interactional process that evolves. In two studies, participants took the perspective of a doctor (advisor) or a patient (client). In both studies we incorporated a vested interest. In Study 1 (N = 82) we found that in response to a vested interest of their interaction partner, patients indicated a stronger experience of reactance, more aggressive behavioral intentions, and more biased cognitions than doctors. A serial multiple mediation revealed that a vested interest engendered mistrust toward the interaction partner and this mistrust led to an emerging reactance process. Study 2 (N = 207) further demonstrated that doctors expressed their reactance in a subtle way: they revealed a classic confirmation bias when searching for additional information on their preliminary decision preference, indicating stronger defense motivation. We discuss how these findings can help us to understand how social interactions develop dynamically.
Zipke, Marcy
2017-01-01
Two experiments explored the effects of reading digital storybooks on tablet computers with 25 preschoolers, aged 4-5. In the first experiment, the students' word recognition scores were found to increase significantly more when students explored a digital storybook and employed the read-aloud function than when they were read to from a comparable…
PREPARATION AND PROPERTY OF POLYMERIC PENDANT Ru(bpy)32+ COMPLEXES
Institute of Scientific and Technical Information of China (English)
HOU Xiaohuai; Masao Kaneko; Akira Yamada
1984-01-01
Polymeric pendant Ru(bpy)32+ complexes were prepared from homopolymer and copolymers of 4-methyl-4'-vinyl-2,2'-bipyridine (Vbpy). Vbpy was prepared from 4-methylpyridine. The comonomers were styrene (St), acrylic acid (AA), N-vinylpyrrolidone (Pyr), 4-vinylpyridine (Vpy), methyl methacrylate (MMA), 2-hydroxyethyl methacrylate (HEMA), acrylonitrile (AN) and N-ethyl-4-vinylpyridium bromide (EQ-Vpy). The fraction of the pendant Ru(bpy)32+ repeating unit in the polymeric complex was 0.022 to 0.052. Absorption maximum, molar extinction coefficient, emission maximum and relative emission intensity of the polymeric complexes were studied.
The development of a virtual camera system for astronaut-rover planetary exploration.
Platt, Donald W; Boy, Guy A
2012-01-01
A virtual assistant is being developed for use by astronauts as they use rovers to explore the surface of other planets. This interactive database, called the Virtual Camera (VC), is an interactive database that allows the user to have better situational awareness for exploration. It can be used for training, data analysis and augmentation of actual surface exploration. This paper describes the development efforts and Human-Computer Interaction considerations for implementing a first-generation VC on a tablet mobile computer device. Scenarios for use will be presented. Evaluation and success criteria such as efficiency in terms of processing time and precision situational awareness, learnability, usability, and robustness will also be presented. Initial testing and the impact of HCI design considerations of manipulation and improvement in situational awareness using a prototype VC will be discussed.
Spaces of interaction, places for experience
Benyon, David
2014-01-01
Spaces of Interaction, Places for Experience is a book about Human-Computer Interaction (HCI), interaction design (ID) and user experience (UX) in the age of ubiquitous computing. The book explores interaction and experience through the different spaces that contribute to interaction until it arrives at an understanding of the rich and complex places for experience that will be the focus of the next period for interaction design. The book begins by looking at the multilayered nature of interaction and UX-not just with new technologies, but with technologies that are embedded in the world. Peop
Robinson, Thomas E.
2012-01-01
Interracial interactions between college students are responsible for important learning outcomes, however many colleges and universities have failed to purposefully encourage students to interact across racial backgrounds. As a result of a lack purposefully facilitated cross-racial interactions (CRIs), fewer interracial interactions occur on U.S.…
Exploring genetic suppression interactions on a global scale.
van Leeuwen, Jolanda; Pons, Carles; Mellor, Joseph C; Yamaguchi, Takafumi N; Friesen, Helena; Koschwanez, John; Ušaj, Mojca Mattiazzi; Pechlaner, Maria; Takar, Mehmet; Ušaj, Matej; VanderSluis, Benjamin; Andrusiak, Kerry; Bansal, Pritpal; Baryshnikova, Anastasia; Boone, Claire E; Cao, Jessica; Cote, Atina; Gebbia, Marinella; Horecka, Gene; Horecka, Ira; Kuzmin, Elena; Legro, Nicole; Liang, Wendy; van Lieshout, Natascha; McNee, Margaret; San Luis, Bryan-Joseph; Shaeri, Fatemeh; Shuteriqi, Ermira; Sun, Song; Yang, Lu; Youn, Ji-Young; Yuen, Michael; Costanzo, Michael; Gingras, Anne-Claude; Aloy, Patrick; Oostenbrink, Chris; Murray, Andrew; Graham, Todd R; Myers, Chad L; Andrews, Brenda J; Roth, Frederick P; Boone, Charles
2016-11-04
Genetic suppression occurs when the phenotypic defects caused by a mutation in a particular gene are rescued by a mutation in a second gene. To explore the principles of genetic suppression, we examined both literature-curated and unbiased experimental data, involving systematic genetic mapping and whole-genome sequencing, to generate a large-scale suppression network among yeast genes. Most suppression pairs identified novel relationships among functionally related genes, providing new insights into the functional wiring diagram of the cell. In addition to suppressor mutations, we identified frequent secondary mutations,in a subset of genes, that likely cause a delay in the onset of stationary phase, which appears to promote their enrichment within a propagating population. These findings allow us to formulate and quantify general mechanisms of genetic suppression. Copyright © 2016, American Association for the Advancement of Science.
Griffin, Kimberly A.; Eury, Jennifer L.; Gaffney, Meghan E.
2015-01-01
While many cite the importance of having a mentor, focusing on the quality and nature of specific interactions between students and faculty can lead to better strategies promoting student agency. This chapter presents narratives from students who work with the same mentor, focusing on their interactions and how they shaped students' experiences…
DEFF Research Database (Denmark)
Jensen, Mads Møller; Rasmussen, Majken; Grønbæk, Kaj
2013-01-01
of how the opponent format and relationships impact a game are almost absent in current research. Thus, this paper aims to elucidate how the perception of a competition differs, depending on the opponent format, by presenting a game mechanic framework. The paper furthermore presents an interactive...... football-training platform, as well as games designed to explore the different opponent formats. The games are qualitatively evaluated to illuminate the qualities of and distinctions between different types of opponent formats, proposed by the framework terminology....
DEFF Research Database (Denmark)
Felekoglu, Burcu; Maier, Anja; Moultrie, James
2013-01-01
Effective interaction across organisational boundaries is a critical success factor in new product development (NPD). However, few studies have investigated how different mechanisms enable effective interaction across organisational and particularly hierarchical boundaries. This study explores how...
Artistic explorations of the brain
Directory of Open Access Journals (Sweden)
Eberhard E Fetz
2012-02-01
Full Text Available The symbiotic relationships between art and the brain begin with the obvious fact that brain mechanisms underlie the creation and appreciation of art. Conversely, many spectacular images of neural structures have remarkable aesthetic appeal. But beyond its fascinating forms, the many functions performed by brain mechanisms provide a profound subject for aesthetic exploration. Complex interactions in the tangled neural networks in our brain miraculously generate coherent behavior and cognition. Neuroscientists tackle these phenomena with specialized methodologies that limit the scope of exposition and are comprehensible to an initiated minority. Artists can perform an end run around this impasse by representing the brain’s many functions in a manner that can communicate to a wide and receptive audience. This paper explores the ways that brain mechanisms can provide a largely untapped subject for artistic exploration.
Exploring Nonconvex, Crossed and Degenerate Polygons
Contreras, Jose N.
2004-01-01
An exploration of nonconvex, crossed, and degenerate polygons (NCCDPs) are described with the help of examples with pedagogical tips and recommendations that are found useful when teaching the mathematical process of extending geometric patterns to NCCDPs. The study concludes that investigating such extensions with interactive geometry software…
Perceptions of a Soft Robotic Tentacle in Interaction
DEFF Research Database (Denmark)
Jørgensen, Jonas
2018-01-01
Soft robotics technology has been proposed for a number of applications that involve human-robot interaction. This video documents a platform created to explore human perceptions of soft robots in interaction. The video presents select footage from an interaction experiment conducted...
Interaction Design for Public Spaces
DEFF Research Database (Denmark)
Kortbek, Karen Johanne
2008-01-01
In this abstract I describe the doctorial research project "Interaction Design for Public Spaces". The objective of the project is to explore and design interaction contexts in culture related public spaces such as museums, experience centres and festivals. As a perspective on this domain, I...... will focus on the usage of the body as an interaction device. Furthermore, the project will involve a dramaturgic take on communication and design of interactive systems in the pursuit of new ways to stage the interactive contexts. The outcome of the project will be guidelines and conceptual frameworks which...... will help interaction designers when designing for bodily movement, and communicating and staging interactive content in public spaces....
Lost Cause: an interactive movie project
Johnson, Kirsten
2008-01-01
One of the challenges in designing an interactive cinematic experience is to offer interactive choices which do not distract from immersion into the story. The interactive movie project, Lost Cause focuses on the life of the main character explored through the inter-related perspectives of three other characters. Lost Cause supports an immersive interactive story experience through its correlated design of an interface, narrative content and narrative structure. The movie project is examined ...
Intergenerational Analysis of Social Interaction
Brown, Sarah; McHardy, Jolian; Taylor, Karl
2011-01-01
We explore the relationship between the social interaction of parents and their offspring from a theoretical and an empirical perspective. Our theoretical framework establishes possible explanations for the intergenerational transfer of social interaction whereby the social interaction of the parent may influence that of their offspring and vice versa. The empirical evidence, based on four data sets covering Great Britain and the U.S., is supportive of our theoretical priors. We find robust e...
Conversation Analysis and Classroom Interaction
Institute of Scientific and Technical Information of China (English)
DING A-ning; LI Fan; CUI Jing
2015-01-01
Conversation Analysis shows the evidence of the social nature of people’s action including talk-in-interaction from a micro-level perspective. The method for basing its analysis on the authentic data rather than the retrospective interviews for gain⁃ing the participants’perception makes it unique in discovering the emic perspective of the social interaction. CA, often called as a“micro”methodology, provides theoretical insights and useful analytical tool for exploring the interaction in classrooms.
Mobile Collocated Interactions
DEFF Research Database (Denmark)
Lucero, Andrés; Clawson, James; Lyons, Kent
2015-01-01
Mobile devices such as smartphones and tablets were originally conceived and have traditionally been utilized for individual use. Research on mobile collocated interactions has been looking at situations in which collocated users engage in collaborative activities using their mobile devices, thus...... going from personal/individual toward shared/multiuser experiences and interactions. However, computers are getting smaller, more powerful, and closer to our bodies. Therefore, mobile collocated interactions research, which originally looked at smartphones and tablets, will inevitably include ever......-smaller computers, ones that can be worn on our wrists or other parts of the body. The focus of this workshop is to bring together a community of researchers, designers and practitioners to explore the potential of extending mobile collocated interactions to the use of wearable devices....
Causal learning is collaborative: Examining explanation and exploration in social contexts.
Legare, Cristine H; Sobel, David M; Callanan, Maureen
2017-10-01
Causal learning in childhood is a dynamic and collaborative process of explanation and exploration within complex physical and social environments. Understanding how children learn causal knowledge requires examining how they update beliefs about the world given novel information and studying the processes by which children learn in collaboration with caregivers, educators, and peers. The objective of this article is to review evidence for how children learn causal knowledge by explaining and exploring in collaboration with others. We review three examples of causal learning in social contexts, which elucidate how interaction with others influences causal learning. First, we consider children's explanation-seeking behaviors in the form of "why" questions. Second, we examine parents' elaboration of meaning about causal relations. Finally, we consider parents' interactive styles with children during free play, which constrains how children explore. We propose that the best way to understand children's causal learning in social context is to combine results from laboratory and natural interactive informal learning environments.
Thermography to explore plant-environment interactions.
Costa, J Miguel; Grant, Olga M; Chaves, M Manuela
2013-10-01
Stomatal regulation is a key determinant of plant photosynthesis and water relations, influencing plant survival, adaptation, and growth. Stomata sense the surrounding environment and respond rapidly to abiotic and biotic stresses. Stomatal conductance to water vapour (g s) and/or transpiration (E) are therefore valuable physiological parameters to be monitored in plant and agricultural sciences. However, leaf gas exchange measurements involve contact with leaves and often interfere with leaf functioning. Besides, they are time consuming and are limited by the sampling characteristics (e.g. sample size and/or the high number of samples required). Remote and rapid means to assess g s or E are thus particularly valuable for physiologists, agronomists, and ecologists. Transpiration influences the leaf energy balance and, consequently, leaf temperature (T leaf). As a result, thermal imaging makes it possible to estimate or quantify g s and E. Thermal imaging has been successfully used in a wide range of conditions and with diverse plant species. The technique can be applied at different scales (e.g. from single seedlings/leaves through whole trees or field crops to regions), providing great potential to study plant-environment interactions and specific phenomena such as abnormal stomatal closure, genotypic variation in stress tolerance, and the impact of different management strategies on crop water status. Nevertheless, environmental variability (e.g. in light intensity, temperature, relative humidity, wind speed) affects the accuracy of thermal imaging measurements. This review presents and discusses the advantages of thermal imaging applications to plant science, agriculture, and ecology, as well as its limitations and possible approaches to minimize them, by highlighting examples from previous and ongoing research.
Interpreting Parent-Infant Interactions: Cross-Cultural Lessons.
McCollum, Jeanette A.; Ree, Yon; Chen, Yu-Jun
2000-01-01
Drawing on interviews with six American and Korean mothers, this article explores the range and coalescence of ideas that mothers from different cultures have about interactions with their 12-month-old babies in social interactive play and joint play with objects. Differences and similarities about the mothers' ideas about interaction are…
Electromagnetic current in weak interactions
International Nuclear Information System (INIS)
Ma, E.
1983-01-01
In gauge models which unify weak and electromagnetic interactions, the weak neutral-current interaction also involves the electromagnetic current. The exact nature of such a component can be explored using e + e - experimental data. In recent years, the existence of a new component of the weak interaction has become firmly established, i.e., the neutral-current interaction. As such, it competes with the electromagnetic interaction whenever the particles involved are also charged, but at a very much lower rate because its effective strength is so small. Hence neutrino processes are best for the detection of the neutral-current interaction. However, in any gauge model which unifies weak and electromagnetic interactions, the weak neutral-current interaction also involves the electromagnetic current
Directory of Open Access Journals (Sweden)
Kangji Li
2017-02-01
Full Text Available This paper is concerned with the development of a high-resolution and control-friendly optimization framework in enclosed environments that helps improve thermal comfort, indoor air quality (IAQ, and energy costs of heating, ventilation and air conditioning (HVAC system simultaneously. A computational fluid dynamics (CFD-based optimization method which couples algorithms implemented in Matlab with CFD simulation is proposed. The key part of this method is a data interactive mechanism which efficiently passes parameters between CFD simulations and optimization functions. A two-person office room is modeled for the numerical optimization. The multi-objective evolutionary algorithm—non-dominated-and-crowding Sorting Genetic Algorithm II (NSGA-II—is realized to explore the environment/energy Pareto front of the enclosed space. Performance analysis will demonstrate the effectiveness of the presented optimization method.
Enhancing the Appreciation of Traditional Chinese Painting Using Interactive Technology
Directory of Open Access Journals (Sweden)
Shichao Zhao
2018-04-01
Full Text Available In this paper, we present a two-part study. The first part was a cultural appreciation study. Through this study, we explored the specific approach of cross-cultural aesthetic appreciation and mapped out the potential insights for a prototype design. In the second part, we carried out a design-led study. We designed a tablet application and conducted focus group studies to explore the interactive technology that assists in the support of cross-cultural audiences’ aesthetic appreciation and engagement of traditional Chinese painting. Based on these findings, we went on to further explore an approach of interactive engagement which is specific to supporting cross-cultural appreciation, while also reflecting upon the interactive design suggestions for the development of aesthetic appreciation to offer various transferable insights to the Human–Computer Interaction (HCI community.
Directory of Open Access Journals (Sweden)
Jiguang Du
2016-04-01
Full Text Available The interaction natures between Pu and different ligands in several plutonyl (VI complexes are investigated by performing topological analyses of electron density. The geometrical structures in both gaseous and aqueous phases are obtained with B3LYP functional, and are generally in agreement with available theoretical and experimental results when combined with all-electron segmented all-electron relativistic contracted (SARC basis set. The Pu– O y l bond orders show significant linear dependence on bond length and the charge of oxygen atoms in plutonyl moiety. The closed-shell interactions were identified for Pu-Ligand bonds in most complexes with quantum theory of atoms in molecules (QTAIM analyses. Meanwhile, we found that some Pu–Ligand bonds, like Pu–OH−, show weak covalent. The interactive nature of Pu–ligand bonds were revealed based on the interaction quantum atom (IQA energy decomposition approach, and our results indicate that all Pu–Ligand interactions is dominated by the electrostatic attraction interaction as expected. Meanwhile it is also important to note that the quantum mechanical exchange-correlation contributions can not be ignored. By means of the non-covalent interaction (NCI approach it has been found that some weak and repulsion interactions existed in plutonyl(VI complexes, which can not be distinguished by QTAIM, can be successfully identified.
Cluster structures influenced by interaction with a surface.
Witt, Christopher; Dieterich, Johannes M; Hartke, Bernd
2018-05-30
Clusters on surfaces are vitally important for nanotechnological applications. Clearly, cluster-surface interactions heavily influence the preferred cluster structures, compared to clusters in vacuum. Nevertheless, systematic explorations and an in-depth understanding of these interactions and how they determine the cluster structures are still lacking. Here we present an extension of our well-established non-deterministic global optimization package OGOLEM from isolated clusters to clusters on surfaces. Applying this approach to intentionally simple Lennard-Jones test systems, we produce a first systematic exploration that relates changes in cluster-surface interactions to resulting changes in adsorbed cluster structures.
Exploring social interaction with everyday object based on perceptual crossing
Anas, S.A.B.; Qiu, S.; Rauterberg, G.W.M.; Hu, J.
2016-01-01
Eye gaze plays an essential role in social interaction which influences our perception of others. It is most likely that we can perceive the existence of another intentional subject through the act of cathing one another's eyes. Based on the notion of perceptual crossing, we aim to establish a
van der Puil, Chiel; Andriessen, Jerry; Kanselaar, Gellof
2004-04-01
This article presents a qualitative analysis showing the dependency of effective collaborative argumentation on interpersonal relational aspects that develop during synchronous interaction. Four regulatory principles are proposed as propelling the interaction, and of these, autoregulation, or the conservative restraints within the existing relation, appears to be the dominant force. When using a structured dialogue system (SDS), instead of free chat, via roles and sentence-openers, the social dimension of the relation between participants disappears from the surface interaction. Even though using the SDS seems to foster a more focused and task-functional approach, argumentation appears to affect the relations between participants in a negative way, since after an argumentative sequence, repair of the relationship takes place. It might even be argued that, because of relational stress, in many cases, argumentation is momentarily suspended.
HSC-explorer: a curated database for hematopoietic stem cells.
Montrone, Corinna; Kokkaliaris, Konstantinos D; Loeffler, Dirk; Lechner, Martin; Kastenmüller, Gabi; Schroeder, Timm; Ruepp, Andreas
2013-01-01
HSC-Explorer (http://mips.helmholtz-muenchen.de/HSC/) is a publicly available, integrative database containing detailed information about the early steps of hematopoiesis. The resource aims at providing fast and easy access to relevant information, in particular to the complex network of interacting cell types and molecules, from the wealth of publications in the field through visualization interfaces. It provides structured information on more than 7000 experimentally validated interactions between molecules, bioprocesses and environmental factors. Information is manually derived by critical reading of the scientific literature from expert annotators. Hematopoiesis-relevant interactions are accompanied with context information such as model organisms and experimental methods for enabling assessment of reliability and relevance of experimental results. Usage of established vocabularies facilitates downstream bioinformatics applications and to convert the results into complex networks. Several predefined datasets (Selected topics) offer insights into stem cell behavior, the stem cell niche and signaling processes supporting hematopoietic stem cell maintenance. HSC-Explorer provides a versatile web-based resource for scientists entering the field of hematopoiesis enabling users to inspect the associated biological processes through interactive graphical presentation.
HSC-explorer: a curated database for hematopoietic stem cells.
Directory of Open Access Journals (Sweden)
Corinna Montrone
Full Text Available HSC-Explorer (http://mips.helmholtz-muenchen.de/HSC/ is a publicly available, integrative database containing detailed information about the early steps of hematopoiesis. The resource aims at providing fast and easy access to relevant information, in particular to the complex network of interacting cell types and molecules, from the wealth of publications in the field through visualization interfaces. It provides structured information on more than 7000 experimentally validated interactions between molecules, bioprocesses and environmental factors. Information is manually derived by critical reading of the scientific literature from expert annotators. Hematopoiesis-relevant interactions are accompanied with context information such as model organisms and experimental methods for enabling assessment of reliability and relevance of experimental results. Usage of established vocabularies facilitates downstream bioinformatics applications and to convert the results into complex networks. Several predefined datasets (Selected topics offer insights into stem cell behavior, the stem cell niche and signaling processes supporting hematopoietic stem cell maintenance. HSC-Explorer provides a versatile web-based resource for scientists entering the field of hematopoiesis enabling users to inspect the associated biological processes through interactive graphical presentation.
Combining Conversation Analysis and Nexus Analysis to explore hospital practices
DEFF Research Database (Denmark)
Paasch, Bettina Sletten
This talk reports findings from a study exploring interactions between nurses and patients in a Danish hospital. The aim of the study is to describe how mobile work phones shape interactions, and for this purpose a data corpus consisting of approximately 140 hours of video recordings, ethnographi...
Noort, V. van; Snel, B.; Huynen, M.A.
2007-01-01
BACKGROUND: In the post-genomic era various functional genomics, proteomics and computational techniques have been developed to elucidate the protein interaction network. While some of these techniques are specific for a certain type of interaction, most predict a mixture of interactions.
AN OUTLINE OF INTERACTION TYPES IN PHYSICAL SERIOUS GAMES
DEFF Research Database (Denmark)
Majgaard, Gunver
This poster explores a perspective in interaction design for physical serious games. It introduces a model for interaction types: horizontal, vertical and collaborative interaction at user level and developer's level. The thesis is that the richer and more meaningful the interaction is the better...
Almeida, Mariana Linhares; Tôrres, Ana Clara Soares de Paiva; de Oliveira, Kleiton Clécio; Calderon, Patrícia Dos Santos; Carreiro, Adriana da Fonte Porto; Gurgel, Bruno César de Vasconcelos
2018-03-06
To evaluate the effect of basic periodontal treatment on clinical periodontal parameters associated with abutment teeth of patients with mandibular Kennedy class I removable partial dentures (RPD) 18 months after treatment. Thirty patients with periodontal disease were treated and evaluated according to the following periodontal parameters: visible plaque index (VPI), bleeding on probing (BOP), probing depth (PD), gingival recession (GR), clinical attachment loss (CAL), and keratinized mucosa (KM). These parameters were compared between abutment teeth with direct and indirect retainers at baseline, and after 6 and 18 months. Data were analyzed by Friedman Test and Wilcoxon Test for all variables. Most patients (n = 26; 86.7%) included in the study were female and had a mean age of 61 years (±7.54). Results showed that VPI and BOP decreased over time, and that VPI values were higher in abutment teeth with direct retainers (p = 0.001). There was a reduction in PD after 6 months, which was maintained up to 18 months. In general, abutment teeth with direct retainers had significantly higher values for PD, GR, and CAL (p = 0.029). Data also indicated that the parameters for VPI, BOP, and PD improved; however, abutment teeth with direct retainers presented smaller improvements, compared with abutment teeth with indirect retainers, which presented significant improvements for almost all variables. Periodontal treatment and oral hygiene care of patients were adequate for maintenance of adequate periodontal conditions, regardless of the use of prostheses. © 2018 by the American College of Prosthodontists.
An exploration in kitchen blender interactions aimed at designing for high levels of engagement
van Rheden, V.; Hengeveld, B.J.
2015-01-01
This paper illustrates three novel kitchen blender interactions aimed at bringing about a higher level of engagement with interactive products, as a response to current, seemingly un-engaging interactions. We describe our starting points and approach after which we present the designed blender
Noort, V. van; Snel, B.; Huynen, M.A.
2007-01-01
ABSTRACT: BACKGROUND: In the post-genomic era various functional genomics, proteomics and computational techniques have been developed to elucidate the protein interaction network. While some of these techniques are specific for a certain type of interaction, most predict a mixture of interactions.
Frey, Bruno S.; Savage, David A.; Torgler, Benno
2010-01-01
To understand human behavior, it is important to know under what conditions people deviate from selfish rationality. This study explores the interaction of natural survival instincts and internalized social norms using data on the sinking of the Titanic and the Lusitania. We show that time pressure appears to be crucial when explaining behavior under extreme conditions of life and death. Even though the two vessels and the composition of their passengers were quite similar, the behavior of the individuals on board was dramatically different. On the Lusitania, selfish behavior dominated (which corresponds to the classical homo economicus); on the Titanic, social norms and social status (class) dominated, which contradicts standard economics. This difference could be attributed to the fact that the Lusitania sank in 18 min, creating a situation in which the short-run flight impulse dominated behavior. On the slowly sinking Titanic (2 h, 40 min), there was time for socially determined behavioral patterns to reemerge. Maritime disasters are traditionally not analyzed in a comparative manner with advanced statistical (econometric) techniques using individual data of the passengers and crew. Knowing human behavior under extreme conditions provides insight into how widely human behavior can vary, depending on differing external conditions. PMID:20194743
Frey, Bruno S; Savage, David A; Torgler, Benno
2010-03-16
To understand human behavior, it is important to know under what conditions people deviate from selfish rationality. This study explores the interaction of natural survival instincts and internalized social norms using data on the sinking of the Titanic and the Lusitania. We show that time pressure appears to be crucial when explaining behavior under extreme conditions of life and death. Even though the two vessels and the composition of their passengers were quite similar, the behavior of the individuals on board was dramatically different. On the Lusitania, selfish behavior dominated (which corresponds to the classical homo economicus); on the Titanic, social norms and social status (class) dominated, which contradicts standard economics. This difference could be attributed to the fact that the Lusitania sank in 18 min, creating a situation in which the short-run flight impulse dominated behavior. On the slowly sinking Titanic (2 h, 40 min), there was time for socially determined behavioral patterns to reemerge. Maritime disasters are traditionally not analyzed in a comparative manner with advanced statistical (econometric) techniques using individual data of the passengers and crew. Knowing human behavior under extreme conditions provides insight into how widely human behavior can vary, depending on differing external conditions.
Intuitive Exploration of Volumetric Data Using Dynamic Galleries.
Jönsson, Daniel; Falk, Martin; Ynnerman, Anders
2016-01-01
In this work we present a volume exploration method designed to be used by novice users and visitors to science centers and museums. The volumetric digitalization of artifacts in museums is of rapidly increasing interest as enhanced user experience through interactive data visualization can be achieved. This is, however, a challenging task since the vast majority of visitors are not familiar with the concepts commonly used in data exploration, such as mapping of visual properties from values in the data domain using transfer functions. Interacting in the data domain is an effective way to filter away undesired information but it is difficult to predict where the values lie in the spatial domain. In this work we make extensive use of dynamic previews instantly generated as the user explores the data domain. The previews allow the user to predict what effect changes in the data domain will have on the rendered image without being aware that visual parameters are set in the data domain. Each preview represents a subrange of the data domain where overview and details are given on demand through zooming and panning. The method has been designed with touch interfaces as the target platform for interaction. We provide a qualitative evaluation performed with visitors to a science center to show the utility of the approach.
Ao, Junjie; Gao, Li; Yuan, Tao; Jiang, Gaofeng
2015-01-01
Organic UV filters are a group of emerging PPCP (pharmaceuticals and personal care products) contaminants. Current information is insufficient to understand the in vivo processes and health risks of organic UV filters in humans. The interaction mechanism of UV filters with serum albumin provides critical information for the health risk assessment of these active ingredients in sunscreen products. This study investigates the interaction mechanisms of five commonly used UV filters (2-hydroxy-4-methoxybenzophenone, BP-3; 2-ethylhexyl 4-methoxycinnamate, EHMC; 4-methylbenzylidene camphor, 4-MBC; methoxydibenzoylmethane, BDM; homosalate, HMS) with bovine serum albumin (BSA) by spectroscopic measurements of fluorescence, circular dichroism (CD), competitive binding experiments and molecular docking. Our results indicated that the fluorescence of BSA was quenched by these UV filters through a static quenching mechanism. The values of the binding constant (Ka) ranged from (0.78±0.02)×10(3) to (1.29±0.01)×10(5) L mol(-1). Further exploration by synchronous fluorescence and CD showed that the conformation of BSA was demonstrably changed in the presence of these organic UV filters. It was confirmed that the UV filters can disrupt the α-helical stability of BSA. Moreover, the results of molecular docking revealed that the UV filter molecule is located in site II (sub-domain IIIA) of BSA, which was further confirmed by the results of competitive binding experiments. In addition, binding occurred mainly through hydrogen bonding and hydrophobic interaction. This study raises critical concerns regarding the transportation, distribution and toxicity effects of organic UV filters in human body. Copyright © 2014 Elsevier Ltd. All rights reserved.
Exploring Action Research as an Approach to Interactive (Participatory) Evaluation
Chaudary, Imran Anjum; Imran, Shahida
2012-01-01
This investigation seeks to understand "action research" as an approach to "interactive form of evaluation". The first half of the investigation illuminates the approach with the help of the selective body of literature and the second half draws attention to its application in the field with the help of an authentic evaluation…
Teaching innovation is social interaction
DEFF Research Database (Denmark)
Petersen, Monika Hoeck; Olsen, Bente
2015-01-01
The paper aims to explore how teaching practitioners teach innovation – by cross comparing the local nursing college innovation program and the innovation teaching at the bachelor program in Mechatronic engineering at the local University; to explore and develop attention points in understanding ...... that emerging entrepreneurial attitudes are linked to the social processes of interaction between the participants of teachers and students....
Exploring Interactions in L2 Blogging: Metadiscourse in Philippine Investigative Journalism Blogs
Veronico Nogales Tarrayo
2014-01-01
Although metadiscourse has been examined in different genres, such as academic papers, newspaper editorials, school textbooks, and the like, still relatively little attention has been given to the discourse of cyber-genres, particularly blogs or weblogs. Using Hyland’s (2005) model, this paper examined the interactive and the interactional metadiscourse in Philippine investigative journalism blogs where English is used as a second language or L2. The corpus analyzed was taken from 20 invest...
Directory of Open Access Journals (Sweden)
Mengya eNiu
2015-12-01
Full Text Available Human noroviruses (HuNoVs are major contributors to acute nonbacterial gastroenteritis outbreaks. Many aspects of HuNoVs are poorly understood due to both the current inability to culture HuNoVs, and the lack of efficient small animal models. Surrogates for HuNoVs, such as recombinant viral like particles (VLPs expressed in eukaryotic system or P particles expressed in prokaryotic system, have been used for studies in immunology and interaction between the virus and its receptors. However, it is difficult to use VLPs or P particles to collect or isolate potential ligands binding to these recombinant capsid proteins. In this study, a new strategy was used to collect HuNoVs binding ligands through the use of ice nucleation protein (INP to display recombinant capsid proteins of HuNoVs on bacterial surfaces. The viral protein-ligand complex could be easily separated by a low speed centrifugation step. This system was also used to explore interaction between recombinant capsid proteins of HuNoVs and their receptors. In this system, the VP1 capsid encoding gene (ORF2 and the protruding domain (P domain encoding gene (3’ terminal fragment of ORF2 of HuNoVs GI.1 and GII.4 were fused with 5’ terminal fragment of ice nucleation protein encoding gene (inaQn. The results demonstrated that the recombinant VP1 and P domains of HuNoVs were expressed and anchored on the surface of Escherichia coli BL21 cells after the bacteria were transformed with the corresponding plasmids. Both cell surface displayed VP1 and P domains could be recognized by HuNoVs specific antibodies and interact with the viral histo-blood group antigens receptors. In both cases, displayed P domains had better binding abilities than VP1. This new strategy of using displayed HuNoVs capsid proteins on the bacterial surface could be utilized to separate HuNoVs binding components from complex samples, to investigate interaction between the virus and its receptors, as well as to develop an
Directory of Open Access Journals (Sweden)
Christina eSteindl
2015-11-01
Full Text Available In social interactions, individuals may sometimes pursue their own interests at the expense of their interaction partner. Such self-interested behaviors impose a threat to the interaction partner’s freedom to act. The current article investigates this threat in the context of interdependence and reactance theory. We explore how vested interests influence reactance process stages of an advisor-client interaction. We aim to explore the interactional process that evolves. In two studies, participants took the perspective of a doctor (advisor or a patient (client. In both studies we incorporated a vested interest. In Study 1 (N=82 we found that in response to a vested interest of their interaction partner, patients indicated a stronger experience of reactance, more aggressive behavioral intentions, and more biased cognitions than doctors. A serial multiple mediation revealed that a vested interest engendered mistrust toward the interaction partner and this mistrust led to an emerging reactance process. Study 2 (N=207 further demonstrated that doctors expressed their reactance in a subtle way: They revealed a classic confirmation bias when searching for additional information on their preliminary decision preference, indicating stronger defense motivation. We discuss how these findings can help us to understand how social interactions develop dynamically.
Steindl, Christina; Jonas, Eva
2015-01-01
In social interactions, individuals may sometimes pursue their own interests at the expense of their interaction partner. Such self-interested behaviors impose a threat to the interaction partner’s freedom to act. The current article investigates this threat in the context of interdependence and reactance theory. We explore how vested interests influence reactance process stages of an advisor–client interaction. We aim to explore the interactional process that evolves. In two studies, participants took the perspective of a doctor (advisor) or a patient (client). In both studies we incorporated a vested interest. In Study 1 (N = 82) we found that in response to a vested interest of their interaction partner, patients indicated a stronger experience of reactance, more aggressive behavioral intentions, and more biased cognitions than doctors. A serial multiple mediation revealed that a vested interest engendered mistrust toward the interaction partner and this mistrust led to an emerging reactance process. Study 2 (N = 207) further demonstrated that doctors expressed their reactance in a subtle way: they revealed a classic confirmation bias when searching for additional information on their preliminary decision preference, indicating stronger defense motivation. We discuss how these findings can help us to understand how social interactions develop dynamically. PMID:26640444
Inter-brain synchronization during social interaction.
Directory of Open Access Journals (Sweden)
Guillaume Dumas
Full Text Available During social interaction, both participants are continuously active, each modifying their own actions in response to the continuously changing actions of the partner. This continuous mutual adaptation results in interactional synchrony to which both members contribute. Freely exchanging the role of imitator and model is a well-framed example of interactional synchrony resulting from a mutual behavioral negotiation. How the participants' brain activity underlies this process is currently a question that hyperscanning recordings allow us to explore. In particular, it remains largely unknown to what extent oscillatory synchronization could emerge between two brains during social interaction. To explore this issue, 18 participants paired as 9 dyads were recorded with dual-video and dual-EEG setups while they were engaged in spontaneous imitation of hand movements. We measured interactional synchrony and the turn-taking between model and imitator. We discovered by the use of nonlinear techniques that states of interactional synchrony correlate with the emergence of an interbrain synchronizing network in the alpha-mu band between the right centroparietal regions. These regions have been suggested to play a pivotal role in social interaction. Here, they acted symmetrically as key functional hubs in the interindividual brainweb. Additionally, neural synchronization became asymmetrical in the higher frequency bands possibly reflecting a top-down modulation of the roles of model and imitator in the ongoing interaction.
Roche Allred, Zahilyn D; Tai, Heeyoung; Bretz, Stacey Lowery; Page, Richard C
2017-11-01
Students' understandings of foundational concepts such as noncovalent interactions, pH and pK a are crucial for success in undergraduate biochemistry courses. We developed a guided-inquiry activity to aid students in making connections between noncovalent interactions and pH/pK a . Students explore these concepts by examining the primary and tertiary structures of immunoglobulin G (IgG) and Protein A. Students use PyMOL, an open source molecular visualization application, to (1) identify hydrogen bonds and salt bridges between and within the proteins at physiological pH and (2) apply their knowledge of pH/pK a to association rate constant data for these proteins at pH 4 and pH 11. The laboratory activity was implemented within a one semester biochemistry laboratory for students majoring in allied health disciplines, engineering, and biological sciences. Several extensions for more advanced students are discussed. Students' overall performance highlighted their ability to successfully complete tasks such as labeling and identifying noncovalent interactions and revealed difficulties with analyzing noncovalent interactions under varying pH/pK a conditions. Students' evaluations after completing the activity indicated they felt challenged but also recognized the potential of the activity to help them gain meaningful understanding of the connections between noncovalent interactions, pH, pK a , and protein structure. © 2017 by The International Union of Biochemistry and Molecular Biology, 45(6):528-536, 2017. © 2017 The International Union of Biochemistry and Molecular Biology.
Techniques and architectures for 3D interaction
De Haan, G.
2009-01-01
Spatial scientific datasets are all around us, and 3D visualization is a powerful tool to explore details and structures within them. When dealing with complex spatial structures, interactive Virtual Reality (VR) systems can potentially improve exploration over desktop-based systems. However, from
From movement to mechanism : exploring expressive movement qualities in shape-change
Kwak, M.; Frens, J.W.
2015-01-01
This one-day studio revolves around the exploration of expressive movement qualities in shape-change by means of physical sketching and prototyping. It is a hands-on studio where participants first explore expressive movement qualities and interaction scenarios with a generic shape-changing platform
Bruns, M.; Stienstra, J.T.; Dijkstra, R.
2014-01-01
To counteract the increased tendency in skill learning addressing our cognitive abilities we discuss an opportunity on how performance skills can be trained by means of inherent feed forward through interactive materiality. We address this approach in the context of designing an interactive
Governing 'Spaces of Interaction' for Sustainable Fisheries
Bush, S.R.
2010-01-01
This paper introduces the concept of 'spaces of interaction' to determine how existing market-based governance tools improve participation and deliberation between actors along fish value chains. Exploring these linkages through the sociology of environmental flows and interactive governance theory
ORF Alignment: NC_004663 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... [Bacteroides thetaiotaomicron VPI-5482] ... Length = 48 ... Query: 191 TSECIGCKRCEKSCPVGNITM...KERRPVWGKNCTACLACYHVCPQHAVQ 238 ... TSECIGCKRCEKSCPVGNITMKERRPVWGKNCTACLACYHVCPQHAVQ Sbjct: 1 ... TSECIGCKRCEKSCPVGNITMKERRPVWGKNCTACLACYHVCPQHAVQ 48
Exploring the Individual-Organizational Global Mindset Nexus
DEFF Research Database (Denmark)
Bird, Allan; Broundal, Magnus; Hansen, Per Geisler
2016-01-01
by interactively exploring this nexus from six different perspectives with a view to carving out paths for future research and next practice: Business strategy, governance, organizational design, the role of boards, leadership brand-building and human resource development. Introductory vignettes from a panel......The objective of this panel symposium is to explore opportunities for connecting individual and organizational global mindset from both a research and practice perspective. The link between individual and organizational global mindset is hinted at in the global mindset literature, but remains...
DIMA 3.0: Domain Interaction Map.
Luo, Qibin; Pagel, Philipp; Vilne, Baiba; Frishman, Dmitrij
2011-01-01
Domain Interaction MAp (DIMA, available at http://webclu.bio.wzw.tum.de/dima) is a database of predicted and known interactions between protein domains. It integrates 5807 structurally known interactions imported from the iPfam and 3did databases and 46,900 domain interactions predicted by four computational methods: domain phylogenetic profiling, domain pair exclusion algorithm correlated mutations and domain interaction prediction in a discriminative way. Additionally predictions are filtered to exclude those domain pairs that are reported as non-interacting by the Negatome database. The DIMA Web site allows to calculate domain interaction networks either for a domain of interest or for entire organisms, and to explore them interactively using the Flash-based Cytoscape Web software.
Tobbell, Jane; O'Donnell, Victoria; Zammit, Maria
2010-01-01
There has been relatively little research to date that has explored the transition to postgraduate study. This paper reports findings from a project (funded by the UK's Higher Education Academy) that sought to address this gap. The research project was ethnographic and explored university practice and student participation in five UK universities.…
Dyadic Interracial Interactions: A Meta-Analysis
Toosi, Negin R.; Babbitt, Laura G.; Ambady, Nalini; Sommers, Samuel R.
2012-01-01
This meta-analysis examined over 40 years of research on interracial interactions by exploring 4 types of outcomes: explicit attitudes toward interaction partners, participants' self-reports of their own emotional state, nonverbal or observed behavior, and objective measures of performance. Data were collected from 108 samples (N = 12,463)…
BLAST-EXPLORER helps you building datasets for phylogenetic analysis
Directory of Open Access Journals (Sweden)
Claverie Jean-Michel
2010-01-01
Full Text Available Abstract Background The right sampling of homologous sequences for phylogenetic or molecular evolution analyses is a crucial step, the quality of which can have a significant impact on the final interpretation of the study. There is no single way for constructing datasets suitable for phylogenetic analysis, because this task intimately depends on the scientific question we want to address, Moreover, database mining softwares such as BLAST which are routinely used for searching homologous sequences are not specifically optimized for this task. Results To fill this gap, we designed BLAST-Explorer, an original and friendly web-based application that combines a BLAST search with a suite of tools that allows interactive, phylogenetic-oriented exploration of the BLAST results and flexible selection of homologous sequences among the BLAST hits. Once the selection of the BLAST hits is done using BLAST-Explorer, the corresponding sequence can be imported locally for external analysis or passed to the phylogenetic tree reconstruction pipelines available on the Phylogeny.fr platform. Conclusions BLAST-Explorer provides a simple, intuitive and interactive graphical representation of the BLAST results and allows selection and retrieving of the BLAST hit sequences based a wide range of criterions. Although BLAST-Explorer primarily aims at helping the construction of sequence datasets for further phylogenetic study, it can also be used as a standard BLAST server with enriched output. BLAST-Explorer is available at http://www.phylogeny.fr
Lekman, Magnus; Hössjer, Ola; Andrews, Peter; Källberg, Henrik; Uvehag, Daniel; Charney, Dennis; Manji, Husseini; Rush, John A; McMahon, Francis J; Moore, Jason H; Kockum, Ingrid
2014-01-01
Genetic contributions to major depressive disorder (MDD) are thought to result from multiple genes interacting with each other. Different procedures have been proposed to detect such interactions. Which approach is best for explaining the risk of developing disease is unclear. This study sought to elucidate the genetic interaction landscape in candidate genes for MDD by conducting a SNP-SNP interaction analysis using an exhaustive search through 3,704 SNP-markers in 1,732 cases and 1,783 controls provided from the GAIN MDD study. We used three different methods to detect interactions, two logistic regressions models (multiplicative and additive) and one data mining and machine learning (MDR) approach. Although none of the interaction survived correction for multiple comparisons, the results provide important information for future genetic interaction studies in complex disorders. Among the 0.5% most significant observations, none had been reported previously for risk to MDD. Within this group of interactions, less than 0.03% would have been detectable based on main effect approach or an a priori algorithm. We evaluated correlations among the three different models and conclude that all three algorithms detected the same interactions to a low degree. Although the top interactions had a surprisingly large effect size for MDD (e.g. additive dominant model Puncorrected = 9.10E-9 with attributable proportion (AP) value = 0.58 and multiplicative recessive model with Puncorrected = 6.95E-5 with odds ratio (OR estimated from β3) value = 4.99) the area under the curve (AUC) estimates were low (< 0.54). Moreover, the population attributable fraction (PAF) estimates were also low (< 0.15). We conclude that the top interactions on their own did not explain much of the genetic variance of MDD. The different statistical interaction methods we used in the present study did not identify the same pairs of interacting markers. Genetic interaction studies may uncover previously
Directory of Open Access Journals (Sweden)
Leanne M. Hirshfield
2014-01-01
Full Text Available In today’s technologically driven world, there is a need to better understand the ways that common computer malfunctions affect computer users. These malfunctions may have measurable influences on computer user’s cognitive, emotional, and behavioral responses. An experiment was conducted where participants conducted a series of web search tasks while wearing functional near-infrared spectroscopy (fNIRS and galvanic skin response sensors. Two computer malfunctions were introduced during the sessions which had the potential to influence correlates of user trust and suspicion. Surveys were given after each session to measure user’s perceived emotional state, cognitive load, and perceived trust. Results suggest that fNIRS can be used to measure the different cognitive and emotional responses associated with computer malfunctions. These cognitive and emotional changes were correlated with users’ self-report levels of suspicion and trust, and they in turn suggest future work that further explores the capability of fNIRS for the measurement of user experience during human-computer interactions.
Breaking Reality: Exploring Pervasive Cheating in Foursquare
Glas, R.
2011-01-01
This paper explores the notion of cheating in location-based mobile applications. Using the popular smartphone app Foursquare as main case study, I address the question if and how devious practices impact the boundaries between play and reality as a negotiated space of interaction. After
Toivanen, Susanna
2011-10-01
This study explored the interplay between work stress and socioeconomic position and investigated if the interaction of work stress and low socioeconomic position is associated with poorer health. A representative sample of the Swedish working population, including 2,613 employees (48.7% women) aged 19-64 years, was analyzed. The health outcomes were poor self-rated health, psychological distress, and musculoskeletal pain. Work stress was operationalized as job strain and effort-reward imbalance, and socioeconomic position as occupational class. Interaction analysis was based on departure from additivity as criterion, and a synergy index (SI) was applied, using odds ratios (ORs) from logistic regressions for women and men. In fully adjusted models, work stress, and in a lesser extent also socioeconomic position, was associated with higher odds for the three health complaints. The prevalence of poorer health was highest among those individuals jointly exposed to high work stress and low occupational class, with ORs ranging from 1.94 to 6.77 (95%CI 1.01-18.65) for poor self-rated health, 2.42-8.44 (95%CI 1.28-27.06) for psychological distress and 1.93-3.93 (95%CI 1.11-6.78) for musculoskeletal pain. The joint influence of work stress and low socioeconomic position on health was additive rather than multiplicative. Copyright © 2011 Wiley-Liss, Inc.
ORF Alignment: NC_004663 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... [Bacteroides thetaiotaomicron VPI-5482] ... Length = 105 ... Query: 449 VLQDQSLQKEASTGYGRLYDFFKHNFNYLMKYAGNLFAQKRYDEAIVILER...AKLVSCHPS 508 ... VLQDQSLQKEASTGYGRLYDFFKHNFNYLMKYAGNLFAQKRYDEAIVILER...AKLVSCHPS Sbjct: 1 ... VLQDQSLQKEASTGYGRLYDFFKHNFNYLMKYAGNLFAQKRYDEAIVILERAKLVSCHPS 60 ...
ORF Alignment: NC_004663 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available thetaiotaomicron ... VPI-5482] ... Length = 176 ... Query: 1082 VLIVEDNKDMLAFVARQLSPLYHVITAENGIE...ALKVLEHEYINLVISDIMMPEMDGLELC 1141 ... VLIVEDNKDMLAFVARQLSPLYHVITAENGIEALKVLEHEYINLVISDIMMPEMDGLELC S...bjct: 1 ... VLIVEDNKDMLAFVARQLSPLYHVITAENGIEALKVLEHEYINLVISDIMMPEMDGLELC 60 ... Query
ORF Alignment: NC_004663 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... [Bacteroides thetaiotaomicron VPI-5482] ... Length = 174 ... Query: 2 ... KEVIFVLLNEFADWEGAFIA...ACLNQGVMPGSPVPYKVKTLSITKEPVSSIGGFRVLPDYD 61 ... KEVIFVLLNEFADWEGAFIAACLNQG...VMPGSPVPYKVKTLSITKEPVSSIGGFRVLPDYD Sbjct: 1 ... KEVIFVLLNEFADWEGAFIAACLNQGVMPGSPVPYKVKTLSITKEPVSSIGGFRVLPDYD 6
ORF Alignment: NC_004663 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available eroides ... thetaiotaomicron VPI-5482] ... Length = 104 ... Query: 277 ILEVVKYIESHYNSDLTIESLLAQIP...LSRRNFEVKFKNAMHTSIYQYILNCRVNHLADLL 336 ... ILEVVKYIESHYNSDLTIESLLAQIPLSRRN...FEVKFKNAMHTSIYQYILNCRVNHLADLL Sbjct: 1 ... ILEVVKYIESHYNSDLTIESLLAQIPLSRRNFEVKFKNAMHTSIYQYILNCRVNHLADLL 60 ...
Reasons for Low Levels of Interactivity
DEFF Research Database (Denmark)
Etter, Michael
2013-01-01
The interactivity levels of online CSR communication are typically low. This study explores the reasons for the low levels of interactivity in the popular social media tool Twitter. An analysis of 41,864 Twitter messages (tweets) from the thirty most central corporate accounts in a CSR Twitter...... network is conducted. Comparisons (t-test) between CSR tweets and general tweets and between specialized CSR Twitter accounts and general accounts reveal that the low levels of interactivity are due to a reactive interaction approach and a lack of specialization....
"Dora the Explorer": Preschool Geographic Educator
Carter, James R.
2008-01-01
"Dora the Explorer" is a twenty-three-minute television program for preschoolers viewed by millions every day in many countries. These programs are also marketed as videotapes and DVDs. This seven-year-old Latina, bilingual cartoon character teaches many things by interacting with the young viewers. On every program Dora and friends have to go…
DEFF Research Database (Denmark)
Sørensen, Eva; Torfing, Jacob; Peters, B. Guy
Governance has become one of the most commonly used concepts in contemporary political science. It is, however, often used to mean a variety of different things. This book helps to clarify this conceptual muddle by concentrating on one variety of governance-interactive governance. The authors argue...... that although the state may remain important for many aspects of governing, interactions between state and society represent an important, and perhaps increasingly important, dimension of governance. These interactions may be with social actors such as networks, with market actors or with other governments......, but all these forms represent means of governing involving mixtures of state action with the actions of other entities.This book explores thoroughly this meaning of governance, and links it to broader questions of governance. In the process of explicating this dimension of governance the authors also...
Directory of Open Access Journals (Sweden)
Giovanni Quintavalle Pastorino
2015-07-01
Full Text Available Interactions that animals experience can have a significant influence on their health and welfare. These interactions can occur between animals themselves, but also between animals and keepers, and animals and the public. Human and non-human animals come into contact with each other in a variety of settings, and wherever there is contact there is the opportunity for interaction to take place. Interaction with companion animals are well known, but human–animal interaction (HAR (Hosey, 2008 also occurs in the context of farms (Hemsworth and Gonyou, 1997; Hemsworth, 2003, laboratories (Chang and Hart, 2002, zoos (Kreger and Mench, 1995 and even the wild (e.g. Cassini, 2001. This project proposes a permanent monitoring scheme to record animal-human interactions and animal-animal interactions in zoos. This will be accompanied by a survey of animal personality for welfare, husbandry, breeding programs and reintroduction purposes. The pilot project is currently based on direct monitoring of animal behaviour, use of time lapse cameras and animal personality questionnaires completed by experienced keepers. The goal of this project is to create a network between zoos to explore the aforementioned interactions to produce husbandry protocols and explore personality and behavioural traits in multiple species. We present provisional data regarding polar bear (Fasano Zoosafari, Italy, Sumatran tigers, Amur tigers and Asiatic lion (ZSL London and Whipsnade zoo interactions with humans and conspecifics. This data is collected across a broad range of environmental conditions and outlines the monitoring protocols developed to collect this data. The first year data show the great adaptability of these species to ex situ environments, low or absent negative impact of visitors’ presence and the relevance of individual personality in these interactions.
MetExploreViz: web component for interactive metabolic network visualization.
Chazalviel, Maxime; Frainay, Clément; Poupin, Nathalie; Vinson, Florence; Merlet, Benjamin; Gloaguen, Yoann; Cottret, Ludovic; Jourdan, Fabien
2017-09-15
MetExploreViz is an open source web component that can be easily embedded in any web site. It provides features dedicated to the visualization of metabolic networks and pathways and thus offers a flexible solution to analyze omics data in a biochemical context. Documentation and link to GIT code repository (GPL 3.0 license)are available at this URL: http://metexplore.toulouse.inra.fr/metexploreViz/doc /. Tutorial is available at this URL. © The Author (2017). Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com
International Nuclear Information System (INIS)
Cockayne, D.
2002-01-01
Full text: The nanoworld is a real world waiting to be explored and to be exploited, and the key to this world is microscopy. Modem techniques of microscopy reveal not only atoms and molecules, but also how they combine and interact. They allow us to explore not only the natural but also the synthesised nanoworld. Through this exploration, we can discover new natural forms which can act as templates for constructing novel materials of technological and scientific importance, we can obtain knowledge about the nanoworld (eg the structure of macromolecules) which gives us the means to manipulate the natural world, and we can discover how nature uses microstructure to achieve materials properties (eg strength) which we can then mimic. There are many modern forms of microscopy which are used in this exploration. They include not only a variety of microscopes (eg electron, atomic force, scanning tunnelling) but also an increasing range of sophisticated techniques such as electron tomography, image reconstruction, energy loss spectroscopy and high resolution microscopy, in which mathematical manipulation of the data is playing an increasingly important role. Meanwhile developments in aberration correctors and electron energy monochromation are taking microscopy into a new realm of resolution both in imaging and spectroscopy. Research at the nanoscale is causing a convergence between the biological and physical sciences, largely because the tools and techniques they use are becoming increasingly common to both fields. This challenges us to arrange our activities to optimise our efforts and resources. So we see significant developments in shared instrumentation and remote operation, and we see the setting up of nanotechnology institutes where researchers from across the biological, mathematical, materials and medical disciplines explore together. Copyright (2002) Australian Society for Electron Microscopy Inc
ORF Alignment: NC_004663 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ne ... amidase [Bacteroides thetaiotaomicron VPI-5482] ... Length = 145 ... Query: 3 ... KQRNISLIVVHCTASRCTSDLT...PPSLDAMHKRQGFTECGYHYYITKDGRIHHMRDITKIG 62 ... KQRNISLIVVHCTASRCTSDLT...PPSLDAMHKRQGFTECGYHYYITKDGRIHHMRDITKIG Sbjct: 1 ... KQRNISLIVVHCTASRCTSDLTPPSLDAMHKRQGFTECGYHYYITKDGRIHH
Cultivating objects in interaction
DEFF Research Database (Denmark)
Hazel, Spencer
2014-01-01
is chapter explores patterns of repeated orientations to physical objects in interactants’ visuo-spatial and haptic surround. A number of examples are presented from advice-giving activities in various institutional settings, where participants-in-interaction initially draw on material objects...
Energy Technology Data Exchange (ETDEWEB)
Stevens, John Colby [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States). The Joint Center for Artificial Photosynthesis; Univ. of California, Berkeley, CA (United States). Dept. of Mechanical Engineering
2012-12-01
Ray tracing was used to perform optical optimization of arrays of photovoltaic microrods and explore the interaction between light and bubbles of oxygen gas on the surface of the microrods. The incident angle of light was varied over a wide range. The percent of incident light absorbed by the microrods and reflected by the bubbles was computed over this range. It was found that, for the 10 μm diameter, 100 μm tall SrTiO3 microrods simulated in the model, the optimal center-to-center spacing was 14 μm for a square grid. This geometry produced 75% average and 90% maximum absorbance. For a triangular grid using the same microrods, the optimal center-to-center spacing was 14 μm. This geometry produced 67% average and 85% maximum absorbance. For a randomly laid out grid of 5 μm diameter, 100 μm tall SrTiO3 microrods with an average center-to-center spacing of 20 μm, the average absorption was 23% and the maximum absorption was 43%. For a 50% areal coverage fraction of bubbles on the absorber surface, between 2%-20% of the incident light energy was reflected away from the rods by the bubbles, depending upon incident angle and bubble morphology.
Fluid-rock geochemical interaction for modelling calibration in geothermal exploration in Indonesia
Deon, Fiorenza; Barnhoorn, Auke; Lievens, Caroline; Ryannugroho, Riskiray; Imaro, Tulus; Bruhn, David; van der Meer, Freek; Hutami, Rizki; Sibarani, Besteba; Sule, Rachmat; Saptadij, Nenny; Hecker, Christoph; Appelt, Oona; Wilke, Franziska
2017-04-01
Indonesia with its large, but partially unexplored geothermal potential is one of the most interesting and suitable places in the world to conduct geothermal exploration research. This study focuses on geothermal exploration based on fluid-rock geochemistry/geomechanics and aims to compile an overview on geochemical data-rock properties from important geothermal fields in Indonesia. The research carried out in the field and in the laboratory is performed in the framework of the GEOCAP cooperation (Geothermal Capacity Building program Indonesia- the Netherlands). The application of petrology and geochemistry accounts to a better understanding of areas where operating power plants exist but also helps in the initial exploration stage of green areas. Because of their relevance and geological setting geothermal fields in Java, Sulawesi and the sedimentary basin of central Sumatra have been chosen as focus areas of this study. Operators, universities and governmental agencies will benefit from this approach as it will be applied also to new green-field terrains. By comparing the characteristic of the fluids, the alteration petrology and the rock geochemistry we also aim to contribute to compile an overview of the geochemistry of the important geothermal fields in Indonesia. At the same time the rock petrology and fluid geochemistry will be used as input data to model the reservoir fluid composition along with T-P parameters with the geochemical workbench PHREEQC. The field and laboratory data are mandatory for both the implementation and validation of the model results.
Diller, Kyle I; Bayden, Alexander S; Audie, Joseph; Diller, David J
2018-01-01
There is growing interest in peptide-based drug design and discovery. Due to their relatively large size, polymeric nature, and chemical complexity, the design of peptide-based drugs presents an interesting "big data" challenge. Here, we describe an interactive computational environment, PeptideNavigator, for naturally exploring the tremendous amount of information generated during a peptide drug design project. The purpose of PeptideNavigator is the presentation of large and complex experimental and computational data sets, particularly 3D data, so as to enable multidisciplinary scientists to make optimal decisions during a peptide drug discovery project. PeptideNavigator provides users with numerous viewing options, such as scatter plots, sequence views, and sequence frequency diagrams. These views allow for the collective visualization and exploration of many peptides and their properties, ultimately enabling the user to focus on a small number of peptides of interest. To drill down into the details of individual peptides, PeptideNavigator provides users with a Ramachandran plot viewer and a fully featured 3D visualization tool. Each view is linked, allowing the user to seamlessly navigate from collective views of large peptide data sets to the details of individual peptides with promising property profiles. Two case studies, based on MHC-1A activating peptides and MDM2 scaffold design, are presented to demonstrate the utility of PeptideNavigator in the context of disparate peptide-design projects. Copyright © 2017 Elsevier Ltd. All rights reserved.
Lunar Exploration Missions Since 2006
Lawrence, S. J. (Editor); Gaddis, L. R.; Joy, K. H.; Petro, N. E.
2017-01-01
The announcement of the Vision for Space Exploration in 2004 sparked a resurgence in lunar missions worldwide. Since the publication of the first "New Views of the Moon" volume, as of 2017 there have been 11 science-focused missions to the Moon. Each of these missions explored different aspects of the Moon's geology, environment, and resource potential. The results from this flotilla of missions have revolutionized lunar science, and resulted in a profoundly new emerging understanding of the Moon. The New Views of the Moon II initiative itself, which is designed to engage the large and vibrant lunar science community to integrate the results of these missions into new consensus viewpoints, is a direct outcome of this impressive array of missions. The "Lunar Exploration Missions Since 2006" chapter will "set the stage" for the rest of the volume, introducing the planetary community at large to the diverse array of missions that have explored the Moon in the last decade. Content: This chapter will encompass the following missions: Kaguya; ARTEMIS (Acceleration, Reconnection, Turbulence, and Electrodynamics of the Moon’s Interaction with the Sun); Chang’e-1; Chandrayaan-1; Moon Impact Probe; Lunar Reconnaissance Orbiter (LRO); Lunar Crater Observation Sensing Satellite (LCROSS); Chang’e-2; Gravity Recovery and Interior Laboratory (GRAIL); Lunar Atmosphere and Dust Environment Explorer (LADEE); Chang’e-3.
Exploring the Materiality of Literary Apps for Children
DEFF Research Database (Denmark)
Henkel, Ayoe Qvist
2016-01-01
Children’s literature is increasingly being realized in app format, with its possibilities of combining text, music, sound effects, stills, animated movies, verbal language, and, not least, interactivity. This digital and medial literary development calls for new analytical approaches to explore...
ORF Alignment: NC_004663 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ne ... decarboxylase [Bacteroides thetaiotaomicron VPI-5482] ... Length = 98 ... Query: 52 ... FTGESWL...APLTGNKDLNVPMSNVTFEPGCRNNWHSHTGGQILIAVGGVGYYQERGKAARR 111 ... FTGESWLAPL...TGNKDLNVPMSNVTFEPGCRNNWHSHTGGQILIAVGGVGYYQERGKAARR Sbjct: 1 ... FTGESWLAPLTGNKDLNVPMSNVTFEPGCRNNWHSHTGGQILIAVGGVGYYQERGKAARR 60 ...
Deonarain Brijlall; Sarah Bansilal; Deborah Moore-Russo
2012-01-01
This article reports on an exploration of teachers’ views on the meaning of mathematical representations in a democratic South Africa. We explored teachers’ conceptions of ‘mathematical representations’ as a means to promote dialogue and negotiation. These conceptions helped us to gauge how these teachers viewed representations in mathematics. Semi-structured questionnaires were administered to 76 high school mathematics teachers who were registered for an upgrading mathematics education...
Scientific Visualization of Radio Astronomy Data using Gesture Interaction
Mulumba, P.; Gain, J.; Marais, P.; Woudt, P.
2015-09-01
MeerKAT in South Africa (Meer = More Karoo Array Telescope) will require software to help visualize, interpret and interact with multidimensional data. While visualization of multi-dimensional data is a well explored topic, little work has been published on the design of intuitive interfaces to such systems. More specifically, the use of non-traditional interfaces (such as motion tracking and multi-touch) has not been widely investigated within the context of visualizing astronomy data. We hypothesize that a natural user interface would allow for easier data exploration which would in turn lead to certain kinds of visualizations (volumetric, multidimensional). To this end, we have developed a multi-platform scientific visualization system for FITS spectral data cubes using VTK (Visualization Toolkit) and a natural user interface to explore the interaction between a gesture input device and multidimensional data space. Our system supports visual transformations (translation, rotation and scaling) as well as sub-volume extraction and arbitrary slicing of 3D volumetric data. These tasks were implemented across three prototypes aimed at exploring different interaction strategies: standard (mouse/keyboard) interaction, volumetric gesture tracking (Leap Motion controller) and multi-touch interaction (multi-touch monitor). A Heuristic Evaluation revealed that the volumetric gesture tracking prototype shows great promise for interfacing with the depth component (z-axis) of 3D volumetric space across multiple transformations. However, this is limited by users needing to remember the required gestures. In comparison, the touch-based gesture navigation is typically more familiar to users as these gestures were engineered from standard multi-touch actions. Future work will address a complete usability test to evaluate and compare the different interaction modalities against the different visualization tasks.
DEFF Research Database (Denmark)
Kortbek, Karen Johanne; Grønbæk, Kaj
2008-01-01
This paper discusses new approaches to interaction design for communication of art in the physical museum space. In contrast to the widespread utilization of interactive technologies in cultural heritage and natural science museums it is generally a challenge to introduce technology in art museums...... without disturbing the domain of the art works. To explore the possibilities of communicating art through the use of technology, and to minimize disturbance of the artworks, we apply four main approaches in the communication: 1) gentle audio augmentation of art works; 2) conceptual affinity of art works...... and remote interactive installations; 3) using the body as an interaction device; 4) consistent audio-visual cues for interaction opportunities. The paper describes the application of these approaches for communication of inspirational material for a Mariko Mori exhibition. The installations are described...
Interactive Topology Optimization
DEFF Research Database (Denmark)
Nobel-Jørgensen, Morten
Interactivity is the continuous interaction between the user and the application to solve a task. Topology optimization is the optimization of structures in order to improve stiffness or other objectives. The goal of the thesis is to explore how topology optimization can be used in applications...... on theory of from human-computer interaction which is described in Chapter 2. Followed by a description of the foundations of topology optimization in Chapter 3. Our applications for topology optimization in 2D and 3D are described in Chapter 4 and a game which trains the human intuition of topology...... optimization is presented in Chapter 5. Topology optimization can also be used as an interactive modeling tool with local control which is presented in Chapter 6. Finally, Chapter 7 contains a summary of the findings and concludes the dissertation. Most of the presented applications of the thesis are available...
Partial-wave analyses of hadron scattering below 2 GeV
International Nuclear Information System (INIS)
Arndt, R.A.; Roper, L.D.
1991-01-01
The Center for Analysis of Particle Scattering (CAPS) in the Department of Physics at Virginia Polytechnic Institute and State University has analyzed basic two-body hadron reactions below 2 GeV for the last two decades. Reactions studied were nucleon-nucleon, pion-nucleon, K + -nucleon and pion photoproduction systems. In addition to analyses of these systems, a computer graphics system (SAID) has been developed and disseminated to over 250 research institutions using VAX computers. The computer-interactive system for disseminating information on basic scattering reactions is also accessible to the physics community through TELNET on the VPI ampersand SU physics department VAX. 6 refs
Lifescience Database Archive (English)
Full Text Available y are in the reverse direction. *1 A comprehensive two-hybrid analysis to explore the yeast protein interact...s. 2000 Jan 1;28(1):73-6. *2 The yeast proteome database (YPD) and Caenorhabditis elegans proteome database (WormPD): comprehensive...000 Jan 1;28(1):73-6. *3 A comprehensive analysis of protein-protein interactions in Saccharomyces cerevisia
Meeus, M.T.H.; Oerlemans, L.A.G.; Hage, J.
2004-01-01
This paper pursues the development and empirical exploration of a theoretical framework that explains the probabilities of interactive learning of innovating firms and actors in the public knowledge infrastructure. Our research question reads as follows: To what extent does the strength of innovator
DEFF Research Database (Denmark)
Brynskov, Martin; Bermúdez, Juan Carlos Carvajal; Fernández, Manu
This book is an effort to explore the newly emerging field of urban interaction design that addresses these issues. In the first part of the book, 'Foundations', we look into its origins. Where do its practitioners come from? How are they working together? What methodologies do they bring...... to the table? What are the key concepts they are addressing in their work? In the second part of the book named 'Trends', we go into current developments in the networked city and how urban interaction design as a field addresses these. Taken together, these sections will not give the definite definition...
Exploring Lawyer-Client Interaction: A Qualitative Study of Positive Lawyer Characteristics.
Elbers, Nieke A; van Wees, Kiliaan A P C; Akkermans, Arno J; Cuijpers, Pim; Bruinvels, David J
2012-03-01
Personal injury victims involved in compensation processes have a worse recovery than those not involved in compensation processes. One predictor for worse recovery is lawyer engagement. As some people argue that this negative relation between lawyer engagement and recovery may be explained by lawyers' attitude and communications to clients, it seems important to investigate lawyer-client interaction. Although procedural justice and therapeutic jurisprudence had previously discussed aspects relevant for lawyer-client interaction, the client's perspective has been rather ignored and only few empirical studies have been conducted. In this qualitative study, 21 traffic accident victims were interviewed about their experiences with their lawyer. Five desirable characteristics for lawyers were identified: communication, empathy, decisiveness, independence, and expertise. Communication and empathy corresponded with aspects already discussed in literature, whereas decisiveness, independence and expertise had been addressed only marginally. Further qualitative and quantitative research is necessary to establish preferable lawyer characteristics and to investigate what would improve the well-being of personal injury victims during the claims settlement process.
Human-Robot Interaction and Human Self-Realization
DEFF Research Database (Denmark)
Nørskov, Marco
2014-01-01
is to test the basis for this type of discrimination when it comes to human-robot interaction. Furthermore, the paper will take Heidegger's warning concerning technology as a vantage point and explore the possibility of human-robot interaction forming a praxis that might help humans to be with robots beyond...
Designing interactive technology for crowd experiences - beyond sanitization
DEFF Research Database (Denmark)
Veerasawmy, Rune
2014-01-01
This dissertation concerns the topic on designing interactive technology for crowd expe- riences. It takes the outset in the experience-oriented design approach within interaction design, exploring the research question how can we conceptually understand and design interactive technology for crowd...... experiences? Through theoretical studies of sociological crowd theory and pragmatist perspectives on experience combined with design exper- iments at sporting events this dissertation establishes an conceptual understanding of crowd experience. The outcome of this work is furthermore synthesized...... in a conceptual model of social experiences that presents crowd experiences as a distinct type of social experience. This is different from what previously have been explored within experi- ence-oriented design. This dissertation is composed of four research papers framed by an overview that summarizes...
Multimodal interaction design in collocated mobile phone use
El-Ali, A.; Lucero, A.; Aaltonen, V.
2011-01-01
In the context of the Social and Spatial Interactions (SSI) platform, we explore how multimodal interaction design (input and output) can augment and improve the experience of collocated, collaborative activities using mobile phones. Based largely on our prototype evaluations, we reflect on and
Social interactions for economic value? A marketing perspective
Vock, M.
2011-01-01
This dissertation explores emerging social interactions in relation to economic value, more specifically how social interactions at the organizational and individual levels may affect individual consumers and companies economically as well. To help shed light on this broad theme, it focuses on two
Directory of Open Access Journals (Sweden)
Imogen C Rehm
2016-11-01
Full Text Available In the burgeoning field of e-mental health interventions, avatars are increasingly being utilized to facilitate online communication between clients and therapists, and amongst peers. Avatars are digital self-representations which enable individuals to interact with each other in computer-based virtual environments. In this narrative review, we examine the psychotherapeutic applications of avatars that have been investigated and trialed to date. Five key applications were identified: (1 in the formation of online peer support communities; (2 replicating traditional modes of psychotherapy by using avatars as a vehicle to communicate within a wholly virtual environment; (3 using avatar technology to facilitate or augment face-to-face treatment; (4 as part of serious games, and (5 communication with an autonomous virtual therapist. Across these applications, avatars appeared to serve several functions conducive to treatment engagement: (1 facilitating the development of a virtual therapeutic alliance; (2 reducing communication barriers; (3 promoting treatment-seeking through anonymity; (4 promoting expression and exploration of client identity, and (5 enabling therapists to control and manipulate treatment stimuli. Further research into the feasibility and ethical implementation of avatar-based psychotherapies is required.
Rehm, Imogen C; Foenander, Emily; Wallace, Klaire; Abbott, Jo-Anne M; Kyrios, Michael; Thomas, Neil
2016-01-01
In the burgeoning field of e-mental health interventions, avatars are increasingly being utilized to facilitate online communication between clients and therapists, and among peers. Avatars are digital self-representations, which enable individuals to interact with each other in computer-based virtual environments. In this narrative review, we examine the psychotherapeutic applications of avatars that have been investigated and trialed to date. Five key applications were identified (1) in the formation of online peer support communities; (2) replicating traditional modes of psychotherapy by using avatars as a vehicle to communicate within a wholly virtual environment; (3) using avatar technology to facilitate or augment face-to-face treatment; (4) as part of serious games; and (5) communication with an autonomous virtual therapist. Across these applications, avatars appeared to serve several functions conducive to treatment engagement by (1) facilitating the development of a virtual therapeutic alliance; (2) reducing communication barriers; (3) promoting treatment-seeking through anonymity; (4) promoting expression and exploration of client identity; and (5) enabling therapists to control and manipulate treatment stimuli. Further research into the feasibility and ethical implementation of avatar-based psychotherapies is required.
Nonfiction Reading Comprehension in Middle School: Exploring in Interactive Software Approach
Wolff, Evelyn S.; Isecke, Harriet; Rhoads, Christopher; Madura, John P.
2013-01-01
The struggles of students in the United States to comprehend non-fiction science text are well documented. Middle school students, in particular, have minimal instruction in comprehending nonfiction and flounder on assessments. This article describes the development process of the Readorium software, an interactive web-based program being…
Enabling through design : explorations of aesthetic interaction in therapy and care
Marti, P.
2012-01-01
Digital products generally place demands on our cognitive abilities, and deny us the opportunity of building bodily skills (Djajadiningrat et al, 2007). We have a body, we have our senses to dialogue with the environment around us. Why does interaction design not use these skills in a more
Skin: an interactive hyperstereoscopic electro installation
Kostis, Helen-Nicole; Kooima, Robert; Kannenberg, John
2007-02-01
It is the uniqueness of Virtual Reality as a medium that calls for the creation of hybrid realities which blur the finite boundaries between physical and digital existence. Virtual Reality's distinguishing features as an artistic medium embody a distinct form of aesthetics: it is a stereoscopic, immersive, interactive, performative, dynamic, and experiential medium. A Virtual Reality art piece manifests in multiple ways. It can present itself as an interactive virtual archetype, exploring concepts rendered from different perspectives, and as an impetus to challenge the platform's capabilities, not only theoretically as an artistic practice, but also by calling for the instantiation of authoring tools for the development of virtual reality experiences. The paradigm presented in this paper is a Virtual Reality art piece, called skin, 2006, developed on Electro, which is an open-source cross-platform development environment. skin, 2006, is an interactive hypersteroscopic high-definition audiovisual installation that explores a dialogue between physical and digital senses of "touch".
Object texture recognition by dynamic tactile sensing using active exploration
DEFF Research Database (Denmark)
Drimus, Alin; Børlum Petersen, Mikkel; Bilberg, Arne
with a dynamic tactile transducer based on polyvinylidene fluoride (PVDF) piezoelectric film. Different test surfaces are actively explored and the signal from the sensor is used for feature extraction, which is subsequently used for classification. A comparison between the significance of different extracted......For both humans and robots, tactile sensing is important for interaction with the environment: it is the core sensing used for exploration and manipulation of objects. In this paper, we present a method for determining object texture by active exploration with a robotic fingertip equipped...
Meeus, M.T.H.; Oerlemans, L.A.G.; Hage, J.
1999-01-01
This paper pursues the development of a theoretical framework that explains interactive learning between innovating firms and external actors in the knowledge infrastructure and the production chain. The research question is: what kinds of factors explain interactive learning of innovating firms
Jana, Arnab; Harata, Noboru; Kiyoshi, Takami; Ohmori, Nobuaki
2014-01-01
This article explores the phenomenon of companionship as an adaptation strategy to counter the existing barriers to health care access in developing nations. Companionship is argued to be an outcome of "inter" and "intra" household collaboration to offer diverse supports in addition to altruism. The analysis of the household survey conducted in West Bengal, India, exhibited different patterns of health care tours and the associated dependencies. In addition to support in terms of mobility while traveling and companionship while waiting for the opportunity, support in terms of refuge is also found to be essential, especially for the poor while they undertake regional tours. Causal models focusing on aggregated general health tours and specific regional tours were estimated separately to comprehend the implicit social interactions and their effects on the patient as well as the companions. The research demonstrated that accessibility barriers affect not only the ill, but also those associated with them and at times adversely. Segregation of regional tours illustrated the gaps, which instigated such tours and also might aid in health infrastructure planning as a whole.
Shan, Liran Christine; Panagiotopoulos, Panagiotis; Regan, Áine; De Brún, Aoife; Barnett, Julie; Wall, Patrick; McConnon, Áine
2015-01-01
To examine the use and impact of social media on 2-way communication between consumers and public organizations in the food safety and nutrition area. In-depth qualitative study conducted between October, 2012 and January, 2013, using semi-structured interviews in the United Kingdom and Ireland. Sixteen professionals worked on the public interface within 5 national organizations with a role in communicating on food safety and nutrition issues in this thematic analysis. Five main themes were identified: gradual shift toward social media-based queries and complaints; challenges and limitations of social media to deal with queries and complaints; benefits of using social media in query and complaint services; content redesign driven by social media use; and using social media to learn more about consumers. Social media penetrated and brought new opportunities to food organizations' interactions with the public. Given the increasing use of social media by the public, food organizations need to explore such new opportunities for communication and research. Copyright © 2015 Society for Nutrition Education and Behavior. Published by Elsevier Inc. All rights reserved.
SISGR - Hydrogen Caged in Carbon-Exploration of Novel Carbon-Hydrogen Interactions
Energy Technology Data Exchange (ETDEWEB)
Lueking, Angela [Pennsylvania State Univ., State College, PA (United States); Badding, John [Pennsylvania State Univ., State College, PA (United States); Crespi, Vinent [Pennsylvania State Univ., State College, PA (United States)
2015-12-01
Hydrogen trapped in a carbon cage, captured through repulsive interactions, is a novel concept in hydrogen storage. Trapping hydrogen via repulsive interactions borrows an idea from macroscale hydrogen storage (i.e. compressed gas storage tanks) and reapplies these concepts on the nanoscale in specially designed molecular containers. Under extreme conditions of pressure, hydrogen solubility in carbon materials is expected to increase and carbon is expected to restructure to minimize volume via a mixed sp2/sp3 hydrogenated state. Thermodynamics dictate that pre-formed C-H structures will rearrange with increased pressure, yet the final carbon-hydrogen interactions may be dependent upon the mechanism by which hydrogen is introduced. Gas “trapping” is meant to denote gas present in a solid in a high density, adsorbed-like state, when the external pressure is much less than that necessary to provide a comparable fluid density. Trapping thus denotes a kinetically metastable state rather than thermodynamic equilibrium. This project probed mechanochemical means to polymerize select hydrocarbons in the presence of gases, in an attempt to form localized carbon cages that trap gases via repulsive interactions. Aromatic, polyaromatic, and hydroaromatic molecules expected to undergo cyclo-addition reactions were polymerized at high (~GPa) pressures to form extended hydrogenated amorphous carbon networks. Notably, aromatics with a pre-existing internal free volume (such as Triptycene) appeared to retain an internal porosity upon application of pressure. However, a high photoluminescence background after polymerization precluded in situ identification of trapped gases. No spectroscopic evidence was found after depressurization that would be indicative of pockets of trapped gases in a localized high-pressure environment. Control studies suggested this measurement may be insensitive to gases at low pressure. Similarly, no spectral fingerprint was found for gas-imbued spherical
Empowered interaction through creativity
DEFF Research Database (Denmark)
Hasselblad, Stefan; Petersson, Eva; Brooks, Tony
2007-01-01
This paper reflects upon a case study where exploration, play and empowerment in interactive therapy sessions with audio and visual stimuli resulted in achievement, self-esteem and a shared pride between a young adult with profound and multiple learning disabilities (PMLD), his mother and the spe...
Negative Interpersonal Interactions in Student Training Settings
Ferris, Patricia A.; Kline, Theresa J. B.
2009-01-01
Studies demonstrate that negative interpersonal interaction(s) (NII) such as bullying are frequent and harmful to individuals in workplace and higher education student settings. Nevertheless, it is unclear whether the degree of perceived severity of NII varies by the status of the actor. The present study explored the moderating effect of actor…
2nd Workshop on Evaluating Child Robot Interaction
Zaga, Cristina; Lohse, M.; Charisi, Vasiliki; Evers, Vanessa; Neerincx, Marc; Kanda, Takayuki; Leite, Iolanda
Many researchers have started to explore natural interaction scenarios for children. No matter if these children are normally developing or have special needs, evaluating Child-Robot Interaction (CRI) is a challenge. To find methods that work well and provide reliable data is difficult, for example
Multimodal Challenge: Analytics Beyond User-computer Interaction Data
Di Mitri, Daniele; Schneider, Jan; Specht, Marcus; Drachsler, Hendrik
2018-01-01
This contribution describes one the challenges explored in the Fourth LAK Hackathon. This challenge aims at shifting the focus from learning situations which can be easily traced through user-computer interactions data and concentrate more on user-world interactions events, typical of co-located and
Cuhadar, Cem
2012-01-01
The current study investigated the relationship between problematic Internet use and social interaction anxiety among pre-service teachers. Participants were 1235 students attending teacher training programs at a Turkish state university. The "Problematic Internet Use Scale" and "Social Interaction Anxiety Scale" were used to…
Lischner, Ray
2014-01-01
Exploring C++ divides C++ up into bite-sized chunks that will help you learn the language one step at a time. Assuming no familiarity with C++, or any other C-based language, you'll be taught everything you need to know in a logical progression of small lessons that you can work through as quickly or as slowly as you need.C++ can be a complicated language. Writing even the most straight-forward of programs requires you to understand many disparate aspects of the language and how they interact with one another. C++ doesn't lend itself to neat compartmentalization the way other languages do. Rat
Eckhoff, Angela
2013-01-01
In many early childhood classrooms, visual arts experiences occur around a communal arts table. A shared workspace allows for spontaneous conversation and exploration of the art-making process of peers and teachers. In this setting, conversation can play an important role in visual arts experiences as children explore new media, skills, and ideas.…
Ceré, Raphaël; Kaiser, Christian
2015-04-01
models (DEM) or individual building vector layers. Morphological properties can be calculated for different scales using different moving window sizes. Multi-scale measures such as fractal or lacunarity can be integrated into the analysis. Other properties such as different densities and ratios are also easy to calculate and include. Based on a rather extensive set of properties or features, a feature selection or extraction method such as Principal Component Analysis can be used to obtain a subset of relevant properties. In a second step, an unsupervised classification algorithm such as Self-Organizing Maps can be used to group similar locations together, and criteria such as the intra-group distance and geographic distribution can be used for selecting relevant locations to be displayed in an interactive data exploration interface along with a given main location. A case study for a part of Switzerland illustrates the presented approach within a working interactive tool, showing the feasibility and allowing for an investigation of the usefulness of our method.
Exploring Collaborative Learning Effect in Blended Learning Environments
Sun, Z.; Liu, R.; Luo, L.; Wu, M.; Shi, C.
2017-01-01
The use of new technology encouraged exploration of the effectiveness and difference of collaborative learning in blended learning environments. This study investigated the social interactive network of students, level of knowledge building and perception level on usefulness in online and mobile collaborative learning environments in higher…
Visualizing recommendations to support exploration, transparency and controllability
Verbert, K.; Parra, D.; Brusilovsky, P.; Duval, E.
2013-01-01
Research on recommender systems has traditionally focused on the development of algorithms to improve accuracy of recommendations. So far, little research has been done to enable user interaction with such systems as a basis to support exploration and control by end users. In this paper, we present
VIP Data Explorer: A Tool for Exploring 30 years of Vegetation Index and Phenology Observations
Barreto-munoz, A.; Didan, K.; Rivera-Camacho, J.; Yitayew, M.; Miura, T.; Tsend-Ayush, J.
2011-12-01
Continuous acquisition of global satellite imagery over the years has contributed to the creation of long term data records from AVHRR, MODIS, TM, SPOT-VGT and other sensors. These records account for 30+ years, as these archives grow, they become invaluable tools for environmental, resources management, and climate studies dealing with trends and changes from local, regional to global scale. In this project, the Vegetation Index and Phenology Lab (VIPLab) is processing 30 years of daily global surface reflectance data into an Earth Science Data Record of Vegetation Index and Phenology metrics. Data from AVHRR (N07,N09,N11 and N14) and MODIS (AQUA and TERRA collection 5) for the periods 1981-1999 and 2000-2010, at CMG resolution were processed into one seamless and sensor independent data record using various filtering, continuity and gap filling techniques (Tsend-Ayush et al., AGU 2011, Rivera-Camacho et al, AGU 2011). An interactive online tool (VIP Data Explorer) was developed to support the visualization, qualitative and quantitative exploration, distribution, and documentation of these records using a simple web 2.0 interface. The VIP Data explorer (http://vip.arizona.edu/viplab_data_explorer) can display any combination of multi temporal and multi source data, enable the quickly exploration and cross comparison of the various levels of processing of this data. It uses the Google Earth (GE) model and was developed using the GE API for images rendering, manipulation and geolocation. These ESDRs records can be quickly animated in this environment and explored for visual trends and anomalies detection. Additionally the tool enables extracting and visualizing any land pixel time series while showing the different levels of processing it went through. User can explore this ESDR database within this data explorer GUI environment, and any desired data can be placed into a dynamic "cart" to be ordered and downloaded later. More functionalities are planned and will be
Durso, Francis T; Stearman, Eric J; Morrow, Daniel G; Mosier, Kathleen L; Fischer, Ute; Pop, Vlad L; Feigh, Karen M
2015-05-01
We attempted to understand the latent structure underlying the systems pilots use to operate in situations involving human-automation interaction (HAI). HAI is an important characteristic of many modern work situations. Of course, the cognitive subsystems are not immediately apparent by observing a functioning system, but correlations between variables may reveal important relations. The current report examined pilot judgments of 11 HAI dimensions (e.g., Workload, Task Management, Stress/Nervousness, Monitoring Automation, and Cross-Checking Automation) across 48 scenarios that required airline pilots to interact with automation on the flight deck. We found three major clusters of the dimensions identifying subsystems on the flight deck: a workload subsystem, a management subsystem, and an awareness subsystem. Relationships characterized by simple correlations cohered in ways that suggested underlying subsystems consistent with those that had previously been theorized. Understanding the relationship among dimensions affecting HAI is an important aspect in determining how a new piece of automation designed to affect one dimension will affect other dimensions as well. © 2014, Human Factors and Ergonomics Society.
Urban Space Explorer: A Visual Analytics System for Urban Planning.
Karduni, Alireza; Cho, Isaac; Wessel, Ginette; Ribarsky, William; Sauda, Eric; Dou, Wenwen
2017-01-01
Understanding people's behavior is fundamental to many planning professions (including transportation, community development, economic development, and urban design) that rely on data about frequently traveled routes, places, and social and cultural practices. Based on the results of a practitioner survey, the authors designed Urban Space Explorer, a visual analytics system that utilizes mobile social media to enable interactive exploration of public-space-related activity along spatial, temporal, and semantic dimensions.
Affective Dynamics in Triadic Peer Interactions in Early Childhood
Lavictoire, L.A.; Snyder, J.; Stoolmiller, M.; Hollenstein, T.P.
2012-01-01
In interpersonal interaction research, moving beyond dyadic to triadic dynamics can be analytically daunting. We explored the affective states expressed during triadic peer interactions to understand how patterns were associated with childhood psychopathology and sociometric status. High-risk
Using Social Media Sentiment Analysis for Interaction Design Choices
DEFF Research Database (Denmark)
McGuire, Mark; Kampf, Constance Elizabeth
2015-01-01
Social media analytics is an emerging skill for organizations. Currently, developers are exploring ways to create tools for simplifying social media analysis. These tools tend to focus on gathering data, and using systems to make it meaningful. However, we contend that making social media data...... meaningful is by nature a human-computer interaction problem. We examine this problem around the emerging field of sentiment analysis, exploring criteria for designing sentiment analysis systems based in Human Computer interaction, HCI. We contend that effective sentiment analysis affects audience analysis...
Comparing modalities and feedback for peripheral interaction
DEFF Research Database (Denmark)
Hausen, Doris; Wagner, Christine; Boring, Sebastian
2013-01-01
When executing one task on a computer, we are frequently confronted with secondary tasks (e.g., controlling an audio player or changing the IM state) that require shifting our attention away from the actual task, thus increasing our cognitive load. Peripheral interaction aims at reducing...... that cognitive load through the use of the periphery of our attention for interaction. In previous work, token- or tag-based systems alongside wearable and graspable devices were the dominant way of interacting in the periphery. We explore touch and freehand interaction in combination with several forms...
Interaction Forms in Successful Collaborative Learning in Virtual Learning Environments
Vuopala, Essi; Hyvönen, Pirkko; Järvelä, Sanna
2016-01-01
Despite the numerous studies on social interaction in collaborative learning, little is known about interaction forms in successful computer-supported collaborative learning situations. The purpose of this study was to explore and understand student interaction in successful collaborative learning during a university course which was mediated by…
Yin, Hong-biao; Lee, John Chi-Kin
2011-01-01
Compared with the rich exploration of teachers' emotional geographies in the West, there have been only a small number of studies conducted in Chinese societies that have adopted Hargreaves's emotional geographies to analyze human interactions in education. This study explores the nature of emotions felt by teachers during their interactions with…
Qin, Ling; Wang, Chun; Qin, You-Wen; Xie, Kuang-Cheng; Yan, Shi-Ke; Gao, Yan-Rong; Wang, Xiao-Rui; Zhao, Chu-Xian
2008-06-01
This study was aimed to investigate the distribution of abnormal clone in marrow cell lineages and apoptosis cells in myelodysplastic syndrome (MDS) with deletion of chromosome 20q. Monoclonal antibodies recognizing myeloid precursors (CD15), erythroid precursors (GPA), T cells (CD3(+)CD56(-)CD16(-)), B cells (CD19), NK cells (CD3(-)CD56(+)CD16(+)) were used to sort bone marrow cells in a MDS patient with del (20q) by fluorescence activated cell sorting (FACS). Annexin V-FITC and PI were used to sort bone marrow Annexin V(+)PI(-) and Annexin V(-)PI(-) cells by FACS. The sorted positive cells were detected by interphase dual-color fluorescence in situ hybridization (D-FISH) using a LSI D20S108 probe (Spectrum Orange) and a Telvysion TM 20p probe (Spectrum Green). FACS and FISH analysis were also performed on the samples from 4 cases with normal karyotype. The results showed that the proportions of MDS clone in the myeloid and erythroid precursors were 70.50% and 93.33% respectively, in the RAEB-1 patient with del (20q) and were obviously higher than that in control group (5.39% and 6.17%). The proportions of abnormal clone in T, B and NK cells were 3.23%, 4.32% and 5.77% respectively and were less than that in control group (5.76%, 4.85%, 6.36%). The percentage of apoptotic cells in the bone marrow nucleated cells was 16.09%. The proportions of MDS clone in Annexin V(+)PI(-) and Annexin V(-)PI(-) cells were 32.48% and 70.11%, respectively. It is concluded that most myeloid and erythroid precursors are originated from the abnormal clone in MDS with del (20q). A little part of apoptotic cells are derived from the abnormal clone.
Multiactivity in Social Interaction
DEFF Research Database (Denmark)
Doing more than one thing at the same time – a phenomenon that is often called ‘multitasking’ – is characteristic to many situations in everyday and professional life. Although we all experience it, its real time features remain understudied. Multiactivity in Social Interaction: Beyond multitasking...... offers a fresh view to the phenomenon by presenting studies that explore how two or more activities can be related and made co-relevant as people interact with one another. The studies build on the basis that multiactivity is a social, verbal and embodied phenomenon. They investigate multiactivity...... by using video recordings of real-life interactions from a range of different contexts, such as medical settings, office workplaces and car driving. With the companion collection Interacting with Objects: Language, materiality, and social activity, the book advances understanding of the complex...
Communicative interactions involving plants: information, evolution, and ecology.
Mescher, Mark C; Pearse, Ian S
2016-08-01
The role of information obtained via sensory cues and signals in mediating the interactions of organisms with their biotic and abiotic environments has been a major focus of work on sensory and behavioral ecology. Information-mediated interactions also have important implications for broader ecological patterns emerging at the community and ecosystem levels that are only now beginning to be explored. Given the extent to which plants dominate the sensory landscapes of terrestrial ecosystems, information-mediated interactions involving plants should be a major focus of efforts to elucidate these broader patterns. Here we explore how such efforts might be enhanced by a clear understanding of information itself-a central and potentially unifying concept in biology that has nevertheless been the subject of considerable confusion-and of its relationship to adaptive evolution and ecology. We suggest that information-mediated interactions should be a key focus of efforts to more fully integrate evolutionary biology and ecology. Copyright © 2016 Elsevier Ltd. All rights reserved.
Cross-cultural differences in emotion suppression in everyday interactions
Huwae, Sylvia; Schaafsma, Juliëtte
Previous research suggests that in collectivistic cultures, people tend to suppress their emotions more than in individualistic cultures. Little research, however, has explored cross-cultural differences in emotion regulation in everyday interactions. Using a daily social interaction method, we
Exploring hierarchical and overlapping modular structure in the yeast protein interaction network
Directory of Open Access Journals (Sweden)
Zhao Yi
2010-12-01
Full Text Available Abstract Background Developing effective strategies to reveal modular structures in protein interaction networks is crucial for better understanding of molecular mechanisms of underlying biological processes. In this paper, we propose a new density-based algorithm (ADHOC for clustering vertices of a protein interaction network using a novel subgraph density measurement. Results By statistically evaluating several independent criteria, we found that ADHOC could significantly improve the outcome as compared with five previously reported density-dependent methods. We further applied ADHOC to investigate the hierarchical and overlapping modular structure in the yeast PPI network. Our method could effectively detect both protein modules and the overlaps between them, and thus greatly promote the precise prediction of protein functions. Moreover, by further assaying the intermodule layer of the yeast PPI network, we classified hubs into two types, module hubs and inter-module hubs. Each type presents distinct characteristics both in network topology and biological functions, which could conduce to the better understanding of relationship between network architecture and biological implications. Conclusions Our proposed algorithm based on the novel subgraph density measurement makes it possible to more precisely detect hierarchical and overlapping modular structures in protein interaction networks. In addition, our method also shows a strong robustness against the noise in network, which is quite critical for analyzing such a high noise network.
Engineering light-matter interaction for emerging optical manipulation applications
DEFF Research Database (Denmark)
Qiu, Cheng-Wei; Palima, Darwin; Novitsky, Andrey
2014-01-01
In this review, we explore recent trends in optical micromanipulation by engineering light-matter interaction and controlling the mechanical effects of optical fields. One central theme is exploring the rich phenomena beyond the now established precision measurements based on trapping micro beads...
Shao, Xin; Ai, Ni; Xu, Donghang; Fan, Xiaohui
2016-05-01
Human serum albumin (HSA) binding is one of important pharmacokinetic properties of drug, which is closely related to in vivo distribution and may ultimately influence its clinical efficacy. Compared to conventional drug, limited information on this transportation process is available for medicinal herbs, which significantly hampers our understanding on their pharmacological effects, particularly when herbs and drug are co-administrated as polytherapy to the ailment. Several lines of evidence suggest the existence of Salvia miltiorrhiza-Warfarin interaction. Since Warfarin is highly HSA bound in the plasma with selectivity to site I, it is critical to evaluate the possibility of HSA-related herb-drug interaction. Herein an integrated approach was employed to analyze the binding of chemicals identified in S. miltiorrhiza to HSA. Molecular docking simulations revealed filtering criteria for HSA site I compounds that include docking score and key molecular determinants for binding. For eight representative ingredients from the herb, their affinity and specificity to HSA site I was measured and confirmed fluorometrically, which helps to improve the knowledge of interaction mechanisms between this herb and HSA. Our results indicated that several compounds in S. miltiorrhiza were capable of decreasing the binding constant of Warfarin to HSA site I significantly, which may increase free drug concentration in vivo, contributing to the herb-drug interaction observed clinically. Furthermore, the significance of HSA mediated herb-drug interactions was further implied by manual mining on the published literatures on S. miltiorrhiza.
Synergistic Interactions in Multispecies Biofilms
DEFF Research Database (Denmark)
Ren, Dawei
The coexistence of hugely diverse microbes in most environments highlights the intricate interactions in microbial communities, which are central to their properties, such as productivity, stability and the resilience to disturbance. Biofilm, in environmental habitats, is such a spatially...... multispecies biofilm models, oral microbial community, also known as “dental plaque” is thoroughly investigated as a focal point to describe the interspecies interactions [1]. However, owing to the lack of a reliable high throughput and quantitative approach for exploring the interplay between multiple...... bacterial species, the study to elucidate the impact of interaction networks on the multispecies biofilms in natural ecosystems, especially in soil, is still at an early stage. The diverse patterns of interactions within the mixed communities as well as the predatorprey relationship between protozoa...
Person, Situational, and Interactional Influences on Assertive Behavior.
Kirschner, Stuart M.; Galassi, John P.
1983-01-01
Explored the validity of the College Self-Expression Scale (CSES) for 144 students in the context of three alternative models of behavior--personism, situationalism, and interactionalism. Results supported the concurrent validity of the CSES and the role of both person and situational, but not interactional, influences on assertion. (WAS)
NASA's Solar System Exploration Research Virtual Institute: Merging Science and Exploration
Pendleton, Y. J.; Schmidt, G. K.; Bailey, B. E.; Minafra, J. A.
2016-01-01
NASA's Solar System Exploration Research Virtual Institute (SSERVI) represents a close collaboration between science, technology and exploration, and was created to enable a deeper understanding of the Moon and other airless bodies. SSERVI is supported jointly by NASA's Science Mission Directorate and Human Exploration and Operations Mission Directorate. The institute currently focuses on the scientific aspects of exploration as they pertain to the Moon, Near Earth Asteroids (NEAs) and the moons of Mars, but the institute goals may expand, depending on NASA's needs, in the future. The 9 initial teams, selected in late 2013 and funded from 2014-2019, have expertise across the broad spectrum of lunar, NEA, and Martian moon sciences. Their research includes various aspects of the surface, interior, exosphere, near-space environments, and dynamics of these bodies. NASA anticipates a small number of additional teams to be selected within the next two years, with a Cooperative Agreement Notice (CAN) likely to be released in 2016. Calls for proposals are issued every 2-3 years to allow overlap between generations of institute teams, but the intent for each team is to provide a stable base of funding for a five year period. SSERVI's mission includes acting as a bridge between several groups, joining together researchers from: 1) scientific and exploration communities, 2) multiple disciplines across a wide range of planetary sciences, and 3) domestic and international communities and partnerships. The SSERVI central office is located at NASA Ames Research Center in Mountain View, CA. The administrative staff at the central office forms the organizational hub for the domestic and international teams and enables the virtual collaborative environment. Interactions with geographically dispersed teams across the U.S., and global partners, occur easily and frequently in a collaborative virtual environment. This poster will provide an overview of the 9 current US teams and
Interactive Simulations of Biohybrid Systems
Directory of Open Access Journals (Sweden)
Sebastian Albrecht von Mammen
2017-10-01
Full Text Available In this article, we present approaches to interactive simulations of biohybrid systems. These simulations are comprised of two major computational components: (1 agent-based developmental models that retrace organismal growth and unfolding of technical scaffoldings and (2 interfaces to explore these models interactively. Simulations of biohybrid systems allow us to fast forward and experience their evolution over time based on our design decisions involving the choice, configuration and initial states of the deployed biological and robotic actors as well as their interplay with the environment. We briefly introduce the concept of swarm grammars, an agent-based extension of L-systems for retracing growth processes and structural artifacts. Next, we review an early augmented reality prototype for designing and projecting biohybrid system simulations into real space. In addition to models that retrace plant behaviors, we specify swarm grammar agents to braid structures in a self-organizing manner. Based on this model, both robotic and plant-driven braiding processes can be experienced and explored in virtual worlds. We present an according user interface for use in virtual reality. As we present interactive models concerning rather diverse description levels, we only ensured their principal capacity for interaction but did not consider efficiency analyzes beyond prototypic operation. We conclude this article with an outlook on future works on melding reality and virtuality to drive the design and deployment of biohybrid systems.
Feature Usage Explorer: Usage Monitoring and Visualization Tool in HTML5 Based Applications
Directory of Open Access Journals (Sweden)
Sarunas Marciuska
2013-10-01
Full Text Available Feature Usage Explorer is a JavaScript library, which automatically detects features in HTML5 based applications and monitors their usage. The collected information can be visualized in a Feature Usage Diagram, which is automatically generated from an input json file. Currently, the users of Feature Usage Explorer have to design their own tool in order to generate the json file from collected usage information. This option remains viable when using the library in order not to constraint the user’s choice of preferred data storage. Feature Usage Explorer can be reused in any HTML5 based applications where an understanding of how users interact with the system is required (i.e. user experience and usability studies, human computer interaction field, or requirement prioritization area.
Klep, Annefloor; Wisse, Barbara; Van Der Flier, Henk
This study explores whether the dynamic path to group affect, which is characterized by interactive affective sharing processes, yields different effects on task performance and group dynamics than the static path to group affect, which arises from non-interactive affective sharing. The results of
Klep, A.H.M.; Wisse, B.M.; van der Flier, H.
2011-01-01
This study explores whether the dynamic path to group affect, which is characterized by interactive affective sharing processes, yields different effects on task performance and group dynamics than the static path to group affect, which arises from non-interactive affective sharing. The results of
Ergonomics-inspired Reshaping and Exploration of Collections of Models
Zheng, Youyi
2015-06-22
This paper examines the following question: given a collection of man-made shapes, e.g., chairs, can we effectively explore and rank the shapes with respect to a given human body – in terms of how well a candidate shape fits the specified human body? Answering this question requires identifying which shapes are more suitable for a prescribed body, and how to alter the input geometry to better fit the shapes to a given human body. The problem links physical proportions of the human body and its interaction with object geometry, which is often expressed as ergonomics guidelines. We present an interactive system that allows users to explore shapes using different avatar poses, while, at the same time providing interactive previews of how to alter the shapes to fit the user-specified body and pose. We achieve this by first constructing a fuzzy shape-to-body map from the ergonomic guidelines to multi-contacts geometric constraints; and then, proposing a novel contact-preserving deformation paradigm to realize a reshaping to adapt the input shape. We evaluate our method on collections of models from different categories and validate the results through a user study.
Paper mechanisms for sonic interaction
DEFF Research Database (Denmark)
Delle Monache, Stefano; Rocchesso, Davide; Qi, Ji
2012-01-01
Introducing continuous sonic interaction in augmented pop-up books enhances the expressive and performative qualities of movables, making the whole narrative experience more engaging and personal. The SaMPL Spring School on Sounding Popables explored the specific topic of paper-driven sonic...
Diversity in Action | Interactive Workshop | 4 July
2013-01-01
Come and take part in an interactive workshop organised by the CERN Diversity Programme designed to creatively explore the meaning of diversity and share your experience of working with differences at CERN. Thursday 4 July 2013 – 1.30 p.m. - 5.30 p.m. Pump Hall - Building 216-R-401 "Diversity in Action" is an interactive half-day workshop designed to creatively explore the meaning and importance of diversity at CERN, in support of the Organization’s value of “appreciating differences, fostering equality and promoting collaboration”. Using participative multi-media methods, this innovative workshop will provide participants with insights into diversity, help them to develop greater sensitivity to differences, explore ways to recognise and overcome biases and thereby strengthen our tradition of inclusiveness at CERN. Alan Richter, Ph. D., is the president of QED Consulting, a 25-year-old company based in New York. He has consulted to org...
Abou-Elsaad, Tamer; Baz, Hemmat; Afsah, Omayma; Mansy, Alzahraa
2015-09-01
Even with early surgical repair, the majority of cleft palate children demonstrate articulation errors and have typical cleft palate speech. Was to determine the nature of articulation errors of Arabic consonants in Egyptian Arabic-speaking children with velopharyngeal insufficiency (VPI). Thirty Egyptian Arabic-speaking children with VPI due to cleft palate (whether primary repaired or secondary repaired) were studied. Auditory perceptual assessment (APA) of children speech was conducted. Nasopharyngoscopy was done to assess the velopharyngeal port (VPP) movements while the child was repeating speech tasks. Mansoura Arabic Articulation test (MAAT) was performed to analyze the consonants articulation of these children. The most frequent type of articulatory errors observed was substitution, more specifically, backing. Pharyngealization of anterior fricatives was the most frequent substitution, especially for the /s/ sound. The most frequent substituting sounds for other sounds were /ʔ/ followed by /k/ and /n/ sounds. Significant correlations were found between the degrees of the open nasality and VPP closure and the articulation errors. On the other hand, the sounds (/ʔ/,/ħ/,/ʕ/,/n/,/w/,/j/) were normally articulated in all studied group. The determination of articulation errors in VPI children could guide the therapists for designing appropriate speech therapy programs for these cases. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.
Data Input and Content Exploration in Scenarios with Restrictions
D.C. Pedrosa
2014-01-01
htmlabstractAs technology evolves, new devices and interaction techniques are developed. These transformations create several challenges in terms of usability and user experience. Our research faces some challenges for data input or content exploration in scenarios with restrictions. It is not our
Mayer, L. A.; Calder, B.; Schmidt, J. S.
2003-12-01
Historically, archaeological investigations use sidescan sonar and marine magnetometers as initial search tools. Targets are then examined through direct observation by divers, video, or photographs. Magnetometers can demonstrate the presence, absence, and relative susceptibility of ferrous objects but provide little indication of the nature of the target. Sidescan sonar can present a clear image of the overall nature of a target and its surrounding environment, but the sidescan image is often distorted and contains little information about the true 3-D shape of the object. Optical techniques allow precise identification of objects but suffer from very limited range, even in the best of situations. Modern high-resolution multibeam sonar offers an opportunity to cover a relatively large area from a safe distance above the target, while resolving the true three-dimensional (3-D) shape of the object with centimeter-level resolution. The combination of 3-D mapping and interactive 3-D visualization techniques provides a powerful new means to explore underwater artifacts. A clear demonstration of the applicability of high-resolution multibeam sonar to wreck and artifact investigations occurred when the Naval Historical Center (NHC), the Center for Coastal and Ocean Mapping (CCOM) at the University of New Hampshire, and Reson Inc., collaborated to explore the state of preservation and impact on the surrounding environment of a series of wrecks located off the coast of Normandy, France, adjacent to the American landing sectors The survey augmented previously collected magnetometer and high-resolution sidescan sonar data using a Reson 8125 high-resolution focused multibeam sonar with 240, 0.5° (at nadir) beams distributed over a 120° swath. The team investigated 21 areas in water depths ranging from about three -to 30 meters (m); some areas contained individual targets such as landing craft, barges, a destroyer, troop carrier, etc., while others contained multiple smaller
A method for aircraft concept exploration using multicriteria interactive genetic algorithms
Buonanno, Michael Alexander
2005-08-01
The problem of aircraft concept selection has become increasingly difficult in recent years due to changes in the primary evaluation criteria of concepts. In the past, performance was often the primary discriminator, whereas modern programs have placed increased emphasis on factors such as environmental impact, economics, supportability, aesthetics, and other metrics. The revolutionary nature of the vehicles required to simultaneously meet these conflicting requirements has prompted a shift from design using historical data regression techniques for metric prediction to the use of sophisticated physics-based analysis tools that are capable of analyzing designs outside of the historical database. The use of optimization methods with these physics-based tools, however, has proven difficult because of the tendency of optimizers to exploit assumptions present in the models and drive the design towards a solution which, while promising to the computer, may be infeasible due to factors not considered by the computer codes. In addition to this difficulty, the number of discrete options available at this stage may be unmanageable due to the combinatorial nature of the concept selection problem, leading the analyst to select a sub-optimum baseline vehicle. Some extremely important concept decisions, such as the type of control surface arrangement to use, are frequently made without sufficient understanding of their impact on the important system metrics due to a lack of historical guidance, computational resources, or analysis tools. This thesis discusses the difficulties associated with revolutionary system design, and introduces several new techniques designed to remedy them. First, an interactive design method has been developed that allows the designer to provide feedback to a numerical optimization algorithm during runtime, thereby preventing the optimizer from exploiting weaknesses in the analytical model. This method can be used to account for subjective criteria, or
RJSplot: Interactive Graphs with R.
Barrios, David; Prieto, Carlos
2018-03-01
Data visualization techniques provide new methods for the generation of interactive graphs. These graphs allow a better exploration and interpretation of data but their creation requires advanced knowledge of graphical libraries. Recent packages have enabled the integration of interactive graphs in R. However, R provides limited graphical packages that allow the generation of interactive graphs for computational biology applications. The present project has joined the analytical power of R with the interactive graphical features of JavaScript in a new R package (RJSplot). It enables the easy generation of interactive graphs in R, provides new visualization capabilities, and contributes to the advance of computational biology analytical methods. At present, 16 interactive graphics are available in RJSplot, such as the genome viewer, Manhattan plots, 3D plots, heatmaps, dendrograms, networks, and so on. The RJSplot package is freely available online at http://rjsplot.net. © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
A Situation Awareness Assistant for Human Deep Space Exploration
Boy, Guy A.; Platt, Donald
2013-01-01
This paper presents the development and testing of a Virtual Camera (VC) system to improve astronaut and mission operations situation awareness while exploring other planetary bodies. In this embodiment, the VC is implemented using a tablet-based computer system to navigate through inter active database application. It is claimed that the advanced interaction media capability of the VC can improve situation awareness as the distribution of hu man space exploration roles change in deep space exploration. The VC is being developed and tested for usability and capability to improve situation awareness. Work completed thus far as well as what is needed to complete the project will be described. Planned testing will also be described.
International Nuclear Information System (INIS)
Wang Gangbo; Guan Jiancheng
2011-01-01
This article contributes to the growing study on the interactions between science and technology with China’s evidence in the field of nanotechnology, based on the database of United States Patent and Trademark Office. The analysis is focused during the period of 1991–2008, a rapid increasing period for the development of nanotechnology. Using the non-patent references cited by patents, we first investigate the science–technology connections in the context of Chinese nanotechnology, especially in institutional sectors and its application fields. Those patents, produced by academic researchers and directed towards basic scientific knowledge, generally cite more scientific references with a higher proportion of self-citations. It is interesting to find that patents contributed by collaborations between public organizations and corporations seldom contain scientific references. Following an interesting path on matching the data of publications and patents, we establish the author-inventor links in this emerging field. Author-inventors, who are co-active in publishing and patenting, are at the very top of the most prolific and highly cited researchers. Finally, we employ social network analysis to explore the characteristics of scientific and technological networks generated by co-authorship and co-invention data, to investigate the position and the role of patenting–publishing scientists in these research networks.
Fluxacademy: From Intermedia to Interactive Education.
Saper, Craig
1992-01-01
Advocates a Fluxus-based experimental pedagogy which is suited for scholarship confronted with film and electronic media. Notes that the theory explored in Fluxacademy focuses specifically on the use of intermedia for interactive education. (RS)
The Cognitive Neuroscience of the Teacher-Student Interaction
Battro, Antonio M.; Calero, Cecilia I.; Goldin, Andrea P.; Holper, Lisa; Pezzatti, Laura; Shalóm, Diego E.; Sigman, Mariano
2013-01-01
Pedagogy is the science and art of teaching. Each generation needs to explore the history, theory, and practice of the teacher-student interaction. Here we pave the path to develop a science that explores the cognitive and physiological processes involved in the human capacity to communicate knowledge through teaching. We review examples from our…
Exploring Media Convergence: Evidence from Italy
Directory of Open Access Journals (Sweden)
Debora Bettiga
2013-12-01
Full Text Available The evolution of media and devices is enabling the ubiquitous and multi-device access to media and information, so that a media mutual contamination is in play. New forms of user interactions with media, in which different devices are used simultaneously in different contexts, have emerged. These new interactions are significantly impacting on users’ attitudes towards the media and their way of searching and generating content. Such a change, called “media convergence”, has a strong potential impact on marketing and communication processes, but as yet has not been deeply analysed in the literature. This paper presents the outcomes of several studies aimed at exploring media convergence on the demand-side to advance possible implications for marketers and managers.
Designing for social interaction in open-ended play environments
de Valk, L.; Bekker, T.; Eggen, J.H.
2015-01-01
Interactive technology is becoming more strongly integrated in innovative play solutions. As play is often a social experience, understanding the dynamic social context in which such play takes place is an essential step in designing new interactive play environments. In this paper, we explore the
Weiland, C.; Chadwick, W. W.; Hanshumaker, W.; Osis, V.; Hamilton, C.
2002-12-01
We have created a new interactive exhibit in which the user can sit down and simulate that they are making a dive to the seafloor with the remotely operated vehicle (ROV) named ROPOS. The exhibit immerses the user in an interactive experience that is naturally fun but also educational. This new public display is located at the Hatfield Marine Science Visitor Center in Newport, Oregon. The exhibit is designed to look like the real ROPOS control console and includes three video monitors, a PC, a DVD player, an overhead speaker, graphic panels, buttons, lights, dials, and a seat in front of a joystick. The dives are based on real seafloor settings at Axial seamount, an active submarine volcano on the Juan de Fuca Ridge (NE Pacific) that is also the location of a seafloor observatory called NeMO. The user can choose between 1 of 3 different dives sites in the caldera of Axial Volcano. Once a dive is chosen, then the user watches ROPOS being deployed and then arrives into a 3-D computer-generated seafloor environment that is based on the real world but is easier to visualize and navigate. Once on the bottom, the user is placed within a 360 degree panorama and can look in all directions by manipulating the joystick. By clicking on markers embedded in the scene, the user can then either move to other panorama locations via movies that travel through the 3-D virtual environment, or they can play video clips from actual ROPOS dives specifically related to that scene. Audio accompanying the video clips informs the user where they are going or what they are looking at. After the user is finished exploring the dive site they end the dive by leaving the bottom and watching the ROV being recovered onto the ship at the surface. The user can then choose a different dive or make the same dive again. Within the three simulated dives there are a total of 6 arrival and departure movies, 7 seafloor panoramas, 12 travel movies, and 23 ROPOS video clips. The exhibit software was created
The Impact of Social Interaction on Student Learning
Hurst, Beth; Wallace, Randall; Nixon, Sarah B.
2013-01-01
Due to the lack of student engagement in the common lecture-centered model, we explored a model of instructional delivery where our undergraduate and graduate classes were structured so that students had opportunities for daily interaction with each other. Specifically, we examined how students perceived the value of social interaction on their…
Zhang, Qi; Alexander, Murray; Ryner, Lawrence
2013-01-01
Efficient software with the ability to display multiple neurological image datasets simultaneously with full real-time interactivity is critical for brain disease diagnosis and image-guided planning. In this paper, we describe the creation and function of a new comprehensive software platform that integrates novel algorithms and functions for multiple medical image visualization, processing, and manipulation. We implement an opacity-adjustment algorithm to build 2D lookup tables for multiple slice image display and fusion, which achieves a better visual result than those of using VTK-based methods. We also develop a new real-time 2D and 3D data synchronization scheme for multi-function MR volume and slice image optical mapping and rendering simultaneously through using the same adjustment operation. All these methodologies are integrated into our software framework to provide users with an efficient tool for flexibly, intuitively, and rapidly exploring and analyzing the functional and anatomical MR neurological data. Finally, we validate our new techniques and software platform with visual analysis and task-specific user studies. Copyright © 2013 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Anna Einarsson
2017-09-01
Full Text Available The question motivating the work presented here, starting from a view of music as embodied and situated activity, is how can we account for the complexity of interactive music performance situations. These are situations in which human performers interact with responsive technologies, such as sensor-driven technology or sound synthesis affected by analysis of the performed sound signal. This requires investigating in detail the underlying mechanisms, but also providing a more holistic approach that does not lose track of the complex whole constituted by the interactions and relationships of composers, performers, audience, technologies, etc. The concept of affordances has frequently been invoked in musical research, which has seen a “bodily turn” in recent years, similar to the development of the embodied cognition approach in the cognitive sciences. We therefore begin by broadly delineating its usage in the cognitive sciences in general, and in music research in particular. We argue that what is still missing in the discourse on musical affordances is an encompassing theoretical framework incorporating the sociocultural dimensions that are fundamental to the situatedness and embodiment of interactive music performance and composition. We further argue that the cultural affordances framework, proposed by Rietveld and Kiverstein (2014 and recently articulated further by Ramstead et al. (2016 in this journal, although not previously applied to music, constitutes a promising starting point. It captures and elucidates this complex web of relationships in terms of shared landscapes and individual fields of affordances. We illustrate this with examples foremost from the first author's artistic work as composer and performer of interactive music. This sheds new light on musical composition as a process of construction—and embodied mental simulation—of situations, guiding the performers' and audience's attention in shifting fields of affordances
Einarsson, Anna; Ziemke, Tom
2017-01-01
The question motivating the work presented here, starting from a view of music as embodied and situated activity, is how can we account for the complexity of interactive music performance situations. These are situations in which human performers interact with responsive technologies, such as sensor-driven technology or sound synthesis affected by analysis of the performed sound signal. This requires investigating in detail the underlying mechanisms, but also providing a more holistic approach that does not lose track of the complex whole constituted by the interactions and relationships of composers, performers, audience, technologies, etc. The concept of affordances has frequently been invoked in musical research, which has seen a " bodily turn " in recent years, similar to the development of the embodied cognition approach in the cognitive sciences. We therefore begin by broadly delineating its usage in the cognitive sciences in general, and in music research in particular. We argue that what is still missing in the discourse on musical affordances is an encompassing theoretical framework incorporating the sociocultural dimensions that are fundamental to the situatedness and embodiment of interactive music performance and composition. We further argue that the cultural affordances framework, proposed by Rietveld and Kiverstein (2014) and recently articulated further by Ramstead et al. (2016) in this journal, although not previously applied to music, constitutes a promising starting point. It captures and elucidates this complex web of relationships in terms of shared landscapes and individual fields of affordances. We illustrate this with examples foremost from the first author's artistic work as composer and performer of interactive music. This sheds new light on musical composition as a process of construction-and embodied mental simulation-of situations, guiding the performers' and audience's attention in shifting fields of affordances. More generally, we
Hellström, Daniel
2007-01-01
Packaging is a fundamental element in logistics systems. Packaging not only affects every logistical activity; it is also recognised as having a significant impact on logistics costs and performance. In order for logisticians and packaging professionals to gain insight into packaging-dependent costs and performance, the interactions between packaging systems and logistics systems must be understood. This is instead of dividing packaging and logistics into separate systems which are analysed o...
Semantic Interaction for Sensemaking: Inferring Analytical Reasoning for Model Steering.
Endert, A; Fiaux, P; North, C
2012-12-01
Visual analytic tools aim to support the cognitively demanding task of sensemaking. Their success often depends on the ability to leverage capabilities of mathematical models, visualization, and human intuition through flexible, usable, and expressive interactions. Spatially clustering data is one effective metaphor for users to explore similarity and relationships between information, adjusting the weighting of dimensions or characteristics of the dataset to observe the change in the spatial layout. Semantic interaction is an approach to user interaction in such spatializations that couples these parametric modifications of the clustering model with users' analytic operations on the data (e.g., direct document movement in the spatialization, highlighting text, search, etc.). In this paper, we present results of a user study exploring the ability of semantic interaction in a visual analytic prototype, ForceSPIRE, to support sensemaking. We found that semantic interaction captures the analytical reasoning of the user through keyword weighting, and aids the user in co-creating a spatialization based on the user's reasoning and intuition.
The DIMA web resource--exploring the protein domain network.
Pagel, Philipp; Oesterheld, Matthias; Stümpflen, Volker; Frishman, Dmitrij
2006-04-15
Conserved domains represent essential building blocks of most known proteins. Owing to their role as modular components carrying out specific functions they form a network based both on functional relations and direct physical interactions. We have previously shown that domain interaction networks provide substantially novel information with respect to networks built on full-length protein chains. In this work we present a comprehensive web resource for exploring the Domain Interaction MAp (DIMA), interactively. The tool aims at integration of multiple data sources and prediction techniques, two of which have been implemented so far: domain phylogenetic profiling and experimentally demonstrated domain contacts from known three-dimensional structures. A powerful yet simple user interface enables the user to compute, visualize, navigate and download domain networks based on specific search criteria. http://mips.gsf.de/genre/proj/dima
Interactive visual exploration and refinement of cluster assignments.
Kern, Michael; Lex, Alexander; Gehlenborg, Nils; Johnson, Chris R
2017-09-12
With ever-increasing amounts of data produced in biology research, scientists are in need of efficient data analysis methods. Cluster analysis, combined with visualization of the results, is one such method that can be used to make sense of large data volumes. At the same time, cluster analysis is known to be imperfect and depends on the choice of algorithms, parameters, and distance measures. Most clustering algorithms don't properly account for ambiguity in the source data, as records are often assigned to discrete clusters, even if an assignment is unclear. While there are metrics and visualization techniques that allow analysts to compare clusterings or to judge cluster quality, there is no comprehensive method that allows analysts to evaluate, compare, and refine cluster assignments based on the source data, derived scores, and contextual data. In this paper, we introduce a method that explicitly visualizes the quality of cluster assignments, allows comparisons of clustering results and enables analysts to manually curate and refine cluster assignments. Our methods are applicable to matrix data clustered with partitional, hierarchical, and fuzzy clustering algorithms. Furthermore, we enable analysts to explore clustering results in context of other data, for example, to observe whether a clustering of genomic data results in a meaningful differentiation in phenotypes. Our methods are integrated into Caleydo StratomeX, a popular, web-based, disease subtype analysis tool. We show in a usage scenario that our approach can reveal ambiguities in cluster assignments and produce improved clusterings that better differentiate genotypes and phenotypes.
A tool for exploring space-time patterns : an animation user research
Directory of Open Access Journals (Sweden)
Ogao Patrick J
2006-08-01
Full Text Available Abstract Background Ever since Dr. John Snow (1813–1854 used a case map to identify water well as the source of a cholera outbreak in London in the 1800s, the use of spatio-temporal maps have become vital tools in a wide range of disease mapping and control initiatives. The increasing use of spatio-temporal maps in these life-threatening sectors warrants that they are accurate, and easy to interpret to enable prompt decision making by health experts. Similar spatio-temporal maps are observed in urban growth and census mapping – all critical aspects a of a country's socio-economic development. In this paper, a user test research was carried out to determine the effectiveness of spatio-temporal maps (animation in exploring geospatial structures encompassing disease, urban and census mapping. Results Three types of animation were used, namely; passive, interactive and inference-based animation, with the key differences between them being on the level of interactivity and complementary domain knowledge that each offers to the user. Passive animation maintains the view only status. The user has no control over its contents and dynamic variables. Interactive animation provides users with the basic media player controls, navigation and orientation tools. Inference-based animation incorporates these interactive capabilities together with a complementary automated intelligent view that alerts users to interesting patterns, trends or anomalies that may be inherent in the data sets. The test focussed on the role of animation passive and interactive capabilities in exploring space-time patterns by engaging test-subjects in thinking aloud evaluation protocol. The test subjects were selected from a geoinformatics (map reading, interpretation and analysis abilities background. Every test-subject used each of the three types of animation and their performances for each session assessed. The results show that interactivity in animation is a preferred
A tool for exploring space-time patterns: an animation user research.
Ogao, Patrick J
2006-08-29
Ever since Dr. John Snow (1813-1854) used a case map to identify water well as the source of a cholera outbreak in London in the 1800s, the use of spatio-temporal maps have become vital tools in a wide range of disease mapping and control initiatives. The increasing use of spatio-temporal maps in these life-threatening sectors warrants that they are accurate, and easy to interpret to enable prompt decision making by health experts. Similar spatio-temporal maps are observed in urban growth and census mapping--all critical aspects a of a country's socio-economic development. In this paper, a user test research was carried out to determine the effectiveness of spatio-temporal maps (animation) in exploring geospatial structures encompassing disease, urban and census mapping. Three types of animation were used, namely; passive, interactive and inference-based animation, with the key differences between them being on the level of interactivity and complementary domain knowledge that each offers to the user. Passive animation maintains the view only status. The user has no control over its contents and dynamic variables. Interactive animation provides users with the basic media player controls, navigation and orientation tools. Inference-based animation incorporates these interactive capabilities together with a complementary automated intelligent view that alerts users to interesting patterns, trends or anomalies that may be inherent in the data sets. The test focussed on the role of animation passive and interactive capabilities in exploring space-time patterns by engaging test-subjects in thinking aloud evaluation protocol. The test subjects were selected from a geoinformatics (map reading, interpretation and analysis abilities) background. Every test-subject used each of the three types of animation and their performances for each session assessed. The results show that interactivity in animation is a preferred exploratory tool in identifying, interpreting and
ORF Alignment: NC_004663 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available roides ... thetaiotaomicron VPI-5482] ... Length = 129 ... Query: 21 ... VIVDATDQTLGRLGAKVAKLLRGKYKPNFTPHVDC...GDNVIIINADKVKLTGNKWNDRVYL 80 ... VIVDATDQTLGRLGAKVAKLLRGKYKPNFTPHVDC...GDNVIIINADKVKLTGNKWNDRVYL Sbjct: 1 ... VIVDATDQTLGRLGAKVAKLLRGKYKPNFTPHVDCGDNVIIINADKVKLTGNKWNDRVYL 60 ... Query: 141 AQSPKMIDI 149 ... AQSPKMIDI Sbjct: 121 AQSPKMIDI 129
Towards Ways to Promote Interaction in Digital Learning Spaces
Olsson , Hanna ,
2012-01-01
Part 7: Doctoral Student Papers; International audience; Social learning is dependent on social interactions. I am exploring ways to promote interaction in Digital Learning Spaces. As theoretical framework I use the types of interaction between learner, instructor and content. That learners feel isolated and lonely in DLSs is a problem which comes at high cost for social learning. My aim is to promote social interaction by offering the edentity: a system for making participants visible to eac...
Trends in interactive visualization state-of-the-art survey
Wu, Xindong
2008-01-01
The purpose of Interactive Visualization is to develop scientific methods to increase scientists'' abilities to explore data and to understand better the results of experiments based on extensive calculations. This book provides readers with insight in Interactive Visualization from various perspectives, representing the developments in the field.
Fable: Socially Interactive Modular Robot
DEFF Research Database (Denmark)
Magnússon, Arnþór; Pacheco, Moises; Moghadam, Mikael
2013-01-01
Modular robots have a significant potential as user-reconfigurable robotic playware, but often lack sufficient sensing for social interaction. We address this issue with the Fable modular robotic system by exploring the use of smart sensor modules that has a better ability to sense the behavior...
Structure of local interactions in complex financial dynamics.
Jiang, X F; Chen, T T; Zheng, B
2014-06-17
With the network methods and random matrix theory, we investigate the interaction structure of communities in financial markets. In particular, based on the random matrix decomposition, we clarify that the local interactions between the business sectors (subsectors) are mainly contained in the sector mode. In the sector mode, the average correlation inside the sectors is positive, while that between the sectors is negative. Further, we explore the time evolution of the interaction structure of the business sectors, and observe that the local interaction structure changes dramatically during a financial bubble or crisis.
Soto, Axel J; Zerva, Chrysoula; Batista-Navarro, Riza; Ananiadou, Sophia
2018-04-15
Pathway models are valuable resources that help us understand the various mechanisms underpinning complex biological processes. Their curation is typically carried out through manual inspection of published scientific literature to find information relevant to a model, which is a laborious and knowledge-intensive task. Furthermore, models curated manually cannot be easily updated and maintained with new evidence extracted from the literature without automated support. We have developed LitPathExplorer, a visual text analytics tool that integrates advanced text mining, semi-supervised learning and interactive visualization, to facilitate the exploration and analysis of pathway models using statements (i.e. events) extracted automatically from the literature and organized according to levels of confidence. LitPathExplorer supports pathway modellers and curators alike by: (i) extracting events from the literature that corroborate existing models with evidence; (ii) discovering new events which can update models; and (iii) providing a confidence value for each event that is automatically computed based on linguistic features and article metadata. Our evaluation of event extraction showed a precision of 89% and a recall of 71%. Evaluation of our confidence measure, when used for ranking sampled events, showed an average precision ranging between 61 and 73%, which can be improved to 95% when the user is involved in the semi-supervised learning process. Qualitative evaluation using pair analytics based on the feedback of three domain experts confirmed the utility of our tool within the context of pathway model exploration. LitPathExplorer is available at http://nactem.ac.uk/LitPathExplorer_BI/. sophia.ananiadou@manchester.ac.uk. Supplementary data are available at Bioinformatics online.
International Nuclear Information System (INIS)
Guan, Jiwen; Hu, Yongjun; Xie, Min; Bernstein, Elliot R.
2012-01-01
Highlights: ► The carbonyl overtone of acetone clusters is observed by IR-VUV spectroscopy. ► Acetone molecules in the dimer are stacked with an antiparallel way. ► The structure of the acetone trimer and the tetramer are the cyclic structures. ► The carbonyl groups would interact with the methyl groups in acetone clusters. ► These weak interactions are further confirmed by H/D substitution experiment. -- Abstract: Size-selected IR–VUV spectroscopy is employed to detect vibrational characteristics in the region 2850 ∼ 3550 cm −1 of neutral acetone and its clusters (CH 3 COCH 3 ) n (n = 1–4). Features around 3440 cm −1 in the spectra of acetone monomer and its clusters are assigned to the carbonyl stretch (CO) overtone. These features red-shift from 3455 to 3433 cm −1 as the size of the clusters increases from the monomer to the tetramer. Based on calculations, the experimental IR spectra in the C=O overtone region suggest that the dominant structures for the acetone trimer and tetramer should be cyclic in the supersonic expansion sample. This study also suggests that the carbonyl groups interact with the methyl groups in the acetone clusters. These weak interactions are further confirmed by the use of deuterium substitution.
Directory of Open Access Journals (Sweden)
Gaetano Castaldo
2005-01-01
Full Text Available Interactions between proteins that form the ’minimal’ type II polyketide synthase in the doxorubicin producing biosynthetic pathway from Streptomyces peucetius were investigated using a yeast two-hybrid system (Y2H. Proteins that function as the so called ’chain length factor’ (DpsB and putative transacylase (DpsD were found to interact with the ketosynthase subunit (DpsA, which can also interact with itself. On the basis of these results we propose a head-to-tail homodimeric structure, which is consistent with previously published in vivo mutagenesis studies. No interactions were found between the acyl-carrier protein (DpsG and any of the other constituents of the complex, however, transient interactions, not detectable using the Y2H system, cannot be discounted and warrant further investigation.
Sectoral patterns of interactive learning : an empirical exploration of a case in a Dutch region
Meeus, M.T.H.; Oerlemans, L.A.G.; Hage, J.
2001-01-01
This paper pursues the development of a theoretical framework that explains interactive learning between innovator firms and external actors in both the knowledge infrastructure and the production chain. The research question is: What kinds of factors explain the interactive learning of innovator
Improving the EFL Learners' Speaking Ability through Interactive Storytelling
Marzuki; Prayogo, Johannes Ananto; Wahyudi, Arwijati
2016-01-01
This present research was aimed to improve the EFL learners' speaking ability and their classroom activities through the implementation of Interactive Storytelling Strategy. Therefore, this study was directed to explore the beneficial of Interactive Storytelling that closely related to the EFL learners' everyday activities at their home and…
The Human-Computer Interaction of Cross-Cultural Gaming Strategy
Chakraborty, Joyram; Norcio, Anthony F.; Van Der Veer, Jacob J.; Andre, Charles F.; Miller, Zachary; Regelsberger, Alexander
2015-01-01
This article explores the cultural dimensions of the human-computer interaction that underlies gaming strategies. The article is a desktop study of existing literature and is organized into five sections. The first examines the cultural aspects of knowledge processing. The social constructs technology interaction is discussed. Following this, the…
Kjällander, Susanne
2018-01-01
Assessment in the much-discussed digital divide in Scandinavian technologically advanced schools, is the study object of this article. Interaction is studied to understand assessment; and to see how assessment can be didactically designed to recognise students' learning. With a multimodal, design theoretical perspective on learning teachers' and…
Exploring the Early Universe on Mobile Devices
Kocevski, Dale; McGrath, E. J.; CANDELS Collaboration
2014-01-01
The widespread adoption of smart phones and tablet computers has the potential to revolutionize the way in which educational material is shared with the general public. As part of the outreach effort for the CANDELS survey, we have developed a free interactive astronomy education application named Hubble Universe for iPad and iPhone devices. The application focuses on extragalactic science topics related to the CANDELS legacy survey, which is documenting galaxy evolution in the early universe. I will provide an overview of the application, which contains a wide range of interactive content, including 3D models of astrophysical phenomenon, informative diagrams and computer simulations. I will discuss how the application can be used to enhance classroom learning both by providing a database of interactive media and by encouraging students to explore astronomical topics away from traditional settings like the classroom or the desktop computer.
Energy Technology Data Exchange (ETDEWEB)
Sun, Fusheng [Jiangsu Provincial Key Lab for Organic Solid Waste Utilization and National Engineering Research Center for Organic-Based Fertilizers, College of Resources & Environmental Sciences, Nanjing Agricultural University, Nanjing 210095 (China); Department of Soil Science, North Carolina State University, Raleigh, NC 27695 (United States); Polizzotto, Matthew L. [Department of Soil Science, North Carolina State University, Raleigh, NC 27695 (United States); Guan, Dongxing [Key Laboratory of Surficial Geochemistry, Ministry of Education, School of Earth Sciences and Engineering, Nanjing University, Nanjing 210026 (China); Wu, Jun [College of Environment, Zhejiang University of Technology, Hangzhou 310014 (China); Shen, Qirong; Ran, Wei [Jiangsu Provincial Key Lab for Organic Solid Waste Utilization and National Engineering Research Center for Organic-Based Fertilizers, College of Resources & Environmental Sciences, Nanjing Agricultural University, Nanjing 210095 (China); Wang, Boren [Institute of Agricultural Resources and Regional Planning, Chinese Academy of Agricultural Sciences, Beijing 100081 (China); Yu, Guanghui, E-mail: yuguanghui@njau.edu.cn [Jiangsu Provincial Key Lab for Organic Solid Waste Utilization and National Engineering Research Center for Organic-Based Fertilizers, College of Resources & Environmental Sciences, Nanjing Agricultural University, Nanjing 210095 (China)
2017-03-15
Highlights: • The interactions and binding between Cd and functional groups are essential for their fates. • Two-dimensional correlation spectroscopy can identify Cd binding to functional groups in soils. • Synchrotron radiation based spectromicroscopy shows the micro-scale distribution of Cd in soils. • Soil functional groups controlling Cd binding can be modified by fertilization treatments. - Abstract: Understanding how heavy metals bind and interact in soils is essential for predicting their distributions, reactions and fates in the environment. Here we propose a novel strategy, i.e., combining two-dimensional correlation spectroscopy (2D COS) and synchrotron radiation based spectromicroscopies, for identifying heavy metal binding to functional groups in soils. The results showed that although long-term (23 yrs) organic fertilization treatment caused the accumulation of Cd (over 3 times) in soils when compared to no fertilization and chemical fertilization treatments, it significantly (p < 0.05) reduced the Cd concentration in wheat grain. The 2D COS analyses demonstrated that soil functional groups controlling Cd binding were modified by fertilization treatments, providing implications for the reduced bioavailability of heavy metals in organic fertilized soils. Furthermore, correlative micro X-ray fluorescence spectromicroscopy, electron probe micro-analyzer mapping, and synchrotron-radiation-based FTIR spectromicroscopy analysis showed that Cd, minerals, and organic functional groups were heterogeneously distributed at the micro-scale in soil colloids. Only minerals, rather than organic groups, had a similar distribution pattern with Cd. Together, this strategy has a potential to explore the interactions and binding sites among heavy metals, minerals and organic components in soil.
Supramolecular interactions in the solid state
Directory of Open Access Journals (Sweden)
Giuseppe Resnati
2015-11-01
Full Text Available In the last few decades, supramolecular chemistry has been at the forefront of chemical research, with the aim of understanding chemistry beyond the covalent bond. Since the long-range periodicity in crystals is a product of the directionally specific short-range intermolecular interactions that are responsible for molecular assembly, analysis of crystalline solids provides a primary means to investigate intermolecular interactions and recognition phenomena. This article discusses some areas of contemporary research involving supramolecular interactions in the solid state. The topics covered are: (1 an overview and historical review of halogen bonding; (2 exploring non-ambient conditions to investigate intermolecular interactions in crystals; (3 the role of intermolecular interactions in morphotropy, being the link between isostructurality and polymorphism; (4 strategic realisation of kinetic coordination polymers by exploiting multi-interactive linker molecules. The discussion touches upon many of the prerequisites for controlled preparation and characterization of crystalline materials.
Bodystorming for Movement-Based Interaction Design
Directory of Open Access Journals (Sweden)
Elena Márquez Segura
2016-11-01
Full Text Available After a decade of movement-based interaction in human–computer interaction, designing for the moving body still remains a challenge. Research in this field requires methods to help access, articulate, and harness embodied experiences in ways that can inform the design process. To address this challenge, this article appropriates bodystorming, an embodied ideation method for movement-based interaction design. The proposed method allows for early consideration of the physical, collocated, and social aspects of a designed activity as illustrated with two explorative workshops in different application domains: interactive body games and interactive performances. Using a qualitative methods approach, we used video material from the workshops, feedback from participants, and our own experience as participants and facilitators to outline important characteristics of the bodystorming method in the domain of movement-based interaction. The proposed method is compared with previous ones and application implications are discussed.
Directory of Open Access Journals (Sweden)
G. Meschke
2018-03-01
Full Text Available This paper reports on planning and construction related results from research performed at the Collaborative Research Center “Interaction Modeling in Mechanized Tunneling” at Ruhr-University Bochum, Germany. Research covers a broad spectrum of topics relevant for mechanized tunneling in soft soil conditions. This includes inverse numerical methods for advance exploration and models for the characterization of the in situ ground conditions, the interaction of the face support and the tail gap grouting with the porous soil, multi-scale models for the design of fiber reinforced segmental linings with enhanced robustness, computational methods for the numerical simulation of the tunnel advancement, the soil excavation and the material transport in the pressure chamber, logistics processes and risk analysis in urban tunneling. Targeted towards the continuous support of the construction process, a concept for real-time steering support of tunnel boring machines in conjunction with model update procedures and methods of uncertainty quantification is addressed. Keywords: Mechanized tunneling, Computational simulation, Tunnel reconnaissance, Tunnel linings, Face support, Tail void grouting, Real-time analysis, Abrasion, Process simulation
Exaggerated Claims for Interactive Stories
Thue, David; Bulitko, Vadim; Spetch, Marcia; Webb, Michael
As advertising becomes more crucial to video games' success, developers risk promoting their products beyond the features that they can actually include. For features of interactive storytelling, the effects of making such exaggerations are not well known, as reports from industry have been anecdotal at best. In this paper, we explore the effects of making exaggerated claims for interactive stories, in the context of the theory of advertising. Results from a human user study show that female players find linear and branching stories to be significantly less enjoyable when they are advertised with exaggerated claims.
Explorative visual analytics on interval-based genomic data and their metadata.
Jalili, Vahid; Matteucci, Matteo; Masseroli, Marco; Ceri, Stefano
2017-12-04
With the wide-spreading of public repositories of NGS processed data, the availability of user-friendly and effective tools for data exploration, analysis and visualization is becoming very relevant. These tools enable interactive analytics, an exploratory approach for the seamless "sense-making" of data through on-the-fly integration of analysis and visualization phases, suggested not only for evaluating processing results, but also for designing and adapting NGS data analysis pipelines. This paper presents abstractions for supporting the early analysis of NGS processed data and their implementation in an associated tool, named GenoMetric Space Explorer (GeMSE). This tool serves the needs of the GenoMetric Query Language, an innovative cloud-based system for computing complex queries over heterogeneous processed data. It can also be used starting from any text files in standard BED, BroadPeak, NarrowPeak, GTF, or general tab-delimited format, containing numerical features of genomic regions; metadata can be provided as text files in tab-delimited attribute-value format. GeMSE allows interactive analytics, consisting of on-the-fly cycling among steps of data exploration, analysis and visualization that help biologists and bioinformaticians in making sense of heterogeneous genomic datasets. By means of an explorative interaction support, users can trace past activities and quickly recover their results, seamlessly going backward and forward in the analysis steps and comparative visualizations of heatmaps. GeMSE effective application and practical usefulness is demonstrated through significant use cases of biological interest. GeMSE is available at http://www.bioinformatics.deib.polimi.it/GeMSE/ , and its source code is available at https://github.com/Genometric/GeMSE under GPLv3 open-source license.
Chan, Hsun-yu; Wang, Xueli
2016-01-01
Objective: This study explored the relationship between different types of interpersonal interaction, characterized by their underlying motivations, and educational outcomes among students in manufacturing programs at two-year colleges. While there exist several ways to classify interaction, motivation as an inherent attribute that fuels behaviors…
Impedance Based Analysis of DFIG Stator Current Unbalance and Distortion Suppression Strategies
DEFF Research Database (Denmark)
Song, Yipeng; Zhou, Dao; Blaabjerg, Frede
2016-01-01
The control strategies of Doubly Fed Induction Generator (DFIG) system output current unbalance and distortion suppression have been well investigated in detail, with the implementation of two kinds of resonant regulators, i.e., conventional Resonance (R) regulator or Vector Proportional Integral...... reshaping though the introduction of R and VPI regulator. It is pointed out that, when implemented in the DFIG system output current unbalance and distortion suppression, the VPI regulator (equivalent to the combination of virtual positive inductor and virtual positive resistor) has two advantages over R...... regulator (equivalent to the combination of virtual positive resistor and virtual negative inductor), i.e., better high order harmonic distortion suppression. The theoretical analysis and MATLAB simulation results have validated the correctness of this conclusion....
Exploring the interaction network of the Bacillus subtilis outer coat and crust proteins.
Krajčíková, Daniela; Forgáč, Vladimír; Szabo, Adam; Barák, Imrich
2017-11-01
Bacillus subtilis spores, representatives of an exceptionally resistant dormant cell type, are encircled by a thick proteinaceous layer called the spore coat. More than 80 proteins assemble into four distinct coat layers: a basement layer, an inner coat, an outer coat and a crust. As the spore develops inside the mother cell, spore coat proteins synthesized in the cytoplasm are gradually deposited onto the prespore surface. A small set of morphogenetic proteins necessary for spore coat morphogenesis are thought to form a scaffold to which the rest of the coat proteins are attached. Extensive localization and proteomic studies using wild type and mutant spores have revealed the arrangement of individual proteins within the spore coat layers. In this study we examined the interactions between the proteins localized to the outer coat and crust using a bacterial two hybrid system. These two layers are composed of at least 25 components. Self-interactions were observed for most proteins and numerous novel interactions were identified. The most interesting contacts are those made with the morphogenetic proteins CotE, CotY and CotZ; these could serve as a basis for understanding the specific roles of particular proteins in spore coat morphogenesis. Copyright © 2017 Elsevier GmbH. All rights reserved.
Agus, Marco
2018-01-29
We analyze use of an interactive system for the exploration of highly detailed three-dimensional (3D) models of a collection of protostoric Mediterranean sculptures. In this system, when the object of interest is selected, its detailed 3D model and associated information are presented at high resolution on a large display controlled by a touch-enabled horizontal surface at a suitable distance. The user interface combines an object-Aware interactive camera controller with an interactive point-ofinterest selector and is implemented within a scalable implementation based on multiresolution structures shared between the rendering and user interaction subsystems. The system was installed in several temporary and permanent exhibitions and was extensively used by tens of thousands of visitors. We provide a data-driven analysis of usage experience based on logs gathered during a 27-month period at four exhibitions in archeological museums for a total of more than 75K exploration sessions. We focus on discerning the main visitor behaviors during 3D exploration by employing tools for deriving interest measures on surfaces and tools for clustering and knowledge discovery from high-dimensional data. The results highlight the main trends in visitor behavior during the interactive sessions. These results provide useful insights for the design of 3D exploration user interfaces in future digital installations.© 2017 ACM 1556-4673/2017/12-ART2 $15.00.
Agus, Marco; Marton, Fabio; Bettio, Fabio; Hadwiger, Markus; Gobbetti, Enrico
2018-01-01
We analyze use of an interactive system for the exploration of highly detailed three-dimensional (3D) models of a collection of protostoric Mediterranean sculptures. In this system, when the object of interest is selected, its detailed 3D model and associated information are presented at high resolution on a large display controlled by a touch-enabled horizontal surface at a suitable distance. The user interface combines an object-Aware interactive camera controller with an interactive point-ofinterest selector and is implemented within a scalable implementation based on multiresolution structures shared between the rendering and user interaction subsystems. The system was installed in several temporary and permanent exhibitions and was extensively used by tens of thousands of visitors. We provide a data-driven analysis of usage experience based on logs gathered during a 27-month period at four exhibitions in archeological museums for a total of more than 75K exploration sessions. We focus on discerning the main visitor behaviors during 3D exploration by employing tools for deriving interest measures on surfaces and tools for clustering and knowledge discovery from high-dimensional data. The results highlight the main trends in visitor behavior during the interactive sessions. These results provide useful insights for the design of 3D exploration user interfaces in future digital installations.© 2017 ACM 1556-4673/2017/12-ART2 $15.00.
Dynamics of Moment Neuronal Networks with Intra- and Inter-Interactions
Directory of Open Access Journals (Sweden)
Xuyan Xiang
2015-01-01
Full Text Available A framework of moment neuronal networks with intra- and inter-interactions is presented. It is to show how the spontaneous activity is propagated across the homogeneous and heterogeneous network. The input-output firing relationship and the stability are first explored for a homogeneous network. For heterogeneous network without the constraint of the correlation coefficients between neurons, a more sophisticated dynamics is then explored. With random interactions, the network gets easily synchronized. However, desynchronization is produced by a lateral interaction such as Mexico hat function. It is the external intralayer input unit that offers a more sophisticated and unexpected dynamics over the predecessors. Hence, the work further opens up the possibility of carrying out a stochastic computation in neuronal networks.
Exploring language variation across Europe
DEFF Research Database (Denmark)
Hovy, Dirk; Johannsen, Anders Trærup
2016-01-01
Language varies not only between countries, but also along regional and sociodemographic lines. This variation is one of the driving factors behind language change. However, investigating language variation is a complex undertaking: the more factors we want to consider, the more data we need. Tra...... use of large amounts of data and provides statistical analyses, maps, and interactive features that enable scholars to explore language variation in a data-driven way.......Language varies not only between countries, but also along regional and sociodemographic lines. This variation is one of the driving factors behind language change. However, investigating language variation is a complex undertaking: the more factors we want to consider, the more data we need...... training in both variational linguistics and computational methods, a combination that is still not common. We take a first step here to alleviate the problem by providing an interface to explore large-scale language variation along several socio-demographic factors without programming knowledge. It makes...
Hall, V. J.
2017-01-01
A small-scale action research project was used to consider the policy and rhetoric surrounding development of the "expert learner" and how this might be further explored to provide opportunities for learners to have greater direct involvement in reflection and discussion with teachers. The research was based within a further education…
Brion, Mélanie; Pitel, Anne-Lise; Beaunieux, Hélène; Maurage, Pierre
2014-01-01
Korsakoff syndrome (KS) is a neurological state mostly caused by alcohol-dependence and leading to disproportionate episodic memory deficits. KS patients present more severe anterograde amnesia than Alcohol-Dependent Subjects (ADS), which led to the continuum hypothesis postulating a progressive increase in brain and cognitive damages during the evolution from ADS to KS. This hypothesis has been extensively examined for memory but is still debated for other abilities, notably executive functions (EF). EF have up to now been explored by unspecific tasks in KS, and few studies explored their interactions with memory. Exploring EF in KS by specific tasks based on current EF models could thus renew the exploration of the continuum hypothesis. This paper will propose a research program aiming at: (1) clarifying the extent of executive dysfunctions in KS by tasks focusing on specific EF subcomponents; (2) determining the differential EF deficits in ADS and KS; (3) exploring EF-memory interactions in KS with innovative tasks. At the fundamental level, this exploration will test the continuum hypothesis beyond memory. At the clinical level, it will propose new rehabilitation tools focusing on the EF specifically impaired in KS.
Directory of Open Access Journals (Sweden)
Mélanie eBrion
2014-07-01
Full Text Available Korsakoff syndrome (KS is a neurological state mostly caused by alcohol-dependence and leading to disproportionate episodic memory deficits. KS patients present more severe anterograde amnesia than alcohol-dependent subjects (ADS, which led to the continuum hypothesis postulating a progressive increase in brain and cognitive damages during the evolution from ADS to KS. This hypothesis has been extensively examined for memory but is still debated for other abilities, notably executive functions (EF. EF have up to now been explored by unspecific tasks in KS, and few studies explored their interactions with memory. Exploring EF in KS by specific tasks based on current EF models could thus renew the exploration of the continuum hypothesis. This paper will propose a research program aiming at: (1 clarifying the extent of executive dysfunctions in KS by tasks focusing on specific EF subcomponents; (2 determining the differential EF deficits in ADS and KS; (3 exploring EF-memory interactions in KS with innovative tasks. At the fundamental level, this exploration will test the continuum hypothesis beyond memory. At the clinical level, it will propose new rehabilitation tools focusing on the EF specifically impaired in KS.
Well-Conditioned Multi-Level Fast Multipole Modeling of Military Communication Channels
National Research Council Canada - National Science Library
Carin, Lawrence
2004-01-01
Duke University and Virginia Polytechnic Institute and State University (VPI&SU) propose to team in a research effort to develop computer codes for the analysis and prediction of electromagnetic wave (EM...
Directory of Open Access Journals (Sweden)
Ricardo Rosales
2018-03-01
Full Text Available Technology has become a necessity in our everyday lives and essential for completing activities we typically take for granted; technologies can assist us by completing set tasks or achieving desired goals with optimal affect and in the most efficient way, thereby improving our interactive experiences. This paper presents research that explores the representation of user interaction levels using an intelligent hybrid system approach with agents. We evaluate interaction levels of Human-Computer Interaction (HCI with the aim of enhancing user experiences. We consider the description of interaction levels using an intelligent hybrid system to provide a decision-making system to an agent that evaluates interaction levels when using interactive modules of a museum exhibition. The agents represent a high-level abstraction of the system, where communication takes place between the user, the exhibition and the environment. In this paper, we provide a means to measure the interaction levels and natural behaviour of users, based on museum user-exhibition interaction. We consider that, by analysing user interaction in a museum, we can help to design better ways to interact with exhibition modules according to the properties and behaviour of the users. An interaction-evaluator agent is proposed to achieve the most suitable representation of the interaction levels with the aim of improving user interactions to offer the most appropriate directions, services, content and information, thereby improving the quality of interaction experienced between the user-agent and exhibition-agent.
Exploring the role of Facebook in re-shaping backpacker’s social interactions
Berger, Edward Alexander; Paris, Cody Morris
2014-01-01
The recent Facebook launch of Timeline, Social Graph Search, and the increased use of the mobile Facebook apps has resulted in some important implications for the use of Facebook by backpackers. The purpose of this paper is to (re) explore how Facebook has impacted social relationships between backpackers and their personal, professional, and ‘fellow traveller’ networks, particularly in-light of these recent changes to Facebook and the increased reduction of anonymity while travelling. An exp...
Visual Workflows for Oil and Gas Exploration
Hollt, Thomas
2013-04-14
The most important resources to fulfill today’s energy demands are fossil fuels, such as oil and natural gas. When exploiting hydrocarbon reservoirs, a detailed and credible model of the subsurface structures to plan the path of the borehole, is crucial in order to minimize economic and ecological risks. Before that, the placement, as well as the operations of oil rigs need to be planned carefully, as off-shore oil exploration is vulnerable to hazards caused by strong currents. The oil and gas industry therefore relies on accurate ocean forecasting systems for planning their operations. This thesis presents visual workflows for creating subsurface models as well as planning the placement and operations of off-shore structures. Creating a credible subsurface model poses two major challenges: First, the structures in highly ambiguous seismic data are interpreted in the time domain. Second, a velocity model has to be built from this interpretation to match the model to depth measurements from wells. If it is not possible to obtain a match at all positions, the interpretation has to be updated, going back to the first step. This results in a lengthy back and forth between the different steps, or in an unphysical velocity model in many cases. We present a novel, integrated approach to interactively creating subsurface models from reflection seismics, by integrating the interpretation of the seismic data using an interactive horizon extraction technique based on piecewise global optimization with velocity modeling. Computing and visualizing the effects of changes to the interpretation and velocity model on the depth-converted model, on the fly enables an integrated feedback loop that enables a completely new connection of the seismic data in time domain, and well data in depth domain. For planning the operations of off-shore structures we present a novel integrated visualization system that enables interactive visual analysis of ensemble simulations used in ocean
ARIES: Enabling Visual Exploration and Organization of Art Image Collections.
Crissaff, Lhaylla; Wood Ruby, Louisa; Deutch, Samantha; DuBois, R Luke; Fekete, Jean-Daniel; Freire, Juliana; Silva, Claudio
2018-01-01
Art historians have traditionally used physical light boxes to prepare exhibits or curate collections. On a light box, they can place slides or printed images, move the images around at will, group them as desired, and visual-ly compare them. The transition to digital images has rendered this workflow obsolete. Now, art historians lack well-designed, unified interactive software tools that effectively support the operations they perform with physi-cal light boxes. To address this problem, we designed ARIES (ARt Image Exploration Space), an interactive image manipulation system that enables the exploration and organization of fine digital art. The system allows images to be compared in multiple ways, offering dynamic overlays analogous to a physical light box, and sup-porting advanced image comparisons and feature-matching functions, available through computational image processing. We demonstrate the effectiveness of our system to support art historians tasks through real use cases.
Tunable-Range, Photon-Mediated Atomic Interactions in Multimode Cavity QED
Directory of Open Access Journals (Sweden)
Varun D. Vaidya
2018-01-01
Full Text Available Optical cavity QED provides a platform with which to explore quantum many-body physics in driven-dissipative systems. Single-mode cavities provide strong, infinite-range photon-mediated interactions among intracavity atoms. However, these global all-to-all couplings are limiting from the perspective of exploring quantum many-body physics beyond the mean-field approximation. The present work demonstrates that local couplings can be created using multimode cavity QED. This is established through measurements of the threshold of a superradiant, self-organization phase transition versus atomic position. Specifically, we experimentally show that the interference of near-degenerate cavity modes leads to both a strong and tunable-range interaction between Bose-Einstein condensates (BECs trapped within the cavity. We exploit the symmetry of a confocal cavity to measure the interaction between real BECs and their virtual images without unwanted contributions arising from the merger of real BECs. Atom-atom coupling may be tuned from short range to long range. This capability paves the way toward future explorations of exotic, strongly correlated systems such as quantum liquid crystals and driven-dissipative spin glasses.
A Retrospective Assessment of the Educational Benefits of Interaction across Racial Boundaries
Luo, Jiali; Jamieson-Drake, David
2009-01-01
Through the analysis of alumni survey data from three graduating cohorts, this study examined the influence of interracial interaction on college outcomes and explored factors that helped to promote interracial interaction on college campuses. Its findings indicate that interracial interaction made unique, consistent contribution to college…
Photonic and Quantum Interactions of Atomic-Scale Junctions
National Aeronautics and Space Administration — In this proposal, the fundamental quantum and photonic interactions of bimetallic atomic-scale junctions (ASJs) will be explored, with three major space...
Interactive eLearning - a safe place to practice.
Einarson, Elisabeth; Moen, Anne; Kolberg, Ragnhild; Flingtorp, Gry; Linnerud, Eva
2009-01-01
Interactive web-based learning environment offers refreshing opportunities to create innovative solutions to explore and exploit informatics support on-the-job training. We report from a study where a hospital is created a interactive eLearning resource. The modules are creating a safe place to practice - to be used for introduction to the work and preparation for certification or re-certification of competencies.
Dust Interactions on Small Solar System Bodies and Technology Considerations for Exploration
Kobrick, Ryan,; Hoffman, Jeffrey; Pavone, Marco; Street, Kenneth; Rickman, Douglas
2014-01-01
Small-bodies such as asteroids and Mars' moons Phobos and Deimos have relatively unknown regolith environments. It is hypothesized that dust preserved in the regolith on the surfaces will have similar mechanical properties to lunar dust because of similar formation processes from micrometeorite bombardment, low relative gravity for slow settling times, and virtually no weathering because there is no atmosphere. This combination of processes infers that small-body dust particles will be highly angular and retain abrasive properties. The focus of this paper uses the mission architecture and engineering design for an asteroid hopper known as Hedgehog, a spherical spacecraft with several symmetric spikes used to aid with tumbling mobility in a low gravity environment. Dust abrasion considerations are highlighted throughout the paper relating to the lead authors' previous work, but act as an example of one of many important dust or regolith physical properties that need to be considered for future exploration. Measurable regolith properties are summarized in order to identify technologies that may be useful for exploration in terms of scientific return and spacecraft design. Previous instruments are summarized in this paper that could be used on the Hedgehog. Opportunities for hardware payloads are highlighted that include low mass solutions or dualpurpose instruments that can measure regolith or dust properties. Finally, dust mitigation suggestions are made for vehicles of this mobility profile.
Interactions between Turkish Mothers and Preschool Children with Autism
Diken, Ozlem; Mahoney, Gerald
2013-01-01
This study explored the relationship between Turkish mothers' style of interaction and the engagement of their preschool-aged children with autism. Data were collected from fifty mother-child dyads in which all children had diagnoses of autism. Video recordings of mother-child interaction were analyzed using the Turkish versions of the Maternal…
Weiland, C.; Chadwick, W. W.
2004-12-01
Several years ago we created an exciting and engaging multimedia exhibit for the Hatfield Marine Science Center that lets visitors simulate making a dive to the seafloor with the remotely operated vehicle (ROV) named ROPOS. The exhibit immerses the user in an interactive experience that is naturally fun but also educational. The public display is located at the Hatfield Marine Science Visitor Center in Newport, Oregon. We are now completing a revision to the project that will make this engaging virtual exploration accessible to a much larger audience. With minor modifications we will be able to put the exhibit onto the world wide web so that any person with internet access can view and learn about exciting volcanic and hydrothermal activity at Axial Seamount on the Juan de Fuca Ridge. The modifications address some cosmetic and logistic ISSUES confronted in the museum environment, but will mainly involve compressing video clips so they can be delivered more efficiently over the internet. The web version, like the museum version, will allow users to choose from 1 of 3 different dives sites in the caldera of Axial Volcano. The dives are based on real seafloor settings at Axial seamount, an active submarine volcano on the Juan de Fuca Ridge (NE Pacific) that is also the location of a seafloor observatory called NeMO. Once a dive is chosen, then the user watches ROPOS being deployed and then arrives into a 3-D computer-generated seafloor environment that is based on the real world but is easier to visualize and navigate. Once on the bottom, the user is placed within a 360 degree panorama and can look in all directions by manipulating the computer mouse. By clicking on markers embedded in the scene, the user can then either move to other panorama locations via movies that travel through the 3-D virtual environment, or they can play video clips from actual ROPOS dives specifically related to that scene. Audio accompanying the video clips informs the user where they are
Investigating the use of a dynamic physical bar chart for data exploration and presentation
DEFF Research Database (Denmark)
Taher, Faisal; Jansen, Yvonne; Woodruff, Jonathan
2017-01-01
and facilitate data exploration tasks such as sorting, navigating in data sets which exceed the fixed size of a given physical display, or preparing “views” to communicate insights about data. However, it is currently unclear how people approach and interact bar chart for an open-ended data exploration...... and presentation task. We asked 16 participants to explore a data set on European values and to prepare a short presentation of their insights using a physical display. We analyze: (1) users’ body movements to understand how they approach and react to the physicalization, (2) their hand-gestures to understand how......Physical data representations, or data physicalizations, are a promising new medium to represent and communicate data. Previous work mostly studied passive physicalizations which require humans to perform all interactions manually. Dynamic shape-changing displays address this limitation...
Integrating GIS and ABM to Explore Spatiotemporal Dynamics
Sun, M.; Jiang, Y.; Yang, C.
2013-12-01
Agent-based modeling as a methodology for the bottom-up exploration with the account of adaptive behavior and heterogeneity of system components can help discover the development and pattern of the complex social and environmental system. However, ABM is a computationally intensive process especially when the number of system components becomes large and the agent-agent/agent-environmental interaction is modeled very complex. Most of traditional ABM frameworks developed based on CPU do not have a satisfying computing capacity. To address the problem and as the emergence of advanced techniques, GPU computing with CUDA can provide powerful parallel structure to enable the complex simulation of spatiotemporal dynamics. In this study, we first develop a GPU-based ABM system. Secondly, in order to visualize the dynamics generated from the movement of agent and the change of agent/environmental attributes during the simulation, we integrate GIS into the ABM system. Advanced geovisualization technologies can be utilized for representing the spatiotemporal change events, such as proper 2D/3D maps with state-of-the-art symbols, space-time cube and multiple layers each of which presents pattern in one time-stamp, etc. Thirdly, visual analytics which include interactive tools (e.g. grouping, filtering, linking, etc.) is included in our ABM-GIS system to help users conduct real-time data exploration during the progress of simulation. Analysis like flow analysis and spatial cluster analysis can be integrated according to the geographical problem we want to explore.
Directory of Open Access Journals (Sweden)
Scott Barlowe
2017-06-01
Full Text Available Understanding how proteins mutate is critical to solving a host of biological problems. Mutations occur when an amino acid is substituted for another in a protein sequence. The set of likelihoods for amino acid substitutions is stored in a matrix and input to alignment algorithms. The quality of the resulting alignment is used to assess the similarity of two or more sequences and can vary according to assumptions modeled by the substitution matrix. Substitution strategies with minor parameter variations are often grouped together in families. For example, the BLOSUM and PAM matrix families are commonly used because they provide a standard, predefined way of modeling substitutions. However, researchers often do not know if a given matrix family or any individual matrix within a family is the most suitable. Furthermore, predefined matrix families may inaccurately reflect a particular hypothesis that a researcher wishes to model or otherwise result in unsatisfactory alignments. In these cases, the ability to compare the effects of one or more custom matrices may be needed. This laborious process is often performed manually because the ability to simultaneously load multiple matrices and then compare their effects on alignments is not readily available in current software tools. This paper presents SubVis, an interactive R package for loading and applying multiple substitution matrices to pairwise alignments. Users can simultaneously explore alignments resulting from multiple predefined and custom substitution matrices. SubVis utilizes several of the alignment functions found in R, a common language among protein scientists. Functions are tied together with the Shiny platform which allows the modification of input parameters. Information regarding alignment quality and individual amino acid substitutions is displayed with the JavaScript language which provides interactive visualizations for revealing both high-level and low-level alignment
Social Interactions in Online Gaming
Griffiths, Mark; Hussain, Zaheer; Grüsser, Sabine M.; Thalemann, Ralf; Cole, Helena; Davies, Mark N. O.; Chappell, Darren
2011-01-01
This paper briefly overviews five studies examining massively multiplayer online role-playing games (MMORPGs). The first study surveyed 540 gamers and showed that the social aspects of the game were the most important factor for many gamers. The second study explored the social interactions of 912 MMORPG players and showed they created strong…
Chang, Yen-Liang; Hung, Chao-Ho; Chen, Po-Yueh; Chen, Wei-Chang; Hung, Shih-Han
2015-10-01
Acoustic analysis is often used in speech evaluation but seldom for the evaluation of oral prostheses designed for reconstruction of surgical defect. This study aimed to introduce the application of acoustic analysis for patients with velopharyngeal insufficiency (VPI) due to oral surgery and rehabilitated with oral speech-aid prostheses. The pre- and postprosthetic rehabilitation acoustic features of sustained vowel sounds from two patients with VPI were analyzed and compared with the acoustic analysis software Praat. There were significant differences in the octave spectrum of sustained vowel speech sound between the pre- and postprosthetic rehabilitation. Acoustic measurements of sustained vowels for patients before and after prosthetic treatment showed no significant differences for all parameters of fundamental frequency, jitter, shimmer, noise-to-harmonics ratio, formant frequency, F1 bandwidth, and band energy difference. The decrease in objective nasality perceptions correlated very well with the decrease in dips of the spectra for the male patient with a higher speech bulb height. Acoustic analysis may be a potential technique for evaluating the functions of oral speech-aid prostheses, which eliminates dysfunctions due to the surgical defect and contributes to a high percentage of intelligible speech. Octave spectrum analysis may also be a valuable tool for detecting changes in nasality characteristics of the voice during prosthetic treatment of VPI. Copyright © 2014. Published by Elsevier B.V.
Host-pathogen interactions in typhoid fever
de Jong, H.K.
2015-01-01
This thesis focuses on host-pathogen interactions in Salmonella Typhi and Burkholderia pseudomallei infections and explores the interplay between these bacteria and the innate immune system. Typhoid fever is one of the most common causes of bacterial infection in low-income countries. With adequate
Mapping Cultural Frame Shifting in Interaction Design with Blending Theory
DEFF Research Database (Denmark)
Markussen, Thomas; Krogh, Peter Gall
2008-01-01
In this paper, we introduce Gilles Fauconnier & Mark Turner's blending theory as a new conceptual framework for explaining ‘cultural frame shifting' in interaction design. Cultural frame shifting is when people, through their explorative use of technology, are required imaginatively to reorganize...... their cultural background knowledge and expectations. In current HCI research it has occasionally been pointed out that a proper understanding of this phenomenon hinges on addressing the relationship between embodied interaction and cultural meaning construction as part of a larger interactive system. However...... the network model of mental spaces from Fauconnier & Turner's blending theory onto video material and interviews from initial qualitative use studies of a design case. In so doing we explore and argue for how meaning formation and embodied cognition coalesce in cultural frame shifting and provide a tool...
Ammonia nanotubes and their interactions with coinage metals
Energy Technology Data Exchange (ETDEWEB)
Mohajeri, Afshan, E-mail: amohajeri@shirazu.ac.ir; Bozorgizadeh, Tahereh
2014-09-30
Highlights: • The possibility of building ammonia nanotubes (ANTs) is explored. • Six ANTs formed by the stacks of 4- and 5-membered ammonia rings have been studied. • The interactions between the ANTs and coinage metals are investigated. • The nature of nitrogen–metal bonds is unveiled by quantum chemical approaches. - Abstract: The hydrogen bond networks of finite ammonia molecules are considered to explore the possibility of building ammonia nanotubes (ANTs). Six ANTs formed by the stacks of 4- and 5-membered ammonia rings have been studied. The calculated stabilization energies indicate considerable stability for ANTs. In the second part, the interactions between the constructed ANTs and coinage metals (M = Cu, Ag, and Au) are investigated with a focus on the nature of nitrogen…metal bonds. The changes in binding energies from copper to gold reveal that the three metals have almost similar tendency for the interaction with ANTs and the interaction strength is governed by the structure of ANT. Furthermore, the electronic and structural properties of the resulting complexes have been unveiled by means of the quantum chemical analyses. The N…M bonds are found to have partially covalent and partially electrostatic nature.
Harmonic Inverse FEL Interaction at 800nm
Sears, C M S; Siemann, R; Spencer, J E
2005-01-01
The inverse Free Electron Laser (IFEL) interaction has recently been proposed and demonstrated as a premodulator for High Gain Harmonic Generation (HGHG) experiments. These experiments utilized the fundamental of the interaction between the laser field and electron bunch. In the current experiment, we explore the higher order resonances of the IFEL interaction from a 3 period, 1.8 centimeter wavelength undulator with a picosecond, 0.25 mJ/pulse laser at 800nm. The resonances are observed by adjusting the gap of the undulator while keeping the beam energy constant. The harmonic IFEL can add flexibility to HGHG FEL design.
The Factors Influencing Young Children's Social Interaction in Technology Integration
Lim, Eun Mee
2015-01-01
When technology integration is accomplished successfully in early childhood education settings, children tend to interact more with one another and exchange information related to computer tasks as well as the overall classroom on-going curriculum themes. Therefore, to explore how young children are interacting in computer areas when using…
Embodying multilingual interaction
DEFF Research Database (Denmark)
Hazel, Spencer; Mortensen, Janus
this linguistic diversity is managed in situ by participants engaged in dialogue with one another, and what it is used for in these transient multilingual communities. This paper presents CA-based micro-ethnographic analyses of language choice in an informal social setting – a kitchen – of an international study...... literature on language choice in interaction, our findings emphasize that analyses of language choice in multilingual settings need to take into account social actions beyond the words that are spoken. We show that facial, spatial and postural configurations, gaze orientation and gestures as well as prosodic...... in the particular community of practice that we are investigating. Reference Hazel, Spencer, and Janus Mortensen. forthcoming. Kitchen talk: Exploring linguistic practices in liminal institutional interactions in a multilingual university setting. in Language Alternation, Language Choice, and Language Encounter...
International Nuclear Information System (INIS)
Banipal, Parampaul K.; Sharma, Mousmee; Aggarwal, Neha; Banipal, Tarlok S.
2016-01-01
Highlights: • The hydrophilic-hydrophilic interactions predominate at low temperatures. • Enthalpy change for polyol is less exothermic than its parent saccharide. • Δ dil C o p,2,m values suggest structural increase in presence of L-ascorbic acid. • Solutes act as kosmotropes in L-ascorbic acid (aq) solutions as indicated by dB/dT. - Abstract: Isothermal titration micro-calorimeter has been used to measure the enthalpy change (q) of polyhydroxy solutes [(+)-D-xylose, xylitol, (+)-D-glucose, 2-deoxy-D-glucose, (+)-methyl-α-D-glucopyranoside, and (+)-maltose monohydrate] in water and in (0.05, 0.15, and 0.25) mol·kg −1 L-ascorbic acid (aq) solutions at (288.15, 298.15, 308.15, and 318.15) K. Limiting enthalpies of dilution (Δ dil H°) of these solutes were calculated from heat evolved/absorbed during calorimetric experiments. Further thermodynamic quantities such as limiting enthalpies of dilution of transfer (Δ tr Δ dil H°), change in heat capacity (Δ dil C o p,2,m ), and pair (h AB ) and triplet (h ABB ) enthalpic interaction coefficients were also calculated and used to explore the nature of interactions of solutes with cosolute (L-ascorbic acid). The Jones-Dole viscosity B-coefficients for (+)-D-xylose, xylitol, (+)-D-galactose, galactitol, (+)-D-glucose, 2-deoxy-D-glucose, (+)-methyl-α-D-glucopyranoside, and (+)-maltose monohydrate in water and in (0.05, 0.15, 0.25, and 0.35) mol·kg −1 L-ascorbic acid (aq) solutions have been determined from viscosity (η) data measured over temperature range (288.15–318.15) K and at pressure, P = 101.3 kPa. The temperature dependence of B-coefficients (dB/dT), and viscosity B-coefficients of transfer (Δ tr B) of solutes from water to cosolute have also been estimated. These parameters have been discussed in terms of structure-making (kosmotropic) or -breaking (chaotropic) behavior of solutes.
Using A Normative Framework to Explore the Prototyping of Wireless Grids
DEFF Research Database (Denmark)
Balke, Tina; De Vos, Marina; Padget, Julian
2011-01-01
The capacity for normative frameworks to capture the essential features of interactions between components in open architectures suggests they might also be of assistance in an early, rapid prototyping phase of system development, helping to refine concepts, identify actors, explore policies...
Digital Cities in the making: exploring perceptions of space, agency of actors and heterotopia
Directory of Open Access Journals (Sweden)
Asne Kvale Handlykken
2011-12-01
Full Text Available
This paper is an attempt to explore how we imagine, sense and experience spaces in digital cities by a study of the hybrid relations between digital media, users' bodies, architecture and the city. Digital and physical spaces of the city are intertwined, the city and urban places and things become sentient, embedded with sensors and digital infrastructure, challenging traditional notions of space, and how we perceive and experience urban space. Crucial issues to explore are how interactions and agency operating amongst actors in these spaces; between sentient non-human actors, places and people? How are spaces of interaction embedded in the city, what characterizes these spaces, can they be explored as heterotopias (Foucault? These processes are a mutual shaping of society and technology, where the role of the imaginary, of mental representations and creation are being transformed.
ConnectomeExplorer: Query-guided visual analysis of large volumetric neuroscience data
Beyer, Johanna
2013-12-01
This paper presents ConnectomeExplorer, an application for the interactive exploration and query-guided visual analysis of large volumetric electron microscopy (EM) data sets in connectomics research. Our system incorporates a knowledge-based query algebra that supports the interactive specification of dynamically evaluated queries, which enable neuroscientists to pose and answer domain-specific questions in an intuitive manner. Queries are built step by step in a visual query builder, building more complex queries from combinations of simpler queries. Our application is based on a scalable volume visualization framework that scales to multiple volumes of several teravoxels each, enabling the concurrent visualization and querying of the original EM volume, additional segmentation volumes, neuronal connectivity, and additional meta data comprising a variety of neuronal data attributes. We evaluate our application on a data set of roughly one terabyte of EM data and 750 GB of segmentation data, containing over 4,000 segmented structures and 1,000 synapses. We demonstrate typical use-case scenarios of our collaborators in neuroscience, where our system has enabled them to answer specific scientific questions using interactive querying and analysis on the full-size data for the first time. © 1995-2012 IEEE.
Ingroups and Outgroups in Complaints: Exploring Politic Behaviour in Nurses’ Discourse
Directory of Open Access Journals (Sweden)
Mariana Virginia Lazzaro-Salazar
2017-11-01
Full Text Available The relevance of social norms for understanding appropriate behaviour in context has taken central stage in (impoliteness research in recent years, and particularly in studies of workplace interaction (Holmes, 2012. As an example of this research, this paper explores the way in which a group of nurses interacting with their colleagues negotiates complaints. The data were collected in a ward of a public healthcare institution in New Zealand and consist of audio and video recordings of four roster meetings involving nurses and nurse managers. Instances of nurses’ complaints are explored from an interactional sociolinguistic point of view, allowing the researcher to investigate emergent facework (drawing on Locher and Watts, 2005. The findings suggest that multiple ingroup and outgroup memberships, achieved through the dynamic use of personal pronouns, enact preferred politic behaviour for both, transactional and relational goals. In addition, nurses’ convergence in their display of socio-pragmatic norms governing their complaining practices suggests that this group of nurses belongs to the same workplace community. Finally, strong emphasis is placed on the role that complaining plays in the positive presentation of nurses’ identities.
Tian, Xing; Gao, Lingyue; An, Li; Jiang, Xiaowen; Bai, Junpeng; Huang, Jian; Meng, Weihong; Zhao, Qingchun
2016-12-01
Compound MQA (1,5-O-dicaffeoyl-3-O-[4-malic acid methyl ester]-quinic acid) is a natural caffeoylquinic acid derivative isolated from Arctium lappa L. roots. This study aims to explore the neuroprotective effects of MQA against hydrogen peroxide (H 2 O 2 )-induced oxidative stress in SH-SY5Y neuroblastoma cells. The SH-SY5Y cells were divided into four groups, including control, 20 μM MQA, 200 μM H2O2, 200 μM H2O2 + 20 μM MQA groups. The effects of MQA on H 2 O 2 -induced cell death were measured by MTT and LDH assays. Hoechst 33342 and Annexin V-PI double staining were used to observed H2O2-induced apoptosis. Also, the effects of MQA on antioxidant system and mitochondrial pathway were explored. Further, steady-state phosphorylation levels of ERK1/2, Akt and GSK-3β were examined by Western blot analysis. Pretreatment with MQA prevented cell death in SH-SY5Y cells exposed to 200 μM H2O2 for 3 h. Meanwhile, Hoechst 33342 and Annexin V-PI double staining showed that MQA attenuated H 2 O 2 -induced apoptosis. These changes are related to elevation in SOD activity, reduction in MDA production and ROS formation, and increases in mitochondrial membrane potential (MMP). In addition, the potential mechanisms of MQA against H 2 O 2 -induced apoptosis are associated with increases in the Bcl-2/Bax ratio, decreases in cytochrome c release, caspase-3 and caspase-9 expressions, phosphorylation of ERK1/2, and dephosphorylation of AKT and GSK-3β. These findings suggest that protective effects of MQA against H 2 O 2 -induced apoptosis might be associated with mitochondrial apoptosis, ERK1/2 and AKT/GSK-3β pathway.
Student Interactions in Technology-Rich Classrooms
Fonkert, Karen L.
2010-01-01
Students are more likely to develop a deep conceptual understanding of mathematics when they interact with and discuss their thoughts with others. The National Council of Teachers of Mathematics (NCTM) (1989, 2000) has recommended that students be active learners--communicating with one another, conjecturing, exploring, and justifying claims by…
Identifying Successful Learners from Interaction Behaviour
McCuaig, Judi; Baldwin, Julia
2012-01-01
The interaction behaviours of successful, high-achieving learners when using a Learning Management System (LMS) are different than the behaviours of learners who are having more difficulty mastering the course material. This paper explores the idea that conventional Learning Management Systems can exploit data mining techniques to predict the…
Evolutionary dynamics under interactive diversity
Su, Qi; Li, Aming; Wang, Long
2017-10-01
As evidenced by many cases in human societies, individuals often make different behavior decisions in different interactions, and adaptively adjust their behavior in changeable interactive scenarios. However, up to now, how such diverse interactive behavior affects cooperation dynamics has still remained unknown. Here we develop a general framework of interactive diversity, which models individuals’ separated behavior against distinct opponents and their adaptive adjustment in response to opponents’ strategies, to explore the evolution of cooperation. We find that interactive diversity enables individuals to reciprocate every single opponent, and thus sustains large-scale reciprocal interactions. Our work witnesses an impressive boost of cooperation for a notably extensive range of parameters and for all pairwise games. These results are robust against well-mixed and various networked populations, and against degree-normalized and cumulative payoff patterns. From the perspective of network dynamics, distinguished from individuals competing for nodes in most previous work, in this paper, the system evolves in the form of behavior disseminating along edges. We propose a theoretical method based on evolution of edges, which predicts well both the frequency of cooperation and the compact cooperation clusters. Our thorough investigation clarifies the positive role of interactive diversity in resolving social dilemmas and highlights the significance of understanding evolutionary dynamics from the viewpoint of edge dynamics.
Interactions, Starbursts, and Star Formation
Directory of Open Access Journals (Sweden)
Johan H. Knapen
2015-12-01
Full Text Available We study how interactions between galaxies affect star formation within them by considering a sample of almost 1500 of the nearest galaxies, all within a distance of ∼45 Mpc. We use the far-IR emission to define the massive star formation rate (SFR, and then normalise the SFR by the stellar mass of the galaxy to obtain the specific star formation rate (SSFR. We explore the distribution of (SSFR with morphological type and with stellar mass. We calculate the relative enhancement of SFR and SSFR for each galaxy by normalising them by the median SFR and SSFR values of individual control samples of similar non-interacting galaxies. We find that both the median SFR and SSFR are enhanced in interacting galaxies, and more so as the degree of interaction is higher. The increase is moderate, reaching a maximum of a factor of 1.9 for the highest degree of interaction (mergers. While the SFR and SSFR are enhanced statistically by interactions, in many individual interacting galaxies they are not enhanced at all. Our study is based on a representative sample of nearby galaxies and should be used to place constraints on studies based on samples of galaxies at larger distances.
Using Interactive Graphics to Teach Multivariate Data Analysis to Psychology Students
Valero-Mora, Pedro M.; Ledesma, Ruben D.
2011-01-01
This paper discusses the use of interactive graphics to teach multivariate data analysis to Psychology students. Three techniques are explored through separate activities: parallel coordinates/boxplots; principal components/exploratory factor analysis; and cluster analysis. With interactive graphics, students may perform important parts of the…
Interactions of attention, emotion and motivation.
Raymond, Jane
2009-01-01
Although successful visually guided action begins with sensory processes and ends with motor control, the intervening processes related to the appropriate selection of information for processing are especially critical because of the brain's limited capacity to handle information. Three important mechanisms--attention, emotion and motivation--contribute to the prioritization and selection of information. In this chapter, the interplay between these systems is discussed with emphasis placed on interactions between attention (or immediate task relevance of stimuli) and emotion (or affective evaluation of stimuli), and between attention and motivation (or the predicted value of stimuli). Although numerous studies have shown that emotional stimuli modulate mechanisms of selective attention in humans, little work has been directed at exploring whether such interactions can be reciprocal, that is, whether attention can influence emotional response. Recent work on this question (showing that distracting information is typically devalued upon later encounters) is reviewed in the first half of the chapter. In the second half, some recent experiments exploring how prior value-prediction learning (i.e., learning to associate potential outcomes, good or bad, with specific stimuli) plays a role in visual selection and conscious perception. The results indicate that some aspects of motivation act on selection independently of traditionally defined attention and other aspects interact with it.
Augmenting Everyday Artefacts to Support Social Interaction Among Senior Peers
DEFF Research Database (Denmark)
Nazzi, Elena; Sokoler, Tomas
2015-01-01
Novel technological possibilities emerge when tangible and social computing come together. This paper explores the potential of such technology when designing for seniors and their social interaction. Our research is guided by the concept of twitterIDo, which is to make seniors’ everyday activities...... and displays designed to start a dialogue with the seniors on how twitterIDo-technology may fit into their everyday situations. Our findings point out how augmented everyday artefacts can make a positive difference when designing technology in a domain such the one of seniors’ and their social interaction...... more visible by augmenting everyday artefacts to communicate the ongoing activity they are used for. We engaged a local community of seniors in a living lab to explore the possibilities of twitterIDo in real life situations. This paper presents a series of interactive prototypes of everyday artefacts...
Modelling of spatially complex human-ecosystem, rural-urban and rich-poor interactions
CSIR Research Space (South Africa)
Naude, AH
2008-06-01
Full Text Available The paper outlines the challenges of modelling and assessing spatially complex human-ecosystem interactions, and the need to simultaneously consider rural-urban and rich-poor interactions. The context for exploring these challenges is South Africa...
They Work Together to Roar: Kindergartners' Understanding of an Interactive Causal Task
Solis, S. Lynneth; Grotzer, Tina A.
2016-01-01
The aim of this study was to investigate kindergartners' exploration of interactive causality during their play with a pair of toy sound blocks. Interactive causality refers to a type of causal pattern in which two entities interact to produce a causal force, as in particle attraction and symbiotic relationships. Despite being prevalent in nature,…
Exploring nutrition capacity in Australia's charitable food sector.
Wingrove, Kate; Barbour, Liza; Palermo, Claire
2017-11-01
The primary aim of this study was to explore the capacity of community organisations within Australia's charitable food sector to provide nutritious food to people experiencing food insecurity. A secondary aim was to explore their capacity to provide food in an environment that encourages social interaction. This qualitative research used an exploratory case study design and was informed by a nutrition capacity framework. Participants were recruited through SecondBite, a not-for-profit food rescue organisation in Australia. Convenience sampling methods were used. Semi-structured interviews were conducted to explore the knowledge, attitudes and experiences of people actively involved in emergency food relief provision. Transcripts were thematically analysed using an open coding technique. Nine interviews were conducted. The majority of participants were female (n = 7, 77.8%) and worked or volunteered at organisations within Victoria (n = 7, 77.8%). Results suggest that the capacity for community organisations to provide nutritious food to their clients may be limited by resource availability more so than the nutrition-related knowledge and attitudes of staff members and volunteers. Australia's charitable food sector plays a vital role in addressing the short-term needs of people experiencing food insecurity. To ensure the food provided to people experiencing food insecurity is nutritious and provided in an environment that encourages social interaction, it appears that the charitable food sector requires additional resources. In order to reduce demand for emergency food relief, an integrated policy approach targeting the underlying determinants of food insecurity may be needed. © 2016 Dietitians Association of Australia.
Interactive tabletops in education
Dillenbourg, Pierre; Evans, Michael
2011-01-01
Interactive tabletops are gaining increased attention from CSCL researchers. This paper analyses the relation between this technology and teaching and learning processes. At a global level, one could argue that tabletops convey a socio-constructivist flavor: they support small teams that solve problems by exploring multiple solutions. The development of tabletop applications also witnesses the growing importance of face-to-face collaboration in CSCL and acknowledges the physicality of learnin...
Adhikarla, Vamsi Kiran; Sodnik, Jaka; Szolgay, Peter; Jakus, Grega
2015-04-14
This paper reports on the design and evaluation of direct 3D gesture interaction with a full horizontal parallax light field display. A light field display defines a visual scene using directional light beams emitted from multiple light sources as if they are emitted from scene points. Each scene point is rendered individually resulting in more realistic and accurate 3D visualization compared to other 3D displaying technologies. We propose an interaction setup combining the visualization of objects within the Field Of View (FOV) of a light field display and their selection through freehand gesture tracked by the Leap Motion Controller. The accuracy and usefulness of the proposed interaction setup was also evaluated in a user study with test subjects. The results of the study revealed high user preference for free hand interaction with light field display as well as relatively low cognitive demand of this technique. Further, our results also revealed some limitations and adjustments of the proposed setup to be addressed in future work.
Mamas, Christoforos
2018-01-01
This study primarily applied social network analysis (SNA) to explore the relationship between friendships, peer social interactions and group work dynamics within a higher education undergraduate programme in England. A critical case study design was adopted so as to allow for an in-depth exploration of the students' voice. In doing so, the views…
Practice and Personhood in Professional Interaction: Social Identities and Information Needs.
Mokros, Hartmut B.; And Others
1995-01-01
Explores the human aspect of information retrieval by examining the behavior and pronoun use of librarians in the course of communicating with patrons during online computer search interactions. Compares two studies on the conduct of librarians as intermediaries in naturally occurring online computer search interactions. (JMV)
Ross, Helen
2017-01-01
This article explores teachers' experiences of dyslexia and classroom interventions via lesson observations and semi-structured interviews. These experiences were analysed through a Bourdieusien lens, based on Jenkins's "levels of interaction", to delineate power relationships inherent in classroom interactions, teachers' interactions…
Interaction physics for megajoule laser fusion targets
International Nuclear Information System (INIS)
Kruer, W.L.
1992-02-01
Some little-explored interaction phenomena for targets irradiated with megajoule lasers are considered. Simple estimates show that the laser plasma interaction then occurs in a hot (multi-keV) plasma with density much less than the critical density. In such plasmas, Raman and Brillouin scattering into the forward hemisphere are potentially significant. A simple model shows that Raman forward scattering can be saturated at low levels by ponderomotive detuning. Calculations also illustrate a suppression of ponderomotive filamentation by plasma-induced beam smoothing
Diversity in Action | Interactive Workshop | 2nd edition | 22 October
2013-01-01
The CERN Diversity Programme has designed an interactive workshop to creatively explore the meaning of diversity. Come, take part, and share your experience of working with differences at CERN. Tuesday 22 October 2013 – 1.30 p.m. - 5.30 p.m. Pump Hall - Building 216-R-401 "Diversity in Action" is an interactive half-day workshop designed to creatively explore the meaning and importance of diversity at CERN, in support of the Organization’s value of “appreciating differences, fostering equality and promoting collaboration”. Using participative multi-media methods, this innovative workshop will provide participants with insights into diversity, help them to develop greater sensitivity to differences, explore ways to recognise and overcome biases and thereby strengthen our tradition of inclusiveness at CERN. Virginia Humud Guerrero is a seasoned professional and HR expert who has spent a considerable part of her career in UN agencies worl...
Predicting rates of interspecific interaction from phylogenetic trees.
Nuismer, Scott L; Harmon, Luke J
2015-01-01
Integrating phylogenetic information can potentially improve our ability to explain species' traits, patterns of community assembly, the network structure of communities, and ecosystem function. In this study, we use mathematical models to explore the ecological and evolutionary factors that modulate the explanatory power of phylogenetic information for communities of species that interact within a single trophic level. We find that phylogenetic relationships among species can influence trait evolution and rates of interaction among species, but only under particular models of species interaction. For example, when interactions within communities are mediated by a mechanism of phenotype matching, phylogenetic trees make specific predictions about trait evolution and rates of interaction. In contrast, if interactions within a community depend on a mechanism of phenotype differences, phylogenetic information has little, if any, predictive power for trait evolution and interaction rate. Together, these results make clear and testable predictions for when and how evolutionary history is expected to influence contemporary rates of species interaction. © 2014 John Wiley & Sons Ltd/CNRS.
Determinants of Internet Use for Interactive Learning: An Exploratory Study
Castaño, Jonatan; Duart, Josep M.; Sancho-Vinuesa, Teresa
2015-01-01
The use of the Internet in higher education teaching can facilitate the interactive learning process and thus improve educational outcomes. The aim of the study presented here is to explore which variables are linked to higher intensity of Internet-based interactive educational practices. The study is based on data obtained from an online survey…
Interactive Graph Layout of a Million Nodes
Directory of Open Access Journals (Sweden)
Peng Mi
2016-12-01
Full Text Available Sensemaking of large graphs, specifically those with millions of nodes, is a crucial task in many fields. Automatic graph layout algorithms, augmented with real-time human-in-the-loop interaction, can potentially support sensemaking of large graphs. However, designing interactive algorithms to achieve this is challenging. In this paper, we tackle the scalability problem of interactive layout of large graphs, and contribute a new GPU-based force-directed layout algorithm that exploits graph topology. This algorithm can interactively layout graphs with millions of nodes, and support real-time interaction to explore alternative graph layouts. Users can directly manipulate the layout of vertices in a force-directed fashion. The complexity of traditional repulsive force computation is reduced by approximating calculations based on the hierarchical structure of multi-level clustered graphs. We evaluate the algorithm performance, and demonstrate human-in-the-loop layout in two sensemaking case studies. Moreover, we summarize lessons learned for designing interactive large graph layout algorithms on the GPU.
Wu, Xiaoli; Lowyck, Joost; Sercu, Lies; Elen, Jan
2012-01-01
The present study aimed for better understanding of the interactions between task complexity and students' self-efficacy beliefs and students' use of learning strategies, and finally their interacting effects on task performance. This investigation was carried out in the context of Chinese students learning English as a foreign language in a…
Exploring light mediators with low-threshold direct detection experiments
Energy Technology Data Exchange (ETDEWEB)
Kahlhoefer, Felix [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany); RWTH Aachen Univ. (Germany). Inst. for Theoretical Particle Physics and Cosmology; Kulkarni, Suchita [Oesterreichische Akademie der Wissenschaften, Vienna (Austria). Inst. fuer Hochenergiephysik; Wild, Sebastian [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany)
2017-11-15
We explore the potential of future cryogenic direct detection experiments to determine the properties of the mediator that communicates the interactions between dark matter and nuclei. Due to their low thresholds and large exposures, experiments like CRESST-III, SuperCDMS SNOLAB and EDELWEISS-III will have excellent capability to reconstruct mediator masses in the MeV range for a large class of models. Combining the information from several experiments further improves the parameter reconstruction, even when taking into account additional nuisance parameters related to background uncertainties and the dark matter velocity distribution. These observations may offer the intriguing possibility of studying dark matter self-interactions with direct detection experiments.