The Predictive Role of Emotional Intelligence on Personality and Shyness

Science.gov (United States)

Arslan, Coskun; Bülbül, Ayse Eliüsük; Büyükbayraktar, Çagla Girgin

2017-01-01

The main objective of this research is to determine the relationship between shyness, emotional intelligence and the five factor personality traits in university students. Furthermore it aims to determine whether the emotional intelligence and personality traits predict the Shyness levels at a significant level. The population of this study…

Spider-Ant Associations: An Updated Review of Myrmecomorphy, Myrmecophily, and Myrmecophagy in Spiders

Directory of Open Access Journals (Sweden)

Paula E. Cushing

2012-01-01

Full Text Available This paper provides a summary of the extensive theoretical and empirical work that has been carried out in recent years testing the adaptational significance of various spider-ant associations. Hundreds of species of spiders have evolved close relationships with ants and can be classified as myrmecomorphs, myrmecophiles, or myrmecophages. Myrmecomorphs are Batesian mimics. Their close morphological and behavioral resemblance to ants confers strong survival advantages against visually hunting predators. Some species of spiders have become integrated into the ant society as myrmecophiles or symbionts. These spider myrmecophiles gain protection against their own predators, live in an environment with a stable climate, and are typically surrounded by abundant food resources. The adaptations by which this integration is made possible are poorly known, although it is hypothesized that most spider myrmecophiles are chemical mimics and some are even phoretic on their hosts. The third type of spider-ant association discussed is myrmecophagy—or predatory specialization on ants. A table of known spider myrmecophages is provided as is information on their biology and hunting strategies. Myrmecophagy provides these predators with an essentially unlimited food supply and may even confer other protections to the spiders.

Emotional intelligence, personality, and gender as factors in disordered eating patterns.

Science.gov (United States)

Zysberg, Leehu

2014-08-01

We examined the hypotheses that proposing higher levels of emotional intelligence (ability test and self-report) and lower neuroticism, extraversion, and agreeableness associate with lower levels of disordered eating. In a correlational study, 126 Israeli college students completed two measures of emotional intelligence, a brief five-factor personality test, demographic data questionnaires, and questionnaires assessing food preoccupation, namely, the Body Weight, Image and Self-Esteem Scale and the Appearance Schema Inventory. Results suggested that ability emotional intelligence is associated with disordered eating beyond gender and personality. Self-reported emotional intelligence did not associate with any of the outcomes after controlling for personality. Implications and applications are briefly discussed. © The Author(s) 2013.

Attending to detail by communal spider-eating spiders.

Science.gov (United States)

Jackson, Robert R; Nelson, Ximena J

2012-07-01

Communal predators may often need to make especially intricate foraging decisions, as a predator's success may depend on the actions of its neighbours. Here,we consider the decisions made by Portia africana, a jumping spider (Salticidae) that preys on other spiders, including Oecobius amboseli (Oecobiidae), a small prey spider that lives under small sheets of silk (nests) on the walls of buildings. P. africana juveniles settle near oecobiid nests and then ambush oecobiids as they leave or enter the nest. Two or more P. africana juveniles sometimes settle at the same nest and, when an oecobiid is captured, the P. africana juveniles may share the meal. We investigated the joining decisions made by naïve P. africana juveniles. Experiments were based on using lures (dead spiders positioned in lifelike posture) arranged in a series of 17 different scenes defined by the presence/absence of a nest, the lure types present and the configuration of the lures and the nest. Our findings imply that P. africana juveniles make remarkably precise predatory decisions, with the variables that matter including whether a nest is present, the identity of spiders inside and outside a nest and how spiders are positioned relative to each other and the nest.

Protestant Ethic Endorsement, Personality, and General Intelligence

Science.gov (United States)

Christopher, Andrew N.; Furnham, Adrian; Batey, Mark; Martin, G. Neil; Koenig, Cynthia S.; Doty, Kristin

2010-01-01

To learn if Protestant ethic endorsement predicted intelligence controlling for the big five personality factors, 364 college students from England and the United States completed a 65-item multifaceted work ethic endorsement measure, the 50-item Wonderlic Personnel Test, and a 60-item measure of the big five personality factors. A hierarchical…

Different aspects of emotional intelligence of borderline personality disorder

NARCIS (Netherlands)

Peter, Mathell; Arntz, Arnoud R; Klimstra, T.A.; Vingerhoets, A.J.J.M.

2018-01-01

Objectives: The present study investigated deficiencies in different components of emotional intelligence in borderline personality disorder (BPD). Method: The Mayer-Salovey-Caruso Emotional Intelligence Test (MSCEIT) and the Emotional Quotient Inventory (EQ-i) were used to assess EI dimensions. BPD

Relationships of Big Five personality traits and nonverbal intelligence at high school age

Directory of Open Access Journals (Sweden)

Voronina Irina

2016-01-01

Full Text Available The article presents the results of study on the relationship of personality traits and intelligence in Russian high school students. The study focused on Big Five personality traits - Neuroticism, Extraversion, Openness, Agreeableness and Conscientiousness - and the structure of their relationships with nonverbal intelligence, as measured by the test “Standard Progressive Matrices”. Significant correlations were only found between nonverbal intelligence and Openness (r = 0.26, p < 0.05. The results are interpreted in the context of investment theory, which assumes that personality traits can promote the formation of individual differences in intelligence.

E-learning systems intelligent techniques for personalization

CERN Document Server

Klašnja-Milićević, Aleksandra; Ivanović, Mirjana; Budimac, Zoran; Jain, Lakhmi C

2017-01-01

This monograph provides a comprehensive research review of intelligent techniques for personalisation of e-learning systems. Special emphasis is given to intelligent tutoring systems as a particular class of e-learning systems, which support and improve the learning and teaching of domain-specific knowledge. A new approach to perform effective personalization based on Semantic web technologies achieved in a tutoring system is presented. This approach incorporates a recommender system based on collaborative tagging techniques that adapts to the interests and level of students' knowledge. These innovations are important contributions of this monograph. Theoretical models and techniques are illustrated on a real personalised tutoring system for teaching Java programming language. The monograph is directed to, students and researchers interested in the e-learning and personalization techniques. .

EFL Teachers' Emotional Intelligence and Their Personality Types: Exploring Possible Relations

Science.gov (United States)

Razavi, Roya

2014-01-01

The major aim of this study was to examine the relationship between teachers' emotional intelligence and their personality traits in an Iranian context. To this end, 85 Iranian EFL teachers were asked to fill out The Big Five Inventory Personality Test (John & Srivastava, 1999) and The Bar-On Emotional Intelligences test (1997). The results…

Relationship emotional intelligence and personality traits with organizational commitment among Iranian nurses

Directory of Open Access Journals (Sweden)

Zahra Taherinejad

2017-06-01

Full Text Available In the past three decades, organizational commitment has been of interest to researchers as one of the organizational attitudes. The aim of this study was to investigate the relationship of emotional intelligence and personality traits with organizational commitment among Iranian nurses. A total of 280 nurses were selected by multistage random sampling. Study tools included emotional intelligence inventory, Neo personality inventory and organizational commitment inventory. Results showed the positive and significant relationship of emotional intelligence and its dimensions (self-expression, self-regard, independence, social responsibility, problem solving, stress tolerance, impulse control, and optimism with organizational commitment. Also, organizational commitment showed a positive and significant relationship with extroversion and conscientiousness. Moreover, components of self-expression, problem solving and stress tolerance in emotional intelligence are able to predict organizational commitment. Thus, these results indicate the importance of emotional intelligence and personality traits in organizational commitment.

Spider Movement, UV Reflectance and Size, but Not Spider Crypsis, Affect the Response of Honeybees to Australian Crab Spiders

Science.gov (United States)

Llandres, Ana L.; Rodríguez-Gironés, Miguel A.

2011-01-01

According to the crypsis hypothesis, the ability of female crab spiders to change body colour and match the colour of flowers has been selected because flower visitors are less likely to detect spiders that match the colour of the flowers used as hunting platform. However, recent findings suggest that spider crypsis plays a minor role in predator detection and some studies even showed that pollinators can become attracted to flowers harbouring Australian crab spider when the UV contrast between spider and flower increases. Here we studied the response of Apis mellifera honeybees to the presence of white or yellow Thomisus spectabilis Australian crab spiders sitting on Bidens alba inflorescences and also the response of honeybees to crab spiders that we made easily detectable painting blue their forelimbs or abdomen. To account for the visual systems of crab spider's prey, we measured the reflectance properties of the spiders and inflorescences used for the experiments. We found that honeybees did not respond to the degree of matching between spiders and inflorescences (either chromatic or achromatic contrast): they responded similarly to white and yellow spiders, to control and painted spiders. However spider UV reflection, spider size and spider movement determined honeybee behaviour: the probability that honeybees landed on spider-harbouring inflorescences was greatest when the spiders were large and had high UV reflectance or when spiders were small and reflected little UV, and honeybees were more likely to reject inflorescences if spiders moved as the bee approached the inflorescence. Our study suggests that only the large, but not the small Australian crab spiders deceive their preys by reflecting UV light, and highlights the importance of other cues that elicited an anti-predator response in honeybees. PMID:21359183

Spider movement, UV reflectance and size, but not spider crypsis, affect the response of honeybees to Australian crab spiders.

Science.gov (United States)

Llandres, Ana L; Rodríguez-Gironés, Miguel A

2011-02-16

According to the crypsis hypothesis, the ability of female crab spiders to change body colour and match the colour of flowers has been selected because flower visitors are less likely to detect spiders that match the colour of the flowers used as hunting platform. However, recent findings suggest that spider crypsis plays a minor role in predator detection and some studies even showed that pollinators can become attracted to flowers harbouring Australian crab spider when the UV contrast between spider and flower increases. Here we studied the response of Apis mellifera honeybees to the presence of white or yellow Thomisus spectabilis Australian crab spiders sitting on Bidens alba inflorescences and also the response of honeybees to crab spiders that we made easily detectable painting blue their forelimbs or abdomen. To account for the visual systems of crab spider's prey, we measured the reflectance properties of the spiders and inflorescences used for the experiments. We found that honeybees did not respond to the degree of matching between spiders and inflorescences (either chromatic or achromatic contrast): they responded similarly to white and yellow spiders, to control and painted spiders. However spider UV reflection, spider size and spider movement determined honeybee behaviour: the probability that honeybees landed on spider-harbouring inflorescences was greatest when the spiders were large and had high UV reflectance or when spiders were small and reflected little UV, and honeybees were more likely to reject inflorescences if spiders moved as the bee approached the inflorescence. Our study suggests that only the large, but not the small Australian crab spiders deceive their preys by reflecting UV light, and highlights the importance of other cues that elicited an anti-predator response in honeybees.

Attentional bias to moving spiders in spider fearful individuals.

Science.gov (United States)

Vrijsen, Janna N; Fleurkens, Pascal; Nieuwboer, Wieteke; Rinck, Mike

2009-05-01

We investigated if an attentional bias for spiders in spider fearful individuals (SFs) can also be found for moving spiders, rather than static images. In Study 1, 28 SFs and 33 non-anxious controls (NACs) participated in a modified version of the dot probe paradigm: they had to react to a probe that appeared either in the next, previous, or side position of a spider's or a wheel's path. 24 SFs and 29 NACs participated in Study 2, in which a fourth, highly predictable, probe position was added. We expected that moving spiders would capture the attention of SFs. In addition, we tested whether SFs try to predict the movement of the spider to make it less threatening. As expected, SFs showed an attentional bias towards moving spiders. However, both groups reacted fastest to unpredictable movements, indicating that SFs and NACs alike anticipate unpredictable spider movements.

[The relationship between cognitive intelligence, emotional intelligence, coping and stress symptoms in the context of type A personality pattern].

Science.gov (United States)

Hisli Sahin, Nesrin; Güler, Murat; Basim, H Nejat

2009-01-01

This study aimed to determine the relationships between cognitive and emotional intelligence, coping and stress symptoms in the context of Type A personality pattern. The Raven Progressive Matrices, Emotional Intelligence Questionnaire, Ways of Coping Inventory, Stress Symptoms Scale, and Type A Personality Scale were administered to 271 university students. Two groups, Type As and Type Bs were created according to the Type A Personality Scale scores and were compared in terms of their scores on the other scales that were administered. Our analyses showed that stress symptoms were negatively correlated with effective coping, stress management, and general mood dimensions of the Emotional Intelligence Questionnaire. They were also positively correlated with ineffective coping and Type A behaviors. Being female also significantly predicted stress symptoms. When the participants were grouped according to Type A Personality Scale scores as Type As and Type Bs, the regression analysis showed that the stress symptoms of Type As were significantly predicted by the insufficient use of effective coping styles and deficiencies in the general mood component of emotional intelligence, whereas the stress symptoms of Type Bs were predicted by the insufficient use of effective coping styles, overuse of ineffective coping styles, and increase in the intrapersonal abilities component of emotional intelligence. Stress symptoms can be related to the variables associated with personality styles. It is suggested that stress management programs for Type As should include exercises that increase emotional intelligence, especially the components of drawing pleasure from their life situation, being more positive, hopeful and optimistic.

Low Correlations between Intelligence and Big Five Personality Traits: Need to Broaden the Domain of Personality

Directory of Open Access Journals (Sweden)

Lazar Stankov

2018-05-01

Full Text Available The correlations between the measures of cognitive abilities and personality traits are known to be low. Our data based on the popular Big Five model of intelligence show that the highest correlations (up to r = 0.30 tend to occur with the Openness to Experience. Some recent developments in the studies of intelligence (e.g., emotional intelligence, complex problem solving and economic games indicate that this link may become stronger in future. Furthermore, our studies of the processes in the “no-man’s-land” between intelligence and personality suggest that the non-cognitive constructs are correlated with both. These include the measures of social conservatism and self-beliefs. Importantly, the Big Five measures do not tap into either the dark traits associated with social conservatism or self-beliefs that are known to be good predictors of academic achievement. This paper argues that the personality domain should be broadened to include new constructs that have not been captured by the lexical approach employed in the development of the Big Five model. Furthermore, since the measures of confidence have the highest correlation with cognitive performance, we suggest that the trait of confidence may be a driver that leads to the separation of fluid and crystallized intelligence during development.

Creating robots with personality : the effect of personality on social intelligence

NARCIS (Netherlands)

Mileounis, A.; Cuijpers, R.H.; Barakova, E.I.

2015-01-01

This study investigates the effect of two personality traits, dominance and extroversion, on social intelligence. To test these traits, a NAO robot was used, which was teleoperated through a computer using a Wizard of Oz technique. A within-subject design was conducted with extroversion as

Intelligent Adaptation and Personalization Techniques in Computer-Supported Collaborative Learning

CERN Document Server

Demetriadis, Stavros; Xhafa, Fatos

2012-01-01

Adaptation and personalization have been extensively studied in CSCL research community aiming to design intelligent systems that adaptively support eLearning processes and collaboration. Yet, with the fast development in Internet technologies, especially with the emergence of new data technologies and the mobile technologies, new opportunities and perspectives are opened for advanced adaptive and personalized systems. Adaptation and personalization are posing new research and development challenges to nowadays CSCL systems. In particular, adaptation should be focused in a multi-dimensional way (cognitive, technological, context-aware and personal). Moreover, it should address the particularities of both individual learners and group collaboration. As a consequence, the aim of this book is twofold. On the one hand, it discusses the latest advances and findings in the area of intelligent adaptive and personalized learning systems. On the other hand it analyzes the new implementation perspectives for intelligen...

A study on effect of big five personality traits on emotional intelligence

Directory of Open Access Journals (Sweden)

Hamed Dehghanan

2014-06-01

Full Text Available This paper presents a study to investigate the effects of big five personal traits on emotional intelligence on some Iranian firms located in city of Tehran, Iran. The proposed study uses two questionnaires, one, which is originally developed by McCare and Costa (1992 [McCrae, R. R., & Costa, P. T., Jr. (1992. Discriminant validity of NEO-PI-R facet scales. Educational and Psychological Measurement, 52, 229-237.] for measuring personality traits and the other, which is used for measuring emotional intelligence . The first questionnaire consists of five personal categories including extraversion, agreeableness, conscientiousness, emotional stability versus neuroticism, and openness. Using structural equation modeling and stepwise regression model, the study has detected a positive and meaningful relationship between four components namely, extraversion, agreeableness, conscientiousness as well as openness and emotional intelligence. In addition, the study detects a negative and meaningful relationship between neuroticism and emotional intelligence.

Interrelationship between Personality Traits and Emotional Intelligence of Secondary Teachers in India

Science.gov (United States)

Kant, Ravi

2014-01-01

Emotional intelligence is an ability to control our emotions in abnormal situations. Now it is widely accepted that emotional intelligence also a key determent for success and also in development in personality. Personality is a sum total of emotions. By taking a sample of 200 secondary school teachers an attempt has made to find out the…

EFL Teachers’ Emotional Intelligence and Their Personality Types: Exploring Possible Relations

Directory of Open Access Journals (Sweden)

Roya Razavi

2014-04-01

Full Text Available The major aim of this study was to examine the relationship between teachers’ emotional intelligence and their personality traits in an Iranian context. To this end, 85 Iranian EFL teachers were asked to fill out The Big Five Inventory Personality Test (John & Srivastava, 1999 and The Bar-On Emotional Intelligences test (1997. The results showed both negative and positive correlations among different subscales of the variables under study. It was found that among the 15 components of EI, problem solving has the highest positive correlation with personality types (i.e., agreeableness. Also, problem solving was found to have the highest negative significant correlation with personality types (i.e., neuroticism. Pedagogical implications are discussed.

Domain-specific knowledge as the "dark matter" of adult intelligence: Gf/Gc, personality and interest correlates.

Science.gov (United States)

Ackerman, P L

2000-03-01

An enduring controversy in intelligence theory and assessment, the argument that middle-aged adults are, on average, less intelligent than young adults, is addressed in this study. A sample of 228 educated adults between ages 21 and 62 years was given an array of tests that focused on a broad assessment of intelligence-as-knowledge, traditional estimates of fluid intelligence (Gf) and crystallized intelligence (Gc), personality, and interests. The results indicate that middle-aged adults are more knowledgeable in many domains, compared with younger adults. A coherent pattern of ability, personality, and interest relations is found. The results are consistent with a developmental perspective of intelligence that includes both traditional ability and non-ability determinants of intelligence during adulthood. A reassessment of the nature of intelligence in adulthood is provided, in the context of a lifelong learning and investment model, called PPIK, for intelligence-as-Process, Personality, Interests, and intelligence-as-Knowledge (Ackerman, 1996).

Spiders in dermatology.

Science.gov (United States)

Kang, Jun K; Bhate, Chinmoy; Schwartz, Robert A

2014-09-01

Spider bites represent an unusual and potentially over-represented clinical diagnosis. Despite a common fear of spiders, known as arachnophobia, current knowledge suggests that only a small number of families within the order Araneae are medically relevant. Moreover, most cutaneous spider reactions, including both evenomations and physical trauma, produce mild, local symptoms which may be managed with supportive care alone. The differential diagnosis for spider bites may be broad, especially if the offending arachnid is not seen or found. We describe a series of spiders relevant to the dermatologist in the United States.

Beyond fluid intelligence and personality traits in social support: the role of ability based emotional intelligence.

Science.gov (United States)

Fabio, Annamaria Di

2015-01-01

Social support represents an important individual resource that has been associated with multiple indices of adaptive functioning and resiliency. Existing research has also identified an association between emotional intelligence (EI) and social support. The present study builds on prior research by investigating the contributions of ability based EI to social support, beyond the effects of fluid intelligence and personality traits. The Advanced Progressive Matrices, the Big Five Questionnaire, the Mayer Salovey Caruso EI test (MSCEIT), and the Multidimensional Scale of Perceived Social Support were administered to 149 Italian high school students. The results showed that ability based EI added significant incremental variance in explaining perceived social support, beyond the variance due to fluid intelligence and personality traits. The results underline the role of ability based EI in relation to perceived social support. Since ability based EI can be increased through specific training, the results of the present study highlight new possibilities for research and intervention in a preventive framework.

Different aspects of emotional intelligence of borderline personality disorder.

Science.gov (United States)

Peter, Mathell; Arntz, Arnoud R; Klimstra, Theo; Vingerhoets, Ad J J M

2018-01-01

The present study investigated deficiencies in different components of emotional intelligence in borderline personality disorder (BPD). The Mayer-Salovey-Caruso Emotional Intelligence Test (MSCEIT) and the Emotional Quotient Inventory (EQ-i) were used to assess EI dimensions. BPD patients (N = 85; 69 women; M = 33.6 years) were compared with Cluster C personality disorder (PD) patients (N = 39; 23 women; M = 36.6 years) and nonpatients (N = 69; 44 women; M = 35.6 years). Compared to the Cluster C PD patients and the nonpatient group, BPD patients displayed only deficits in their ability to understand emotions as measured with the Mayer-Salovey-Caruso Emotional Intelligence Test. The Emotional Quotient Inventory only revealed deficits in stress management in BPD patients compared to Cluster C PD patients. Our findings suggest that BPD patients have the ability to regulate emotions effectively, but they subjectively experience deficits in emotion regulation and therefore may not use this ability when they need it. Copyright © 2017 John Wiley & Sons, Ltd.

Specialised use of working memory by Portia africana, a spider-eating salticid.

Science.gov (United States)

Cross, Fiona R; Jackson, Robert R

2014-03-01

Using expectancy-violation methods, we investigated the role of working memory in the predatory strategy of Portia africana, a salticid spider from Kenya that preys by preference on other spiders. One of this predator's tactics is to launch opportunistic leaping attacks on to other spiders in their webs. Focussing on this particular tactic, our experiments began with a test spider on a ramp facing a lure (dead prey spider mounted on a cork disc) that could be reached by leaping. After the test spider faced the lure for 30 s, we blocked the test spider's view of the lure by lowering an opaque shutter before the spider leapt. When the shutter was raised 90 s later, either the same lure came into view again (control) or a different lure came into view (experimental: different prey type in same orientation or same prey type in different orientation). We recorded attack frequency (number of test spiders that leapt at the lure) and attack latency (time elapsing between shutter being raised and spiders initiating a leap). Attack latencies in control trials were not significantly different from attack latencies in experimental trials, regardless of whether it was prey type or prey orientation that changed in the experimental trials. However, compared with test spiders in the no-change control trials, significantly fewer test spiders leapt when prey type changed. There was no significant effect on attack frequency when prey orientation changed. These findings suggest that this predator represents prey type independently of prey orientation.

Molecular phylogeny of moth-specialized spider sub-family Cyrtarachninae, which includes bolas spiders.

Science.gov (United States)

Tanikawa, Akio; Shinkai, Akira; Miyashita, Tadashi

2014-11-01

The evolutionary process of the unique web architectures of spiders of the sub-family Cyrtarachninae, which includes the triangular web weaver, bolas spider, and webless spider, is thought to be derived from reduction of orbicular 'spanning-thread webs' resembling ordinal orb webs. A molecular phylogenetic analysis was conducted to explore this hypothesis using orbicular web spiders Cyrtarachne, Paraplectana, Poecilopachys, triangular web spider Pasilobus, bolas spiders Ordgarius and Mastophora, and webless spider Celaenia. The phylogeny inferred from partial sequences of mt-COI, nuclear 18S-rRNA and 28S-rRNA showed that the common ancestor of these spiders diverged into two clades: a spanning-thread web clade and a bolas or webless clade. This finding suggests that the triangular web evolved by reduction of an orbicular spanning web, but that bolas spiders evolved in the early stage, which does not support the gradual web reduction hypothesis.

Improving Emotional Intelligence through Personality Development: The Effect of the Smart Phone Application based Dharma Life Program on Emotional Intelligence.

Science.gov (United States)

Poonamallee, Latha; Harrington, Alex M; Nagpal, Manisha; Musial, Alec

2018-01-01

Emotional intelligence is established to predict success in leadership effectiveness in various contexts and has been linked to personality factors. This paper introduces Dharma Life Program, a novel approach to improving emotional intelligence by targeting maladaptive personality traits and triggering neuroplasticity through the use of a smart-phone application and mentoring. The program uses neuroplasticity to enable users to create a more adaptive application of their maladaptive traits, thus improving their emotional intelligence. In this study 26 participants underwent the Dharma Life Program in a leadership development setting. We assessed their emotional and social intelligence before and after the Dharma Life Program intervention using the Emotional and Social Competency Inventory (ESCI). The study found a significant improvement in the lowest three competencies and a significant improvement in almost all domains for the entire sample. Our findings suggest that the completion of the Dharma Life Program has a significant positive effect on Emotional and Social Competency scores and offers a new avenue for improving emotional intelligence competencies.

Application of 3 kinds of practical electromagnetic spiders in electromagnetic spider web

Directory of Open Access Journals (Sweden)

Jiang Min

2016-01-01

Full Text Available Electromagnetic spider web the launch circuit has introduced a lot, but in the center position of the utility of the spider generally have 3 kinds of circuits respectively, the use of single-chip microcomputer circuit of the low energy consumption spider by multi-channel transmission, single circuit receiver circuit. Direct use of the 3 channels of the spider and the use of PLC circuit spider, depending on the actual situation were placed.

Application of 3 kinds of practical electromagnetic spiders in electromagnetic spider web

OpenAIRE

Jiang Min

2016-01-01

Electromagnetic spider web the launch circuit has introduced a lot, but in the center position of the utility of the spider generally have 3 kinds of circuits respectively, the use of single-chip microcomputer circuit of the low energy consumption spider by multi-channel transmission, single circuit receiver circuit. Direct use of the 3 channels of the spider and the use of PLC circuit spider, depending on the actual situation were placed.

Spider Vein Removal

Science.gov (United States)

Spider veins: How are they removed? I have spider veins on my legs. What options are available ... M.D. Several options are available to remove spider veins — thin red lines or weblike networks of ...

Emotional intelligence, personality and sales performance

OpenAIRE

Sjöberg, Lennart; Littorin, Patrick

2003-01-01

In this study, salespersons in a telecommunications company were tested for emotional intelligence (EI), additional dimensions of work motivation and personality, and work performance. It was found that EI was related as expected to other variables, most noticeably to life/work balance (positively), to positive affective tone (positively), and to materialistic values and money obsession (negatively). EI was most clearly related to citizenship behavior and less to core task performance, as exp...

Developing human capital by linking emotional intelligence with personal competencies in Indian business organizations

Directory of Open Access Journals (Sweden)

Singh, K.

2010-01-01

Full Text Available The concept of emotional intelligence has become so popular in the management literature that it has become imperative to understand and leverage it for the sake of enhancing the capacity of human capital in organizations. As the pace of change is increasing and world of work is making ever greater demands on a person’s cognitive, emotional and physical resources, this particular set of abilities are becoming increasingly important. Since majority of the concerns in organization involve people in different roles, emotional intelligence must become a determining factor for their effective management. It has also been found that ultimately it is the emotional and personal competencies that we need to identify and measure if we want to be able to predict performance at workplace resulting in its effectiveness, thereby enhancing the worth of the human capital. In this scenario the competencies possessed by the people will have a bearing on the extent to which they can actualize their emotional intelligence. The current paper sets out to examine the relationship between the emotional intelligence of executives in Indian business organizations with their personal competencies. The result suggests that emotional intelligence is significantly related with the personal competencies of employees and the variables of personal competency namely, people success, system success and self success have a predictive relationship with emotional intelligence.

Mothers' daily person and process praise: implications for children's theory of intelligence and motivation.

Science.gov (United States)

Pomerantz, Eva M; Kempner, Sara G

2013-11-01

This research examined if mothers' day-to-day praise of children's success in school plays a role in children's theory of intelligence and motivation. Participants were 120 children (mean age = 10.23 years) and their mothers who took part in a 2-wave study spanning 6 months. During the first wave, mothers completed a 10-day daily interview in which they reported on their use of person (e.g., "You are smart") and process (e.g., "You tried hard") praise. Children's entity theory of intelligence and preference for challenge in school were assessed with surveys at both waves. Mothers' person, but not process, praise was predictive of children's theory of intelligence and motivation: The more person praise mothers used, the more children subsequently held an entity theory of intelligence and avoided challenge over and above their earlier functioning on these dimensions.

Spider Bites: First Aid

Science.gov (United States)

... care immediately if: You were bitten by a black widow or brown recluse spider You are unsure whether the bite ... in the South. Signs and symptoms of a black widow spider bite may include: At ... fever and nausea Brown recluse spider The brown recluse spider has a ...

Spiders in caves.

Science.gov (United States)

Mammola, Stefano; Isaia, Marco

2017-04-26

World experts of different disciplines, from molecular biology to macro-ecology, recognize the value of cave ecosystems as ideal ecological and evolutionary laboratories. Among other subterranean taxa, spiders stand out as intriguing model organisms for their ecological role of top predators, their unique adaptations to the hypogean medium and their sensitivity to anthropogenic disturbance. As the description of the first eyeless spider ( Stalita taenaria ), an array of papers on subterranean spider biology, ecology and evolution has been published, but a comprehensive review on these topics is still lacking. We provide a general overview of the spider families recorded in hypogean habitats worldwide, we review the different adaptations of hypogean spiders to subterranean life, and we summarize the information gathered so far about their origin, population structure, ecology and conservation status. Finally, we point out the limits of the knowledge we currently have regarding hypogean spiders, aiming to stimulate future research. © 2017 The Author(s).

Improving Emotional Intelligence through Personality Development: The Effect of the Smart Phone Application based Dharma Life Program on Emotional Intelligence

Directory of Open Access Journals (Sweden)

Latha Poonamallee

2018-02-01

Full Text Available Emotional intelligence is established to predict success in leadership effectiveness in various contexts and has been linked to personality factors. This paper introduces Dharma Life Program, a novel approach to improving emotional intelligence by targeting maladaptive personality traits and triggering neuroplasticity through the use of a smart-phone application and mentoring. The program uses neuroplasticity to enable users to create a more adaptive application of their maladaptive traits, thus improving their emotional intelligence. In this study 26 participants underwent the Dharma Life Program in a leadership development setting. We assessed their emotional and social intelligence before and after the Dharma Life Program intervention using the Emotional and Social Competency Inventory (ESCI. The study found a significant improvement in the lowest three competencies and a significant improvement in almost all domains for the entire sample. Our findings suggest that the completion of the Dharma Life Program has a significant positive effect on Emotional and Social Competency scores and offers a new avenue for improving emotional intelligence competencies.

Improving Emotional Intelligence through Personality Development: The Effect of the Smart Phone Application based Dharma Life Program on Emotional Intelligence

Science.gov (United States)

Poonamallee, Latha; Harrington, Alex M.; Nagpal, Manisha; Musial, Alec

2018-01-01

Emotional intelligence is established to predict success in leadership effectiveness in various contexts and has been linked to personality factors. This paper introduces Dharma Life Program, a novel approach to improving emotional intelligence by targeting maladaptive personality traits and triggering neuroplasticity through the use of a smart-phone application and mentoring. The program uses neuroplasticity to enable users to create a more adaptive application of their maladaptive traits, thus improving their emotional intelligence. In this study 26 participants underwent the Dharma Life Program in a leadership development setting. We assessed their emotional and social intelligence before and after the Dharma Life Program intervention using the Emotional and Social Competency Inventory (ESCI). The study found a significant improvement in the lowest three competencies and a significant improvement in almost all domains for the entire sample. Our findings suggest that the completion of the Dharma Life Program has a significant positive effect on Emotional and Social Competency scores and offers a new avenue for improving emotional intelligence competencies. PMID:29527182

Spider phylogenomics: untangling the Spider Tree of Life

Directory of Open Access Journals (Sweden)

Nicole L. Garrison

2016-02-01

Full Text Available Spiders (Order Araneae are massively abundant generalist arthropod predators that are found in nearly every ecosystem on the planet and have persisted for over 380 million years. Spiders have long served as evolutionary models for studying complex mating and web spinning behaviors, key innovation and adaptive radiation hypotheses, and have been inspiration for important theories like sexual selection by female choice. Unfortunately, past major attempts to reconstruct spider phylogeny typically employing the “usual suspect” genes have been unable to produce a well-supported phylogenetic framework for the entire order. To further resolve spider evolutionary relationships we have assembled a transcriptome-based data set comprising 70 ingroup spider taxa. Using maximum likelihood and shortcut coalescence-based approaches, we analyze eight data sets, the largest of which contains 3,398 gene regions and 696,652 amino acid sites forming the largest phylogenomic analysis of spider relationships produced to date. Contrary to long held beliefs that the orb web is the crowning achievement of spider evolution, ancestral state reconstructions of web type support a phylogenetically ancient origin of the orb web, and diversification analyses show that the mostly ground-dwelling, web-less RTA clade diversified faster than orb weavers. Consistent with molecular dating estimates we report herein, this may reflect a major increase in biomass of non-flying insects during the Cretaceous Terrestrial Revolution 125–90 million years ago favoring diversification of spiders that feed on cursorial rather than flying prey. Our results also have major implications for our understanding of spider systematics. Phylogenomic analyses corroborate several well-accepted high level groupings: Opisthothele, Mygalomorphae, Atypoidina, Avicularoidea, Theraphosoidina, Araneomorphae, Entelegynae, Araneoidea, the RTA clade, Dionycha and the Lycosoidea. Alternatively, our results

Spider phylogenomics: untangling the Spider Tree of Life

Science.gov (United States)

Garrison, Nicole L.; Rodriguez, Juanita; Agnarsson, Ingi; Coddington, Jonathan A.; Griswold, Charles E.; Hamilton, Christopher A.; Hedin, Marshal; Kocot, Kevin M.; Ledford, Joel M.

2016-01-01

Spiders (Order Araneae) are massively abundant generalist arthropod predators that are found in nearly every ecosystem on the planet and have persisted for over 380 million years. Spiders have long served as evolutionary models for studying complex mating and web spinning behaviors, key innovation and adaptive radiation hypotheses, and have been inspiration for important theories like sexual selection by female choice. Unfortunately, past major attempts to reconstruct spider phylogeny typically employing the “usual suspect” genes have been unable to produce a well-supported phylogenetic framework for the entire order. To further resolve spider evolutionary relationships we have assembled a transcriptome-based data set comprising 70 ingroup spider taxa. Using maximum likelihood and shortcut coalescence-based approaches, we analyze eight data sets, the largest of which contains 3,398 gene regions and 696,652 amino acid sites forming the largest phylogenomic analysis of spider relationships produced to date. Contrary to long held beliefs that the orb web is the crowning achievement of spider evolution, ancestral state reconstructions of web type support a phylogenetically ancient origin of the orb web, and diversification analyses show that the mostly ground-dwelling, web-less RTA clade diversified faster than orb weavers. Consistent with molecular dating estimates we report herein, this may reflect a major increase in biomass of non-flying insects during the Cretaceous Terrestrial Revolution 125–90 million years ago favoring diversification of spiders that feed on cursorial rather than flying prey. Our results also have major implications for our understanding of spider systematics. Phylogenomic analyses corroborate several well-accepted high level groupings: Opisthothele, Mygalomorphae, Atypoidina, Avicularoidea, Theraphosoidina, Araneomorphae, Entelegynae, Araneoidea, the RTA clade, Dionycha and the Lycosoidea. Alternatively, our results challenge the

Fluid intelligence, traits of personality and personality disorders in a cohort of adult KS patients with the classic 47, XXY karyotype.

Science.gov (United States)

Liberato, D; Granato, S; Grimaldi, D; Rossi, F M; Tahani, N; Gianfrilli, D; Anzuini, A; Lenzi, A; Cavaggioni, G; Radicioni, A F

2017-11-01

Klinefelter's syndrome (KS) is associated with specific neurobehavioral features and personality traits. The aim of our study was to investigate fluid intelligence, personality traits and personality disorders (PD) and possible correlations with testosterone in a cohort of adult KS patients. We analyzed 58 adult KS patients with the classic 47, XXY karyotype. The Structured Clinical Interview for axis II disorders was used to assess DSM IV personality disorders. Personality traits were assessed using MMPI-2. Fluid intelligence was tested by using Raven's Standard Progressive Matrices (SPM) Test. Testosterone blood concentration was measured by CMIA. PD prevalence was 31%. Four altered MMPI scales (Social Responsibility, Dominance, Ego Strength and Repression) were found in more than 40% of patients. Overcontrolled hostility and MacAndrew Alcoholism Scale-Revised scales were altered in the PD- group only. Biz-Odd Thinking and Post-Traumatic Stress Disorder scale were associated with the presence of personality disorder. The raw SPM score was 44 ± 10.8 without any significant correlation with testosterone. No significant difference in mean age, SPM raw score and MMPI score was observed between eugonadal, hypogonadal and treated patients. Most KS patients had average fluid intelligence. PD prevalence was higher than in the general population. Testosterone was not correlated with fluid intelligence, personality traits or PD, but a reduction in marital distress was observed in treated patients. This could suggest that testosterone therapy can improve physical symptoms and this effect could also improve relationship abilities and wellness awareness.

Respiration in spiders (Araneae).

Science.gov (United States)

Schmitz, Anke

2016-05-01

Spiders (Araneae) are unique regarding their respiratory system: they are the only animal group that breathe simultaneously with lungs and tracheae. Looking at the physiology of respiration the existence of tracheae plays an important role in spiders with a well-developed tracheal system. Other factors as sex, life time, type of prey capture and the high ability to gain energy anaerobically influence the resting and the active metabolic rate intensely. Most spiders have metabolic rates that are much lower than expected from body mass; but especially those with two pairs of lungs. Males normally have higher resting rates than females; spiders that are less evolved and possess a cribellum have lower metabolic rates than higher evolved species. Freely hunting spiders show a higher energy turnover than spiders hunting with a web. Spiders that live longer than 1 year will have lower metabolic rates than those species that die after 1 year in which development and reproduction must be completed. Lower temperatures and starvation, which most spiders can cope with, will decrease the metabolic rate as well.

Speech Intelligibility and Personality Peer-Ratings of Young Adults with Cochlear Implants

Science.gov (United States)

Freeman, Valerie

2018-01-01

Speech intelligibility, or how well a speaker's words are understood by others, affects listeners' judgments of the speaker's competence and personality. Deaf cochlear implant (CI) users vary widely in speech intelligibility, and their speech may have a noticeable "deaf" quality, both of which could evoke negative stereotypes or…

Predicting Academic Success: General Intelligence, "Big Five" Personality Traits, and Work Drive

Science.gov (United States)

Ridgell, Susan D.; Lounsbury, John W.

2004-01-01

General intelligence, Big Five personality traits, and the construct Work Drive were studied in relation to two measures of collegiate academic performance: a single course grade received by undergraduate students in an introductory psychology course, and self-reported GPA. General intelligence and Work Drive were found to be significantly…

Tarantula spider

Science.gov (United States)

... page: //medlineplus.gov/ency/article/002855.htm Tarantula spider bite To use the sharing features on this ... This article describes the effects of a tarantula spider bite. The class of insects to which the ...

Predictors of effective leadership in industry - should engineering education focus on traditional intelligence, personality, or emotional intelligence?

Science.gov (United States)

Lappalainen, Pia

2015-03-01

Despite the changing global and industrial conditions requiring new approaches to leadership, management training as part of higher engineering education still remains understudied. The subsequent gap in engineering education calls for research on today's leader requirements and pedagogy supporting the inclusion of management competence in higher engineering education. Previous organisation and management studies have, on a general level, established the importance of managerial qualities for industrial performance, but the nature and make-up of these qualifications has not been adequately analysed. To fill the related research gap, the present work embarked on a quantitative empirical effort to identify predictors of successful leadership in engineering. In particular, this study investigated relationships between perceived leader performance and three dimensions of managerial capability: (1) mathematical-logical intelligence, (2) personality, and (3) socio-emotional intelligence. This work complemented previous research by resorting to both self-reports and other-reports: the results acquired from the managerial sample were compared to subordinate perceptions as measured through an emotive intelligence other-report and a general managerial competence multi-source appraisal. The sample comprised 80 superiors and 354 subordinates operating in seven organisations in engineering industries. The results from the quantitative measurements signalled the strongest correlation for socio-emotional intelligence and certain personality dimensions with successful leadership. Mathematical-logical intelligence demonstrated no correlation with subordinate perceptions of good leadership. These findings lay the foundation for the incorporation of socio-emotive skills into higher engineering education.

The relationship of emotional intelligence and personality traits (abridged from the survey of students of the Theatre College

Directory of Open Access Journals (Sweden)

Vladimir S. Sobkin

2015-06-01

Full Text Available The paper continues a series of research devoted to the study of personal and professional development of actor students conducted since 2010. The paper presents the results of studying the peculiarities of emotional intelligence and its relationship with personal characteristics of the actor students, carried out on the basis of the Moscow Tabakov Theatre College. The results obtained using the method of diagnosing emotional intelligence MSCEIT and questionnaire by R. Cattell 16 PF are presented. In the research 66 people were interviewed. The characteristics of emotional intelligence of actor students, as well as the results of factor analysis of indicators MSCEIT test and the Cattell’s test are discussed. The hypothesis assumes the existence of meaningful relationships between indicators of emotional intelligence and personal characteristics, fixing volitional and emotional personality traits of the actor student. The analysis of the MSCEIT test results showed that two scales that comprise the domain of experienced emotional intelligence, highly intercorrelated, indicating a connection between the ability to identify emotions and the ability to use emotions to make decisions. It is shown that experienced emotional intelligence of actor students are not associated with personal characteristics. It is revealed that the scale components of the strategic domain of emotional intelligence is positively correlated with personal traits of Cattell’s test: we discovered the link between the scale of Cattell’s General intelligence test (B and “understanding and analyzing emotions” indicator of the MSCEIT test; Cattell’s test I (sensitivity is positively correlated with the “managing emotions” index of emotional intelligence.

Almost a spider: a 305-million-year-old fossil arachnid and spider origins.

Science.gov (United States)

Garwood, Russell J; Dunlop, Jason A; Selden, Paul A; Spencer, Alan R T; Atwood, Robert C; Vo, Nghia T; Drakopoulos, Michael

2016-03-30

Spiders are an important animal group, with a long history. Details of their origins remain limited, with little knowledge of their stem group, and no insights into the sequence of character acquisition during spider evolution. We describe a new fossil arachnid, Idmonarachne brasierigen. et sp. nov. from the Late Carboniferous (Stephanian,ca 305-299 Ma) of Montceau-les-Mines, France. It is three-dimensionally preserved within a siderite concretion, allowing both laboratory- and synchrotron-based phase-contrast computed tomography reconstruction. The latter is a first for siderite-hosted fossils and has allowed us to investigate fine anatomical details. Although distinctly spider-like in habitus, this remarkable fossil lacks a key diagnostic character of Araneae: spinnerets on the underside of the opisthosoma. It also lacks a flagelliform telson found in the recently recognized, spider-related, Devonian-Permian Uraraneida. Cladistic analysis resolves our new fossil as sister group to the spiders: the spider stem-group comprises the uraraneids and I. brasieri While we are unable to demonstrate the presence of spigots in this fossil, the recovered phylogeny suggests the earliest character to evolve on the spider stem-group is the secretion of silk. This would have been followed by the loss of a flagelliform telson, and then the ability to spin silk using spinnerets. This last innovation defines the true spiders, significantly post-dates the origins of silk, and may be a key to the group's success. The Montceau-les-Mines locality has previously yielded a mesothele spider (with spinnerets). Evidently, Late Palaeozoic spiders lived alongside Palaeozoic arachnid grades which approached the spider condition, but did not express the full suite of crown-group autapomorphies. © 2016 The Authors.

Emotional Intelligence, Personality Traits and Career Decision Difficulties

Science.gov (United States)

Di Fabio, Annamaria; Palazzeschi, Letizia

2009-01-01

This study aims to take an in-depth look at the role of emotional intelligence and personality traits in relation to career decision difficulties. The Italian version of the Career Decision Difficulties Questionnaire (CDDQ), the Bar-On Emotional Quotient Inventory: Short (Bar-On EQ-i: S), and the Big Five Questionnaire (BFQ) were administered to…

Verified spider bites in Oregon (USA) with the intent to assess hobo spider venom toxicity.

Science.gov (United States)

McKeown, Nathanael; Vetter, Richard S; Hendrickson, Robert G

2014-06-01

This study compiled 33 verified spider bites from the state of Oregon (USA). The initial goal was to amass a series of bites by the hobo spider to assess whether it possesses toxic venom, a supposition which is currently in a contested state. None of the 33 bites from several spider species developed significant medical symptoms nor did dermonecrosis occur. The most common biters were the yellow sac spider, Cheiracanthium mildei (N = 10) and orb-weavers of the genus Araneus (N = 6). There were 10 bites from three genera of funnel web spiders of the family Agelenidae including one hobo spider bite and one from the congeneric giant house spider which is readily confused as a hobo spider. The hobo spider bite resulted in pain, redness, twitching in the calf muscle and resolved in 12 h. Also generated from this study were possibly the first records of bites from spiders of the genera Callobius (Amaurobiidae) and Antrodiaetus (Antrodiaetidae), both with minor manifestations. Published by Elsevier Ltd.

Funnel-web spider bite

Science.gov (United States)

... page: //medlineplus.gov/ency/article/002844.htm Funnel-web spider bite To use the sharing features on ... the effects of a bite from the funnel-web spider. Male funnel-web spiders are more poisonous ...

Spider Bites (For Parents)

Science.gov (United States)

... Videos for Educators Search English Español First Aid: Spider Bites KidsHealth / For Parents / First Aid: Spider Bites ... rare. Signs and Symptoms Of a brown recluse spider bite: red blister in the center with surrounding ...

STEM-based science learning implementation to identify student’s personal intelligences profiles

Science.gov (United States)

Wiguna, B. J. P. K.; Suwarma, I. R.; Liliawati, W.

2018-05-01

Science and technology are rapidly developing needs to be balanced with the human resources that have the qualified ability. Not only cognitive ability, but also have the soft skills that support 21st century skills. Science, Technology, Engineering, and Mathematics (STEM) Education is a solution to improve the quality of learning and prepare students may be able to trained 21st century skills. This study aims to analyse the implementation of STEM-based science learning on Newton’s law of motion by identifying the personal intelligences profile junior high school students. The method used in this research is pre experiment with the design of the study one group pre-test post-test. Samples in this study were 26 junior high school students taken using Convenience Sampling. Students personal intelligences profile after learning STEM-based science uses two instruments, self-assessment and peer assessment. Intrapersonal intelligence profile based self-assessment and peer assessment are respectively 69.38; and 64.08. As for interpersonal intelligence for self-assessment instrument is 73 and the peer assessment is 60.23.

Flee or fight: ontogenetic changes in the behavior of cobweb spiders in encounters with spider-hunting wasps.

Science.gov (United States)

Uma, Divya B; Weiss, Martha R

2012-12-01

An animal's body size plays a predominant role in shaping its interspecific interactions, and, in encounters between two predators, often determines which shall be predator and which shall be prey. Spiders are top predators of insects, yet can fall prey to mud-dauber wasps that provision their larval nests with paralyzed spiders. Here we examined predator-prey interactions between Chalybion californicum (Saussure) (Sphecidae), a mud-dauber wasp, and Parasteatoda tepidariorum C. L. Koch (Theridiidae), a cobweb spider. We examined whether a spider's size influences its response to an attacking wasp, and report a size-dependent change in spider behavior: small-sized spiders fled, whereas medium- and large-sized spiders fought in response to wasp attacks. From the wasps' perspective, we examined whether spider size influences a wasp's hunting behavior and capture success. We found that wasps commonly approached small spiders, but were much less likely to approach medium and large spiders. However, wasp capture success did not vary with spider size. We also report a strategy used by Chalybion wasps toward cobweb spiders that is consistent with an interpretation of aggressive mimicry.

How Emotional Intelligence Might Get You the Job: The Relationship Between Trait Emotional Intelligence and Faking on Personality Tests

NARCIS (Netherlands)

D.H.M. Pelt (Dirk); D. van der Linden (Dimitri); M.Ph. Born (Marise)

2017-01-01

textabstractThis study examined trait emotional intelligence (EI) in relation to the ability to fake on personality tests. Undergraduate students (N = 129) were first instructed to fill out a personality inventory honestly, and subsequently in such a way as to maximize their chances of obtaining two

SPIDER SILK

Directory of Open Access Journals (Sweden)

PORAV Viorica

2014-05-01

Full Text Available The strengthness and toughness of spider fiber and its multifunctional nature is only surpassed in some cases by synthetic high performance fibers. In the world of natural fibers, spider silk has been long time recognized as a wonder fiber for its unique combination of high strength and rupture elongation. Scientists in civil military engineering reveal that the power of biological material (spider silk lies in the geometric configuration of structural protein, and the small cluster of week hydrogen bonds that works together to resist force and dissipate energy. Each spider and each type of silk has a set of mechanical properties optimized for their biological function. Most silks, in particular deagline silk, have exceptional mechanical properties. They exhibit a unique combination of high tensile strength and extensibility (ductility. This enables a silk fiber to absorb a lot of energy before breaking (toughness, the area under a stress- strain curve. A frequent mistake made in the mainstream media is to confuse strength and toughness when comparing silk to other materials. As shown below in detail, weight for weight, silk is stronger than steel, but not as strong as Kevlar. Silk is,however, tougher than both.This paper inform about overview on the today trend in the world of spider silk.

Artificial Intelligence is Getting Personal : A study on the Usage Motivations and Privacy Concerns of Intelligent Personal Assistants’ Users

OpenAIRE

Tundrea, Darius

2017-01-01

The present study is aiming to evaluate the Intelligent Personal Assistants usage motivations, addressing at the same time various privacy issues and concerns related to this emergent technology. To fulfil the purpose of the study I have applied two different research methods. Initially, a web survey conducted gathered 18 respondents answering 24 questions related to the presented topic. Subsequently, was organised a focus group by gathering seven respondents who shared their opinions on the ...

Intelligent Techniques Using Molecular Data Analysis in Leukaemia: An Opportunity for Personalized Medicine Support System.

Science.gov (United States)

Banjar, Haneen; Adelson, David; Brown, Fred; Chaudhri, Naeem

2017-01-01

The use of intelligent techniques in medicine has brought a ray of hope in terms of treating leukaemia patients. Personalized treatment uses patient's genetic profile to select a mode of treatment. This process makes use of molecular technology and machine learning, to determine the most suitable approach to treating a leukaemia patient. Until now, no reviews have been published from a computational perspective concerning the development of personalized medicine intelligent techniques for leukaemia patients using molecular data analysis. This review studies the published empirical research on personalized medicine in leukaemia and synthesizes findings across studies related to intelligence techniques in leukaemia, with specific attention to particular categories of these studies to help identify opportunities for further research into personalized medicine support systems in chronic myeloid leukaemia. A systematic search was carried out to identify studies using intelligence techniques in leukaemia and to categorize these studies based on leukaemia type and also the task, data source, and purpose of the studies. Most studies used molecular data analysis for personalized medicine, but future advancement for leukaemia patients requires molecular models that use advanced machine-learning methods to automate decision-making in treatment management to deliver supportive medical information to the patient in clinical practice.

Bat Predation by Spiders

Science.gov (United States)

Nyffeler, Martin; Knörnschild, Mirjam

2013-01-01

In this paper more than 50 incidences of bats being captured by spiders are reviewed. Bat-catching spiders have been reported from virtually every continent with the exception of Antarctica (∼90% of the incidences occurring in the warmer areas of the globe between latitude 30° N and 30° S). Most reports refer to the Neotropics (42% of observed incidences), Asia (28.8%), and Australia-Papua New Guinea (13.5%). Bat-catching spiders belong to the mygalomorph family Theraphosidae and the araneomorph families Nephilidae, Araneidae, and Sparassidae. In addition to this, an attack attempt by a large araneomorph hunting spider of the family Pisauridae on an immature bat was witnessed. Eighty-eight percent of the reported incidences of bat catches were attributable to web-building spiders and 12% to hunting spiders. Large tropical orb-weavers of the genera Nephila and Eriophora in particular have been observed catching bats in their huge, strong orb-webs (of up to 1.5 m diameter). The majority of identifiable captured bats were small aerial insectivorous bats, belonging to the families Vespertilionidae (64%) and Emballonuridae (22%) and usually being among the most common bat species in their respective geographic area. While in some instances bats entangled in spider webs may have died of exhaustion, starvation, dehydration, and/or hyperthermia (i.e., non-predation death), there were numerous other instances where spiders were seen actively attacking, killing, and eating the captured bats (i.e., predation). This evidence suggests that spider predation on flying vertebrates is more widespread than previously assumed. PMID:23516436

Bat predation by spiders.

Science.gov (United States)

Nyffeler, Martin; Knörnschild, Mirjam

2013-01-01

In this paper more than 50 incidences of bats being captured by spiders are reviewed. Bat-catching spiders have been reported from virtually every continent with the exception of Antarctica (≈ 90% of the incidences occurring in the warmer areas of the globe between latitude 30° N and 30° S). Most reports refer to the Neotropics (42% of observed incidences), Asia (28.8%), and Australia-Papua New Guinea (13.5%). Bat-catching spiders belong to the mygalomorph family Theraphosidae and the araneomorph families Nephilidae, Araneidae, and Sparassidae. In addition to this, an attack attempt by a large araneomorph hunting spider of the family Pisauridae on an immature bat was witnessed. Eighty-eight percent of the reported incidences of bat catches were attributable to web-building spiders and 12% to hunting spiders. Large tropical orb-weavers of the genera Nephila and Eriophora in particular have been observed catching bats in their huge, strong orb-webs (of up to 1.5 m diameter). The majority of identifiable captured bats were small aerial insectivorous bats, belonging to the families Vespertilionidae (64%) and Emballonuridae (22%) and usually being among the most common bat species in their respective geographic area. While in some instances bats entangled in spider webs may have died of exhaustion, starvation, dehydration, and/or hyperthermia (i.e., non-predation death), there were numerous other instances where spiders were seen actively attacking, killing, and eating the captured bats (i.e., predation). This evidence suggests that spider predation on flying vertebrates is more widespread than previously assumed.

Goal orientations predict academic performance beyond intelligence and personality

NARCIS (Netherlands)

Steinmayr, R.; Bipp, T.; Spinath, B.

2011-01-01

Goal orientations are thought to be an important predictor of scholastic achievement. The present paper investigated the joint influence of goal orientations, intelligence, and personality on school performance in a sample of N = 520 11th and 12th graders (303 female; mean age M = 16.94 years).

What Has Personality and Emotional Intelligence to Do with "Feeling Different" while Using a Foreign Language?

Science.gov (United States)

Ozanska-Ponikwia, Katarzyna

2012-01-01

The present study investigates the link between personality traits (OCEAN Personality test), emotional intelligence (EI) (Trait Emotional Intelligence Questionnaire) and the notion of "feeling different" while using a foreign language among 102 Polish-English bilinguals and Polish L2 users of English who were immersed in a foreign language and…

Is Nurses' Professional Competence Related to Their Personality and Emotional Intelligence? A Cross-Sectional Study.

Science.gov (United States)

Heydari, Abbas; Kareshki, Hossein; Armat, Mohammad Reza

2016-01-01

Nurses' professional competence is a crucial factor in clinical practice. Systematic evaluation of nurses' competence and its related factors are essential for enhancing the quality of nursing care. This study aimed to assess the nurses' competence level and its possible relationship with their personality and emotional intelligence. Using a cross-sectional survey design, three instruments including Nurse Competence Scale, short form of Schutte Self Report Emotional Intelligence Test, and the short 10-item version of Big Five Factor Inventory, were administered simultaneously to a randomized stratified sample of 220 nurses working in hospitals affiliated to Mashhad University of Medical Sciences. Data analysis was performed using SPSS 11.5. Majority of nurses rated themselves as "good" and "very good", with the highest scores in "managing situations" and "work role" dimensions of nurse competence. A relatively similar pattern of scores was seen in competence dimensions, personality and emotional intelligence, among male and female nurses. Emotional intelligence and personality scores showed a significant relationship with nurses' competence, explaining almost 20% of variations in nurse competence scores. Iranian nurses evaluated their overall professional competence at similar level of the nurses in other countries. Knowledge about the nurses' competence level and its related factors, including personality and emotional intelligence, may help nurse managers in enhancing nurses' professional competence through appropriate task assignments and conducting in-service educational programs, thus improving the health status of patients.

Employees High in Personal Intelligence Differ From Their Colleagues in Workplace Perceptions and Behavior.

Science.gov (United States)

Mayer, John D; Lortie, Brendan; Panter, A T; Caruso, David R

2018-05-02

Personal intelligence (PI) involves the ability to recognize, reason, and use information about personality to understand oneself and other people. Employees in two studies (Ns = 394, 482) completed the Test of Personal Intelligence (TOPI; e.g., Mayer, Panter, & Caruso, 2017a) and assessments of workplace perception and behavior. Higher PI was associated with higher perceived workplace support and lower counterproductive work behavior. These relationships continued to hold after controlling for other key variables. The results indicate the TOPI, although still in research trials, shows promise as a screening device for selecting employees and targeting individuals for training.

Intelligence, General Knowledge and Personality as Predictors of Creativity

Science.gov (United States)

Batey, Mark; Furnham, Adrian; Safiullina, Xeniya

2010-01-01

This study sought to examine the contribution of fluid intelligence, general knowledge and Big Five personality traits in predicting four indices of creativity: Divergent Thinking (DT) fluency, Rated DT, Creative Achievement and Self-Rated creativity and a combined Total Creativity variable. When creativity was assessed by DT test, the consistent…

Did You Say Spiders?

Science.gov (United States)

Campbell, Alene

This spider unit focuses on students' development of cooperative learning and inquiry-based skills. Students read "The Very Busy Spider" by Eric Carle, and then work in cooperative groups using the Internet to research and synthesize important information about spiders. Technology is used for vocabulary instruction and to create a…

Are executive functions related to emotional intelligence? A correlational study in schizophrenia and borderline personality disorder.

Science.gov (United States)

Hurtado, M M; Triviño, M; Arnedo, M; Roldán, G; Tudela, P

2016-12-30

This research explored the relationship between executive functions (working memory and reasoning subtests of the Wechsler Adult Intelligence Scale, Trail Making and Stroop tests, fluency and planning tasks, and Wisconsin Card Sorting Test) and emotional intelligence measured by the Mayer-Salovey-Caruso Emotional Intelligence Test in patients with schizophrenia or borderline personality disorder compared to a control group. As expected, both clinical groups performed worse than the control group in executive functions and emotional intelligence, although the impairment was greater in the borderline personality disorder group. Executive functions significantly correlated with social functioning. Results are discussed in relation to the brain circuits that mediate executive functions and emotional intelligence and the findings obtained with other models of social cognition. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

The location of the Trait Emotional Intelligence in the Zuckerman's Personality Model space and the role of General Intelligence and social status.

Science.gov (United States)

Blanco, Eduardo; García, Luis Francisco; Aluja, Anton

2016-10-01

The aim of this study was to investigate the relationships between Emotional Intelligence (EI) measured by the Trait Emotional Intelligence Questionnaire (TEIQue) and personality measured by the Zuckerman-Kuhlman-Aluja Personality Questionnaire (ZKA-PQ) with the purpose of analyzing similarities and differences of both psychological constructs. Additionally, we studied the relationship among EI, personality, General Intelligence (GI) and a social position index (SPI). Results showed that the ZKA-PQ predicts the 66% (facets) and the 64% (factors) of the TEIQue. High scores in EI correlated negatively with Neuroticism (r: -0.66) and Aggressiveness (r: -0.27); and positively with Extraversion (r: 0.62). Oblique factorial analyses demonstrated that TEIQue scales were located basically in the Neuroticism and Extraversion factors. The SPI and GI no loaded in any factor. These findings showed that EI is a not a distinct construct of personality and it cannot be isolated in the ZKA-PQ personality space. GI is related with the SPI (r: 0.26), and EI correlated with GI (r: 0.18) and SPI (r: 0.16). Nevertheless, we found differences between GI high groups and the TEIQue and ZKA-PQ factors when controlling age and sex. These findings are discussed in the individual differences context. © 2016 Scandinavian Psychological Associations and John Wiley & Sons Ltd.

Ant mimicry lessens predation on a North American jumping spider by larger salticid spiders.

Science.gov (United States)

Durkee, Caitlin A; Weiss, Martha R; Uma, Divya B

2011-10-01

Ant-like appearance (myrmecomorphy) has evolved >70 times in insects and spiders, accounting for >2,000 species of myrmecomorphic arthropods. Most myrmecomorphic spiders are considered to be Batesian mimics; that is, a palatable spider avoids predation through resemblance to an unpalatable ant-although this presumption has been tested in relatively few cases. Here we explicitly examined the extent to which Peckhamia picata (Salticidae), a North American ant-mimicking jumping spider, is protected from four species of jumping spider predators, relative to nonmimetic salticids and model ants. In addition, we conducted focused behavioral observations on one salticid predator, Thiodina puerpera, to determine the point at which the predators' behaviors toward model, mimic, and nonmimic diverge. We also examined the behaviors of Peckhamia in the presence of Thiodina. We found that mimetic jumping spiders were consumed less than a third as often as nonmimetic jumping spiders, suggesting that Peckhamia does indeed gain protection as a result of its resemblance to ants, and so can be considered a Batesian mimic. Furthermore, our focal predator did not consume any ant-mimicking spiders, and seemed to categorize Peckhamia with its model ant early in the hunting sequence. Such early determination of prey versus nonprey may be the result of speed-accuracy trade-offs in predator decision-making.

Black widow spider

Science.gov (United States)

... medlineplus.gov/ency/article/002858.htm Black widow spider To use the sharing features on this page, please enable JavaScript. The black widow spider (Latrodectus) has a shiny black body with a ...

Is Nurses' Professional Competence Related to Their Personality and Emotional Intelligence? A Cross-Sectional Study

Directory of Open Access Journals (Sweden)

Abbas Heydari

2016-01-01

Full Text Available Introduction: Nurses' professional competence is a crucial factor in clinical practice. Systematic evaluation of nurses’ competence and its related factors are essential for enhancing the quality of nursing care. This study aimed to assess the nurses’ competence level and its possible relationship with their personality and emotional intelligence. Methods: Using a cross-sectional survey design, three instruments including Nurse Competence Scale, short form of Schutte Self Report Emotional Intelligence Test, and the short 10-item version of Big Five Factor Inventory, were administered simultaneously to a randomized stratified sample of 220 nurses working in hospitals affiliated to Mashhad University of Medical Sciences. Data analysis was performed using SPSS 11.5. Results: Majority of nurses rated themselves as "good" and "very good", with the highest scores in "managing situations" and "work role" dimensions of nurse competence. A relatively similar pattern of scores was seen in competence dimensions, personality and emotional intelligence, among male and female nurses. Emotional intelligence and personality scores showed a significant relationship with nurses’ competence, explaining almost 20% of variations in nurse competence scores. Conclusion: Iranian nurses evaluated their overall professional competence at similar level of the nurses in other countries. Knowledge about the nurses’ competence level and its related factors, including personality and emotional intelligence, may help nurse managers in enhancing nurses' professional competence through appropriate task assignments and conducting in-service educational programs, thus improving the health status of patients.

What you fear will appear: detection of schematic spiders in spider fear.

Science.gov (United States)

Peira, Nathalie; Golkar, Armita; Larsson, Maria; Wiens, Stefan

2010-01-01

Various experimental tasks suggest that fear guides attention. However, because these tasks often lack ecological validity, it is unclear to what extent results from these tasks can be generalized to real-life situations. In change detection tasks, a brief interruption of the visual input (i.e., a blank interval or a scene cut) often results in undetected changes in the scene. This setup resembles real-life viewing behavior and is used here to increase ecological validity of the attentional task without compromising control over the stimuli presented. Spider-fearful and nonfearful women detected schematic spiders and flowers that were added to one of two identical background pictures that alternated with a brief blank in between them (i.e., flicker paradigm). Results showed that spider-fearful women detected spiders (but not flowers) faster than did nonfearful women. Because spiders and flowers had similar low-level features, these findings suggest that fear guides attention on the basis of object features rather than simple low-level features.

Brown Recluse Spider

Science.gov (United States)

... to a group of spiders commonly known as violin spiders or fiddlebacks. The characteristic fiddle-shaped pattern ... 4-19.1mm) • Color: Golden brown • A dark violin/fiddle shape (see top photo) is located on ...

The Effect of Paternal Age on Offspring Intelligence and Personality when Controlling for Parental Trait Levels

Science.gov (United States)

Arslan, Ruben C.; Penke, Lars; Johnson, Wendy; Iacono, William G.; McGue, Matt

2014-01-01

Paternal age at conception has been found to predict the number of new genetic mutations. We examined the effect of father’s age at birth on offspring intelligence, head circumference and personality traits. Using the Minnesota Twin Family Study sample we tested paternal age effects while controlling for parents’ trait levels measured with the same precision as offspring’s. From evolutionary genetic considerations we predicted a negative effect of paternal age on offspring intelligence, but not on other traits. Controlling for parental intelligence (IQ) had the effect of turning an initially positive association non-significantly negative. We found paternal age effects on offspring IQ and Multidimensional Personality Questionnaire Absorption, but they were not robustly significant, nor replicable with additional covariates. No other noteworthy effects were found. Parents’ intelligence and personality correlated with their ages at twin birth, which may have obscured a small negative effect of advanced paternal age (birth order and the Flynn effect. PMID:24587224

The effect of paternal age on offspring intelligence and personality when controlling for paternal trait level.

Science.gov (United States)

Arslan, Ruben C; Penke, Lars; Johnson, Wendy; Iacono, William G; McGue, Matt

2014-01-01

Paternal age at conception has been found to predict the number of new genetic mutations. We examined the effect of father's age at birth on offspring intelligence, head circumference and personality traits. Using the Minnesota Twin Family Study sample we tested paternal age effects while controlling for parents' trait levels measured with the same precision as offspring's. From evolutionary genetic considerations we predicted a negative effect of paternal age on offspring intelligence, but not on other traits. Controlling for parental intelligence (IQ) had the effect of turning an initially positive association non-significantly negative. We found paternal age effects on offspring IQ and Multidimensional Personality Questionnaire Absorption, but they were not robustly significant, nor replicable with additional covariates. No other noteworthy effects were found. Parents' intelligence and personality correlated with their ages at twin birth, which may have obscured a small negative effect of advanced paternal age (birth order and the Flynn effect.

Development of Android Based Powered Intelligent Wheelchair for Quadriplegic Persons

Science.gov (United States)

Gupta, Ashutosh; Ghosh, Tathagata; Kumar, Pradeep; Bhawna, Shruthi. S.

2017-08-01

Several surveys give us the view that both children and adults benefit substantially from access towards independent mobility. With the inventions of technology, no individuals are satisfied with traditional manual operated machines. To accommodate population, researchers are using technology, originally developed for mobile robots to create ‘intelligent wheelchairs’. It’s a major challenge for quadriplegic persons as they really find it difficult to manipulate powered wheelchair during the activities of their daily living. As the Smartphone era has evolved with innovative android based applications, engineers are improving and trying to make such machines simple and cheap to the next level. In this paper, we present a development of android based powered intelligent wheelchair to assist the quadriplegic person by making them self sufficient in controlling the wheelchair. The wheels of the chair can be controlled by the voice or gesture movement or by touching the screen of the android app by the challenged persons. The system uses the Bluetooth communication to interface the microcontroller and the inbuilt sensors in the android Smartphone. According to the commands received from android phone, the kinematics of the wheels are controlled.

Trait Emotional Intelligence and Personality: Gender-Invariant Linkages Across Different Measures of the Big Five.

OpenAIRE

Siegling, A. B.; Furnham, A.; Petrides, K. V.

2015-01-01

This study investigated if the linkages between trait emotional intelligence (trait EI) and the Five-Factor Model of personality were invariant between men and women. Five English-speaking samples (N = 307-685) of mostly undergraduate students each completed a different measure of the Big Five personality traits and either the full form or short form of the Trait Emotional Intelligence Questionnaire (TEIQue). Across samples, models predicting global TEIQue scores from the Big Five were invari...

The effect of paternal age on offspring intelligence and personality when controlling for paternal trait level.

Directory of Open Access Journals (Sweden)

Ruben C Arslan

Full Text Available Paternal age at conception has been found to predict the number of new genetic mutations. We examined the effect of father's age at birth on offspring intelligence, head circumference and personality traits. Using the Minnesota Twin Family Study sample we tested paternal age effects while controlling for parents' trait levels measured with the same precision as offspring's. From evolutionary genetic considerations we predicted a negative effect of paternal age on offspring intelligence, but not on other traits. Controlling for parental intelligence (IQ had the effect of turning an initially positive association non-significantly negative. We found paternal age effects on offspring IQ and Multidimensional Personality Questionnaire Absorption, but they were not robustly significant, nor replicable with additional covariates. No other noteworthy effects were found. Parents' intelligence and personality correlated with their ages at twin birth, which may have obscured a small negative effect of advanced paternal age (<1% of variance explained on intelligence. We discuss future avenues for studies of paternal age effects and suggest that stronger research designs are needed to rule out confounding factors involving birth order and the Flynn effect.

Conflict management styles, emotional intelligence and implicit theories of personality of nursing students: a cross-sectional study.

Science.gov (United States)

Chan, Joanne C Y; Sit, Emily N M; Lau, W M

2014-06-01

Conflict management is an essential skill that nursing students need to master as conflict is unavoidable in clinical settings. Examining nursing students' conflict management styles and the associating factors can inform nurse educators on how to equip nursing students for effective conflict management. This study aimed at examining undergraduate nursing students conflict management styles in managing conflict with their supervisors in clinical placement. The associations of emotional intelligence and implicit theories of personality with conflict management styles were also investigated. This is a cross-sectional quantitative survey. This study took place at a nursing school at a university in Hong Kong. 568 undergraduate nursing students participated in the study. Students completed a questionnaire which consisted of demographics, Measure of Implicit Theories of Personality, The Schutte Emotional Intelligence Scale (SEIS) and The Rahim Organizational Conflict Inventory-II (ROCI-II) and received a HKD 20 book coupon as compensation. The data were analyzed by descriptive statistics, reliability analyses, t-tests, correlational and linear regression analyses. For managing conflict with clinical supervisors, students used obliging and integrating most frequently whereas used dominating least. Emotional intelligence was a significant predictor of all five conflict management styles. The higher the emotional intelligence, the more students used integrating, obliging, compromising and dominating. The lower the emotional intelligence, the more students used avoiding. There was a significant association between implicit theories of personality and compromising. The less malleable students perceived personality to be, the more they used compromising. Emotional intelligence was significantly associated with all five conflict management styles while implicit theories of personality were significantly associated with compromising style only. Efforts of nurse educators to

The five factor model of personality and intelligence: A twin study on the relationship between the two constructs

NARCIS (Netherlands)

Bartels, M.; van Weegen, F.I.; van Beijsterveldt, C.E.M.; Carlier, M.; Polderman, T.J.C.; Hoekstra, R.A.; Boomsma, D.I.

2012-01-01

We assessed the association and underlying genetic and environmental influences among intelligence (IQ) and personality in adolescent and young adult twins. Data on intelligence were obtained from psychometric IQ tests and personality was assessed with the short form of the NEO five factor inventory

Factor analysis of Wechsler Adult Intelligence Scale-Revised in developmentally disabled persons.

Science.gov (United States)

Di Nuovo, Santo F; Buono, Serafino

2006-12-01

The results of previous studies on the factorial structure of Wechsler Intelligence Scales are somewhat inconsistent across normal and pathological samples. To study specific clinical groups, such as developmentally disabled persons, it is useful to examine the factor structure in appropriate samples. A factor analysis was carried out using the principal component method and the Varimax orthogonal rotation on the Wechsler Adult Intelligence Scale (WAIS-R) in a sample of 203 developmentally disabled persons, with a mean age of 25 years 4 months. Developmental disability ranged from mild to moderate. Partially contrasting with previous studies on normal samples, results found a two-factor solution. Wechsler's traditional Verbal and Performance scales seems to be more appropriate for this sample than the alternative three-factor solution.

THE EXECUTION OF PLANNED DETOURS BY SPIDER-EATING PREDATORS

Science.gov (United States)

Cross, Fiona R.; Jackson, Robert R.

2016-01-01

Many spiders from the salticid subfamily Spartaeinae specialize at preying on other spiders and they adopt complex strategies when targeting these dangerous prey. We tested 15 of these spider-eating spartaeine species for the capacity to plan detours ahead of time. Each trial began with the test subject on top of a tower from which it could view two boxes: one containing prey and the other not containing prey. The distance between the tower and the boxes was too far to reach by leaping and the tower sat on a platform surrounded by water. As the species studied are known to avoid water, the only way they could reach the prey without getting wet was by taking one of two circuitous walkways from the platform: one leading to the prey (‘correct’) and one not leading to the prey (‘incorrect’). After leaving the tower, the test subject could not see the prey and sometimes it had to walk past the incorrect walkway before reaching the correct walkway. Yet all 15 species chose the correct walkway significantly more often than the incorrect walkway. We propose that these findings exemplify genuine cognition based on representation. PMID:26781057

Resident Advisor General Intelligence, Emotional Intelligence, Personality Dimensions, and Internal Belief Characteristics as Predictors of Rated Performance

Science.gov (United States)

Wu, Max B.; Stemler, Steven

2008-01-01

Resident Advisors (RAs) have a significant hand in helping students adjust and thrive in college life. Given the importance of selecting high-performing RAs, this study sought to examine how well various measures of intelligence (e.g., general, emotional) in addition to personality and additional "internal belief" characteristics predict…

Hedonic and eudaimonic well-being: The role of resilience beyond fluid intelligence and personality traits

Directory of Open Access Journals (Sweden)

Annamaria eDi Fabio

2015-09-01

Full Text Available Resilience is a key factor in the well-being of individuals. The present study set out to analyze the role of fluid intelligence, personality traits, and resilience in hedonic and eudaimonic well-being in order to determine the incremental validity of resilience with respect to fluid intelligence and personality traits in 168 Italian high school students. The Advanced Progressive Matrices (APM, the Big Five Questionnaire (BFQ, the Connor-Davidson Resilience Scale (CD-RISC, the Satisfaction With Life Scale (SWLS, the Positive and Negative Affect Schedule (PANAS, the Meaningful Life Measure (MLM, the Authenticity Scale (AS were administered to the participants in the study. The results showed that resilience added a significant percentage of incremental variance with respect to fluid intelligence and personality traits in relation to life satisfaction, positive affect, life meaning, and authenticity. These results underline the value of resilience in both hedonic and eudaimonic well-being, thus offering new perspectives for research and intervention.

Intelligent Personal Supercomputer for Solving Scientific and Technical Problems

Directory of Open Access Journals (Sweden)

Khimich, O.M.

2016-09-01

Full Text Available New domestic intellіgent personal supercomputer of hybrid architecture Inparkom_pg for the mathematical modeling of processes in the defense industry, engineering, construction, etc. was developed. Intelligent software for the automatic research and tasks of computational mathematics with approximate data of different structures was designed. Applied software to provide mathematical modeling problems in construction, welding and filtration processes was implemented.

Nature Study Tips. Spiders.

Science.gov (United States)

Mulaik, Stanley B.

1990-01-01

Different types of spiders, their ranges and habits are discussed. Activities associated with the study of spiders are suggested. Four references are listed which may be of interest to beginners. (CW)

The evolution of sociality in spiders

DEFF Research Database (Denmark)

Lubin, Yael; Bilde, T.

2007-01-01

. Anelosimus (Theridiidae) C. Sociality in Spiders: An Evolutionary Dead End? V. Evolution and Maintenance of Sociality in Spiders: Relevant Models A. Kin Selection 1. Kin Recognition 2. Inbreeding and Kin Selection B. Multilevel Selection (Group Selection) C. Ecological Benefits D. Ecological Constraints E......I. Introducing Social Spiders II. Social and Subsocial Species: A Survey of Behavioral Traits III. Inbred Sociality in Spiders A. Cooperation Versus Competition: A Balancing Act B. Do Social Spiders Have Division of Labor? C. Colony Foundation: Propagule Dispersal Versus Fission D. Female......-Biased Colony Sex Ratios: Primary and Operational Sex Ratios E. Mating System: Inbreeding and Its Population-Genetic Consequences F. "Boom and Bust" Colony Dynamics IV. Phylogenetic Relationships Among Social Spider Species A. Common Features of Social Evolution B. Case Studies 1. Stegodyphus (Eresidae) 2...

The relationship of Emotional Intelligence with Academic Intelligence and the Big Five

NARCIS (Netherlands)

Van der Zee, K.I.; Thijs, Melanie; Schakel, Lolle

The present study examines the relationship of self- and other ratings of emotional intelligence with academic intelligence and personality, as well as the incremental validity of emotional intelligence beyond academic intelligence and personality in predicting academic and social success. A sample

The relationship of emotional intelligence with academic intelligence and the Big Five

NARCIS (Netherlands)

van der Zee, K; Thijs, M; Schakel, L

2002-01-01

The present study examines the relationship of self- and other ratings of emotional intelligence with academic intelligence and personality, as well as the incremental validity of emotional intelligence beyond academic intelligence and personality in predicting academic and social success. A sample

Non-webbuilding spiders: prey specialists or generalists?

Science.gov (United States)

Nentwig, Wolfgang

1986-07-01

Feeding experiments were performed with seven species of non-webbuilding spiders and a variety of prey taxa. Some species were generally polyphagous whereas other spiders restricted their prey to a few groups. At one end of the spectrum of prey specialization the thomisid Misumena vatia is limited to a few taxa of possible prey (Table 1). The literature of prey records of non-webbuilding spiders is reviewed (Table 2) with special emphasis on oligophagous or monophagous spiders. Monophagous spiders are generally rare and have specialized on only a few prey taxa: social insects (ants, bees, termites) and spiders.

Remembering the object you fear: brain potentials during recognition of spiders in spider-fearful individuals.

Science.gov (United States)

Michalowski, Jaroslaw M; Weymar, Mathias; Hamm, Alfons O

2014-01-01

In the present study we investigated long-term memory for unpleasant, neutral and spider pictures in 15 spider-fearful and 15 non-fearful control individuals using behavioral and electrophysiological measures. During the initial (incidental) encoding, pictures were passively viewed in three separate blocks and were subsequently rated for valence and arousal. A recognition memory task was performed one week later in which old and new unpleasant, neutral and spider pictures were presented. Replicating previous results, we found enhanced memory performance and higher confidence ratings for unpleasant when compared to neutral materials in both animal fearful individuals and controls. When compared to controls high animal fearful individuals also showed a tendency towards better memory accuracy and significantly higher confidence during recognition of spider pictures, suggesting that memory of objects prompting specific fear is also facilitated in fearful individuals. In line, spider-fearful but not control participants responded with larger ERP positivity for correctly recognized old when compared to correctly rejected new spider pictures, thus showing the same effects in the neural signature of emotional memory for feared objects that were already discovered for other emotional materials. The increased fear memory for phobic materials observed in the present study in spider-fearful individuals might result in an enhanced fear response and reinforce negative beliefs aggravating anxiety symptomatology and hindering recovery.

Science Education Resources on the Web--Spiders.

Science.gov (United States)

Thirunarayanan, M. O.

1997-01-01

Lists Web sites containing information on spiders and offers brief descriptions of the information available at those sites. The 11 sites provide information on taxonomy of spiders, anatomy, different ways spiders use silk, Internet mailing lists, folk literature and art, bibliographies, night collection, and spiders commonly found in the state of…

Aquatic subsidies transport anthropogenic nitrogen to riparian spiders

Energy Technology Data Exchange (ETDEWEB)

Akamatsu, Fumikazu, E-mail: f-akamt55@pwri.go.jp [Department of Environmental Sciences, Shinshu University, 3-1-1 Asahi, Matsumoto, Nagano 390-8621 (Japan); Toda, Hideshige [Department of Environmental Sciences, Shinshu University, 3-1-1 Asahi, Matsumoto, Nagano 390-8621 (Japan)

2011-05-15

Stable nitrogen isotopic composition ({delta}{sup 15}N) of aquatic biota increases with anthropogenic N inputs such as sewage and livestock waste downstream. Increase in {delta}{sup 15}N of riparian spiders downstream may reflect the anthropogenic pollution exposure through predation on aquatic insects. A two-source mixing model based on stable carbon isotopic composition showed the greatest dependence on aquatic insects (84%) by horizontal web-building spiders, followed by intermediate (48%) and low (31%) dependence by cursorial and vertical web-building spiders, respectively. The spider body size was negatively correlated with the dietary proportion of aquatic insects and spider {delta}{sup 15}N. The aquatic subsidies transported anthropogenic N to smaller riparian spiders downstream. This transport of anthropogenic N was regulated by spider's guild designation and body size. - Highlights: > {delta}{sup 15}N of aquatic insects increases downstream with anthropogenic nitrogen inputs. > {delta}{sup 15}N of riparian spiders increases with a high dietary proportion of aquatic insects and smaller spider body size. > The aquatic subsidies transport anthropogenic nitrogen to smaller riparian spiders downstream. - Smaller spiders assimilate anthropogenic nitrogen through the predation on aquatic subsides.

Aquatic subsidies transport anthropogenic nitrogen to riparian spiders

International Nuclear Information System (INIS)

Akamatsu, Fumikazu; Toda, Hideshige

2011-01-01

Stable nitrogen isotopic composition (δ 15 N) of aquatic biota increases with anthropogenic N inputs such as sewage and livestock waste downstream. Increase in δ 15 N of riparian spiders downstream may reflect the anthropogenic pollution exposure through predation on aquatic insects. A two-source mixing model based on stable carbon isotopic composition showed the greatest dependence on aquatic insects (84%) by horizontal web-building spiders, followed by intermediate (48%) and low (31%) dependence by cursorial and vertical web-building spiders, respectively. The spider body size was negatively correlated with the dietary proportion of aquatic insects and spider δ 15 N. The aquatic subsidies transported anthropogenic N to smaller riparian spiders downstream. This transport of anthropogenic N was regulated by spider's guild designation and body size. - Highlights: → δ 15 N of aquatic insects increases downstream with anthropogenic nitrogen inputs. → δ 15 N of riparian spiders increases with a high dietary proportion of aquatic insects and smaller spider body size. → The aquatic subsidies transport anthropogenic nitrogen to smaller riparian spiders downstream. - Smaller spiders assimilate anthropogenic nitrogen through the predation on aquatic subsides.

Successful Graduate Students: The Roles of Personality Traits and Emotional Intelligence

Science.gov (United States)

Grehan, Patrick M.; Flanagan, Rosemary; Malgady, Robert G.

2011-01-01

Given the complex role of school psychologists, it is in the interest of stakeholders to identify characteristics related to student success in graduate training, which is suggestive of their effectiveness as practitioners. This study explores the relationship of personality traits and Emotional Intelligence (EI) to graduate students' performance…

Career Indecision versus Indecisiveness: Associations with Personality Traits and Emotional Intelligence

Science.gov (United States)

Di Fabio, Annamaria; Palazzeschi, Letizia; Asulin-Peretz, Lisa; Gati, Itamar

2013-01-01

The goal of the present study was to investigate the distinctions between career indecision and indecisiveness. The different patterns of the associations between career indecision and indecisiveness, on one hand, and personality traits, career decision-making self-efficacy, perceived social support, and emotional intelligence, on the other, were…

Radiation effect onto biodiversity of spiders

International Nuclear Information System (INIS)

Mehrabova, M.A.; Naghiyev, J.A; Huseynov, N.I; Topchiyeva, Sh.A.; Hasanov, N.H.

2010-01-01

At present time spiders are one of the considerably diverse groups of living organisms in fauna of Azerbayjan Republic. They play an important in environmental chain, being the main group of wild arthropodas in most biocoenoses. Therefore, it's not surprised that recently an increased interest has being observed to the study of spiders as indicators of environmental conditions. Spiders have been collected in polluted areas, their identification and sampling of soil, water and plants has been conducted. The degree of radionuclides' impact on the number and distribution of spiders and their venom in the observed zones of Azerbaijan has been revealed and preliminarily predicted. The number of the collected spiders equals to 292 which has been determined later at an electronic identifier Spinnen Mitteleuropas. The radionuclides in spiders have been determined at Canberra facility. Different natural radioactive elements were revealed in the investigated samples.

Energetics, scaling and sexual size dimorphism of spiders.

Science.gov (United States)

Grossi, B; Canals, M

2015-03-01

The extreme sexual size dimorphism in spiders has motivated studies for many years. In many species the male can be very small relative to the female. There are several hypotheses trying to explain this fact, most of them emphasizing the role of energy in determining spider size. The aim of this paper is to review the role of energy in sexual size dimorphism of spiders, even for those spiders that do not necessarily live in high foliage, using physical and allometric principles. Here we propose that the cost of transport or equivalently energy expenditure and the speed are traits under selection pressure in male spiders, favoring those of smaller size to reduce travel costs. The morphology of the spiders responds to these selective forces depending upon the lifestyle of the spiders. Climbing and bridging spiders must overcome the force of gravity. If bridging allows faster dispersal, small males would have a selective advantage by enjoying more mating opportunities. In wandering spiders with low population density and as a consequence few male-male interactions, high speed and low energy expenditure or cost of transport should be favored by natural selection. Pendulum mechanics show the advantages of long legs in spiders and their relationship with high speed, even in climbing and bridging spiders. Thus small size, compensated by long legs should be the expected morphology for a fast and mobile male spider.

But what about the Empress of Racnoss? The allocation of attention to spiders and Doctor Who in a visual search task is predicted by fear and expertise.

Science.gov (United States)

Purkis, Helena M; Lester, Kathryn J; Field, Andy P

2011-12-01

If there is a spider in the room, then the spider phobic in your group is most likely to point it out to you. This phenomenon is believed to arise because our attentional systems are hardwired to attend to threat in our environment, and, to a spider phobic, spiders are threatening. However, an alternative explanation is simply that attention is quickly drawn to the stimulus of most personal relevance in the environment. Our research examined whether positive stimuli with no biological or evolutionary relevance could be allocated preferential attention. We compared attention to pictures of spiders with pictures from the TV program Doctor Who, for people who varied in both their love of Doctor Who and their fear of spiders. We found a double dissociation: interference from spider and Doctor-Who-related images in a visual search task was predicted by spider fear and Doctor Who expertise, respectively. As such, allocation of attention reflected the personal relevance of the images rather than their threat content. The attentional system believed to have a causal role in anxiety disorders is therefore likely to be a general system that responds not to threat but to stimulus relevance; hence, nonevolutionary images, such as those from Doctor Who, captured attention as quickly as fear-relevant spider images. Where this leaves the Empress of Racnoss, we are unsure. (c) 2011 APA, all rights reserved.

Spiders do have melanin after all.

Science.gov (United States)

Hsiung, Bor-Kai; Blackledge, Todd A; Shawkey, Matthew D

2015-11-01

Melanin pigments are broadly distributed in nature - from bacteria to fungi to plants and animals. However, many previous attempts to identify melanins in spiders were unsuccessful, suggesting that these otherwise ubiquitous pigments were lost during spider evolution. Yet, spiders exhibit many dark colours similar to those produced by melanins in other organisms, and the low solubility of melanins makes isolation and characterization difficult. Therefore, whether melanins are truly absent or have simply not yet been detected is an open question. Raman spectroscopy provides a reliable way to detect melanins in situ, without the need for isolation. In this study, we document the presence of eumelanin in diverse species of spiders using confocal Raman microspectroscopy. Comparisons of spectra with theoretically calculated data falsify the previous hypothesis that dark colours are produced solely by ommochromes in spiders. Our data indicate that melanins are present in spiders and further supporting that they are present in most living organisms. © 2015. Published by The Company of Biologists Ltd.

Phobic spider fear is associated with enhanced attentional capture by spider pictures: a rapid serial presentation event-related potential study.

Science.gov (United States)

Van Strien, Jan W; Franken, Ingmar H A; Huijding, Jorg

2009-03-04

The early posterior negativity (EPN) reflects early selective visual processing of emotionally significant information. This study explored the association between fear of spiders and the EPN for spider pictures. Fifty women completed a Spider Phobia Questionnaire and watched the random rapid serial presentation of 600 neutral, 600 negatively valenced emotional, and 600 spider pictures (three pictures per second). The EPN was scored as the mean activity in the 225-300-ms time window at lateral occipital electrodes. Participants with higher scores on the phobia questionnaire showed larger (i.e. more negative) EPN amplitudes in response to spider pictures. The results suggest that the attentional capture of spider-related stimuli is an automatic response, which is modulated by the extent of spider fear.

The role of genes, intelligence, personality, and social engagement in cognitive performance in Klinefelter syndrome.

Science.gov (United States)

Skakkebæk, Anne; Moore, Philip J; Pedersen, Anders Degn; Bojesen, Anders; Kristensen, Maria Krarup; Fedder, Jens; Laurberg, Peter; Hertz, Jens Michael; Østergaard, John Rosendahl; Wallentin, Mikkel; Gravholt, Claus Højbjerg

2017-03-01

The determinants of cognitive deficits among individuals with Klinefelter syndrome (KS) are not well understood. This study was conducted to assess the impact of general intelligence, personality, and social engagement on cognitive performance among patients with KS and a group of controls matched for age and years of education. Sixty-nine patients with KS and 69 controls were assessed in terms of IQ, NEO personality inventory, the Autism Spectrum Quotient (AQ) scale, and measures of cognitive performance reflecting working memory and executive function. Patients with KS performed more poorly on memory and executive-function tasks. Patients with KS also exhibited greater neuroticism and less extraversion, openness, and conscientiousness than controls. Memory deficits among patients with KS were associated with lower intelligence, while diminished executive functioning was mediated by both lower intelligence and less social engagement. Our results suggest that among patients with KS, memory deficits are principally a function of lower general intelligence, while executive-function deficits are associated with both lower intelligence and poorer social skills. This suggests a potential influence of social engagement on executive cognitive functioning (and/or vice-versa) among individuals with KS, and perhaps those with other genetic disorders. Future longitudinal research would be important to further clarify this and other issues discussed in this research.

An intelligent tele-healthcare environment offering person-centric and wellness-maintenance services.

Science.gov (United States)

Abidi, S S

2001-06-01

Worldwide healthcare delivery trends are undergoing a subtle paradigm shift--patient centered services as opposed to provider centered services and wellness maintenance as opposed to illness management. In this paper we present a Tele-Healthcare project TIDE--Tele-Healthcare Information and Diagnostic Environment. TIDE manifests an 'intelligent' healthcare environment that aims to ensure lifelong coverage of person-specific health maintenance decision-support services--i.e., both wellness maintenance and illness management services--ubiquitously available via the Internet/WWW. Taking on an all-encompassing health maintenance role--spanning from wellness to illness issues--the functionality of TIDE involves the generation and delivery of (a) Personalized, Pro-active, Persistent, Perpetual, and Present wellness maintenance services, and (b) remote diagnostic services for managing noncritical illnesses. Technically, TIDE is an amalgamation of diverse computer technologies--Artificial Intelligence, Internet, Multimedia, Databases, and Medical Informatics--to implement a sophisticated healthcare delivery infostructure.

Trait Emotional Intelligence and Academic Performance: Controlling for the Effects of IQ, Personality, and Self-Concept

Science.gov (United States)

Ferrando, Mercedes; Prieto, Maria Dolores; Almeida, Leandro S.; Ferrandiz, Carmen; Bermejo, Rosario; Lopez-Pina, Jose Antonio; Hernandez, Daniel; Sainz, Marta; Fernandez, Mari-Carmen

2011-01-01

This article analyses the relationship between trait emotional intelligence and academic performance, controlling for the effects of IQ, personality, and self-concept dimensions. A sample of 290 preadolescents (11-12 years old) took part in the study. The instruments used were (a) Trait Emotional Intelligence Questionnaire-Adolescents Short Form…

Scavenging by spiders (Araneae) and its relationship to pest management of the brown recluse spider.

Science.gov (United States)

Vetter, Richard S

2011-06-01

Experiments reported in Sandidge (2003; Nature 426: 30) indicated that the brown recluse spider, Loxosceles reclusa Gertsch & Mulaik, preferred to scavenge dead prey over live prey and that the spiders were not detrimentally affected when fed insecticide-killed crickets. Extrapolations made in subsequent media coverage disseminating the results of this research made counter-intuitive statements that pesticide treatment in houses would increase brown recluse populations in homes. This information was presented as if the scavenging behavior was specialized in the brown recluse; however, it was more likely that this behavior has not been well studied in other species. To provide a comparison, the current laboratory study examined the likelihood of non-Loxosceles spiders to scavenge dead prey. Of 100 non-Loxosceles spiders that were tested (from 11 families, 24 genera, and at least 29 species from a variety of spider hunting guilds), 99 scavenged dead crickets when offered in petri dishes. Some of the spiders were webspinners in which real-world scavenging of dead prey is virtually impossible, yet they scavenge when given the opportunity. Therefore, scavenging is a flexible opportunistic predatory behavior that is spread across a variety of taxa and is not a unique behavior in brown recluses. These findings are discussed in relation to pest management practices.

Can Personality Traits and Intelligence Compensate for Background Disadvantage? Predicting Status Attainment in Adulthood

Science.gov (United States)

Damian, Rodica Ioana; Su, Rong; Shanahan, Michael; Trautwein, Ulrich; Roberts, Brent W.

2014-01-01

This paper investigates the interplay of family background and individual differences, such as personality traits and intelligence (measured in a large US representative sample of high school students; N = 81,000) in predicting educational attainment, annual income, and occupational prestige eleven years later. Specifically, we tested whether individual differences followed one of three patterns in relation to parental SES when predicting attained status: (a) the independent effects hypothesis (i.e., individual differences predict attainments independent of parental SES level), (b) the resource substitution hypothesis (i.e., individual differences are stronger predictors of attainments at lower levels of parental SES), and (c) the Matthew effect hypothesis (i.e., “the rich get richer,” individual differences are stronger predictors of attainments at higher levels of parental SES). We found that personality traits and intelligence in adolescence predicted later attained status above and beyond parental SES. A standard deviation increase in individual differences translated to up to 8 additional months of education, $4,233 annually, and more prestigious occupations. Furthermore, although we did find some evidence for both the resource substitution and the Matthew effect hypotheses, the most robust pattern across all models supported the independent effects hypothesis. Intelligence was the exception, where interaction models were more robust. Finally, we found that although personality traits may help compensate for background disadvantage to a small extent, they do not usually lead to a “full catch up” effect, unlike intelligence. This was the first longitudinal study of status attainment to test interactive models of individual differences and background factors. PMID:25402679

Can personality traits and intelligence compensate for background disadvantage? Predicting status attainment in adulthood.

Science.gov (United States)

Damian, Rodica Ioana; Su, Rong; Shanahan, Michael; Trautwein, Ulrich; Roberts, Brent W

2015-09-01

This study investigated the interplay of family background and individual differences, such as personality traits and intelligence (measured in a large U.S. representative sample of high school students; N = 81,000) in predicting educational attainment, annual income, and occupational prestige 11 years later. Specifically, we tested whether individual differences followed 1 of 3 patterns in relation to parental socioeconomic status (SES) when predicting attained status: (a) the independent effects hypothesis (i.e., individual differences predict attainments independent of parental SES level), (b) the resource substitution hypothesis (i.e., individual differences are stronger predictors of attainments at lower levels of parental SES), and (c) the Matthew effect hypothesis (i.e., "the rich get richer"; individual differences are stronger predictors of attainments at higher levels of parental SES). We found that personality traits and intelligence in adolescence predicted later attained status above and beyond parental SES. A standard deviation increase in individual differences translated to up to 8 additional months of education, $4,233 annually, and more prestigious occupations. Furthermore, although we did find some evidence for both the resource substitution and the Matthew effect hypotheses, the most robust pattern across all models supported the independent effects hypothesis. Intelligence was the exception, the interaction models being more robust. Finally, we found that although personality traits may help compensate for background disadvantage to a small extent, they do not usually lead to a "full catch-up" effect, unlike intelligence. This was the first longitudinal study of status attainment to test interactive models of individual differences and background factors. (c) 2015 APA, all rights reserved).

A Cross-Cultural Study of Implicit Theories of an Intelligent Person

Science.gov (United States)

Aljughaiman, Abdullah; Duan, Xiaoju; Handel, Marion; Hopp, Manuel; Stoeger, Heidrun; Ziegler, Albert

2012-01-01

This contribution is based on the assumption that implicit theories influence the subjective action space and hence the learning behavior of students. The implicit theory that an individual holds of an intelligent person is of particular importance in this context. For this cross-cultural study, we asked 200 students from Kenya and Germany to draw…

Assessing cultural intelligence, personality and identity amongst young white Afrikaans-speaking students: A preliminary study

Directory of Open Access Journals (Sweden)

Natasha Nel

2015-04-01

Research purpose: The objective of this research is to determine the relationship between personality, identity and CQ amongst young Afrikaans-speaking South Africans. Research approach, design and method: A quantitative research design was used in this study. This study was cross-sectional in nature. For the purpose of this study, a sample of young South African university students (N = 252 was used. The personal identity subscale from the Erickson Psychosocial Stage Inventory, the Multi-Ethnic Identity Measure, the Religious Identity Short Scale, the South African Personality Inventory questionnaire and the Four Factor Model of Cultural Intelligence Scale were applied as the measuring instruments. Main findings: Religious identity and ethnic identity have a relationship with cognitive CQ. Soft-heartedness and conscientiousness have a relationship with behavioural CQ. Also, soft-heartedness, facilitating, extroversion and religious identity have a relationship with motivational CQ. Practical/managerial implications: Organisations within South Africa will gain a better understanding of CQ and the benefits of having a culturally intelligent workforce as a strengths-based approach. Culturally intelligent employees will be able to adjust to working with co-workers from another culture, not feel threatened when interacting with co-workers and clients and be able to transfer knowledge from one culture to another, which will aid the organisation in completing overseas assignments, cross-cultural decision-making, leadership in multicultural environments and managing international careers. Contribution/value-add: CQ is a relatively new concept and empirical research on positive subjects is still very limited. Research on personality, identity and CQ within the South African context is still very limited. Therefore, this study will contribute to literature on positive psychology and cultural intelligence.

Emotional intelligence predicts peer-rated social competence above and beyond personality traits

Directory of Open Access Journals (Sweden)

Dorota Szczygieł

2016-12-01

Full Text Available Background This study investigated the relationship between trait emotional intelligence (EI and social competences (SC, which determine effective functioning in three types of social situations: intimate situations, situations of social exposure and situations requiring self-assertion. Social competences were assessed using a peer nomination method. It was hypothesized that trait EI predicts SC above and beyond personality traits. Participants and procedure Data were collected from among 111 adolescents (46.95% girls. The study was conducted among five classes from three public high schools. Participants first completed the Personality Inventory NEO-FFI and the Trait Emotional Intelligence Questionnaire-Short Form (TEIQue-SF. Subsequently, the descriptions of three different persons were presented to the participants. Each description concerned one of the SC: intimate competence, social exposure competence and assertive competence. Participants were asked to nominate three classmates who suited each description best. Results A series of hierarchical regression analyses was performed. Personality traits and trait EI were regressed on each competence. Analyses involved two-step hierarchical regressions, entering personality traits at step 1 and adding trait EI at step 2. The results demonstrated that personality traits explained a substantial portion of the variance in each SC. Beyond these variables, trait EI was significant as a predictor of nominations for each SC, explaining an additional amount of the unique variance. Conclusions The results complement existing evidence that trait EI contributes to successful social functioning. The relationships between trait EI and SC remained statistically significant even after controlling for Big Five variance. The results demonstrate incremental validity of trait EI over and above personality traits.

Spider and burnable poison rod combinations

International Nuclear Information System (INIS)

Edwards, G.T.; Schluderberg, D.C.

1980-01-01

An improved design of burnable poison rods and associated spiders used in fuel assemblies of pressurized water power reactor cores, is described. The rods are joined to the spider arms in a manner which is proof against the reactor core environment and yet allows the removal of the rods from the spider simply, swiftly and delicately. (U.K.)

A Research into the Relationship Between Type a Personality and Emotional Intelligence in Leadership Development

Directory of Open Access Journals (Sweden)

Gökhan İncebacak

2017-05-01

Full Text Available The aim of this study, which is conducted on male and femaleparticipants and managers from different departments and sectors, is to inves-tigate the relationship between Type A personality traits and emotional intelligence dimensions.In addition, for male and female managers, the emotional intelligence dimensions that are effective on type A personality traits are tried to be determined according to each department. In the results of the analysis conducted on 205 participant managers and the survey used as the data collection tool, different findings were obtained for different departments in male and female managers, and the hypotheses proposed for inter-variable effects and relationships were partially accepted.

Personality and achievement motivation : relationship among Big Five domain and facet scales, achievement goals, and intelligence

NARCIS (Netherlands)

Bipp, T.; Steinmayr, R.; Spinath, B.

2008-01-01

In the present study we examined the nomological network of achievement motivation and personality by inspecting the relationships between four goal orientations (learning, performance-approach, performance-avoidance, work avoidance), the Big Five personality traits, and intelligence. Within a

Are temperate canopy spiders tree-species specific?

Science.gov (United States)

Mupepele, Anne-Christine; Müller, Tobias; Dittrich, Marcus; Floren, Andreas

2014-01-01

Arboreal spiders in deciduous and coniferous trees were investigated on their distribution and diversity. Insecticidal knock-down was used to comprehensively sample spiders from 175 trees from 2001 to 2003 in the Białowieża forest and three remote forests in Poland. We identified 140 species from 9273 adult spiders. Spider communities were distinguished between deciduous and coniferous trees. The richest fauna was collected from Quercus where beta diversity was also highest. A tree-species-specific pattern was clearly observed for Alnus, Carpinus, Picea and Pinus trees and also for those tree species that were fogged in only four or three replicates, namely Betula and Populus. This hitherto unrecognised association was mainly due to the community composition of common species identified in a Dufrene-Legendre indicator species analysis. It was not caused by spatial or temporal autocorrelation. Explaining tree-species specificity for generalist predators like spiders is difficult and has to involve physical and ecological tree parameters like linkage with the abundance of prey species. However, neither did we find a consistent correlation of prey group abundances with spiders nor could differences in spider guild composition explain the observed pattern. Our results hint towards the importance of deterministic mechanisms structuring communities of generalist canopy spiders although the casual relationship is not yet understood.

National Intelligence and Personality: Their Relationships and Impact on National Economic Success

Science.gov (United States)

Stolarski, Maciej; Zajenkowski, Marcin; Meisenberg, Gerhard

2013-01-01

The relationships between national personality traits and intelligence from 51 countries were examined. It was found that extraversion, openness to experience and agreeableness measured at the national level were significantly and positively correlated with national IQs; however, in the regression model only the former two were marginally…

Relationship Between Personality Types Conceptualized by C. G. Jung and Emotional Intelligence

Directory of Open Access Journals (Sweden)

Natasha Virmozelova

2013-10-01

Full Text Available The main aim of this study is to present the results from a study of the relationship between personality types described by C. G. Jung and emotional intelligence. The investigated subjects were 150 at the age of 18 – 50. The methods of research were MBTI (Myers-Briggs Type Indicator - Bulgarian adaptation (Rusinova, 1992 and one psychological questionnaire measuring emotional intelligence -Bulgarian adaptation (Stoyanova, 2008. The received data indicated that the functions of thinking and sensing, and introversion correlated inversely with the factors of emotional intelligence “Sharing emotions and empathy”, “Motivation to overcome difficulties and optimisms” and extroversion correlated proportionally with them. The function feeling correlated proportionally with the factor “Sharing emotions and empathy” and it correlated inversely with the factor “Recognition of nonverbal expression of emotion of the other people”.

Warring arthropod societies: Social spider colonies can delay annihilation by predatory ants via reduced apparency and increased group size.

Science.gov (United States)

Keiser, Carl N; Wright, Colin M; Pruitt, Jonathan N

2015-10-01

Sociality provides individuals with benefits via collective foraging and anti-predator defense. One of the costs of living in large groups, however, is increased apparency to natural enemies. Here, we test how the individual-level and collective traits of spider societies can increase the risk of discovery and death by predatory ants. We transplanted colonies of the social spider Stegodyphus dumicola into a habitat dense with one of their top predators, the pugnacious ant Anoplolepis custodiens. With three different experiments, we test how colony-wide survivorship in a predator-dense habitat can be altered by colony apparency (i.e., the presence of a capture web), group size, and group composition (i.e., the proportion of bold and shy personality types present). We also test how spiders' social context (i.e., living solitarily vs. among conspecifics) modifies their behaviour toward ants in their capture web. Colonies with capture webs intact were discovered by predatory ants on average 25% faster than colonies with the capture web removed, and all discovered colonies eventually collapsed and succumbed to predation. However, the lag time from discovery by ants to colony collapse was greater for colonies containing more individuals. The composition of individual personality types in the group had no influence on survivorship. Spiders in a social group were more likely to approach ants caught in their web than were isolated spiders. Isolated spiders were more likely to attack a safe prey item (a moth) than they were to attack ants and were more likely to retreat from ants after contact than they were after contact with moths. Together, our data suggest that the physical structures produced by large animal societies can increase their apparency to natural enemies, though larger groups can facilitate a longer lag time between discovery and demise. Lastly, the interaction between spiders and predatory ants seems to depend on the social context in which spiders reside

Organizational Justice: Personality Traits or Emotional Intelligence? An Empirical Study in an Italian Hospital Context

Science.gov (United States)

Di Fabio, Annamaria; Palazzeschi, Letizia

2012-01-01

The purpose of this study was to investigate the role of personality traits and emotional intelligence in relation to organizational justice. The Organizational Justice Scale, the Eysenck Personality Questionnaire-Revised Short Form, and the Bar-On Emotional Quotient Inventory were administered to 384 Italian nurses. The emotional intelligence…

Fish predation by semi-aquatic spiders: a global pattern.

Directory of Open Access Journals (Sweden)

Martin Nyffeler

Full Text Available More than 80 incidences of fish predation by semi-aquatic spiders--observed at the fringes of shallow freshwater streams, rivers, lakes, ponds, swamps, and fens--are reviewed. We provide evidence that fish predation by semi-aquatic spiders is geographically widespread, occurring on all continents except Antarctica. Fish predation by spiders appears to be more common in warmer areas between 40° S and 40° N. The fish captured by spiders, usually ranging from 2-6 cm in length, are among the most common fish taxa occurring in their respective geographic area (e.g., mosquitofish [Gambusia spp.] in the southeastern USA, fish of the order Characiformes in the Neotropics, killifish [Aphyosemion spp.] in Central and West Africa, as well as Australian native fish of the genera Galaxias, Melanotaenia, and Pseudomugil. Naturally occurring fish predation has been witnessed in more than a dozen spider species from the superfamily Lycosoidea (families Pisauridae, Trechaleidae, and Lycosidae, in two species of the superfamily Ctenoidea (family Ctenidae, and in one species of the superfamily Corinnoidea (family Liocranidae. The majority of reports on fish predation by spiders referred to pisaurid spiders of the genera Dolomedes and Nilus (>75% of observed incidences. There is laboratory evidence that spiders from several more families (e.g., the water spider Argyroneta aquatica [Cybaeidae], the intertidal spider Desis marina [Desidae], and the 'swimming' huntsman spider Heteropoda natans [Sparassidae] predate fish as well. Our finding of such a large diversity of spider families being engaged in fish predation is novel. Semi-aquatic spiders captured fish whose body length exceeded the spiders' body length (the captured fish being, on average, 2.2 times as long as the spiders. Evidence suggests that fish prey might be an occasional prey item of substantial nutritional importance.

Fish predation by semi-aquatic spiders: a global pattern.

Science.gov (United States)

Nyffeler, Martin; Pusey, Bradley J

2014-01-01

More than 80 incidences of fish predation by semi-aquatic spiders--observed at the fringes of shallow freshwater streams, rivers, lakes, ponds, swamps, and fens--are reviewed. We provide evidence that fish predation by semi-aquatic spiders is geographically widespread, occurring on all continents except Antarctica. Fish predation by spiders appears to be more common in warmer areas between 40° S and 40° N. The fish captured by spiders, usually ranging from 2-6 cm in length, are among the most common fish taxa occurring in their respective geographic area (e.g., mosquitofish [Gambusia spp.] in the southeastern USA, fish of the order Characiformes in the Neotropics, killifish [Aphyosemion spp.] in Central and West Africa, as well as Australian native fish of the genera Galaxias, Melanotaenia, and Pseudomugil). Naturally occurring fish predation has been witnessed in more than a dozen spider species from the superfamily Lycosoidea (families Pisauridae, Trechaleidae, and Lycosidae), in two species of the superfamily Ctenoidea (family Ctenidae), and in one species of the superfamily Corinnoidea (family Liocranidae). The majority of reports on fish predation by spiders referred to pisaurid spiders of the genera Dolomedes and Nilus (>75% of observed incidences). There is laboratory evidence that spiders from several more families (e.g., the water spider Argyroneta aquatica [Cybaeidae], the intertidal spider Desis marina [Desidae], and the 'swimming' huntsman spider Heteropoda natans [Sparassidae]) predate fish as well. Our finding of such a large diversity of spider families being engaged in fish predation is novel. Semi-aquatic spiders captured fish whose body length exceeded the spiders' body length (the captured fish being, on average, 2.2 times as long as the spiders). Evidence suggests that fish prey might be an occasional prey item of substantial nutritional importance.

Trait Emotional Intelligence and Personality: Gender-Invariant Linkages Across Different Measures of the Big Five.

Science.gov (United States)

Siegling, Alexander B; Furnham, Adrian; Petrides, K V

2015-02-01

This study investigated if the linkages between trait emotional intelligence (trait EI) and the Five-Factor Model of personality were invariant between men and women. Five English-speaking samples ( N = 307-685) of mostly undergraduate students each completed a different measure of the Big Five personality traits and either the full form or short form of the Trait Emotional Intelligence Questionnaire (TEIQue). Across samples, models predicting global TEIQue scores from the Big Five were invariant between genders, with Neuroticism and Extraversion being the strongest trait EI correlates, followed by Conscientiousness, Agreeableness, and Openness. However, there was some evidence indicating that the gender-specific contributions of the Big Five to trait EI vary depending on the personality measure used, being more consistent for women. Discussion focuses on the validity of the TEIQue as a measure of trait EI and its psychometric properties, more generally.

Evidence for competition between carnivorous plants and spiders.

Science.gov (United States)

Jennings, David E; Krupa, James J; Raffel, Thomas R; Rohr, Jason R

2010-10-07

Several studies have demonstrated that competition between disparate taxa can be important in determining community structure, yet surprisingly, to our knowledge, no quantitative studies have been conducted on competition between carnivorous plants and animals. To examine potential competition between these taxa, we studied dietary and microhabitat overlap between pink sundews (Drosera capillaris) and wolf spiders (Lycosidae) in the field, and conducted a laboratory experiment examining the effects of wolf spiders on sundew fitness. In the field, we found that sundews and spiders had a high dietary overlap with each other and with the available arthropod prey. Associations between sundews and spiders depended on spatial scale: both sundews and spiders were found more frequently in quadrats with more abundant prey, but within quadrats, spiders constructed larger webs and located them further away from sundews as the total sundew trapping area increased, presumably to reduce competition. Spiders also constructed larger webs when fewer prey were available. In the laboratory, our experiment revealed that spiders can significantly reduce sundew fitness. Our findings suggest that members of the plant and animal kingdoms can and do compete.

Training emotional intelligence improves both emotional intelligence and depressive symptoms in inpatients with borderline personality disorder and depression.

Science.gov (United States)

Jahangard, Leila; Haghighi, Mohammad; Bajoghli, Hafez; Ahmadpanah, Mohammad; Ghaleiha, Ali; Zarrabian, Mohammad Kazem; Brand, Serge

2012-09-01

Borderline personality disorder (BPD) is defined as a pervasive pattern of instability in emotion, mood and interpersonal relationships, with a comorbidity between PBD and depressive disorders (DD). A key competence for successful management of interpersonal relationships is emotional intelligence (EI). Given the low EI of patients suffering from BPD, the present study aimed at investigating the effect on both emotional intelligence and depression of training emotional intelligence in patients with BPD and DD. A total of 30 inpatients with BPD and DD (53% females; mean age 24.20 years) took part in the study. Patients were randomly assigned either to the treatment or to the control group. Pre- and post-testing 4 weeks later involved experts' rating of depressive disorder and self-reported EI. The treatment group received 12 sessions of training in components of emotional intelligence. Relative to the control group, EI increased significantly in the treatment group over time. Depressive symptoms decreased significantly over time in both groups, though improvement was greater in the treatment than the control group. For inpatients suffering from BPD and DD, regular skill training in EI can be successfully implemented and leads to improvements both in EI and depression. Results suggest an additive effect of EI training on both EI and depressive symptoms.

Genus-specificity of araneophagy of linyphiid spiders and spiders of other families (Arachnida, Araneae)

NARCIS (Netherlands)

Heuts, B.; Brunt, T.

2009-01-01

We found genus specificity of predation by spiders on other spiders in captivity which surpass them in body size (araneophagy). Adult specimens of three species of the linyphiid genus Walckenaeria which were successively tested for araneophagy (in the laboratory) in the order of first species

Approach and avoidance in fear of spiders

NARCIS (Netherlands)

Rinck, M.; Becker, E.S.

2007-01-01

We examined attitudes towards spiders by employing an Approach-Avoidance Task, in which participants respond to pictures by pulling a joystick towards themselves or by pushing it away from themselves. For spider fearfuls, this stimulus–response assignment is either compatible (push spiders away) or

Learning to avoid spiders: fear predicts performance, not competence.

Science.gov (United States)

Luo, Xijia; Becker, Eni S; Rinck, Mike

2018-01-05

We used an immersive virtual environment to examine avoidance learning in spider-fearful participants. In 3 experiments, participants were asked to repeatedly lift one of 3 virtual boxes, under which either a toy car or a spider appeared and then approached the participant. Participants were not told that the probability of encountering a spider differed across boxes. When the difference was large (Exps. 1 and 2), spider-fearfuls learned to avoid spiders by lifting the few-spiders-box more often and the many-spiders-box less often than non-fearful controls did. However, they hardly managed to do so when the probability differences were small (Exp. 3), and they did not escape from threat more quickly (Exp. 2). In contrast to the observed performance differences, spider-fearfuls and non-fearfuls showed equal competence, that is comparable post-experimental knowledge about the probability to encounter spiders under the 3 boxes. The limitations and implications of the present study are discussed.

Attention and amygdala activity: an fMRI study with spider pictures in spider phobia.

Science.gov (United States)

Alpers, Georg W; Gerdes, Antje B M; Lagarie, Bernadette; Tabbert, Katharina; Vaitl, Dieter; Stark, Rudolf

2009-06-01

Facilitated detection of threatening visual cues is thought to be adaptive. In theory, detection of threat cues should activate the amygdala independently from allocation of attention. However, previous studies using emotional facial expressions as well as phobic cues yielded contradictory results. We used fMRI to examine whether the allocation of attention to components of superimposed spider and bird displays modulates amygdala activation. Nineteen spider-phobic women were instructed to identify either a moving or a stationary animal in briefly presented double-exposure displays. Amygdala activation followed a dose-response relationship: Compared to congruent neutral displays (two birds), amygdala activation was most pronounced in response to congruent phobic displays (two spiders) and less but still significant in response to mixed displays (spider and bird) when attention was focused on the phobic component. When attention was focused on the neutral component, mixed displays did not result in significant amygdala activation. This was confirmed in a significant parametric graduation of the amygdala activation in the order of congruent phobic displays, mixed displays with attention focus on the spider, mixed displays with focus on the bird and congruent neutral displays. These results challenge the notion that amygdala activation in response to briefly presented phobic cues is independent from attention.

Speech intelligibility of normal listeners and persons with impaired hearing in traffic noise

Science.gov (United States)

Aniansson, G.; Peterson, Y.

1983-10-01

Speech intelligibility (PB words) in traffic-like noise was investigated in a laboratory situation simulating three common listening situations, indoors at 1 and 4 m and outdoors at 1 m. The maximum noise levels still permitting 75% intelligibility of PB words in these three listening situations were also defined. A total of 269 persons were examined. Forty-six had normal hearing, 90 a presbycusis-type hearing loss, 95 a noise-induced hearing loss and 38 a conductive hearing loss. In the indoor situation the majority of the groups with impaired hearing retained good speech intelligibility in 40 dB(A) masking noise. Lowering the noise level to less than 40 dB(A) resulted in a minor, usually insignificant, improvement in speech intelligibility. Listeners with normal hearing maintained good speech intelligibility in the outdoor listening situation at noise levels up to 60 dB(A), without lip-reading (i.e., using non-auditory information). For groups with impaired hearing due to age and/or noise, representing 8% of the population in Sweden, the noise level outdoors had to be lowered to less than 50 dB(A), in order to achieve good speech intelligibility at 1 m without lip-reading.

Uncovering the structure-function relationship in spider silk

Science.gov (United States)

Yarger, Jeffery L.; Cherry, Brian R.; van der Vaart, Arjan

2018-03-01

All spiders produce protein-based biopolymer fibres that we call silk. The most studied of these silks is spider dragline silk, which is very tough and relatively abundant compared with other types of spider silks. Considerable research has been devoted to understanding the relationship between the molecular structure and mechanical properties of spider dragline silks. In this Review, we overview experimental and computational studies that have provided a wealth of detail at the molecular level on the highly conserved repetitive core and terminal regions of spider dragline silk. We also discuss the role of the nanocrystalline β-sheets and amorphous regions in determining the properties of spider silk fibres, endowing them with strength and elasticity. Additionally, we outline imaging techniques and modelling studies that elucidate the importance of the hierarchical structure of silk fibres at the molecular level. These insights into structure-function relationships can guide the reverse engineering of spider silk to enable the production of superior synthetic fibres.

Animal coloration: sexy spider scales.

Science.gov (United States)

Taylor, Lisa A; McGraw, Kevin J

2007-08-07

Many male jumping spiders display vibrant colors that are used in visual communication. A recent microscopic study on a jumping spider from Singapore shows that three-layered 'scale sandwiches' of chitin and air are responsible for producing their brilliant iridescent body coloration.

Time-dependent motor properties of multipedal molecular spiders.

Science.gov (United States)

Samii, Laleh; Blab, Gerhard A; Bromley, Elizabeth H C; Linke, Heiner; Curmi, Paul M G; Zuckermann, Martin J; Forde, Nancy R

2011-09-01

Molecular spiders are synthetic biomolecular walkers that use the asymmetry resulting from cleavage of their tracks to bias the direction of their stepping motion. Using Monte Carlo simulations that implement the Gillespie algorithm, we investigate the dependence of the biased motion of molecular spiders, along with binding time and processivity, on tunable experimental parameters, such as number of legs, span between the legs, and unbinding rate of a leg from a substrate site. We find that an increase in the number of legs increases the spiders' processivity and binding time but not their mean velocity. However, we can increase the mean velocity of spiders with simultaneous tuning of the span and the unbinding rate of a spider leg from a substrate site. To study the efficiency of molecular spiders, we introduce a time-dependent expression for the thermodynamic efficiency of a molecular motor, allowing us to account for the behavior of spider populations as a function of time. Based on this definition, we find that spiders exhibit transient motor function over time scales of many hours and have a maximum efficiency on the order of 1%, weak compared to other types of molecular motors.

Emotional intelligence in patients with posttraumatic stress disorder, borderline personality disorder and healthy controls.

Science.gov (United States)

Janke, Katrin; Driessen, Martin; Behnia, Behnoush; Wingenfeld, Katja; Roepke, Stefan

2018-06-01

Emotional intelligence as a part of social cognition has, to our knowledge, never been investigated in patients with Posttraumatic Stress Disorder (PTSD), though the disorder is characterized by aspects of emotional dysfunctioning. PTSD often occurs with Borderline Personality Disorder (BPD) as a common comorbidity. Studies about social cognition and emotional intelligence in patients with BPD propose aberrant social cognition, but produced inconsistent results regarding emotional intelligence. The present study aims to assess emotional intelligence in patients with PTSD without comorbid BPD, PTSD with comorbid BPD, and BPD patients without comorbid PTSD, as well as in healthy controls. 71 patients with PTSD (41 patients with PTSD without comorbid BPD, 30 patients with PTSD with comorbid BPD), 56 patients with BPD without PTSD, and 63 healthy controls filled in the Test of Emotional Intelligence (TEMINT). Patients with PTSD without comorbid BPD showed impairments in emotional intelligence compared to patients with BPD without PTSD, and compared to healthy controls. These impairments were not restricted to specific emotions. Patients with BPD did not differ significantly from healthy controls. This study provides evidence for an impaired emotional intelligence in PTSD without comorbid BPD compared to BPD and healthy controls, affecting a wide range of emotions. Copyright © 2018 Elsevier B.V. All rights reserved.

Cognitive bias in spider-phobic children: Comparison of a pictorial and a linguistic spider Stroop.

NARCIS (Netherlands)

Kindt, M.; Brosschot, J.F.

1999-01-01

Examined the relation between spider fear in children and cognitive processing bias toward threatening information. It was investigated whether spider fear in children is related to a cognitive bias for threatening pictures and words. Pictorial and linguistic Stroop stimuli were administered to 28

The role of genes, intelligence, personality, and social engagement in cognitive performance in Klinefelter syndrome

DEFF Research Database (Denmark)

Skakkebæk, Anne; Moore, Philip J.; Pedersen, Anders Degn

2017-01-01

of controls matched for age and years of education. Methods: Sixty-nine patients with KS and 69 controls were assessed in terms of IQ, NEO personality inventory, the Autism Spectrum Quotient (AQ) scale, and measures of cognitive performance reflecting working memory and executive function. Results: Patients...... with KS performed more poorly on memory and executive-function tasks. Patients with KS also exhibited greater neuroticism and less extraversion, openness, and conscientiousness than controls. Memory deficits among patients with KS were associated with lower intelligence, while diminished executive...... functioning was mediated by both lower intelligence and less social engagement. Conclusion: Our results suggest that among patients with KS, memory deficits are principally a function of lower general intelligence, while executive-function deficits are associated with both lower intelligence and poorer social...

Recent advances in the understanding of brown spider venoms: From the biology of spiders to the molecular mechanisms of toxins.

Science.gov (United States)

Gremski, Luiza Helena; Trevisan-Silva, Dilza; Ferrer, Valéria Pereira; Matsubara, Fernando Hitomi; Meissner, Gabriel Otto; Wille, Ana Carolina Martins; Vuitika, Larissa; Dias-Lopes, Camila; Ullah, Anwar; de Moraes, Fábio Rogério; Chávez-Olórtegui, Carlos; Barbaro, Katia Cristina; Murakami, Mario Tyago; Arni, Raghuvir Krishnaswamy; Senff-Ribeiro, Andrea; Chaim, Olga Meiri; Veiga, Silvio Sanches

2014-06-01

The Loxosceles genus spiders (the brown spiders) are encountered in all the continents, and the clinical manifestations following spider bites include skin necrosis with gravitational lesion spreading and occasional systemic manifestations, such as intravascular hemolysis, thrombocytopenia and acute renal failure. Brown spider venoms are complex mixtures of toxins especially enriched in three molecular families: the phospholipases D, astacin-like metalloproteases and Inhibitor Cystine Knot (ICK) peptides. Other toxins with low level of expression also present in the venom include the serine proteases, serine protease inhibitors, hyaluronidases, allergen factors and translationally controlled tumor protein (TCTP). The mechanisms by which the Loxosceles venoms act and exert their noxious effects are not fully understood. Except for the brown spider venom phospholipase D, which causes dermonecrosis, hemolysis, thrombocytopenia and renal failure, the pathological activities of the other venom toxins remain unclear. The objective of the present review is to provide insights into the brown spider venoms and loxoscelism based on recent results. These insights include the biology of brown spiders, the clinical features of loxoscelism and the diagnosis and therapy of brown spider bites. Regarding the brown spider venom, this review includes a description of the novel toxins revealed by molecular biology and proteomics techniques, the data regarding three-dimensional toxin structures, and the mechanism of action of these molecules. Finally, the biotechnological applications of the venom components, especially for those toxins reported as recombinant molecules, and the challenges for future study are discussed. Copyright © 2014 Elsevier Ltd. All rights reserved.

The role of genes, intelligence, personality, and social engagement in cognitive performance in Klinefelter syndrome

DEFF Research Database (Denmark)

Skakkebæk, Anne; Moore, Philip J.; Pedersen, Anders Degn

2017-01-01

of controls matched for age and years of education. Methods: Sixty-nine patients with KS and 69 controls were assessed in terms of IQ, NEO personality inventory, the Autism Spectrum Quotient (AQ) scale, and measures of cognitive performance reflecting working memory and executive function. Results: Patients......Introduction: The determinants of cognitive deficits among individuals with Klinefelter syndrome (KS) are not well understood. This study was conducted to assess the impact of general intelligence, personality, and social engagement on cognitive performance among patients with KS and a group...... with KS performed more poorly on memory and executive-function tasks. Patients with KS also exhibited greater neuroticism and less extraversion, openness, and conscientiousness than controls. Memory deficits among patients with KS were associated with lower intelligence, while diminished executive...

Artificial Intelligence for the Artificial Kidney: Pointers to the Future of a Personalized Hemodialysis Therapy.

Science.gov (United States)

Hueso, Miguel; Vellido, Alfredo; Montero, Nuria; Barbieri, Carlo; Ramos, Rosa; Angoso, Manuel; Cruzado, Josep Maria; Jonsson, Anders

2018-02-01

Current dialysis devices are not able to react when unexpected changes occur during dialysis treatment or to learn about experience for therapy personalization. Furthermore, great efforts are dedicated to develop miniaturized artificial kidneys to achieve a continuous and personalized dialysis therapy, in order to improve the patient's quality of life. These innovative dialysis devices will require a real-time monitoring of equipment alarms, dialysis parameters, and patient-related data to ensure patient safety and to allow instantaneous changes of the dialysis prescription for the assessment of their adequacy. The analysis and evaluation of the resulting large-scale data sets enters the realm of "big data" and will require real-time predictive models. These may come from the fields of machine learning and computational intelligence, both included in artificial intelligence, a branch of engineering involved with the creation of devices that simulate intelligent behavior. The incorporation of artificial intelligence should provide a fully new approach to data analysis, enabling future advances in personalized dialysis therapies. With the purpose to learn about the present and potential future impact on medicine from experts in artificial intelligence and machine learning, a scientific meeting was organized in the Hospital Universitari Bellvitge (L'Hospitalet, Barcelona). As an outcome of that meeting, the aim of this review is to investigate artificial intel ligence experiences on dialysis, with a focus on potential barriers, challenges, and prospects for future applications of these technologies. Artificial intelligence research on dialysis is still in an early stage, and the main challenge relies on interpretability and/or comprehensibility of data models when applied to decision making. Artificial neural networks and medical decision support systems have been used to make predictions about anemia, total body water, or intradialysis hypotension and are promising

Maternal care and subsocial behaviour in spiders.

Science.gov (United States)

Yip, Eric C; Rayor, Linda S

2014-05-01

While most spiders are solitary and opportunistically cannibalistic, a variety of social organisations has evolved in a minority of spider species. One form of social organisation is subsociality, in which siblings remain together with their parent for some period of time but disperse prior to independent reproduction. We review the literature on subsocial and maternal behaviour in spiders to highlight areas in which subsocial spiders have informed our understanding of social evolution and to identify promising areas of future research. We show that subsocial behaviour has evolved independently at least 18 times in spiders, across a wide phylogenetic distribution. Subsocial behaviour is diverse in terms of the form of care provided by the mother, the duration of care and sibling association, the degree of interaction and cooperation among siblings, and the use of vibratory and chemical communication. Subsocial spiders are useful model organisms to study various topics in ecology, such as kin recognition and the evolution of cheating and its impact on societies. Further, why social behaviour evolved in some lineages and not others is currently a topic of debate in behavioural ecology, and we argue that spiders offer an opportunity to untangle the ecological causes of parental care, which forms the basis of many other animal societies. © 2013 The Authors. Biological Reviews © 2013 Cambridge Philosophical Society.

Checklist of spider fauna of FR Peshawar, FATA, Pakistan

Directory of Open Access Journals (Sweden)

F. Perveen

2012-03-01

Full Text Available The spiders are known as poisonous arthropods, but they also act as the predator or biological pests control agent. Their 23 species belonging to 15 genera and 09 families were reported during 2009-2010 from FR Peshawar, FATA, Pakistan. The reported families Clubionidae, Scytodidae and Sprassidae covered each 4%, Araneidae, Gnaphosidae, Pholicidae and Salticidae each 9%, Thomisidae 13% and Lycosidae 43% biodiversity of spiders of FATA. However, the largest spider collected was huntsman, Isopoda tuhodnigra (Barrion with total body length 15.80+-0.83 mm. Moreover, the smallest spider was wolf spider, Pardosa birmanica (Simon with total body length 4.20+-1.30 mm. Further, the crab spiders, Thomisus pugilis (Stoliczka, T. spectabilis (Doleschall and Diaea evanida (Thorell were the most colorful species belonging to family Thomisidae. A detail study is required for further exploration of spider fauna of FATA.

Inbreeding avoidance in spiders: evidence for rescue effect in fecundity of female spiders with outbreeding opportunity

DEFF Research Database (Denmark)

Bilde, T.; Maklakov, A.A.; Schilling, Nadia

2007-01-01

avoidance can be because of low risk of inbreeding, variation in tolerance to inbreeding or high costs of outbreeding. We examined the relationship between inbreeding depression and inbreeding avoidance adaptations under two levels of inbreeding in the spider Oedothorax apicatus, asking whether preference...... for unrelated sperm via pre- and/or post-copulatory mechanisms could restore female fitness when inbreeding depression increases. Using inbred isofemale lines we provided female spiders with one or two male spiders of different relatedness in five combinations: one male sib; one male nonsib; two male sibs; two...

Understanding Spider-Man: Your Everyday Superhero

OpenAIRE

Falk, Nicklas; Blomsterberg, Sofie Amalie; Suciu, Alice Sabrina; Pedersen, Mads Peter; Lucas, Vilhelm

2014-01-01

This project focuses on the understanding of Spider-Man, and the morals and ethics that lie behind the choices he makes. Through the Dimensions Philosophy & Science/Text & Sign, this understanding is concluded by looking at ethical theories and comic book analysis. Based on the Ultimate Spider-Man comic book series, the aim is to clarify who Spider-Man is and what causes him to act in certain ways; before and after his realization of power. Some theories used to investigate these area...

Is Variability in Mate Choice Similar for Intelligence and Personality Traits? Testing a Hypothesis about the Evolutionary Genetics of Personality

Science.gov (United States)

Stone, Emily A.; Shackelford, Todd K.; Buss, David M.

2012-01-01

This study tests the hypothesis presented by Penke, Denissen, and Miller (2007a) that condition-dependent traits, including intelligence, attractiveness, and health, are universally and uniformly preferred as characteristics in a mate relative to traits that are less indicative of condition, including personality traits. We analyzed…

Designing Intelligent Tutoring Systems: A Personalization Strategy using Case-Based Reasoning and Multi-Agent Systems

Directory of Open Access Journals (Sweden)

Rosalía LAZA

2013-05-01

Full Text Available Intelligent Tutoring Systems (ITSs are educational systems that use artificial intelligence techniques for representing the knowledge. ITSs design is often criticized for being a complex and challenging process. In this article, we propose a framework for the ITSs design using Case Based Reasoning (CBR and Multiagent systems (MAS. The major advantage of using CBR is to allow the intelligent system to propose smart and quick solutions to problems, even in complex domains, avoiding the time necessary to derive those solutions from scratch. The use of intelligent agents and MAS architectures supports the retrieval of similar students models and the adaptation of teaching strategies according to the student profile. We describe deeply how the combination of both technologies helps to simplify the design of new ITSs and personalize the e-learning process for each student

Learned predation risk management by spider mites

Directory of Open Access Journals (Sweden)

Thomas eHackl

2014-09-01

Full Text Available Predation is a prime selective force shaping prey behavior. Investment in anti-predator behavior is traded-off against time and energy for other fitness-enhancing activities such as foraging or reproduction. To optimize this benefit/cost trade-off, prey should be able to innately and/or by experience modulate their behavior to the level of predation risk. Here, we assessed learned predation risk management in the herbivorous two-spotted spider mite Tetranychus urticae. We exposed spider mites coming from benign (naïve or high immediate predation risk (experienced environments to latent and/or no risk and assessed their site choice, activity and oviposition. Benign environments were characterized by the absence of any predator cues, high immediate risk environments by killed spider mites, physical presence of the predatory mite Phytoseiulus persimilis and associated chemosensory traces left on the surface, and latent risk environments by only predator traces. In the no-choice experiment both naïve and experienced spider mites laid their first egg later on leaves with than without predator traces. Irrespective of predator traces presence/absence, experienced mites laid their first egg earlier than naïve ones did. Naïve spider mites were more active, indicating higher restlessness, and laid fewer eggs on leaves with predator traces, whereas experienced mites were less active and laid similar numbers of eggs on leaves with and without predator traces. In the choice experiment both naïve and experienced spider mites preferentially resided and oviposited on leaves without predator traces but experienced mites were less active than naïve ones. Overall, our study suggests that spider mites experienced with high predation risk behave bolder under latent risk than naïve spider mites. Since predator traces alone do not indicate immediate risk, we argue that the attenuated anti-predator response of experienced spider mites represents adaptive learned

Naturalist Intelligence Among the Other Multiple Intelligences [In Bulgarian

Directory of Open Access Journals (Sweden)

R. Genkov

2007-09-01

Full Text Available The theory of multiple intelligences was presented by Gardner in 1983. The theory was revised later (1999 and among the other intelligences a naturalist intelligence was added. The criteria for distinguishing of the different types of intelligences are considered. While Gardner restricted the analysis of the naturalist intelligence with examples from the living nature only, the present paper considered this problem on wider background including objects and persons of the natural sciences.

Prey interception drives web invasion and spider size determines successful web takeover in nocturnal orb-web spiders.

Science.gov (United States)

Gan, Wenjin; Liu, Shengjie; Yang, Xiaodong; Li, Daiqin; Lei, Chaoliang

2015-09-24

A striking feature of web-building spiders is the use of silk to make webs, mainly for prey capture. However, building a web is energetically expensive and increases the risk of predation. To reduce such costs and still have access to abundant prey, some web-building spiders have evolved web invasion behaviour. In general, no consistent patterns of web invasion have emerged and the factors determining web invasion remain largely unexplored. Here we report web invasion among conspecifics in seven nocturnal species of orb-web spiders, and examined the factors determining the probability of webs that could be invaded and taken over by conspecifics. About 36% of webs were invaded by conspecifics, and 25% of invaded webs were taken over by the invaders. A web that was built higher and intercepted more prey was more likely to be invaded. Once a web was invaded, the smaller the size of the resident spider, the more likely its web would be taken over by the invader. This study suggests that web invasion, as a possible way of reducing costs, may be widespread in nocturnal orb-web spiders. © 2015. Published by The Company of Biologists Ltd.

Prey interception drives web invasion and spider size determines successful web takeover in nocturnal orb-web spiders

Directory of Open Access Journals (Sweden)

Wenjin Gan

2015-10-01

Full Text Available A striking feature of web-building spiders is the use of silk to make webs, mainly for prey capture. However, building a web is energetically expensive and increases the risk of predation. To reduce such costs and still have access to abundant prey, some web-building spiders have evolved web invasion behaviour. In general, no consistent patterns of web invasion have emerged and the factors determining web invasion remain largely unexplored. Here we report web invasion among conspecifics in seven nocturnal species of orb-web spiders, and examined the factors determining the probability of webs that could be invaded and taken over by conspecifics. About 36% of webs were invaded by conspecifics, and 25% of invaded webs were taken over by the invaders. A web that was built higher and intercepted more prey was more likely to be invaded. Once a web was invaded, the smaller the size of the resident spider, the more likely its web would be taken over by the invader. This study suggests that web invasion, as a possible way of reducing costs, may be widespread in nocturnal orb-web spiders.

First report of clinical presentation of a bite by a running spider, Philodromus sp. (Araneae: Philodromidae), with recommendations for spider bite management.

Science.gov (United States)

Coetzee, Maureen; Dippenaar, Ansie; Frean, John; Hunt, Richard H

2017-06-30

This article describes the clinical progression of symptoms over a period of 5 days of a bite inflicted by a Philodromus sp. spider. Commonly known as 'running spiders', these are not considered to be harmful to humans. This report, however, is the first description of an actual bite by a member of this group of spiders showing cytotoxic envenomation. Management of the bites should be as recommended for other cytotoxic spider bites.

Biomechanics of Spider Silks

Science.gov (United States)

2006-03-02

water and deformation conditions. Such fibres [Nexia ’ biosteel ’ silk ] were spun from recombinant silk ’cloned’ from Spidroin II and indeed show 67...SUBTITLE 5. FUNDING NUMBERS Biomechanics of Spider Silks F49620-03-1-0111 6. AUTHOR(S) Fritz Vollrath 7. PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES...Perform Pro, WHSIDIOR, Oct 94 COVER SHEET FINAL (3rd Year) Report to AFOSR on: BIOMECHANICS OF SPIDER SILKS Fritz Vollrath, Oxford University, England

Sex-specific kleptoparasitic foraging in ant-eating spiders

DEFF Research Database (Denmark)

Martisová, Martina; Bilde, T.; Pekar, Stano

2009-01-01

. To investigate this hypothesis, we studied the effect of sex and life history stage on the frequency of kleptoparasitism in ant-eating spiders of the genus Zodarion in the field. These spiders use a special capture technique involving a quick attack on an ant that is left unguarded by spiders for several minutes......, providing ample opportunities for kleptoparasitism. We found that adult females consistently hunted actively, while adult males ceased active prey capture and instead engaged in kleptoparasitism. Juvenile spiders were active hunters irrespective of sex. Consistent with an ontogenetic shift in foraging...

Specific predictive power of automatic spider-related affective associations for controllable and uncontrollable fear responses toward spiders

NARCIS (Netherlands)

Huijdlng, J; de Jong, PJ; Huijding, J.

This study examined the predictive power of automatically activated spider-related affective associations for automatic and controllable fear responses. The Extrinsic Affective Simon Task (EAST; De Houwer, 2003) was used to indirectly assess automatic spider fear-related associations. The EAST and

Empirical Investigation of Select Personality, Attitudinal, and Experience-Based Antecedents of Cultural Intelligence in Undergraduate Business Students

Science.gov (United States)

Kurpis, Lada V.

2012-01-01

Fostering cultural intelligence development in undergraduate business students should be one of the goals of diversity education in undergraduate business programs due to the demands of the increasingly global workplace of today. A number of personality-based (e.g., self-monitoring personality trait), attitudinal (e.g., preference for jobs…

Realization of Personalized Services for Intelligent Residential Space based on User Identification Method using Sequential Walking Footprints

Directory of Open Access Journals (Sweden)

Jin-Woo Jung

2005-04-01

Full Text Available A new human-friendly assistive home environment, Intelligent Sweet Home (ISH, developed at KAIST, Korea for testing advanced concepts for independent living of the elderly/the physically handicapped. The concept of ISH is to consider the home itself as an intelligent robot. ISH always checks the intention or health status of the resident. Therefore, ISH can do actively the most proper services considering the resident's life-style by the detected intention or emergency information. But, when there are more than two residents, ISH cannot consider the residents' characteristics or tastes if ISH cannot identify who he/she is before. To realize a personalized service system in the intelligent residential space like ISH, we deal with a human-friendly user identification method for ubiquitous computing environment, specially focused on dynamic human footprint recognition. And then, we address some case studies of personalized services that have been experienced by Human-friendly Welfare Robot System research center, KAIST.

Using Intelligent Personal Assistants for Second Language Learning: A Case Study of Alexa

Science.gov (United States)

Dizon, Gilbert

2017-01-01

The proliferation of smartphones has given rise to intelligent personal assistants (IPAs), software that helps users accomplish day-to-day tasks. However, little is known about IPAs in the context of second language (L2) learning. Therefore, the primary objectives of this case study were twofold: to assess the ability of Amazon's IPA, Alexa, to…

Emotional intelligence predicts peer-rated social competence above and beyond personality traits

OpenAIRE

Dorota Szczygieł; Joanna Weber

2016-01-01

Background This study investigated the relationship between trait emotional intelligence (EI) and social competences (SC), which determine effective functioning in three types of social situations: intimate situations, situations of social exposure and situations requiring self-assertion. Social competences were assessed using a peer nomination method. It was hypothesized that trait EI predicts SC above and beyond personality traits. Participants and procedure Data were co...

How emotions affect logical reasoning:Evidence from experiments with mood-manipulated participants, spider phobics, and people with exam anxiety

Directory of Open Access Journals (Sweden)

Nadine eJung

2014-06-01

Full Text Available Recent experimental studies show that emotions can have a significant effect on the way we think, decide, and solve problems. This paper presents a series of four experiments on how emotions affect logical reasoning. In two experiments different groups of participants first had to pass a manipulated intelligence test. Their emotional state was altered by giving them feedback, that they performed excellent, poor or on average. Then they completed a set of logical inference problems (with if p, then q statements either in a Wason selection task paradigm or problems from the logical propositional calculus. Problem content also had either a positive, negative or neutral emotional value. Results showed a clear effect of emotions on reasoning performance. Participants in negative mood performed worse than participants in positive mood, but both groups were outperformed by the neutral mood reasoners. Problem content also had an effect on reasoning performance. In a second set of experiments, participants with exam or spider phobia solved logical problems with contents that were related to their anxiety disorder (spiders or exams. Spider phobic participants’ performance was lowered by the spider-content, while exam anxious participants were not affected by the exam-related problem content. Overall, unlike some previous studies, no evidence was found that performance is improved when emotion and content are congruent. These results have consequences for cognitive reasoning research and also for cognitively oriented psychotherapy and the treatment of disorders like depression and anxiety.

How emotions affect logical reasoning: evidence from experiments with mood-manipulated participants, spider phobics, and people with exam anxiety.

Science.gov (United States)

Jung, Nadine; Wranke, Christina; Hamburger, Kai; Knauff, Markus

2014-01-01

Recent experimental studies show that emotions can have a significant effect on the way we think, decide, and solve problems. This paper presents a series of four experiments on how emotions affect logical reasoning. In two experiments different groups of participants first had to pass a manipulated intelligence test. Their emotional state was altered by giving them feedback, that they performed excellent, poor or on average. Then they completed a set of logical inference problems (with if p, then q statements) either in a Wason selection task paradigm or problems from the logical propositional calculus. Problem content also had either a positive, negative or neutral emotional value. Results showed a clear effect of emotions on reasoning performance. Participants in negative mood performed worse than participants in positive mood, but both groups were outperformed by the neutral mood reasoners. Problem content also had an effect on reasoning performance. In a second set of experiments, participants with exam or spider phobia solved logical problems with contents that were related to their anxiety disorder (spiders or exams). Spider phobic participants' performance was lowered by the spider-content, while exam anxious participants were not affected by the exam-related problem content. Overall, unlike some previous studies, no evidence was found that performance is improved when emotion and content are congruent. These results have consequences for cognitive reasoning research and also for cognitively oriented psychotherapy and the treatment of disorders like depression and anxiety.

How emotions affect logical reasoning: evidence from experiments with mood-manipulated participants, spider phobics, and people with exam anxiety

Science.gov (United States)

Jung, Nadine; Wranke, Christina; Hamburger, Kai; Knauff, Markus

2014-01-01

Recent experimental studies show that emotions can have a significant effect on the way we think, decide, and solve problems. This paper presents a series of four experiments on how emotions affect logical reasoning. In two experiments different groups of participants first had to pass a manipulated intelligence test. Their emotional state was altered by giving them feedback, that they performed excellent, poor or on average. Then they completed a set of logical inference problems (with if p, then q statements) either in a Wason selection task paradigm or problems from the logical propositional calculus. Problem content also had either a positive, negative or neutral emotional value. Results showed a clear effect of emotions on reasoning performance. Participants in negative mood performed worse than participants in positive mood, but both groups were outperformed by the neutral mood reasoners. Problem content also had an effect on reasoning performance. In a second set of experiments, participants with exam or spider phobia solved logical problems with contents that were related to their anxiety disorder (spiders or exams). Spider phobic participants' performance was lowered by the spider-content, while exam anxious participants were not affected by the exam-related problem content. Overall, unlike some previous studies, no evidence was found that performance is improved when emotion and content are congruent. These results have consequences for cognitive reasoning research and also for cognitively oriented psychotherapy and the treatment of disorders like depression and anxiety. PMID:24959160

Disentangling the phylogenetic and ecological components of spider phenotypic variation.

Science.gov (United States)

Gonçalves-Souza, Thiago; Diniz-Filho, José Alexandre Felizola; Romero, Gustavo Quevedo

2014-01-01

An understanding of how the degree of phylogenetic relatedness influences the ecological similarity among species is crucial to inferring the mechanisms governing the assembly of communities. We evaluated the relative importance of spider phylogenetic relationships and ecological niche (plant morphological variables) to the variation in spider body size and shape by comparing spiders at different scales: (i) between bromeliads and dicot plants (i.e., habitat scale) and (ii) among bromeliads with distinct architectural features (i.e., microhabitat scale). We partitioned the interspecific variation in body size and shape into phylogenetic (that express trait values as expected by phylogenetic relationships among species) and ecological components (that express trait values independent of phylogenetic relationships). At the habitat scale, bromeliad spiders were larger and flatter than spiders associated with the surrounding dicots. At this scale, plant morphology sorted out close related spiders. Our results showed that spider flatness is phylogenetically clustered at the habitat scale, whereas it is phylogenetically overdispersed at the microhabitat scale, although phylogenic signal is present in both scales. Taken together, these results suggest that whereas at the habitat scale selective colonization affect spider body size and shape, at fine scales both selective colonization and adaptive evolution determine spider body shape. By partitioning the phylogenetic and ecological components of phenotypic variation, we were able to disentangle the evolutionary history of distinct spider traits and show that plant architecture plays a role in the evolution of spider body size and shape. We also discussed the relevance in considering multiple scales when studying phylogenetic community structure.

The effect of paternal age on offspring intelligence and personality when controlling for paternal trait level

OpenAIRE

Arslan, Ruben C.; Penke, Lars; Johnson, Wendy; Iacono, William G.; McGue, Matt

2013-01-01

Paternal age at conception has been found to predict the number of new genetic mutations. We examined the effect of father’s age at birth on offspring intelligence, head circumference and personality traits. Using the Minnesota Twin Family Study sample we tested paternal age effects while controlling for parents’ trait levels measured with the same precision as offspring’s. From evolutionary genetic considerations we predicted a negative effect of paternal age on offspring intelligence, but n...

[Transcatheter embolization for huge pulmonary arteriovenous fistula using metallic "spider" and spring embolus--application of hand-made metallic "spider" using partial monorail technique].

Science.gov (United States)

Hirota, S; Sako, M; Fujita, Y; Hasegawa, Y; Sugimoto, K; Suzuki, Y; Kono, M

1992-07-25

We performed transcatheter embolization in two cases with huge pulmonary arteriovenous fistula (AVF) using a metallic "spider" and spring embolus. Conventional spring embolus or detachable balloon could not be used in these cases. Metallic spider was indicated for pulmonary AVF with a feeding artery diameter of more than 16 mm to prevent embolus passing through the AVF. In the first case, we used large handmade metallic spiders of 25 mm in diameter followed by embolization by numerous spring coils. At that time, a partial monorail technique was newly devised to carry the large metallic spider into the feeding artery, otherwise the spider could not pass into a 9F catheter. After embolization, symptoms and PaO2 in arterial blood improved remarkably in both cases. In the second case, a spring coil migrated into the normal pulmonary artery, but no infarction resulted. In conclusion, the metallic spider was very useful for embolization of hugee pulmonary AVF to avoid the embolus passing through and to tangle spring coils together with it. If commercially available "spiders" are too small, ones can be made easily.

Second-order nonlinear optical microscopy of spider silk

Science.gov (United States)

Zhao, Yue; Hien, Khuat Thi Thu; Mizutani, Goro; Rutt, Harvey N.

2017-06-01

Asymmetric β-sheet protein structures in spider silk should induce nonlinear optical interaction such as second harmonic generation (SHG) which is experimentally observed for a radial line and dragline spider silk using an imaging femtosecond laser SHG microscope. By comparing different spider silks, we found that the SHG signal correlates with the existence of the protein β-sheets. Measurements of the polarization dependence of SHG from the dragline indicated that the β-sheet has a nonlinear response depending on the direction of the incident electric field. We propose a model of what orientation the β-sheet takes in spider silk.

Tangled in a sparse spider web

DEFF Research Database (Denmark)

Dimitrov, Dimitar Stefanov; Lopardo, Lara; Giribet, Gonzalo

2012-01-01

In order to study the tempo and the mode of spider orb web evolution and diversification, we conducted a phylogenetic analysis using six genetic markers along with a comprehensive taxon sample. The present analyses are the first to recover the monophyly of orb-weaving spiders based solely on DNA ...

Sclerotherapy of Varicose Veins and Spider Veins

Science.gov (United States)

... Index A-Z Sclerotherapy of Varicose Veins and Spider Veins Sclerotherapy uses injections from a very fine, ... Sclerotherapy? What is Sclerotherapy of Varicose Veins and Spider Veins? Sclerotherapy is a minimally invasive treatment used ...

Personality and intelligence: persistence, not self-directedness, cooperativeness or self-transcendence, is related to twins’ cognitive abilities

Directory of Open Access Journals (Sweden)

Fariba Mousavi

2015-08-01

Full Text Available Background. A person-centered approach focusing on the interaction of an individual’s temperament-character-life events is essential in the path of individuals’ well-being. In this context, three character traits, Self-directedness (e.g., self-acceptance, self-control, goal-directed behavior, Cooperativeness (e.g., social affiliation, social tolerance, empathy and helpfulness and Self-transcendence (e.g., spiritual acceptance, transpersonal identification, measured using Cloninger’s model of personality are suggested to help the individual to regulate and resolve the conflicts derived from her/his temperament combinations as a reaction to life events. However, if character is related to the individual’s cognitive ability, then this association might limit any intervention that focuses on character development. We used data from the Child and Adolescent Twin Study in Sweden (CATSS to investigate the relationship between personality and cognitive ability.Method. The sample consisted of 370 15-year-old twins (159 girls/211 boys, 192 of whom screen-positive with various types of mental health problems. We used the Temperament and Character Inventory to measure personality and the Wechsler Intelligence Scales for Children (WISC-IV to measure intelligence. The relationship was investigated using correlation analyses using random-selected twins from each dyad and separately for monozygotic and dizygotic twins. Additional analyses investigated the genetic and environmental effects on personality and cognitive ability in this specific sample.Results. There were no significant correlations between the WISC-IV indices and any of the character traits (i.e., Self-directedness, Cooperativeness, and Self-transcendence. Persistence was significantly related, if weak, to four WISC-IV indices: Verbal Comprehension, Perceptual Reasoning, Working Memory, and the Full WISC-IV Scale. Post-hoc cross-twin/cross-trait analyses showed that the Persistence

Personality and intelligence: persistence, not self-directedness, cooperativeness or self-transcendence, is related to twins' cognitive abilities.

Science.gov (United States)

Mousavi, Fariba; Rozsa, Sandor; Nilsson, Thomas; Archer, Trevor; Anckarsäter, Henrik; Garcia, Danilo

2015-01-01

Background. A person-centered approach focusing on the interaction of an individual's temperament-character-life events is essential in the path of individuals' well-being. In this context, three character traits, Self-directedness (e.g., self-acceptance, self-control, goal-directed behavior), Cooperativeness (e.g., social affiliation, social tolerance, empathy and helpfulness) and Self-transcendence (e.g., spiritual acceptance, transpersonal identification), measured using Cloninger's model of personality are suggested to help the individual to regulate and resolve the conflicts derived from her/his temperament combinations as a reaction to life events. However, if character is related to the individual's cognitive ability, then this association might limit any intervention that focuses on character development. We used data from the Child and Adolescent Twin Study in Sweden (CATSS) to investigate the relationship between personality and cognitive ability. Method. The sample consisted of 370 15-year-old twins (159 girls/211 boys), 192 of whom screen-positive with various types of mental health problems. We used the Temperament and Character Inventory to measure personality and the Wechsler Intelligence Scales for Children (WISC-IV) to measure intelligence. The relationship was investigated using correlation analyses using random-selected twins from each dyad and separately for monozygotic and dizygotic twins. Additional analyses investigated the genetic and environmental effects on personality and cognitive ability in this specific sample. Results. There were no significant correlations between the WISC-IV indices and any of the character traits (i.e., Self-directedness, Cooperativeness, and Self-transcendence). Persistence was significantly related, if weak, to four WISC-IV indices: Verbal Comprehension, Perceptual Reasoning, Working Memory, and the Full WISC-IV Scale. Post-hoc cross-twin/cross-trait analyses showed that the Persistence-cognitive ability

Personality and intelligence: persistence, not self-directedness, cooperativeness or self-transcendence, is related to twins’ cognitive abilities

Science.gov (United States)

Mousavi, Fariba; Rozsa, Sandor; Nilsson, Thomas; Archer, Trevor; Anckarsäter, Henrik

2015-01-01

Background. A person-centered approach focusing on the interaction of an individual’s temperament-character-life events is essential in the path of individuals’ well-being. In this context, three character traits, Self-directedness (e.g., self-acceptance, self-control, goal-directed behavior), Cooperativeness (e.g., social affiliation, social tolerance, empathy and helpfulness) and Self-transcendence (e.g., spiritual acceptance, transpersonal identification), measured using Cloninger’s model of personality are suggested to help the individual to regulate and resolve the conflicts derived from her/his temperament combinations as a reaction to life events. However, if character is related to the individual’s cognitive ability, then this association might limit any intervention that focuses on character development. We used data from the Child and Adolescent Twin Study in Sweden (CATSS) to investigate the relationship between personality and cognitive ability. Method. The sample consisted of 370 15-year-old twins (159 girls/211 boys), 192 of whom screen-positive with various types of mental health problems. We used the Temperament and Character Inventory to measure personality and the Wechsler Intelligence Scales for Children (WISC-IV) to measure intelligence. The relationship was investigated using correlation analyses using random-selected twins from each dyad and separately for monozygotic and dizygotic twins. Additional analyses investigated the genetic and environmental effects on personality and cognitive ability in this specific sample. Results. There were no significant correlations between the WISC-IV indices and any of the character traits (i.e., Self-directedness, Cooperativeness, and Self-transcendence). Persistence was significantly related, if weak, to four WISC-IV indices: Verbal Comprehension, Perceptual Reasoning, Working Memory, and the Full WISC-IV Scale. Post-hoc cross-twin/cross-trait analyses showed that the Persistence-cognitive ability

Assassin bug uses aggressive mimicry to lure spider prey.

Science.gov (United States)

Wignall, Anne E; Taylor, Phillip W

2011-05-07

Assassin bugs (Stenolemus bituberus) hunt web-building spiders by invading the web and plucking the silk to generate vibrations that lure the resident spider into striking range. To test whether vibrations generated by bugs aggressively mimic the vibrations generated by insect prey, we compared the responses of spiders to bugs with how they responded to prey, courting male spiders and leaves falling into the web. We also analysed the associated vibrations. Similar spider orientation and approach behaviours were observed in response to vibrations from bugs and prey, whereas different behaviours were observed in response to vibrations from male spiders and leaves. Peak frequency and duration of vibrations generated by bugs were similar to those generated by prey and courting males. Further, vibrations from bugs had a temporal structure and amplitude that were similar to vibrations generated by leg and body movements of prey and distinctly different to vibrations from courting males or leaves, or prey beating their wings. To be an effective predator, bugs do not need to mimic the full range of prey vibrations. Instead bugs are general mimics of a subset of prey vibrations that fall within the range of vibrations classified by spiders as 'prey'.

SPIDER: CMB Polarimetry from the Edge of Space

Energy Technology Data Exchange (ETDEWEB)

Gualtieri, R.; et al.

2017-11-28

SPIDER is a balloon-borne instrument designed to map the polarization of the millimeter-wave sky at large angular scales. SPIDER targets the B-mode signature of primordial gravitational waves in the cosmic microwave background (CMB), with a focus on mapping a large sky area with high fidelity at multiple frequencies. SPIDER's first longduration balloon (LDB) flight in January 2015 deployed a total of 2400 antenna-coupled Transition Edge Sensors (TESs) at 90 GHz and 150 GHz. In this work we review the design and in-flight performance of the SPIDER instrument, with a particular focus on the measured performance of the detectors and instrument in a space-like loading and radiation environment. SPIDER's second flight in December 2018 will incorporate payload upgrades and new receivers to map the sky at 285 GHz, providing valuable information for cleaning polarized dust emission from CMB maps.

Cuticular antifungals in spiders: density- and condition dependence.

Directory of Open Access Journals (Sweden)

Daniel González-Tokman

Full Text Available Animals living in groups face a high risk of disease contagion. In many arthropod species, cuticular antimicrobials constitute the first protective barrier that prevents infections. Here we report that group-living spiders produce cuticular chemicals which inhibit fungal growth. Given that cuticular antifungals may be costly to produce, we explored whether they can be modulated according to the risk of contagion (i.e. under high densities. For this purpose, we quantified cuticular antifungal activity in the subsocial crab spider Diaea ergandros in both natural nests and experimentally manipulated nests of varying density. We quantified the body-condition of spiders to test whether antifungal activity is condition dependent, as well as the effect of spider density on body-condition. We predicted cuticular antifungal activity to increase and body-condition to decrease with high spider densities, and that antifungal activity would be inversely related to body-condition. Contrary to our predictions, antifungal activity was neither density- nor condition-dependent. However, body-condition decreased with density in natural nests, but increased in experimental nests. We suggest that pathogen pressure is so important in nature that it maintains high levels of cuticular antifungal activity in spiders, impacting negatively on individual energetic condition. Future studies should identify the chemical structure of the isolated antifungal compounds in order to understand the physiological basis of a trade-off between disease prevention and energetic condition caused by group living, and its consequences in the evolution of sociality in spiders.

Cuticular antifungals in spiders: density- and condition dependence.

Science.gov (United States)

González-Tokman, Daniel; Ruch, Jasmin; Pulpitel, Tamara; Ponton, Fleur

2014-01-01

Animals living in groups face a high risk of disease contagion. In many arthropod species, cuticular antimicrobials constitute the first protective barrier that prevents infections. Here we report that group-living spiders produce cuticular chemicals which inhibit fungal growth. Given that cuticular antifungals may be costly to produce, we explored whether they can be modulated according to the risk of contagion (i.e. under high densities). For this purpose, we quantified cuticular antifungal activity in the subsocial crab spider Diaea ergandros in both natural nests and experimentally manipulated nests of varying density. We quantified the body-condition of spiders to test whether antifungal activity is condition dependent, as well as the effect of spider density on body-condition. We predicted cuticular antifungal activity to increase and body-condition to decrease with high spider densities, and that antifungal activity would be inversely related to body-condition. Contrary to our predictions, antifungal activity was neither density- nor condition-dependent. However, body-condition decreased with density in natural nests, but increased in experimental nests. We suggest that pathogen pressure is so important in nature that it maintains high levels of cuticular antifungal activity in spiders, impacting negatively on individual energetic condition. Future studies should identify the chemical structure of the isolated antifungal compounds in order to understand the physiological basis of a trade-off between disease prevention and energetic condition caused by group living, and its consequences in the evolution of sociality in spiders.

Brain systems underlying encounter expectancy bias in spider phobia.

Science.gov (United States)

Aue, Tatjana; Hoeppli, Marie-Eve; Piguet, Camille; Hofstetter, Christoph; Rieger, Sebastian W; Vuilleumier, Patrik

2015-06-01

Spider-phobic individuals are characterized by exaggerated expectancies to be faced with spiders (so-called encounter expectancy bias). Whereas phobic responses have been linked to brain systems mediating fear, little is known about how the recruitment of these systems relates to exaggerated expectancies of threat. We used fMRI to examine spider-phobic and control participants while they imagined visiting different locations in a forest after having received background information about the likelihood of encountering different animals (spiders, snakes, and birds) at these locations. Critically, imagined encounter expectancies modulated brain responses differently in phobics as compared with controls. Phobics displayed stronger negative modulation of activity in the lateral prefrontal cortex, precuneus, and visual cortex by encounter expectancies for spiders, relative to snakes or birds (within-participants analysis); these effects were not seen in controls. Between-participants correlation analyses within the phobic group further corroborated the hypothesis that these phobia-specific modulations may underlie irrationality in encounter expectancies (deviations of encounter expectancies from objective background information) in spider phobia; the greater the negative modulation a phobic participant displayed in the lateral prefrontal cortex, precuneus, and visual cortex, the stronger was her bias in encounter expectancies for spiders. Interestingly, irrationality in expectancies reflected in frontal areas relied on right rather than left hemispheric deactivations. Our data accord with the idea that expectancy biases in spider phobia may reflect deficiencies in cognitive control and contextual integration that are mediated by right frontal and parietal areas.

Self-reported emotional dysregulation but no impairment of emotional intelligence in borderline personality disorder: an explorative study.

Science.gov (United States)

Beblo, Thomas; Pastuszak, Anna; Griepenstroh, Julia; Fernando, Silvia; Driessen, Martin; Schütz, Astrid; Rentzsch, Katrin; Schlosser, Nicole

2010-05-01

Emotional dysfunction is a key feature of patients with borderline personality disorder (BPD) but emotional intelligence (EI) has rarely been investigated in this sample. This study aimed at an investigation of ability EI, general intelligence, and self-reported emotion regulation in BPD. We included 19 patients with BPD and 20 healthy control subjects in the study. EI was assessed by means of the Mayer-Salovey-Caruso emotional intelligence test and the test of emotional intelligence. For the assessment of general intelligence, we administered the multidimensional "Leistungsprüfsystem-Kurzversion." The emotion regulation questionnaire and the difficulties in Emotion Regulation Scale were used to assess emotion regulation. The patients with BPD did not exhibit impairments of ability EI and general intelligence but reported severe impairments in emotion regulation. Ability EI was related both to general intelligence (patients and controls) and to self-reported emotion regulation (patients). In conclusion, emotional dysfunction in BPD might primarily affect self-perceived behavior rather than abilities. Intense negative emotions in everyday life may trigger dysfunctional emotion regulation strategies in BPD although patients possess sufficient theoretical knowledge about optimal regulation strategies.

The effectiveness of discourse-based intervention on personal narrative of school-aged children with borderline intelligence quotient

Directory of Open Access Journals (Sweden)

Belghis Rovshan

2014-04-01

Full Text Available Background and Aim: Discourse-based interventions were studied less in speech therapy. This study aimed to investigate the effects of discourse-based intervention on language disabilities in school-aged children with borderline intelligence quotient (IQ.Methods: In an experimental study, 33 students at the age of 6-13 years with borderline intelligence quotient (17 students for intervention and 16 students for control group were selected with available sampling. The intervention lasted 14 sessions (every session: 45 minutes that focused on the structure and content of discourse. Personal narrative was elicited with explanation of the same topic (go to a trip for pre- and post-test.Results: Mean scores of intelligence quotient, age and education had no difference between the two groups. The intervention caused the increase of compound sentences (p=0.038, types of cohesive conjunctions (p=0.003, and related information (p=0.008 and decrease of ungrammatical sentences (p=0.031.Conclusion: Our findings indicate that participation in the intervention program has a clinically significant effect on the participants' abilities to produce personal narrative.

The aerodynamic signature of running spiders.

Directory of Open Access Journals (Sweden)

Jérôme Casas

Full Text Available Many predators display two foraging modes, an ambush strategy and a cruising mode. These foraging strategies have been classically studied in energetic, biomechanical and ecological terms, without considering the role of signals produced by predators and perceived by prey. Wolf spiders are a typical example; they hunt in leaf litter either using an ambush strategy or by moving at high speed, taking over unwary prey. Air flow upstream of running spiders is a source of information for escaping prey, such as crickets and cockroaches. However, air displacement by running arthropods has not been previously examined. Here we show, using digital particle image velocimetry, that running spiders are highly conspicuous aerodynamically, due to substantial air displacement detectable up to several centimetres in front of them. This study explains the bimodal distribution of spider's foraging modes in terms of sensory ecology and is consistent with the escape distances and speeds of cricket prey. These findings may be relevant to the large and diverse array of arthropod prey-predator interactions in leaf litter.

Biotechnological Trends in Spider and Scorpion Antivenom Development

DEFF Research Database (Denmark)

Laustsen, Andreas Hougaard; Solà, Mireia; Jappe, Emma Christine

2016-01-01

in using bioactive toxins from spiders and scorpions for drug discovery purposes and for solving crystal structures of membrane-embedded receptors. Additionally, the identification and isolation of a myriad of spider and scorpion toxins has allowed research within next generation antivenoms to progress...... at an increasingly faster pace. In this review, the current knowledge of spider and scorpion venoms is presented, followed by a discussion of all published biotechnological efforts within development of spider and scorpion antitoxins based on small molecules, antibodies and fragments thereof, and next generation...... immunization strategies. The increasing number of discovery and development efforts within this field may point towards an upcoming transition from serum-based antivenoms towards therapeutic solutions based on modern biotechnology....

Biased interpretation and memory in children with varying levels of spider fear.

Science.gov (United States)

Klein, Anke M; Titulaer, Geraldine; Simons, Carlijn; Allart, Esther; de Gier, Erwin; Bögels, Susan M; Becker, Eni S; Rinck, Mike

2014-01-01

This study investigated multiple cognitive biases in children simultaneously, to investigate whether spider-fearful children display an interpretation bias, a recall bias, and source monitoring errors, and whether these biases are specific for spider-related materials. Furthermore, the independent ability of these biases to predict spider fear was investigated. A total of 121 children filled out the Spider Anxiety and Disgust Screening for Children (SADS-C), and they performed an interpretation task, a memory task, and a Behavioural Assessment Test (BAT). As expected, a specific interpretation bias was found: Spider-fearful children showed more negative interpretations of ambiguous spider-related scenarios, but not of other scenarios. We also found specific source monitoring errors: Spider-fearful children made more fear-related source monitoring errors for the spider-related scenarios, but not for the other scenarios. Only limited support was found for a recall bias. Finally, interpretation bias, recall bias, and source monitoring errors predicted unique variance components of spider fear.

Competitive interactions between a native spider (Frontinella communis, Araneae: Linyphiidae) and an invasive spider (Linyphia triangularis, Araneae: Linyphiidae)

Science.gov (United States)

Bednarski, Julie V.; Ginsberg, Howard S.; Jakob, Elizabeth M.

2010-01-01

There are numerous reports of spiders that have become established outside of their native ranges, but few studies examine their impact on native spiders. We examined the effect of the European hammock spider Linyphia triangularis (Araneae, Linyphiidae) on the native bowl-and-doily spider Frontinella communis (Araneae, Linyphiidae) in Acadia National Park, Maine, USA. First, we added L. triangularis to established plots of F. communis. Significantly more F. communis abandoned their webs when L. triangularis were added compared to control plots. Second, we tested whether F. communis were deterred from building webs in areas where L. triangularis was established. Significantly fewer F. communis built webs on plots with L. triangularis than on control plots. In both experiments, L. triangularis sometimes took over webs of F. communis or incorporated F. communis webs into their own webs, but F. communisnever took over or incorporated L. triangularis webs. Competition between L. triangularis and F. communis for both webs and web sites may contribute to the decline of F. communis.

Induction of direct and indirect plant responses by jasmonic acid, low spider mite densities, or a combination of jasmonic acid treatment and spider mite infestation.

Science.gov (United States)

Gols, Rieta; Roosjen, Mara; Dijkman, Herman; Dicke, Marcel

2003-12-01

Jasmonic acid (JA) and the octadecanoid pathway are involved in both induced direct and induced indirect plant responses. In this study, the herbivorous mite, Tetranychus urticae, and its predator, Phytoseiulus persimilis, were given a choice between Lima bean plants induced by JA or spider mites and uninduced control plants. Infestation densities resulting in the induction of predator attractants were much lower than thus far assumed, i.e., predatory mites were significantly attracted to plants that were infested for 2 days with only one or four spider mites per plant. Phytoseiulus persimilis showed a density-dependent response to volatiles from plants that were infested with different numbers of spider mites. Similarly, treating plants with increasing concentrations of JA also led to increased attraction of P. persimilis. Moreover, the duration of spider mite infestation was positively correlated with the proportion of predators that were attracted to mite-infested plants. A pretreatment of the plants with JA followed by a spider mite infestation enhanced the attraction of P. persimilis to plant volatiles compared to attraction to volatiles from plants that were only infested with spider mites and did not receive a pretreatment with JA. The herbivore, T. urticae preferred leaf tissue that previously had been infested with conspecifics to uninfested leaf tissue. In the case of choice tests with JA-induced and control leaf tissue, spider mites slightly preferred control leaf tissue. When spider mites were given a choice between leaf discs induced by JA and leaf discs damaged by spider mite feeding, they preferred the latter. The presence of herbivore induced chemicals and/or spider mite products enhanced settlement of the mites, whereas treatment with JA seemed to impede settlement.

Spider foraging strategy affects trophic cascades under natural and drought conditions.

Science.gov (United States)

Liu, Shengjie; Chen, Jin; Gan, Wenjin; Schaefer, Douglas; Gan, Jianmin; Yang, Xiaodong

2015-07-23

Spiders can cause trophic cascades affecting litter decomposition rates. However, it remains unclear how spiders with different foraging strategies influence faunal communities, or present cascading effects on decomposition. Furthermore, increased dry periods predicted in future climates will likely have important consequences for trophic interactions in detritus-based food webs. We investigated independent and interactive effects of spider predation and drought on litter decomposition in a tropical forest floor. We manipulated densities of dominant spiders with actively hunting or sit-and-wait foraging strategies in microcosms which mimicked the tropical-forest floor. We found a positive trophic cascade on litter decomposition was triggered by actively hunting spiders under ambient rainfall, but sit-and-wait spiders did not cause this. The drought treatment reversed the effect of actively hunting spiders on litter decomposition. Under drought conditions, we observed negative trophic cascade effects on litter decomposition in all three spider treatments. Thus, reduced rainfall can alter predator-induced indirect effects on lower trophic levels and ecosystem processes, and is an example of how such changes may alter trophic cascades in detritus-based webs of tropical forests.

Artificial Intelligence.

Science.gov (United States)

Lawrence, David R; Palacios-González, César; Harris, John

2016-04-01

It seems natural to think that the same prudential and ethical reasons for mutual respect and tolerance that one has vis-à-vis other human persons would hold toward newly encountered paradigmatic but nonhuman biological persons. One also tends to think that they would have similar reasons for treating we humans as creatures that count morally in our own right. This line of thought transcends biological boundaries-namely, with regard to artificially (super)intelligent persons-but is this a safe assumption? The issue concerns ultimate moral significance: the significance possessed by human persons, persons from other planets, and hypothetical nonorganic persons in the form of artificial intelligence (AI). This article investigates why our possible relations to AI persons could be more complicated than they first might appear, given that they might possess a radically different nature to us, to the point that civilized or peaceful coexistence in a determinate geographical space could be impossible to achieve.

Peculiar torsion dynamical response of spider dragline silk

Science.gov (United States)

Liu, Dabiao; Yu, Longteng; He, Yuming; Peng, Kai; Liu, Jie; Guan, Juan; Dunstan, D. J.

2017-07-01

The torsional properties of spider dragline silks from Nephila edulis and Nephila pilipes spiders are investigated by using a torsion pendulum technique. A permanent torsional deformation is observed after even small torsional strain. This behaviour is quite different from that of the other materials tested here, i.e., carbon fiber, thin metallic wires, Kevlar fiber, and human hair. The spider dragline thus displays a strong energy dissipation upon the initial excitation (around 75% for small strains and more for a larger strain), which correspondingly reduces the amplitude of subsequent oscillations around the new equilibrium position. The variation of torsional stiffness in relaxation dynamics of spider draglines for different excitations is also determined. The experimental result is interpreted in the light of the hierarchical structure of dragline silk.

Plastic material investment in load-bearing silk attachments in spiders.

Science.gov (United States)

Wolff, Jonas O; Jones, Braxton; Herberstein, Marie E

2018-05-17

The nature and size of attachments is a fundamental element of animal constructions. Presumably, these adhesive structures are plastically deployed to balance material investment and attachment strength. Here we studied plasticity in dragline anchorages of the golden orb web spider, Nephila plumipes. Specifically, we predict that spiders adjust the size and structure of dragline anchorages with load, i.e. spider mass. Mass was manipulated by attaching lead pieces to the spider's abdomen resulting in a 50 percent increase in mass. Loaded spiders spun larger but structurally similar thread anchorages than unloaded spiders. Thus, the spinning program that determines the overall anchor structure is highly stereotypic, and flexibility is introduced through varying the anchor size by increasing material investment. Our study showcases substrate attachments as suitable models to investigate the interplay between innate and changeable elements in the economy of building behaviours. Copyright © 2018 Elsevier GmbH. All rights reserved.

Influence of spider silk on refugia preferences of the recluse spiders Loxosceles reclusa and Loxosceles laeta (Araneae: Sicariidae).

Science.gov (United States)

Vetter, Richard S; Rust, Michael K

2010-06-01

In a previous experimental study, recluse spiders Loxosceles reclusa Gertsch and Mulaik and Loxosceles laeta (Nicolet) (Araneae: Sicariidae) preferred small cardboard refugia covered with conspecific silk compared with never-occupied refugia. Herein, we investigated some factors that might be responsible for this preference using similar cardboard refugia. When the two Loxosceles species were given choices between refugia previously occupied by their own and by the congeneric species, neither showed a species-specific preference; however, each chose refugia coated with conspecific silk rather than those previously inhabited by a distantly related cribellate spider, Metaltella simoni (Keyserling). When L. laeta spiders were offered refugia that were freshly removed from silk donors compared with heated, aged refugia from the same silk donor, older refugia were preferred. Solvent extracts of L. laeta silk were chosen approximately as often as control refugia when a range of solvents (methylene chloride:methanol, water, and hexane) were used. However, when acetone was used on similar silk, there was a statistical preference for the control, indicating that there might be a mildly repellent aspect to acetone-washed silk. Considering the inability to show attraction to chemical aspects of fresh silk, it seems that physical attributes may be more important for selection and that there might be repellency to silk of a recently vacated spider. These findings are discussed in regard to pest management strategies to control recluse spiders.

Photoluminescent properties of spider silk coated with Eu-doped nanoceria

Energy Technology Data Exchange (ETDEWEB)

Dmitrović, Svetlana, E-mail: svetlana8@vin.bg.ac.rs [University of Belgrade, Vinča Institute of Nuclear Sciences (Serbia); Nikolić, Marko G.; Jelenković, Branislav [University of Belgrade, Institute of Physics (Serbia); Prekajski, Marija [University of Belgrade, Vinča Institute of Nuclear Sciences (Serbia); Rabasović, Mihailo [University of Belgrade, Institute of Physics (Serbia); Zarubica, Aleksandra [University of Niš, Department of Chemistry, Faculty of Science and Mathematics (Serbia); Branković, Goran [University of Belgrade, Institute for Multidisciplinary Research, Department of Material Science (Serbia); Matović, Branko [University of Belgrade, Vinča Institute of Nuclear Sciences (Serbia)

2017-02-15

Spider dragline silk was coated with pure as well as Eu-doped ceria nanopowders at the room temperature. The treatment was done by immersion of the spider silk mesh into aqueous solutions of cerium nitrate (Ce(NO{sub 3}){sub 3}) and ammonium hydroxide (NH{sub 4}OH). Depending on the relationship between Ce{sup 3+} ion and ammonium hydroxide concentration, coated fibers exhibited a different thickness. Obtained materials were studied by means of FESEM. It was found that ceria nanoparticles of average size of 3 nm were coated along spider thread. X-ray diffraction (XRD) and selected-area electron diffraction (SAED) confirmed crystal nature of nanoparticle coating of spider silk. By using Williamson-Hall plots, crystallite size and strain were estimated. EDS measurement confirmed the presence of Eu in spider-Eu-doped ceria composite, and according to FTIR analysis, the interaction between CeO2 and spider silk was proposed. The morphology of obtained composite was observed by TEM. The photoluminescence emission spectra of spider silk coated with Eu-doped ceria were measured with two different excitations of 385 and 466 nm. The two-photon excited auto-fluorescence of spider silk coated with Eu-doped ceria was detected using a nonlinear laser scanning microscope. Obtained composite has a potential as a fluorescent labeling material in diverse applications.

High School Students' Attitudes Towards Spiders: A cross-cultural comparison

Science.gov (United States)

Prokop, Pavol; Tolarovičová, Andrea; Camerik, Anne M.; Peterková, Viera

2010-08-01

Spiders are traditionally considered to be among the least popular of animals. Current evidence suggests that a negative attitude towards spiders could be influenced by both cultural and evolutionary pressures. Some researchers suggest that science education activities could positively influence students' perceptions of spiders. Their evidence is, however, ambivalent. Using a five-point score Likert-type questionnaire in which the items were developed in a similar way to four of Kellert's categories of attitude (scientistic, negativistic, naturalistic, and ecologistic) towards invertebrates, we compared the level of knowledge of and attitudes towards spiders of high school students from two countries, Slovakia (n = 354) and South Africa (n = 382). The students represented different cultures and followed dissimilar science education curricula. Only among the Slovakian students there was a statistically significant but low correlation between knowledge and attitude (r = 0.30). The South African students scored higher in the categories of scientistic, naturalistic, and ecologistic attitudes. Comparison of attitude towards spiders of indigenous Africans from coeducational Catholic schools revealed that South African students have greater fear of spiders than Slovakian students, supporting the biological preparedness hypothesis. This hypothesis predicts a greater fear of spiders in South Africa than in Europe since several South African spiders possess venoms that are dangerous to humans. The results of this study are discussed from science education, cultural, and evolutionary perspectives.

Photoluminescent properties of spider silk coated with Eu-doped nanoceria

International Nuclear Information System (INIS)

Dmitrović, Svetlana; Nikolić, Marko G.; Jelenković, Branislav; Prekajski, Marija; Rabasović, Mihailo; Zarubica, Aleksandra; Branković, Goran; Matović, Branko

2017-01-01

Spider dragline silk was coated with pure as well as Eu-doped ceria nanopowders at the room temperature. The treatment was done by immersion of the spider silk mesh into aqueous solutions of cerium nitrate (Ce(NO_3)_3) and ammonium hydroxide (NH_4OH). Depending on the relationship between Ce"3"+ ion and ammonium hydroxide concentration, coated fibers exhibited a different thickness. Obtained materials were studied by means of FESEM. It was found that ceria nanoparticles of average size of 3 nm were coated along spider thread. X-ray diffraction (XRD) and selected-area electron diffraction (SAED) confirmed crystal nature of nanoparticle coating of spider silk. By using Williamson-Hall plots, crystallite size and strain were estimated. EDS measurement confirmed the presence of Eu in spider-Eu-doped ceria composite, and according to FTIR analysis, the interaction between CeO2 and spider silk was proposed. The morphology of obtained composite was observed by TEM. The photoluminescence emission spectra of spider silk coated with Eu-doped ceria were measured with two different excitations of 385 and 466 nm. The two-photon excited auto-fluorescence of spider silk coated with Eu-doped ceria was detected using a nonlinear laser scanning microscope. Obtained composite has a potential as a fluorescent labeling material in diverse applications.

Science 101: Why Don't Spiders Stick to Their Own Webs?

Science.gov (United States)

Robertson, Bill

2011-01-01

This article explains why spiders don't stick to their webs. Spiders don't get stuck in their own webs (and they aren't immune to their own glue) because they use a combination of sticky and nonsticky threads (different glands for producing those), and the glue is in droplets that the spider can avoid but the prey can't. The spider's nervous…

Salticid predation as one potential driving force of ant mimicry in jumping spiders

Science.gov (United States)

Huang, Jin-Nan; Cheng, Ren-Chung; Li, Daiqin; Tso, I-Min

2011-01-01

Many spiders possess myrmecomorphy, and species of the jumping spider genus Myrmarachne exhibit nearly perfect ant mimicry. Most salticids are diurnal predators with unusually high visual acuity that prey on various arthropods, including conspecifics. In this study, we tested whether predation pressure from large jumping spiders is one possible driving force of perfect ant mimicry in jumping spiders. The results showed that small non-ant-mimicking jumping spiders were readily treated as prey by large ones (no matter whether heterospecific or conspecific) and suffered high attack and mortality rates. The size difference between small and large jumping spiders significantly affected the outcomes of predatory interactions between them: the smaller the juvenile jumping spiders, the higher the predation risk from large ones. The attack and mortality rates of ant-mimicking jumping spiders were significantly lower than those of non-ant-mimicking jumping spiders, indicating that a resemblance to ants could provide protection against salticid predation. However, results of multivariate behavioural analyses showed that the responses of large jumping spiders to ants and ant-mimicking salticids differed significantly. Results of this study indicate that predation pressure from large jumping spiders might be one selection force driving the evolution of nearly perfect myrmecomorphy in spiders and other arthropods. PMID:20961898

Research on Artificial Spider Web Model for Farmland Wireless Sensor Network

Directory of Open Access Journals (Sweden)

Jun Wang

2018-01-01

Full Text Available Through systematic analysis of the structural characteristics and invulnerability of spider web, this paper explores the possibility of combining the advantages of spider web such as network robustness and invulnerability with farmland wireless sensor network. A universally applicable definition and mathematical model of artificial spider web structure are established. The comparison between artificial spider web and traditional networks is discussed in detail. The simulation result shows that the networking structure of artificial spider web is better than that of traditional networks in terms of improving the overall reliability and invulnerability of communication system. A comprehensive study on the advantage characteristics of spider web has important theoretical and practical significance for promoting the invulnerability research of farmland wireless sensor network.

Silk Spinning in Silkworms and Spiders.

Science.gov (United States)

Andersson, Marlene; Johansson, Jan; Rising, Anna

2016-08-09

Spiders and silkworms spin silks that outcompete the toughness of all natural and manmade fibers. Herein, we compare and contrast the spinning of silk in silkworms and spiders, with the aim of identifying features that are important for fiber formation. Although spiders and silkworms are very distantly related, some features of spinning silk seem to be universal. Both spiders and silkworms produce large silk proteins that are highly repetitive and extremely soluble at high pH, likely due to the globular terminal domains that flank an intermediate repetitive region. The silk proteins are produced and stored at a very high concentration in glands, and then transported along a narrowing tube in which they change conformation in response primarily to a pH gradient generated by carbonic anhydrase and proton pumps, as well as to ions and shear forces. The silk proteins thereby convert from random coil and alpha helical soluble conformations to beta sheet fibers. We suggest that factors that need to be optimized for successful production of artificial silk proteins capable of forming tough fibers include protein solubility, pH sensitivity, and preservation of natively folded proteins throughout the purification and initial spinning processes.

Personality traits and emotional intelligence as predictors of teachers' psychological well-being

Directory of Open Access Journals (Sweden)

Andreja Avsec

2009-11-01

Full Text Available We examined predictive validity of the Big Five personality traits and three dimensions of emotional intelligence (EI regarding psychological well-being on the sample of primary and highschool teachers. Notwithstanding relatively high correlations between personality and EI scales, reported by other studies, we predicted that EI still accounts for a significant amount of variability in psychological well-being. This prediction originates in idea that different abilities concerning emotions should help individuals to be more effective in various aspects of positive functioning. One hundred fifty two teachers filled out the Big Five Inventory (BFI, Emotional Skills and Competence Questionnaire (ESCQ, and the short version of Riff's Psychological Well-Being Scales (RPWB. Results showed good predictive validity of personality traits, for they accounted for 22 to 43% of variability in different psychological well-being scales. Predictive validity of EI is also excellent, but when controlling for personality traits is far worse, since it accounts for only 1 to 3% of variance in well-being scales. Discriminant validity of EI scales measured by ESCQ is therefore unsatisfactory.

A novel neurotoxin from venom of the spider, Brachypelma albopilosum.

Directory of Open Access Journals (Sweden)

Yunhua Zhong

Full Text Available Spiders have evolved highly selective toxins for insects. There are many insecticidal neurotoxins in spider venoms. Although a large amount of work has been done to focus on neurotoxicity of spider components, little information, which is related with effects of spider toxins on tumor cell proliferation and cytotoxicity, is available for Brachypelma albopilosum venom. In this work, a novel spider neurotoxin (brachyin was identified and characterized from venoms of the spider, Brachypelma albopilosum. Brachyin is composed of 41 amino acid residues with the sequence of CLGENVPCDKDRPNCCSRYECLEPTGYGWWYASYYCYKKRS. There are six cysteines in this sequence, which form three disulfided bridges. The serine residue at the C-terminus is amidated. Brachyin showed strong lethal effects on American cockroaches (Periplaneta americana and Tenebrio molitor (common mealbeetle. This neurotoxin also showed significant analgesic effects in mice models including abdominal writhing induced by acetic acid and formalin-induced paw licking tests. It was interesting that brachyin exerted marked inhibition on tumor cell proliferation.

Spiders of Kerala Agricultural University Campus, Thrissur, Kerala, India

Directory of Open Access Journals (Sweden)

C. K. Adarsh

2015-12-01

Full Text Available A total of 86 species of spiders belonging to 56 genera of 20 families have been recorded from the Kerala Agricultural University (KAU campus, Thrissur, Kerala, southern India.  This represents 5.1% of the total spiders’ species and 33.33% of the total families of spiders recorded in India.  The dominant spider family at KAU campus is Araneidae with 18 species of nine genera. Salticidae is represented by 14 species of 13 genera.  Out of 252 endemic spiders of India, 16 have been reported from KAU campus.  Guild structure analysis shows spiders belonging to seven types of feeding guilds present in KAU campus.  Orb-web builders are the dominant feeding guild accounting for 34%, followed by stalkers (22%, ground runners (20%, ambushers (8%, scattered line weavers (8%, foliage runners (7% and sheet-web builders (1%. 

Estimates of self, parental, and partner multiple intelligence and their relationship with personality, values, and demographic variables: a study in Britain and France.

Science.gov (United States)

Swami, Viren; Furnham, Adrian; Zilkha, Susan

2009-11-01

In the present study, 151 British and 151 French participants estimated their own, their parents' and their partner's overall intelligence and 13 'multiple intelligences.' In accordance with previous studies, men rated themselves as higher on almost all measures of intelligence, but there were few cross-national differences. There were also important sex differences in ratings of parental and partner intelligence. Participants generally believed they were more intelligent than their parents but not their partners. Regressions indicated that participants believed verbal, logical-mathematical, and spatial intelligence to be the main predictors of intelligence. Regressions also showed that participants' Big Five personality scores (in particular, Extraversion and Openness), but not values or beliefs about intelligence and intelligences tests, were good predictors of intelligence. Results were discussed in terms of the influence of gender-role stereotypes.

Research on Artificial Spider Web Model for Farmland Wireless Sensor Network

OpenAIRE

Jun Wang; Song Gao; Shimin Zhao; Guang Hu; Xiaoli Zhang; Guowang Xie

2018-01-01

Through systematic analysis of the structural characteristics and invulnerability of spider web, this paper explores the possibility of combining the advantages of spider web such as network robustness and invulnerability with farmland wireless sensor network. A universally applicable definition and mathematical model of artificial spider web structure are established. The comparison between artificial spider web and traditional networks is discussed in detail. The simulation result shows tha...

Spider diffraction: a comparison of curved and straight legs

International Nuclear Information System (INIS)

Richter, J.L.

1984-01-01

It has been known for some time that, if curved legs rather than the usual straight ones are used in the spider that supports the secondary optics in certain telescopes, the visible diffraction effect is reduced. Fraunhofer theory is used to calculate the diffraction effects due to the curved leg spider. Calculated and photographic diffraction patterns are compared for straight and curved leg spiders

High School Students' Attitudes towards Spiders: A Cross-Cultural Comparison

Science.gov (United States)

Prokop, Pavol; Tolarovicova, Andrea; Camerik, Anne M.; Peterkova, Viera

2010-01-01

Spiders are traditionally considered to be among the least popular of animals. Current evidence suggests that a negative attitude towards spiders could be influenced by both cultural and evolutionary pressures. Some researchers suggest that science education activities could positively influence students' perceptions of spiders. Their evidence is,…

Optically probing torsional superelasticity in spider silks

Energy Technology Data Exchange (ETDEWEB)

Kumar, Bhupesh; Thakur, Ashish; Panda, Biswajit; Singh, Kamal P. [Department of Physical Sciences, IISER Mohali, Sector 81, Manauli, Mohali 140306 (India)

2013-11-11

We investigate torsion mechanics of various spider silks using a sensitive optical technique. We find that spider silks are torsionally superelastic in that they can reversibly withstand great torsion strains of over 10{sup 2−3} rotations per cm before failure. Among various silks from a spider, we find the failure twist-strain is greatest in the sticky capture silk followed by dragline and egg-case silk. Our in situ laser-diffraction measurements reveal that torsional strains on the silks induce a nano-scale transverse compression in its diameter that is linear and reversible. These unique torsional properties of the silks could find applications in silk-based materials and devices.

Optically probing torsional superelasticity in spider silks

International Nuclear Information System (INIS)

Kumar, Bhupesh; Thakur, Ashish; Panda, Biswajit; Singh, Kamal P.

2013-01-01

We investigate torsion mechanics of various spider silks using a sensitive optical technique. We find that spider silks are torsionally superelastic in that they can reversibly withstand great torsion strains of over 10 2−3 rotations per cm before failure. Among various silks from a spider, we find the failure twist-strain is greatest in the sticky capture silk followed by dragline and egg-case silk. Our in situ laser-diffraction measurements reveal that torsional strains on the silks induce a nano-scale transverse compression in its diameter that is linear and reversible. These unique torsional properties of the silks could find applications in silk-based materials and devices

And along Came a Spider: An Attentional Bias for the Detection of Spiders in Young Children and Adults

Science.gov (United States)

LoBue, Vanessa

2010-01-01

Spiders are among the most common targets of fears and phobias in the world. In visual search tasks, adults detect their presence more rapidly than other kinds of stimuli. Reported here is an investigation of whether young children share this attentional bias for the detection of spiders. In a series of experiments, preschoolers and adults were…

Relationships between Personal Traits, Emotional Intelligence, Internal Marketing, Service Management, and Customer Orientation in Korean Outpatient Department Nurses.

Science.gov (United States)

Kim, Bogyun; Lee, Jia

2016-03-01

Current increase and complexity of medical tests and surgical procedures at outpatient department (OPD) require OPD nurses to have customer orientation focusing on various customers' interests and needs. The purpose of this study was to identify the factors associated with customer orientation in nurses working at OPD of hospitals. The study used a descriptive correlational design with cross-sectional survey. The study settings were four general hospitals in Seoul and its metropolitan area. Data were collected from 138 OPD nurses from general hospitals. Study variables were personal traits, emotional intelligence, internal marketing, service management and customer orientation. Factors associated with customer orientation were identified as conscientiousness from personal traits (β = .37, p marketing from environmental characteristics (β = .21, p = .001). Hospital administrators should support OPD nurses to cultivate sincere and sociable personal traits and emotional intelligence, and to consider employees as internal customers to improve patient-oriented services and satisfaction. Copyright © 2015. Published by Elsevier B.V.

Personality Traits and General Intelligence as Predictors of Academic Performance: A Structural Equation Modelling Approach

Science.gov (United States)

Rosander, Pia; Backstrom, Martin; Stenberg, Georg

2011-01-01

The aim of the present study was to investigate the extent to which personality traits, after controlling for general intelligence, predict academic performance in different school subjects. Upper secondary school students in Sweden (N=315) completed the Wonderlic IQ test (Wonderlic, 1992) and the IPIP-NEO-PI test (Goldberg, 1999). A series of…

Early events in the evolution of spider silk genes.

Directory of Open Access Journals (Sweden)

James Starrett

Full Text Available Silk spinning is essential to spider ecology and has had a key role in the expansive diversification of spiders. Silk is composed primarily of proteins called spidroins, which are encoded by a multi-gene family. Spidroins have been studied extensively in the derived clade, Orbiculariae (orb-weavers, from the suborder Araneomorphae ('true spiders'. Orbicularians produce a suite of different silks, and underlying this repertoire is a history of duplication and spidroin gene divergence. A second class of silk proteins, Egg Case Proteins (ECPs, is known only from the orbicularian species, Lactrodectus hesperus (Western black widow. In L. hesperus, ECPs bond with tubuliform spidroins to form egg case silk fibers. Because most of the phylogenetic diversity of spiders has not been sampled for their silk genes, there is limited understanding of spidroin gene family history and the prevalence of ECPs. Silk genes have not been reported from the suborder Mesothelae (segmented spiders, which diverged from all other spiders >380 million years ago, and sampling from Mygalomorphae (tarantulas, trapdoor spiders and basal araneomorph lineages is sparse. In comparison to orbicularians, mesotheles and mygalomorphs have a simpler silk biology and thus are hypothesized to have less diversity of silk genes. Here, we present cDNAs synthesized from the silk glands of six mygalomorph species, a mesothele, and a non-orbicularian araneomorph, and uncover a surprisingly rich silk gene diversity. In particular, we find ECP homologs in the mesothele, suggesting that ECPs were present in the common ancestor of extant spiders, and originally were not specialized to complex with tubuliform spidroins. Furthermore, gene-tree/species-tree reconciliation analysis reveals that numerous spidroin gene duplications occurred after the split between Mesothelae and Opisthothelae (Mygalomorphae plus Araneomorphae. We use the spidroin gene tree to reconstruct the evolution of amino acid

Silk elasticity as a potential constraint on spider body size.

Science.gov (United States)

Rodríguez-Gironés, Miguel A; Corcobado, Guadalupe; Moya-Laraño, Jordi

2010-10-07

Silk is known for its strength and extensibility and has played a key role in the radiation of spiders. Individual spiders use different glands to produce silk types with unique sets of proteins. Most research has studied the properties of major ampullate and capture spiral silks and their ecological implications, while little is known about minor ampullate silk, the type used by those spider species studied to date for bridging displacements. A biomechanical model parameterised with available data shows that the minimum radius of silk filaments required for efficient bridging grows with the square root of the spider's body mass, faster than the radius of minor ampullate silk filaments actually produced by spiders. Because the morphology of spiders adapted to walking along or under silk threads is ill suited for moving on a solid surface, for these species there is a negative relationship between body mass and displacement ability. As it stands, the model suggests that spiders that use silk for their displacements are prevented from attaining a large body size if they must track their resources in space. In particular, silk elasticity would favour sexual size dimorphism because males that must use bridging lines to search for females cannot grow large. 2010 Elsevier Ltd. All rights reserved.

Moral Intelligence in the Schools

Science.gov (United States)

Clarken, Rodney H.

2009-01-01

Moral intelligence is newer and less studied than the more established cognitive, emotional and social intelligences, but has great potential to improve our understanding of learning and behavior. Moral intelligence refers to the ability to apply ethical principles to personal goals, values and actions. The construct of moral intelligence consists…

The Role of Personality Traits, Core Self-Evaluation, and Emotional Intelligence in Career Decision-Making Difficulties

Science.gov (United States)

Di Fabio, Annamaria; Palazzeschi, Letizia; Bar-On, Reuven

2012-01-01

This study examines the role of personality traits, core self-evaluation, and emotional intelligence (EI) in career decision-making difficulties. Italian university students (N = 232) responded to questions on the Big Five Questionnaire, Core Self-Evaluation Scale, Bar-On Emotional Quotient Inventory, and Career Decision-Making Difficulties…

Personality disorder, emotional intelligence, and locus of control of patients with alcohol dependence

OpenAIRE

Prakash, Om; Sharma, Neelu; Singh, Amool R.; Sengar, K. S.; Chaudhury, Suprakash; Ranjan, Jay Kumar

2015-01-01

Aim: To assess personality disorder (PD), emotional intelligence (EI), and locus of control of alcohol dependent (AD) patients and its comparison with normal controls. Materials and Methods: Based on purposive sampling technique, 33 AD patients were selected from the De-Addiction Ward of Ranchi Institute of Neuro-Psychiatry and Allied Sciences (RINPAS) and 33 matched normal subjects were selected from Ranchi and nearby places. Both the groups were matched on various sociodemographic parameter...

Herbivory in spiders: the importance of pollen for orb-weavers.

Science.gov (United States)

Eggs, Benjamin; Sanders, Dirk

2013-01-01

Orb-weaving spiders (Araneidae) are commonly regarded as generalist insect predators but resources provided by plants such as pollen may be an important dietary supplementation. Their webs snare insect prey, but can also trap aerial plankton like pollen and fungal spores. When recycling their orb webs, the spiders may therefore also feed on adhering pollen grains or fungal spores via extraoral digestion. In this study we measured stable isotope ratios in the bodies of two araneid species (Aculepeira ceropegia and Araneus diadematus), their potential prey and pollen to determine the relative contribution of pollen to their diet. We found that about 25% of juvenile orb-weaving spiders' diet consisted of pollen, the other 75% of flying insects, mainly small dipterans and hymenopterans. The pollen grains in our study were too large to be taken up accidentally by the spiders and had first to be digested extraorally by enzymes in an active act of consumption. Therefore, pollen can be seen as a substantial component of the spiders' diet. This finding suggests that these spiders need to be classified as omnivores rather than pure carnivores.

Unravelling the Complex Associations between Emotional Intelligence and Personality in Later Childhood and Early Adolescence

Science.gov (United States)

Séguin, Daniel G.; Hipson, Will

2016-01-01

The primary goal of the study was to examine the relationships between emotional intelligence and personality type in later childhood. Eighty-one youth in grades seven and nine (M[subscript age]=12.49 years, SD[subscript age]=1.20 years) were asked to complete the "Bar-On Emotional Quotient Inventory: Youth Version" and the…

Molecular Evolution of Spider Vision: New Opportunities, Familiar Players.

Science.gov (United States)

Morehouse, Nathan I; Buschbeck, Elke K; Zurek, Daniel B; Steck, Mireille; Porter, Megan L

2017-08-01

Spiders are among the world's most species-rich animal lineages, and their visual systems are likewise highly diverse. These modular visual systems, composed of four pairs of image-forming "camera" eyes, have taken on a huge variety of forms, exhibiting variation in eye size, eye placement, image resolution, and field of view, as well as sensitivity to color, polarization, light levels, and motion cues. However, despite this conspicuous diversity, our understanding of the genetic underpinnings of these visual systems remains shallow. Here, we review the current literature, analyze publicly available transcriptomic data, and discuss hypotheses about the origins and development of spider eyes. Our efforts highlight that there are many new things to discover from spider eyes, and yet these opportunities are set against a backdrop of deep homology with other arthropod lineages. For example, many (but not all) of the genes that appear important for early eye development in spiders are familiar players known from the developmental networks of other model systems (e.g., Drosophila). Similarly, our analyses of opsins and related phototransduction genes suggest that spider photoreceptors employ many of the same genes and molecular mechanisms known from other arthropods, with a hypothesized ancestral spider set of four visual and four nonvisual opsins. This deep homology provides a number of useful footholds into new work on spider vision and the molecular basis of its extant variety. We therefore discuss what some of these first steps might be in the hopes of convincing others to join us in studying the vision of these fascinating creatures.

Acute Generalized Exanthematous Pustulosis (AGEP Triggered by a Spider Bite

Directory of Open Access Journals (Sweden)

Michael Makris

2009-01-01

Discussion: A spider bite may represent a possible causative factor of AGEP. A spider's venom contains sphingomyelinase that stimulates the release of IL8 and GM-CSF, which are involved in AGEP pathogenesis. Whether or not the con-current use of antibiotics has an effect in AGEP appearance when combined with a spider's venom, cannot be excluded.

Coagulopathy after spider bites in a six-year-old boy

Directory of Open Access Journals (Sweden)

Ansari SH.

2008-06-01

Full Text Available Background: Spider bites are common in most parts of the world. In some areas, where snake or scorpion bites are common, spider bites may not be considered a significant problem by the general public and those who have been bitten by spiders may not go to a hospital. However, significant problems are observed in the victims of certain species of spiders including: widow spider (of the genus Latrodectus, including the black widow and brown spiders (of the genus Loxosceles, such as the brown recluse. Case: We report a six-year-old boy, admitted to the hospital two weeks after suffering a spider bite. The patient presented with a severe nose bleed, ecchymosis and purpura, as well as anemia, indicating a clotting disorder. Laboratory results revealed abnormal values for prothrombin time (PT >50 sec, partial thromboplastin time (PTT >120 min and fibrinogen = 0 mg/dl, whereas factor VIII was normal according to a mixing study, with a normal platelet count of 350,000/µl. The patient was managed with fresh frozen plasma every 12 h, and was discharged one week after hospital admission. At present, the patient is well with more normal laboratory results one month after treatment: PT=13.4 sec, PTT= 34 sec, fibrinogen=105 mg/dl.         Conclusions: Although spider bites are uncommon in Iran, severe systemic reactions may occur in the pediatric population requiring admission to the pediatric intensive care unit. These systemic reactions may include hemolytic anemia coagulopathy and renal failure.

Camel spider (Solifugae) use of prairie dog colonies

Science.gov (United States)

Solifugids (camel spiders) are widespread throughout arid regions of western North America and are thought to be important in structuring desert arthropod communities. Despite the ubiquity of camel spiders, little is known about their ecology. Black-tailed prairie dogs (Cynomys ludovicianus) are als...

Nutrient regulation in a predator, the wolf spider Pardosa prativaga

DEFF Research Database (Denmark)

Jensen, Kim; Mayntz, David; Toft, Søren

2011-01-01

Nutrient balancing is well known in herbivores and omnivores, but has only recently been demonstrated in predators. To test how a predator might regulate nutrients when the prey varies in nutrient composition, we restricted juvenile Pardosa prativaga wolf spiders to diets of one of six fruit fly......, Drosophila melanogaster, prey types varying in lipid:protein composition during their second instar. We collected all fly remnants to estimate food and nutrient intake over each meal. The spiders adjusted their capture rate and nutrient extraction in response to prey mass and nutrient composition...... irrespective of energy intake. Intake was initially regulated to a constant lipid plus protein mass, but later spiders fed on prey with high proportions of protein increased consumption relative to spiders fed on other prey types. This pattern indicates that the spiders were prepared to overconsume vast...

Arachnid aloft: directed aerial descent in neotropical canopy spiders.

Science.gov (United States)

Yanoviak, Stephen P; Munk, Yonatan; Dudley, Robert

2015-09-06

The behaviour of directed aerial descent has been described for numerous taxa of wingless hexapods as they fall from the tropical rainforest canopy, but is not known in other terrestrial arthropods. Here, we describe similar controlled aerial behaviours for large arboreal spiders in the genus Selenops (Selenopidae). We dropped 59 such spiders from either canopy platforms or tree crowns in Panama and Peru; the majority (93%) directed their aerial trajectories towards and then landed upon nearby tree trunks. Following initial dorsoventral righting when necessary, falling spiders oriented themselves and then translated head-first towards targets; directional changes were correlated with bilaterally asymmetric motions of the anterolaterally extended forelegs. Aerial performance (i.e. the glide index) decreased with increasing body mass and wing loading, but not with projected surface area of the spider. Along with the occurrence of directed aerial descent in ants, jumping bristletails, and other wingless hexapods, this discovery of targeted gliding in selenopid spiders further indicates strong selective pressures against uncontrolled falls into the understory for arboreal taxa. © 2015 The Author(s).

Spider silk reinforced by graphene or carbon nanotubes

Science.gov (United States)

Lepore, Emiliano; Bosia, Federico; Bonaccorso, Francesco; Bruna, Matteo; Taioli, Simone; Garberoglio, Giovanni; Ferrari, Andrea C.; Pugno, Nicola Maria

2017-09-01

Spider silk has promising mechanical properties, since it conjugates high strength (~1.5 GPa) and toughness (~150 J g-1). Here, we report the production of silk incorporating graphene and carbon nanotubes by spider spinning, after feeding spiders with the corresponding aqueous dispersions. We observe an increment of the mechanical properties with respect to pristine silk, up to a fracture strength ~5.4 GPa and a toughness modulus ~1570 J g-1. This approach could be extended to other biological systems and lead to a new class of artificially modified biological, or ‘bionic’, materials.

Parasitism of Trombidium brevimanum larvae on agrobiont linyphiid spiders from Germany.

Science.gov (United States)

Tomić, Vladimir; Mąkol, Joanna; Stamenković, Srdjan; Büchs, Wolfgang; Prescher, Sabine; Sivčev, Ivan; Graora, Draga; Sivčev, Lazar; Gotlin-Čuljak, Tatjana; Dudić, Boris

2015-08-01

An experiment on three differently-managed agricultural fields in Ahlum, Germany, which aimed at establishing the impact of different management systems on the biodiversity of predators and decomposers, yielded a significant number of spiders parasitized by larvae of Trombidium brevimanum (Actinotrichida, Parasitengona, Trombidiidae). Spider data from the whole sampling period (September 2010-July 2012), indicated that ectoparasitic larvae were recorded only on spiders in pitfall traps in the period of June-July 2011. In this period, only eight species of Linyphiidae--out of 42 species assigned to nine spider families recorded from the study area--were parasitized by mites; considerable levels of parasitism were recorded on Erigone atra, E. dentipalpis, and Oedothorax apicatus. The highest prevalence of parasitism was recorded on the organic field for E. atra (29%), while on the integrated and conventional fields significantly fewer parasitized spiders were observed. The preferred attachment sites on the spider host were regions with softer cuticle, especially regions on the carapace and on the abdomen, adjacent to the pedicel.

Cognitive reappraisal of snake and spider pictures: An event-related potentials study.

Science.gov (United States)

Langeslag, Sandra J E; van Strien, Jan W

2018-05-30

Fear of snakes and spiders are common animal phobias. Emotion regulation can change the response to emotional stimuli, including snakes and spiders. It is well known that emotion regulation modulates the late positive potential (LPP), which reflects sustained motivated attention. However, research concerning the effect of emotion regulation on the early posterior negativity (EPN), which reflects early selective attention, is scarce. The present research question was whether the EPN and LPP amplitudes are modulated by regulation of emotional responses to snake and spider stimuli. Emotion up- and down-regulation were expected to enhance and reduce the LPP amplitude, respectively, but emotion regulation was not expected to modulate the EPN amplitude. Female participants passively viewed snake, spider, and bird pictures, and up- and down-regulated their emotional responses to the snake and spider pictures using self-focused reappraisal, while their electroencephalogram was recorded. There were EPNs for snakes and spiders vs. birds, as well as for snakes vs. spiders. The LPP amplitude tended to be enhanced for snakes and spiders compared to birds. Most importantly, the LPP amplitude was larger in the up-regulate than in the down-regulate condition for both snakes and spiders, but there was no evidence that the EPN amplitude was modulated by emotion regulation. This suggests that emotion regulation modulated sustained motivated attention, but not early selective attention, to snakes and spiders. The findings are in line with the notion that the emotional modulation of the EPN is more automatic than the emotional modulation of the LPP. Copyright © 2018 Elsevier B.V. All rights reserved.

Early Cretaceous greenhouse pumped higher taxa diversification in spiders.

Science.gov (United States)

Shao, Lili; Li, Shuqiang

2018-05-24

The Cretaceous experienced one of the most remarkable greenhouse periods in geological history. During this time, ecosystem reorganizations significantly impacted the diversification of many groups of organisms. The rise of angiosperms marked a major biome turnover. Notwithstanding, relatively little remains known about how the Cretaceous global ecosystem impacted the evolution of spiders, which constitute one of the most abundant groups of predators. Herein, we evaluate the transcriptomes of 91 taxa representing more than half of the spider families. We add 23 newly sequenced taxa to the existing database to obtain a robust phylogenomic assessment. Phylogenetic reconstructions using different datasets and methods obtain novel placements of some groups, especially in the Synspermiata and the group having a retrolateral tibial apophysis (RTA). Molecular analyses indicate an expansion of the RTA clade at the Early Cretaceous with a hunting predatory strategy shift. Fossil analyses show a 7-fold increase of diversification rate at the same period, but this likely owes to the first occurrences spider in amber deposits. Additional analyses of fossil abundance show an accumulation of spider lineages in the Early Cretaceous. We speculate that the establishment of a warm greenhouse climate pumped the diversification of spiders, in particular among webless forms tracking the abundance of insect prey. Our study offers a new pathway for future investigations of spider phylogeny and diversification. Copyright © 2018. Published by Elsevier Inc.

Phylogenomics resolves a spider backbone phylogeny and rejects a prevailing paradigm for orb web evolution.

Science.gov (United States)

Bond, Jason E; Garrison, Nicole L; Hamilton, Chris A; Godwin, Rebecca L; Hedin, Marshal; Agnarsson, Ingi

2014-08-04

Spiders represent an ancient predatory lineage known for their extraordinary biomaterials, including venoms and silks. These adaptations make spiders key arthropod predators in most terrestrial ecosystems. Despite ecological, biomedical, and biomaterial importance, relationships among major spider lineages remain unresolved or poorly supported. Current working hypotheses for a spider "backbone" phylogeny are largely based on morphological evidence, as most molecular markers currently employed are generally inadequate for resolving deeper-level relationships. We present here a phylogenomic analysis of spiders including taxa representing all major spider lineages. Our robust phylogenetic hypothesis recovers some fundamental and uncontroversial spider clades, but rejects the prevailing paradigm of a monophyletic Orbiculariae, the most diverse lineage, containing orb-weaving spiders. Based on our results, the orb web either evolved much earlier than previously hypothesized and is ancestral for a majority of spiders or else it has multiple independent origins, as hypothesized by precladistic authors. Cribellate deinopoid orb weavers that use mechanically adhesive silk are more closely related to a diverse clade of mostly webless spiders than to the araneoid orb-weaving spiders that use adhesive droplet silks. The fundamental shift in our understanding of spider phylogeny proposed here has broad implications for interpreting the evolution of spiders, their remarkable biomaterials, and a key extended phenotype--the spider web. Copyright © 2014 Elsevier Ltd. All rights reserved.

Volatile compounds from leaves of the African spider plant (Gynandropsis gynandra) with bioactivity against spider mite (Tetranychus urticae)

DEFF Research Database (Denmark)

Nyalala, Samuel Odeyo; Petersen, Mikael Agerlin; Grout, Brian William Wilson

2013-01-01

Previous studies have demonstrated that Gynandropsis gynandra emits acetonitrile as a foliar volatile from intact plants and isolated leaves, and that this compound is an effective spider mite repellent. This study has used gas chromatography–mass spectrometry to investigate volatile compounds...... emitted from homogenised G. gynandra leaves to evaluate their tissue acetonitrile content and to look for other compounds that might be exploited for the management of spider mites. Acetonitrile was absent from the homogenised tissues of five lines of G. gynandra, studied over two seasons. Thirteen...... volatile compounds were emitted by G. gynandra at significantly higher levels than mite-susceptible pot roses, including isothiocyanates, aldehydes, esters, alcohols and terpenes. Six representative compounds were selected to assess bioactivity. Spider mite populations were completely inactive after a 2¿h...

Invited review current progress and limitations of spider silk for biomedical applications.

Science.gov (United States)

Widhe, Mona; Johansson, Jan; Hedhammar, My; Rising, Anna

2012-06-01

Spider silk is a fascinating material combining remarkable mechanical properties with low density and biodegradability. Because of these properties and historical descriptions of medical applications, spider silk has been proposed to be the ideal biomaterial. However, overcoming the obstacles to produce spider silk in sufficient quantities and in a manner that meets regulatory demands has proven to be a difficult task. Also, there are relatively few studies of spider silk in biomedical applications available, and the methods and materials used vary a lot. Herein we summarize cell culture- and in vivo implantation studies of natural and synthetic spider silk, and also review the current status and future challenges in the quest for a large scale production of spider silk for medical applications. Copyright © 2011 Wiley Periodicals, Inc.

Determination of PCDDs in spider webs: preliminary studies

Science.gov (United States)

Rybak, Justyna; Rutkowski, Radosław

2018-01-01

The application of spider webs for determination of polichlorinated dibenzo-para-dioxins (PCDDs) has been studied for the first time. The aim of the studies was to find out if spider webs are suitable for such examinations as it was proved in the previous research they are excellent indicators of air pollutants. Spiders are ubiquitous, thus collection of samples is easy and non-invasive. Studies were conducted within the city of Wrocław and surroundings, one of the biggest and at the same time heaviest polluted city in Poland. Five research sites have been chosen, where spider webs were collected after 60 days of continuous exposure time. Webs belonging to two genera Tegenaria sylvestris and Tegenaria ferruginea (family Agelenidae) have been chosen as they are large and very dense, thus they are very suitable for such examinations. Webs were found to retain dioxins probably mainly by external exposure. These promising results should be continued and expanded in the future research.

Spider fauna of semiarid eastern Colorado agroecosystems: diversity, abundance, and effects of crop intensification.

Science.gov (United States)

Kerzicnik, Lauren M; Peairs, Frank B; Cushing, Paula E; Draney, Michael L; Merrill, Scott C

2013-02-01

Spiders are critical predators in agroecosystems. Crop management practices can influence predator density and diversity, which, in turn, can influence pest management strategies. Crop intensification is a sustainable agricultural technique that can enhance crop production although optimizing soil moisture. To date, there is no information on how crop intensification affects natural enemy populations, particularly spiders. This study had two objectives: to characterize the abundance and diversity of spiders in eastern Colorado agroecosystems, and to test the hypothesis that spider diversity and density would be higher in wheat (Triticum aestivum L.) in crop-intensified rotations compared with wheat in conventional rotations. We collected spiders through pitfall, vacuum, and lookdown sampling from 2002 to 2007 to test these objectives. Over 11,000 spiders in 19 families from 119 species were captured from all sampling techniques. Interestingly, the hunting spider guild represented 89% of the spider fauna captured from all sites with the families Gnaphosidae and Lycosidae representing 75% of these spiders. Compared with European agroecosystems, these agroecosystems had greater diversity, which can be beneficial for the biological control of pests. Overall, spider densities were low in these semiarid cropping systems, and crop intensification effects on spider densities were not evident at this scale.

Extended spider cognition.

Science.gov (United States)

Japyassú, Hilton F; Laland, Kevin N

2017-05-01

There is a tension between the conception of cognition as a central nervous system (CNS) process and a view of cognition as extending towards the body or the contiguous environment. The centralised conception requires large or complex nervous systems to cope with complex environments. Conversely, the extended conception involves the outsourcing of information processing to the body or environment, thus making fewer demands on the processing power of the CNS. The evolution of extended cognition should be particularly favoured among small, generalist predators such as spiders, and here, we review the literature to evaluate the fit of empirical data with these contrasting models of cognition. Spiders do not seem to be cognitively limited, displaying a large diversity of learning processes, from habituation to contextual learning, including a sense of numerosity. To tease apart the central from the extended cognition, we apply the mutual manipulability criterion, testing the existence of reciprocal causal links between the putative elements of the system. We conclude that the web threads and configurations are integral parts of the cognitive systems. The extension of cognition to the web helps to explain some puzzling features of spider behaviour and seems to promote evolvability within the group, enhancing innovation through cognitive connectivity to variable habitat features. Graded changes in relative brain size could also be explained by outsourcing information processing to environmental features. More generally, niche-constructed structures emerge as prime candidates for extending animal cognition, generating the selective pressures that help to shape the evolving cognitive system.

A comparison of spider communities in Bt and non-Bt rice fields.

Science.gov (United States)

Lee, Sue Yeon; Kim, Seung Tae; Jung, Jong Kook; Lee, Joon-Ho

2014-06-01

To assess the potential adverse effects of a Bt rice line (Japonica rice cultivar, Nakdong) expressing a synthetic cry1Ac1 gene, C7-1-9-1-B, which was highly active against all larval stages of Cnaphalocrocis medinalis (Guenée) (Lepidoptera: Crambidae), we investigated the community structure of spiders in Bt and non-Bt rice fields during the rice-growing season in 2007 and 2008 in Chungcheongnam-do, Korea. Spiders were surveyed with a sweep net and suction device. Suction sampling captured more spiders, measured in terms of species level and abundance, than sweeping. Araneidae and Thomisidae were captured more by sweeping, and certain species were captured only by sweeping. These findings show that both suction and sweep sampling methods should be used because these methods are most likely complementary. In total, 29 species in 23 genera and nine families were identified from the 4,937 spiders collected, and both Bt and non-Bt rice fields showed a typical Korean spider assemblage. The temporal patterns of spider species richness and spider abundance were very similar between Bt and non-Bt rice, although significant differences in species richness were observed on a few occasions. Overall, spider community structure, including diversity, the dominant species, and abundance did not differ between Bt and non-Bt rice. The results of the study indicated that the transgenic Cry1Ac rice lines tested in this study had no adverse effects on the spider community structure of the rice fields.

Edge effect on weevils and spiders

OpenAIRE

Horváth, R.; Magura, T.; Péter, G.; Tóthmérész, B.

2002-01-01

The edge effect on weevils and spiders was tested along oak forest – meadow transects using sweep-net samples at the Síkfökút Project in Hungary. For spiders the species richness was significantly higher in the forest edge than either in the meadow or the forest interior. For weevils the species richness of the forest edge was higher than that of the meadow, but the difference was not statistically significant whereas the species richness of the forest...

Cuticular bacteria appear detrimental to social spiders in mixed but not monoculture exposure

Science.gov (United States)

Keiser, Carl N.; Shearer, Taylor A.; DeMarco, Alexander E.; Brittingham, Hayley A.; Knutson, Karen A.; Kuo, Candice; Zhao, Katherine; Pruitt, Jonathan N.

2016-01-01

Abstract Much of an animal’s health status, life history, and behavior are dictated by interactions with its endogenous and exogenous bacterial communities. Unfortunately, interactions between hosts and members of their resident bacterial community are often ignored in animal behavior and behavioral ecology. Here, we aim to identify the nature of host–microbe interactions in a nonmodel organism, the African social spider Stegodyphus dumicola. We collected and identified bacteria from the cuticles of spiders in situ and then exposed spiders to bacterial monocultures cultures via topical application or injection. We also topically inoculated spiders with a concomitant “cocktail” of bacteria and measured the behavior of spiders daily for 24 days after inoculation. Lastly, we collected and identified bacteria from the cuticles of prey items in the capture webs of spiders, and then fed spiders domestic crickets which had been injected with these bacteria. We also injected 1 species of prey-borne bacteria into the hemolymph of spiders. Only Bacillus thuringiensis caused increased mortality when injected into the hemolymph of spiders, whereas no bacterial monocultures caused increased mortality when applied topically, relative to control solutions. However, a bacterial cocktail of cuticular bacteria caused weight loss and mortality when applied topically, yet did not detectibly alter spider behavior. Consuming prey injected with prey-borne bacteria was associated with an elongated lifespan in spiders. Thus, indirect evidence from multiple experiments suggests that the effects of these bacteria on spider survivorship appear contingent on their mode of colonization and whether they are applied in monoculture or within a mixed cocktail. We urge that follow-up studies should test these host–microbe interactions across different social contexts to determine the role that microbes play in colony performance. PMID:29491926

Subsocial behaviour and brood adoption in mixed-species colonies of two theridiid spiders

DEFF Research Database (Denmark)

Grinsted, Lena; Agnarsson, Ingi; Bilde, Trine

2012-01-01

Cooperation and group living often evolves through kin selection. However, associations between unrelated organisms, such as different species, can evolve if both parties benefit from the interaction. Group living is rare in spiders, but occurs in cooperative, permanently social spiders, as well...... as in territorial, colonial spiders. Mixed species spider colonies, involving closely related species, have rarely been documented. We examined social interactions in newly discovered mixed-species colonies of theridiid spiders on Bali, Indonesia. Our aim was to test the degree of intra- and interspecific tolerance...

The time course of location-avoidance learning in fear of spiders.

Science.gov (United States)

Rinck, Mike; Koene, Marieke; Telli, Sibel; Moerman-van den Brink, Wiltine; Verhoeven, Barbara; Becker, Eni S

2016-01-01

Two experiments were designed to study the time course of avoidance learning in spider fearfuls (SFs) under controlled experimental conditions. To achieve this, we employed an immersive virtual environment (IVE): While walking freely through a virtual art museum to search for specific paintings, the participants were exposed to virtual spiders. Unbeknown to the participants, only two of four museum rooms contained spiders, allowing for avoidance learning. Indeed, the more SF the participants were, the faster they learned to avoid the rooms that contained spiders (Experiment. 1), and within the first six trials, high fearfuls already developed a preference for starting their search task in rooms without spiders (Experiment 2). These results illustrate the time course of avoidance learning in SFs, and they speak to the usefulness of IVEs in fundamental anxiety research.

Edge effect on weevils and spiders

Directory of Open Access Journals (Sweden)

R. Horváth

2002-05-01

Full Text Available The edge effect on weevils and spiders was tested along oak forest – meadow transects using sweep-net samples at the Síkfökút Project in Hungary. For spiders the species richness was significantly higher in the forest edge than either in the meadow or the forest interior. For weevils the species richness of the forest edge was higher than that of the meadow, but the difference was not statistically significant whereas the species richness of the forest interior was significantly lower than that of the forest edge and the meadow. The composition of the spider assemblage of the edge was more similar to the forest, while the composition of weevils in the edge was more similar to the meadow. Our results based on two invertebrate groups operating on different trophic levels suggest that there is a significant edge effect for the studied taxa resulting in higher species richness in the edge.

Basal salivary oxytocin level predicts extra- but not intra-personal dimensions of emotional intelligence.

Science.gov (United States)

Koven, Nancy S; Max, Laura K

2014-06-01

A wealth of literature suggests that oxytocin is an important mediator of social cognition, but much of the research to date has relied on pharmaceutical administration methods that can raise oxytocin to artificially high levels. The present study builds upon previous work by examining whether basal oxytocin level predicts intra- and extra-personal (i.e., self- and other-focused) elements of emotional intelligence (EI), independent of shared variance with current mood. The sample included 71 healthy young adults (46 women). Assessment measures included the Mayer-Salovey-Caruso Emotional Intelligence Test Version 2.0 (MSCEIT), the Trait Meta-Mood Scale, and the Profile of Mood States. Peripheral oxytocin levels were examined with enzyme-linked immunosorbent assay from saliva after solid phase extraction. Oxytocin level was unrelated to TMMS scores but was positively associated with performance in the Experiential EI domain of the MSCEIT. However, total mood disturbance was positively related to MSCEIT scores. Hierarchical regression analysis indicated that oxytocin level added unique variance to the prediction of MSCEIT performance beyond that of current mood. These results confirm an association between endogenous levels of oxytocin in healthy adults and a subset of EI abilities, including extra-personal emotion recognition and the channeling of emotions to enhance social proficiency. Copyright © 2014 Elsevier Ltd. All rights reserved.

Design and implementation of the standards-based personal intelligent self-management system (PICS).

Science.gov (United States)

von Bargen, Tobias; Gietzelt, Matthias; Britten, Matthias; Song, Bianying; Wolf, Klaus-Hendrik; Kohlmann, Martin; Marschollek, Michael; Haux, Reinhold

2013-01-01

Against the background of demographic change and a diminishing care workforce there is a growing need for personalized decision support. The aim of this paper is to describe the design and implementation of the standards-based personal intelligent care systems (PICS). PICS makes consistent use of internationally accepted standards such as the Health Level 7 (HL7) Arden syntax for the representation of the decision logic, HL7 Clinical Document Architecture for information representation and is based on a open-source service-oriented architecture framework and a business process management system. Its functionality is exemplified for the application scenario of a patient suffering from congestive heart failure. Several vital signs sensors provide data for the decision support system, and a number of flexible communication channels are available for interaction with patient or caregiver. PICS is a standards-based, open and flexible system enabling personalized decision support. Further development will include the implementation of components on small computers and sensor nodes.

Endemic harvestmen and spiders of Austria (Arachnida: Opiliones, Araneae

Directory of Open Access Journals (Sweden)

Komposch, Christian

2011-01-01

Full Text Available A comprehensive overview of plant, fungus and animal species of Austria revealed a total of 748 endemic and subendemic species, including, 11 harvestman and 46 spider species. Altogether two endemic harvestmen (Nemastoma bidentatum relictum, Nemastoma schuelleri and 8 endemic spiders (Abacoproeces molestus, Collinsia (caliginosa nemenziana, Mughiphantes severus, Mughiphantes styriacus, Pelecopsis alpica, Scotophaeus nanus, Troglohyphantes novicordis, Troglohyphantes tauriscus, beside 9 subendemic harvestman and 38 subendemic spider species have been recorded from Austria. Hot-spots of endemism in the Eastern Alps are the north-eastern (Ennstaler Alps and southern Calcareous Alps (Karawanken, Karnische Alps and the Central Alps (Hohe Tauern, Gurktaler Alps, Ötztaler and Stubaier Alps. Most of the endemic arachnid species occur from the nival down to the montane zone. Important habitats are rocky areas, caves and woodlands. High absolute numbers and percentages of endemics can be found within the harvestman families Cladonychiidae, Ischyropsalididae and Nemastomatidae and in the spider genera Lepthyphantes s. l. and Troglohyphantes. The conservation status of these highly endangered taxa – 85 % of the spider species and 100 % of the harvestman taxa are endangered in Austria – is poor.

SPIDER: A Framework for Understanding Driver Distraction.

Science.gov (United States)

Strayer, David L; Fisher, Donald L

2016-02-01

The objective was to identify key cognitive processes that are impaired when drivers divert attention from driving. Driver distraction is increasingly recognized as a significant source of injuries and fatalities on the roadway. A "SPIDER" model is developed that identifies key cognitive processes that are impaired when drivers divert attention from driving. SPIDER is an acronym standing for scanning, predicting, identifying, decision making, and executing a response. When drivers engage in secondary activities unrelated to the task of driving, SPIDER-related processes are impaired, situation awareness is degraded, and the ability to safely operate a motor vehicle may be compromised. The pattern of interference helps to illuminate the sources of driver distraction and may help guide the integration of new technology into the automobile. © 2015, Human Factors and Ergonomics Society.

Information processing biases in spider phobia: application of the Stroop and "White Noise" Paradigm.

Science.gov (United States)

Olatunji, Bunmi O; Sawchuk, Craig N; Lee, Thomas C; Lohr, Jeffrey M; Tolin, David F

2008-06-01

The present study examines attentional and implicit memory biases in spider phobic and nonphobic participants. The results showed that spider phobics demonstrated increased interference for neutral, negative, and spider-relevant words on a computerized Stroop task. However, no group differences emerged when adjusting for differences in color-naming speed. Prior exposure to a dead spider did result in higher overall Stroop interference in spider phobics and this appeared to be mostly pronounced for spider-relevant words. Implicit memory bias for threat was examined with a noise judgment task. Participants first heard neutral and spider-relevant sentences and implicit memory for these sentences was evaluated by having participants rate the volume of noise accompanying the presentation of old sentences intermixed with new sentences. An implicit memory bias is indicated if participants rate noise accompanying old sentences as less loud than noise accompanying new sentences. No evidence was found for an implicit memory bias in spider phobics. These findings are discussed in relation to the role of information processing biases in spider phobia.

Spider diversity in coffee agroecosystems: the influence of agricultural intensification and aggressive ants.

Science.gov (United States)

Marín, Linda; Perfecto, Ivette

2013-04-01

Spiders are a very diverse group of invertebrate predators found in agroecosystems and natural systems. However, spider distribution, abundance, and eventually their ecological function in ecosystems can be influenced by abiotic and biotic factors such as agricultural intensification and dominant ants. Here we explore the influence of both agricultural intensification and the dominant arboreal ant Azteca instabilis on the spider community in coffee agroecosystems in southern Mexico. To measure the influence of the arboreal ant Azteca instabilis (F. Smith) on the spider community inhabiting the coffee layer of coffee agroecosystems, spiders were collected from coffee plants that were and were not patrolled by the ant in sites differing in agricultural intensification. For 2008, generalized linear mixed models showed that spider diversity was affected positively by agricultural intensification but not by the ant. However, results suggested that some spider species were associated with A. instabilis. Therefore, in 2009 we concentrated our research on the effect of A. instabilis on spider diversity and composition. For 2009, generalized linear mixed models show that spider richness and abundance per plant were significantly higher in the presence of A. instabilis. In addition, analyses of visual counts of insects and sticky traps data show that more resources were present in plants patrolled by the ant. The positive effect of A. instabilis on spiders seems to be caused by at least two mechanisms: high abundance of insects and protection against predators.

An examination of personality, emotional intelligence, coping, gender and subjective well-being with perceived stress (trait and state) in undergraduate students.

OpenAIRE

Osborne, Shona Elizabeth

2009-01-01

This multivariate study aimed to further understand student stress. Associations between personality, emotional intelligence, coping and subjective well-being with perceived stress (trait and state) were examined in 238 undergraduate students, using self-report measures. Gender differences in these variables were also investigated. The results showed that students low in emotional stability, extraversion, emotional intelligence, subjective well-being and those with a tendency to use emotion...

Reconstitutable control rod spider assembly

International Nuclear Information System (INIS)

Shallenberger, J.M.; Ferian, S.J.

1990-01-01

A reconstitutable control rod/spider assembly includes a hollow connecting finger of the spider having a pair of opposing flat segments formed on the interior thereof and engaging a pair of opposing flat sectors formed on the exterior of a stem extending form the upper end of control rod. The stem also has an externally-threaded portion engaging a nut and a pilot aligning portion for the nut. The nut has a radially flexible and expandable thread-defining element captured in its bore. The segments and sectors allow the rod to be removed and reattached after turning through 180 0 to allow more even wear on the rod. (author)

A Study of Personality, Emotional Intelligence, Social Maturity, and Job Performance among Nurses in Rural East Texas

Science.gov (United States)

Cox, Shannon J.

2012-01-01

Nursing professionals are held to a variety of roles and responsibilities specific to their field. The success of nursing professionals in their specified roles is essential for quality of care and the success of the healthcare workforce. The current study explored the relationships between personality type, emotional intelligence, social…

Phylogenomics, Diversification Dynamics, and Comparative Transcriptomics across the Spider Tree of Life.

Science.gov (United States)

Fernández, Rosa; Kallal, Robert J; Dimitrov, Dimitar; Ballesteros, Jesús A; Arnedo, Miquel A; Giribet, Gonzalo; Hormiga, Gustavo

2018-05-07

Dating back to almost 400 mya, spiders are among the most diverse terrestrial predators [1]. However, despite considerable effort [1-9], their phylogenetic relationships and diversification dynamics remain poorly understood. Here, we use a synergistic approach to study spider evolution through phylogenomics, comparative transcriptomics, and lineage diversification analyses. Our analyses, based on ca. 2,500 genes from 159 spider species, reject a single origin of the orb web (the "ancient orb-web hypothesis") and suggest that orb webs evolved multiple times since the late Triassic-Jurassic. We find no significant association between the loss of foraging webs and increases in diversification rates, suggesting that other factors (e.g., habitat heterogeneity or biotic interactions) potentially played a key role in spider diversification. Finally, we report notable genomic differences in the main spider lineages: while araneoids (ecribellate orb-weavers and their allies) reveal an enrichment in genes related to behavior and sensory reception, the retrolateral tibial apophysis (RTA) clade-the most diverse araneomorph spider lineage-shows enrichment in genes related to immune responses and polyphenic determination. This study, one of the largest invertebrate phylogenomic analyses to date, highlights the usefulness of transcriptomic data not only to build a robust backbone for the Spider Tree of Life, but also to address the genetic basis of diversification in the spider evolutionary chronicle. Copyright © 2018 Elsevier Ltd. All rights reserved.

Spiders (Araneae) Found in Bananas and Other International Cargo Submitted to North American Arachnologists for Identification.

Science.gov (United States)

Vetter, Richard S; Crawford, Rodney L; Buckle, Donald J

2014-11-01

Spiders found in international cargo brought into North America are sometimes submitted to arachnologists for identification. Often, these spiders are presumed to be of medical importance because of size or a submitter's familiarity with a toxic spider genus from the continent of origin. Starting in 2006, requests were made for spiders found in international cargo brought into North America, in addition to the specimens from similar cargo shipments already in our museum collections. This was an ad hoc study that allowed us to focus on spiders of concern to the discoverer. We identified 135 spiders found in international cargo. A key for the most common species is provided. The most frequently submitted spiders were the pantropical huntsman spider, Heteropoda venatoria (L.) (Sparassidae), and the redfaced banana spider, Cupiennius chiapanensis Medina Soriano (Ctenidae). Spiders of medical importance were rare. The most common cargo from which spiders were submitted was bananas with most specimens coming from Central America, Ecuador, or Colombia. Lack of experience with nonnative fauna caused several experienced American arachnologists to misidentify harmless ctenid spiders (C. chiapanensis, spotlegged banana spider, Cupiennius getazi Simon) as highly toxic Phoneutria spiders. These misidentifications could have led to costly, unwarranted prophylactic eradication measures, unnecessary employee health education, heightened employee anxiety and spoilage when perishable goods are left unloaded due to safety concerns. © 2014 Entomological Society of America.

Remote monitoring of vibrational information in spider webs

Science.gov (United States)

Mortimer, B.; Soler, A.; Siviour, C. R.; Vollrath, F.

2018-06-01

Spiders are fascinating model species to study information-acquisition strategies, with the web acting as an extension of the animal's body. Here, we compare the strategies of two orb-weaving spiders that acquire information through vibrations transmitted and filtered in the web. Whereas Araneus diadematus monitors web vibration directly on the web, Zygiella x-notata uses a signal thread to remotely monitor web vibration from a retreat, which gives added protection. We assess the implications of these two information-acquisition strategies on the quality of vibration information transfer, using laser Doppler vibrometry to measure vibrations of real webs and finite element analysis in computer models of webs. We observed that the signal thread imposed no biologically relevant time penalty for vibration propagation. However, loss of energy (attenuation) was a cost associated with remote monitoring via a signal thread. The findings have implications for the biological use of vibrations by spiders, including the mechanisms to locate and discriminate between vibration sources. We show that orb-weaver spiders are fascinating examples of organisms that modify their physical environment to shape their information-acquisition strategy.

A Tank Bromeliad Favors Spider Presence in a Neotropical Inundated Forest.

Directory of Open Access Journals (Sweden)

Yann Hénaut

Full Text Available Tank bromeliads are good models for understanding how climate change may affect biotic associations. We studied the relationships between spiders, the epiphytic tank bromeliad, Aechmea bracteata, and its associated ants in an inundated forest in Quintana Roo, Mexico, during a drought period while, exceptionally, this forest was dry and then during the flooding that followed. We compared spider abundance and diversity between 'Aechmea-areas' and 'control-areas' of the same surface area. We recorded six spider families: the Dipluridae, Ctenidae, Salticidae, Araneidae, Tetragnathidae and Linyphiidae among which the funnel-web tarantula, Ischnothele caudata, the only Dipluridae noted, was the most abundant. During the drought period, the spiders were more numerous in the Aechmea-areas than in the control-areas, but they were not obligatorily associated with the Aechmea. During the subsequent flooding, the spiders were concentrated in the A. bracteata patches, particularly those sheltering an ant colony. Also, a kind of specificity existed between certain spider taxa and ant species, but varied between the drought period and subsequent flooding. We conclude that climatic events modulate the relationship between A. bracteata patches and their associated fauna. Tank bromeliads, previously considered only for their ecological importance in supplying food and water during drought, may also be considered refuges for spiders during flooding. More generally, tank bromeliads have an important role in preserving non-specialized fauna in inundated forests.

A Tank Bromeliad Favors Spider Presence in a Neotropical Inundated Forest.

Science.gov (United States)

Hénaut, Yann; Corbara, Bruno; Pélozuelo, Laurent; Azémar, Frédéric; Céréghino, Régis; Herault, Bruno; Dejean, Alain

2014-01-01

Tank bromeliads are good models for understanding how climate change may affect biotic associations. We studied the relationships between spiders, the epiphytic tank bromeliad, Aechmea bracteata, and its associated ants in an inundated forest in Quintana Roo, Mexico, during a drought period while, exceptionally, this forest was dry and then during the flooding that followed. We compared spider abundance and diversity between 'Aechmea-areas' and 'control-areas' of the same surface area. We recorded six spider families: the Dipluridae, Ctenidae, Salticidae, Araneidae, Tetragnathidae and Linyphiidae among which the funnel-web tarantula, Ischnothele caudata, the only Dipluridae noted, was the most abundant. During the drought period, the spiders were more numerous in the Aechmea-areas than in the control-areas, but they were not obligatorily associated with the Aechmea. During the subsequent flooding, the spiders were concentrated in the A. bracteata patches, particularly those sheltering an ant colony. Also, a kind of specificity existed between certain spider taxa and ant species, but varied between the drought period and subsequent flooding. We conclude that climatic events modulate the relationship between A. bracteata patches and their associated fauna. Tank bromeliads, previously considered only for their ecological importance in supplying food and water during drought, may also be considered refuges for spiders during flooding. More generally, tank bromeliads have an important role in preserving non-specialized fauna in inundated forests.

Environmental and hormonal factors controlling reversible colour change in crab spiders.

Science.gov (United States)

Llandres, Ana L; Figon, Florent; Christidès, Jean-Philippe; Mandon, Nicole; Casas, Jérôme

2013-10-15

Habitat heterogeneity that occurs within an individual's lifetime may favour the evolution of reversible plasticity. Colour reversibility has many different functions in animals, such as thermoregulation, crypsis through background matching and social interactions. However, the mechanisms underlying reversible colour changes are yet to be thoroughly investigated. This study aims to determine the environmental and hormonal factors underlying morphological colour changes in Thomisus onustus crab spiders and the biochemical metabolites produced during these changes. We quantified the dynamics of colour changes over time: spiders were kept in yellow and white containers under natural light conditions and their colour was measured over 15 days using a spectrophotometer. We also characterised the chemical metabolites of spiders changing to a yellow colour using HPLC. Hormonal control of colour change was investigated by injecting 20-hydroxyecdysone (20E) into spiders. We found that background colouration was a major environmental factor responsible for colour change in crab spiders: individuals presented with white and yellow backgrounds changed to white and yellow colours, respectively. An ommochrome precursor, 3-OH-kynurenine, was the main pigment responsible for yellow colour. Spiders injected with 20E displayed a similar rate of change towards yellow colouration as spiders kept in yellow containers and exposed to natural sunlight. This study demonstrates novel hormonal manipulations that are capable of inducing reversible colour change.

A Tank Bromeliad Favors Spider Presence in a Neotropical Inundated Forest

Science.gov (United States)

Hénaut, Yann; Corbara, Bruno; Pélozuelo, Laurent; Azémar, Frédéric; Céréghino, Régis; Herault, Bruno; Dejean, Alain

2014-01-01

Tank bromeliads are good models for understanding how climate change may affect biotic associations. We studied the relationships between spiders, the epiphytic tank bromeliad, Aechmea bracteata, and its associated ants in an inundated forest in Quintana Roo, Mexico, during a drought period while, exceptionally, this forest was dry and then during the flooding that followed. We compared spider abundance and diversity between ‘Aechmea-areas’ and ‘control-areas’ of the same surface area. We recorded six spider families: the Dipluridae, Ctenidae, Salticidae, Araneidae, Tetragnathidae and Linyphiidae among which the funnel-web tarantula, Ischnothele caudata, the only Dipluridae noted, was the most abundant. During the drought period, the spiders were more numerous in the Aechmea-areas than in the control-areas, but they were not obligatorily associated with the Aechmea. During the subsequent flooding, the spiders were concentrated in the A. bracteata patches, particularly those sheltering an ant colony. Also, a kind of specificity existed between certain spider taxa and ant species, but varied between the drought period and subsequent flooding. We conclude that climatic events modulate the relationship between A. bracteata patches and their associated fauna. Tank bromeliads, previously considered only for their ecological importance in supplying food and water during drought, may also be considered refuges for spiders during flooding. More generally, tank bromeliads have an important role in preserving non-specialized fauna in inundated forests. PMID:25494055

Small Molecules from Spiders Used as Chemical Probes

DEFF Research Database (Denmark)

Olsen, Christian Adam; Kristensen, Anders S.; Strømgaard, Kristian

2011-01-01

Spiders are important species in ecological systems and as major predators of insects they are endowed with a plethora of low‐molecular‐weight natural products having intriguing biological activities. The isolation and biological characterization of these entities are well established, however......, only very recently have these compounds been used as templates for the design, synthesis, and biological evaluation of synthetic analogues. In contrast, the investigation of compounds responsible for chemical communication between spiders is far less developed, but recently new light has been shed onto...... the area of pheromones and allomones from spiders. Herein, we recapitulate these recent results, put them into perspective with previous findings, and provide an outlook for future studies of these chemotypes....

The person who eases your mind "Ibasyo" and emotional intelligence in interpersonal adaptation

Directory of Open Access Journals (Sweden)

Hiroshi Toyota

2009-11-01

Full Text Available The present study was carried out to examine the effect of the "Ibasyo" (the person who eases one's mind and emotional intelligence (EI on self-esteem and loneliness. Five hundred and eight Japanese undergraduates were asked to choose one of the alternatives (e. g., myself, mother, friend to answer the question "Who is the person that eases your mind?" Then, they were asked to rate items from scales corresponding to EI, self-esteem and loneliness. Multiple regression analyses indicated that both Ibasyo and EI explained 25% of loneliness, but only EI explained 25% of self-esteem. The analyses also showed differences of sub-abilities in EI that determined the level of loneliness and self-esteem among Ibasyo groups. These results are interpreted as showing the importance of EI in adaptation.

Exploring of the first recorded spider (Arachenida: Aranae species of Sheringal, Khyber Pakhtunkhwa, Pakistan

Directory of Open Access Journals (Sweden)

Farzana Perveen

2015-09-01

Full Text Available The spiders (Arthropoada: Arachenida are one of the groups of grasping animals. Their carapaces are found on the dorsal side of the cephalothorax, which is an important characteristic of spiders. The present study was conducted to explore the first recorded spider species (nti=75 of Sheringal, Dir Upper (DU, Khyber Pakhtunkhwa (KP, Dir Upper, Khyber Pakhtunkhwa, Pakistan. The 10 genera with 10 species under 7 families were recorded from June 2013-July 2014. According to length of legs, the largest spider was the huntsman spider, Halconia insignis Thorell having length of the first leg was 1.9±0.20, however, the same of the last leg was 1.44±0.25 (n=9. In the same contest, the smallest spider was the ground spider, Gnaphosa eucalyptus Ghafoor and Beg having length of the first leg was 0.4±0.08, while the same of the last leg was 0.4±0.08 (n=3. According to length of cephalothorax and abdomen, the largest spider was the wolf spider, Hippasa partita Takidar having length of the cephalothorax was 1.1±0.01, however, the same of the abdomen was 0.7±0.1 (n=6. In the same contest, the smallest spider was the harvestmen, Hadrobunus grandis Sundevall having length of the cephalothorax was 0.1±0.04, while the same of the abdomen was 0.3±0.04 (n=12. During present research, 10 spider species of Sheringal with different sizes were explored. The present research will be useful to educate and create awareness about spiders in the people of Sheringal.

Optical surface profiling of orb-web spider capture silks

Energy Technology Data Exchange (ETDEWEB)

Kane, D M; Joyce, A M; Staib, G R [Department of Physics, Macquarie University, Sydney, NSW 2109 (Australia); Herberstein, M E, E-mail: deb.kane@mq.edu.a [Department of Biological Sciences, Macquarie University, Sydney, NSW 2109 (Australia)

2010-09-15

Much spider silk research to date has focused on its mechanical properties. However, the webs of many orb-web spiders have evolved for over 136 million years to evade visual detection by insect prey. It is therefore a photonic device in addition to being a mechanical device. Herein we use optical surface profiling of capture silks from the webs of adult female St Andrews cross spiders (Argiope keyserlingi) to successfully measure the geometry of adhesive silk droplets and to show a bowing in the aqueous layer on the spider capture silk between adhesive droplets. Optical surface profiling shows geometric features of the capture silk that have not been previously measured and contributes to understanding the links between the physical form and biological function. The research also demonstrates non-standard use of an optical surface profiler to measure the maximum width of a transparent micro-sized droplet (microlens).

Optical surface profiling of orb-web spider capture silks

International Nuclear Information System (INIS)

Kane, D M; Joyce, A M; Staib, G R; Herberstein, M E

2010-01-01

Much spider silk research to date has focused on its mechanical properties. However, the webs of many orb-web spiders have evolved for over 136 million years to evade visual detection by insect prey. It is therefore a photonic device in addition to being a mechanical device. Herein we use optical surface profiling of capture silks from the webs of adult female St Andrews cross spiders (Argiope keyserlingi) to successfully measure the geometry of adhesive silk droplets and to show a bowing in the aqueous layer on the spider capture silk between adhesive droplets. Optical surface profiling shows geometric features of the capture silk that have not been previously measured and contributes to understanding the links between the physical form and biological function. The research also demonstrates non-standard use of an optical surface profiler to measure the maximum width of a transparent micro-sized droplet (microlens).

Spiders do not evoke greater early posterior negativity in the event-related potential as snakes.

Science.gov (United States)

He, Hongshen; Kubo, Kenta; Kawai, Nobuyuki

2014-09-10

It has been long believed that both snakes and spiders are archetypal fear stimuli for humans. Furthermore, snakes have been assumed as stronger threat cues for nonhuman primates. However, it is still unclear whether spiders hold a special status in human perception. The current study explored to what extent spider pictures draw early visual attention [as assessed with early posterior negativity (EPN)] when compared with insects similar to spiders. To measure the EPN, participants watched a random rapid serial presentation of pictures, which consisted of two conditions: spider condition (spider, wasp, bumblebee, beetle) and snake condition (snake, bird). EPN amplitudes revealed no significant difference between spider, wasp, bumblebee, and beetle pictures, whereas EPN amplitudes were significantly larger for snake pictures relative to bird pictures. In addition, EPN amplitudes were significantly larger for snake pictures relative to spider pictures. These results suggest that the early visual attentional capture of animate objects is stronger for snakes, whereas spiders do not appear to hold special early attentional value.

Solubilization of spider silk proteins and its structural analysis using Fourier transform infrared spectroscopy

Science.gov (United States)

Osbin, K.; Jayan, Manuel; Bhadrakumari, S.; Predeep, P.

2017-06-01

This study investigates the presence of various amide bands present in different spider silk species, which provides extraordinary physical properties. Three different spider silks were collected from Western Ghats region. The collected spider silks samples belonging to the spider Heteropoda venatoria (species 1), Hersilia savignyi (species 2) and Pholcus phalangioides (species 3). Fourier transform infrared (FTIR) spectra reveals the protein peaks in the amide I, II, and III regions in all the three types of spider silk species.

How informative are case studies of spider bites in the medical literature?

Science.gov (United States)

Stuber, Marielle; Nentwig, Wolfgang

2016-05-01

We analyzed the reliability and information content of 134 medical case studies on spider bites, published in 91 journal articles. Overall, we found that only 22% of these studies fulfilled the criteria for a verified spider bite. This means that the majority of such case studies cannot be attributed to a given spider species and usually not even to a spider. Their scientific value is negligible, moreover, such publications are even dangerous because they suggest incorrect conclusions. Secondly, we found that such case studies usually do not follow an obvious structure and many details on the development of symptoms, therapy and healing process are widely lacking. So even for verified spider bites, the comparability of case studies is limited. We discuss the obvious failure of a reviewing process for case studies and give recommendations how to increase the currently low information content of medical case studies on spider bites. Copyright © 2016 Elsevier Ltd. All rights reserved.

Rapid visuomotor processing of phobic images in spider- and snake-fearful participants.

Science.gov (United States)

Haberkamp, Anke; Schmidt, Filipp; Schmidt, Thomas

2013-10-01

This study investigates enhanced visuomotor processing of phobic compared to fear-relevant and neutral stimuli. We used a response priming design to measure rapid, automatic motor activation by natural images (spiders, snakes, mushrooms, and flowers) in spider-fearful, snake-fearful, and control participants. We found strong priming effects in all tasks and conditions; however, results showed marked differences between groups. Most importantly, in the group of spider-fearful individuals, spider pictures had a strong and specific influence on even the fastest motor responses: Phobic primes entailed the largest priming effects, and phobic targets accelerated responses, both effects indicating speeded response activation by phobic images. In snake-fearful participants, this processing enhancement for phobic material was less pronounced and extended to both snake and spider images. We conclude that spider phobia leads to enhanced processing capacity for phobic images. We argue that this is enabled by long-term perceptual learning processes. © 2013.

Who is afraid of a black Spider(-Man)?

OpenAIRE

Ora C. McWilliams

2013-01-01

An Internet post asking about Spider-Man's race in a film turned into an Internet campaign about an actor that led fans to interact with each other as well as with the actor, which in turn led to the attention of media producers, which resulted in a change in Spider-Man's race in a print comic book.

Factors that influence the beta-diversity of spider communities in northwestern Argentinean Grasslands

Directory of Open Access Journals (Sweden)

Sandra M. Rodriguez-Artigas

2016-04-01

Full Text Available Beta-diversity, defined as spatial replacement in species composition, is crucial to the understanding of how local communities assemble. These changes can be driven by environmental or geographic factors (such as geographic distance, or a combination of the two. Spiders have been shown to be good indicators of environmental quality. Accordingly, spiders are used in this work as model taxa to establish whether there is a decrease in community similarity that corresponds to geographic distance in the grasslands of the Campos & Malezales ecoregion (Corrientes. Furthermore, the influence of climactic factors and local vegetation heterogeneity (environmental factors on assemblage composition was evaluated. Finally, this study evaluated whether the differential dispersal capacity of spider families is a factor that influences their community structure at a regional scale. Spiders were collected with a G-Vac from vegetation in six grassland sites in the Campos & Malezales ecoregion that were separated by a minimum of 13 km. With this data, the impact of alpha-diversity and different environmental variables on the beta-diversity of spider communities was analysed. Likewise, the importance of species replacement and nesting on beta-diversity and their contribution to the regional diversity of spider families with different dispersion capacities was evaluated. The regional and site-specific inventories obtained were complete. The similarity between spider communities declined as the geographic distance between sites increased. Environmental variables also influenced community composition; stochastic events and abiotic forces were the principal intervening factors in assembly structure. The differential dispersal capacity of spider groups also influenced community structure at a regional scale. The regional beta-diversity, as well as species replacement, was greater in high and intermediate vagility spiders; while nesting was greater in spiders with low

Nutrient Deprivation Induces Property Variations in Spider Gluey Silk

Science.gov (United States)

Blamires, Sean J.; Sahni, Vasav; Dhinojwala, Ali; Blackledge, Todd A.; Tso, I-Min

2014-01-01

Understanding the mechanisms facilitating property variability in biological adhesives may promote biomimetic innovations. Spider gluey silks such as the spiral threads in orb webs and the gumfoot threads in cobwebs, both of which comprise of an axial thread coated by glue, are biological adhesives that have variable physical and chemical properties. Studies show that the physical and chemical properties of orb web gluey threads change when spiders are deprived of food. It is, however, unknown whether gumfoot threads undergo similar property variations when under nutritional stress. Here we tested whether protein deprivation induces similar variations in spiral and gumfoot thread morphology and stickiness. We manipulated protein intake for the orb web spider Nephila clavipes and the cobweb spider Latrodectus hesperus and measured the diameter, glue droplet volume, number of droplets per mm, axial thread width, thread stickiness and adhesive energy of their gluey silks. We found that the gluey silks of both species were stickier when the spiders were deprived of protein than when the spiders were fed protein. In N. clavipes a concomitant increase in glue droplet volume was found. Load-extension curves showed that protein deprivation induced glue property variations independent of the axial thread extensions in both species. We predicted that changes in salt composition of the glues were primarily responsible for the changes in stickiness of the silks, although changes in axial thread properties might also contribute. We, additionally, showed that N. clavipes' glue changes color under protein deprivation, probably as a consequence of changes to its biochemical composition. PMID:24523902

Structure–Activity Relationship Study of Spider Polyamine Toxins as Inhibitors of Ionotropic Glutamate Receptors

DEFF Research Database (Denmark)

Xiong, Xiaofeng; Poulsen, Mette H; Hussein, Rama A

2014-01-01

The spider polyamine toxins Joro spider toxin-3 (JSTX-3) and Nephila polyamine toxins-1 and -8 (NPTX-1 and NPTX-8) are isolated from the venom of the orb-weaver spider Nephila clavata (Joro spider). They share a high degree of structural resemblance, their aromatic head groups being the only...

Physiognomy: Personality Traits Prediction by Learning

Institute of Scientific and Technical Information of China (English)

Ting Zhang; Ri-Zhen Qin; Qiu-Lei Dong; Wei Gao; Hua-Rong Xu; Zhan-Yi Hu

2017-01-01

Evaluating individuals' personality traits and intelligence from their faces plays a crucial role in interpersonal relationship and important social events such as elections and court sentences.To assess the possible correlations between personality traits (also measured intelligence) and face images,we first construct a dataset consisting of face photographs,personality measurements,and intelligence measurements.Then,we build an end-to-end convolutional neural network for prediction of personality traits and intelligence to investigate whether self-reported personality traits and intelligence can be predicted reliably from a face image.To our knowledge,it is the first work where deep learning is applied to this problem.Experimental results show the following three points:1)"Rule-consciousness" and "Tension" can be reliably predicted from face images.2) It is difficult,if not impossible,to predict intelligence from face images,a finding in accord with previous studies.3) Convolutional neural network (CNN) features outperform traditional handcrafted features in predicting traits.

Record breaking achievements by spiders and the scientists who study them.

Science.gov (United States)

Mammola, Stefano; Michalik, Peter; Hebets, Eileen A; Isaia, Marco

2017-01-01

Organismal biology has been steadily losing fashion in both formal education and scientific research. Simultaneous with this is an observable decrease in the connection between humans, their environment, and the organisms with which they share the planet. Nonetheless, we propose that organismal biology can facilitate scientific observation, discovery, research, and engagement, especially when the organisms of focus are ubiquitous and charismatic animals such as spiders. Despite being often feared, spiders are mysterious and intriguing, offering a useful foundation for the effective teaching and learning of scientific concepts and processes. In order to provide an entryway for teachers and students-as well as scientists themselves-into the biology of spiders, we compiled a list of 99 record breaking achievements by spiders (the "Spider World Records"). We chose a world-record style format, as this is known to be an effective way to intrigue readers of all ages. We highlighted, for example, the largest and smallest spiders, the largest prey eaten, the fastest runners, the highest fliers, the species with the longest sperm, the most venomous species, and many more. We hope that our compilation will inspire science educators to embrace the biology of spiders as a resource that engages students in science learning. By making these achievements accessible to non-arachnologists and arachnologists alike, we suggest that they could be used: (i) by educators to draw in students for science education, (ii) to highlight gaps in current organismal knowledge, and (iii) to suggest novel avenues for future research efforts. Our contribution is not meant to be comprehensive, but aims to raise public awareness on spiders, while also providing an initial database of their record breaking achievements.

Radiation Safety System for SPIDER Neutral Beam Accelerator

International Nuclear Information System (INIS)

Sandri, S.; Poggi, C.; Coniglio, A.; D'Arienzo, M.

2011-01-01

SPIDER (Source for Production of Ion of Deuterium Extracted from RF Plasma only) and MITICA (Megavolt ITER Injector Concept Advanced) are the ITER neutral beam injector (NBI) testing facilities of the PRIMA (Padova Research Injector Megavolt Accelerated) Center. Both injectors accelerate negative deuterium ions with a maximum energy of 1 MeV for MITICA and 100 keV for SPIDER with a maximum beam current of 40 A for both experiments. The SPIDER facility is classified in Italy as a particle accelerator. At present, the design of the radiation safety system for the facility has been completed and the relevant reports have been presented to the Italian regulatory authorities. Before SPIDER can operate, approval must be obtained from the Italian Regulatory Authority Board (IRAB) following a detailed licensing process. In the present work, the main project information and criteria for the SPIDER injector source are reported together with the analysis of hypothetical accidental situations and safety issues considerations. Neutron and photon nuclear analysis is presented, along with special shielding solutions designed to meet Italian regulatory dose limits. The contribution of activated corrosion products (ACP) to external exposure of workers has also been assessed. Nuclear analysis indicates that the photon contribution to worker external exposure is negligible, and the neutron dose can be considered by far the main radiation protection issue. Our results confirm that the injector has no important radiological impact on the population living around the facility.

Colonization of subterranean habitats by spiders in Central Europe

Directory of Open Access Journals (Sweden)

Vlastimil Růžička

2013-05-01

Full Text Available Using data from the Czech Republic, we studied the distribution of spiders in soils, crevice systems, scree and caves, i.e. subterranean habitats at depths spanning from 10 cm to 100 m. In total, we found 161 species. The number of species declines with increasing habitat depth, with a major drop in species richness at the depth of 10 meters. Thirteen species exhibit morphological adaptations to life in subterranean habitats. At depths greater than 10 meters, spider assemblages are almost exclusively composed of troglomorphic species. We propose a hypothesis of evolution of troglomorphisms at spiders during Quaternary climatic cycles.

Distribution and importance of spiders inhabiting a Brazilian sugar cane plantation

Directory of Open Access Journals (Sweden)

Isabela Maria Piovesan Rinaldi

2002-07-01

Full Text Available The spider fauna (Araneae of a sugar eane plantation was surveyed monthly by hand colteetion and beating vegetation in sugar cane fields across Botucatu, State of São Paulo, Brazil. Composition and rchness (family and species where identifieation to species was possible microhabitat preferenees were reeorded, and diversity and evenness indices were calculated. A total of 1291 spiders belonging to 73 species and 20 families were collected. The most diverse families were Theridiidae, Salticidae, and Araneidae, and the most abundant ones were Theridiidae, Saltieidae, Anyphaenidae, and Araneidae, Seven species represented 58.6% of the total fauna, with Crysso pulcherrima (Mello-Leitão,1917 (Theridiidae composing 28.2%. About 65% of the spiders occupied the upper part of the plants (above 20 cm. Five spider species were present in the sugar cane throughout crop development. Evidence of spiders feeding on sugar cane pest species was observed.

Biomimetic calcium phosphate coatings on recombinant spider silk fibres

Energy Technology Data Exchange (ETDEWEB)

Yang Liang; Habibovic, Pamela; Van Blitterswijk, Clemens A [Department of Tissue Regeneration, University of Twente, PO Box 217, 7500 AE Enschede (Netherlands); Hedhammar, My; Johansson, Jan [Department of Anatomy, Physiology and Biochemistry, Swedish University of Agricultural Sciences, the Biomedical Centre, Box 575, 751 23 Uppsala (Sweden); Blom, Tobias; Leifer, Klaus [Department of Engineering Sciences, Uppsala University, Box 534, S-751 21 Uppsala (Sweden)

2010-08-01

Calcium phosphate ceramic coatings, applied on surfaces of metallic and polymeric biomaterials, can improve their performance in bone repair and regeneration. Spider silk is biocompatible, strong and elastic, and hence an attractive biomaterial for applications in connective tissue repair. Recently, artificial spider silk, with mechanical and structural characteristics similar to those of native spider silk, has been produced from recombinant minispidroins. In the present study, supersaturated simulated body fluid was used to deposit calcium phosphate coatings on recombinant spider silk fibres. The mineralization process was followed in time using scanning electron microscopy equipped with an energy dispersive x-ray (EDX) detector and Raman spectroscope. Focused ion beam technology was used to produce a cross section of a coated fibre, which was further analysed by EDX. Preliminary in vitro experiments using a culture of bone marrow-derived human mesenchymal stem cells (hMSCs) on coated fibres were also performed. This study showed that recombinant spider silk fibres were successfully coated with a homogeneous and thick crystalline calcium phosphate layer. In the course of the mineralization process from modified simulated body fluid, sodium chloride crystals were first deposited on the silk surface, followed by the deposition of a calcium phosphate layer. The coated silk fibres supported the attachment and growth of hMSCs.

Spider Silk as Guiding Biomaterial for Human Model Neurons

Directory of Open Access Journals (Sweden)

Frank Roloff

2014-01-01

Full Text Available Over the last years, a number of therapeutic strategies have emerged to promote axonal regeneration. An attractive strategy is the implantation of biodegradable and nonimmunogenic artificial scaffolds into injured peripheral nerves. In previous studies, transplantation of decellularized veins filled with spider silk for bridging critical size nerve defects resulted in axonal regeneration and remyelination by invading endogenous Schwann cells. Detailed interaction of elongating neurons and the spider silk as guidance material is unknown. To visualize direct cellular interactions between spider silk and neurons in vitro, we developed an in vitro crossed silk fiber array. Here, we describe in detail for the first time that human (NT2 model neurons attach to silk scaffolds. Extending neurites can bridge gaps between single silk fibers and elongate afterwards on the neighboring fiber. Culturing human neurons on the silk arrays led to an increasing migration and adhesion of neuronal cell bodies to the spider silk fibers. Within three to four weeks, clustered somata and extending neurites formed ganglion-like cell structures. Microscopic imaging of human neurons on the crossed fiber arrays in vitro will allow for a more efficient development of methods to maximize cell adhesion and neurite growth on spider silk prior to transplantation studies.

Biomimetic calcium phosphate coatings on recombinant spider silk fibres

International Nuclear Information System (INIS)

Yang Liang; Habibovic, Pamela; Van Blitterswijk, Clemens A; Hedhammar, My; Johansson, Jan; Blom, Tobias; Leifer, Klaus

2010-01-01

Calcium phosphate ceramic coatings, applied on surfaces of metallic and polymeric biomaterials, can improve their performance in bone repair and regeneration. Spider silk is biocompatible, strong and elastic, and hence an attractive biomaterial for applications in connective tissue repair. Recently, artificial spider silk, with mechanical and structural characteristics similar to those of native spider silk, has been produced from recombinant minispidroins. In the present study, supersaturated simulated body fluid was used to deposit calcium phosphate coatings on recombinant spider silk fibres. The mineralization process was followed in time using scanning electron microscopy equipped with an energy dispersive x-ray (EDX) detector and Raman spectroscope. Focused ion beam technology was used to produce a cross section of a coated fibre, which was further analysed by EDX. Preliminary in vitro experiments using a culture of bone marrow-derived human mesenchymal stem cells (hMSCs) on coated fibres were also performed. This study showed that recombinant spider silk fibres were successfully coated with a homogeneous and thick crystalline calcium phosphate layer. In the course of the mineralization process from modified simulated body fluid, sodium chloride crystals were first deposited on the silk surface, followed by the deposition of a calcium phosphate layer. The coated silk fibres supported the attachment and growth of hMSCs.

Relationship Between Big Five Personality Traits, Emotional Intelligence and Self-esteem Among College Students

OpenAIRE

Fauzia Nazir, AnamAzam, Muhammad Rafiq, Sobia Nazir, Sophia Nazir, ShaziaTasleem

2015-01-01

The current research study was on the “Relationship between Big Five Personality Traits & Emotional Intelligence and Self-esteem among the College Students”. This work is based on cross sectional survey research design. The convenience sample was used by including 170 female Students studying at government college kotla Arab Ali khan Gujrat, Pakistan, degree program of 3rd year and 4th year. The study variables were measured using Big Five Inventory Scale by Goldberg (1993), Emotional Intell...

Neural correlation of successful cognitive behaviour therapy for spider phobia: a magnetoencephalography study.

Science.gov (United States)

Wright, Barry; Alderson-Day, Ben; Prendergast, Garreth; Kennedy, Juliette; Bennett, Sophie; Docherty, Mary; Whitton, Clare; Manea, Laura; Gouws, Andre; Tomlinson, Heather; Green, Gary

2013-12-30

Cognitive behavioural therapy (CBT) can be an effective treatment for spider phobia, but the underlying neural correlates of therapeutic change are yet to be specified. The present study used magnetoencephalography (MEG) to study responses within the first half second, to phobogenic stimuli in a group of individuals with spider phobia prior to treatment (n=12) and then in nine of them following successful CBT (where they could touch and manage live large common house spiders) at least 9 months later. We also compared responses to a group of age-matched healthy control participants (n=11). Participants viewed static photographs of real spiders, other fear-inducing images (e.g. snakes, sharks) and neutral stimuli (e.g. kittens). Beamforming methods were used to localise sources of significant power changes in response to stimuli. Prior to treatment, participants with spider phobia showed a significant maximum response in the right frontal pole when viewing images of real spiders specifically. No significant frontal response was observed for either control participants or participants with spider phobia post-treatment. In addition, participants' subjective ratings of spider stimuli significantly predicted peak responses in right frontal regions. The implications for understanding brain-based effects of cognitive therapies are discussed. © 2013 Published by Elsevier Ireland Ltd.

SPIDER: Probing the dawn of time from above the clouds

Science.gov (United States)

Moncelsi, Lorenzo; Spider Collaboration

2017-11-01

SPIDER is a balloon-borne microwave polarimeter designed to measure cosmological B-modes on degree angular scales in the presence of Galactic foregrounds. With six independent telescopes housing a total of 2000 detectors in the 90 GHz and 150 GHz frequency bands, SPIDER is the most instantaneously-sensitive CMB polarimeter deployed on the sky to date. SPIDER was successfully launched from McMurdo Station, Antarctica in January 2015 and acquired science data for 16 days. We cover the in-flight performance and present highlights from the ongoing data-analysis. After a successful recovery, the SPIDER team is planning the next flight, featuring one foreground-optimized channel at 280GHz, which will allow us constrain the primordial tensor-mode amplitude at the level of r < 0.03 (99% CL), in the presence of foregrounds.

Interpretative bias in spider phobia: Perception and information processing of ambiguous schematic stimuli.

Science.gov (United States)

Haberkamp, Anke; Schmidt, Filipp

2015-09-01

This study investigates the interpretative bias in spider phobia with respect to rapid visuomotor processing. We compared perception, evaluation, and visuomotor processing of ambiguous schematic stimuli between spider-fearful and control participants. Stimuli were produced by gradually morphing schematic flowers into spiders. Participants rated these stimuli related to their perceptual appearance and to their feelings of valence, disgust, and arousal. Also, they responded to the same stimuli within a response priming paradigm that measures rapid motor activation. Spider-fearful individuals showed an interpretative bias (i.e., ambiguous stimuli were perceived as more similar to spiders) and rated spider-like stimuli as more unpleasant, disgusting, and arousing. However, we observed no differences between spider-fearful and control participants in priming effects for ambiguous stimuli. For non-ambiguous stimuli, we observed a similar enhancement for phobic pictures as has been reported previously for natural images. We discuss our findings with respect to the visual representation of morphed stimuli and to perceptual learning processes. Copyright © 2015 Elsevier B.V. All rights reserved.

Who is afraid of a black Spider(-Man?

Directory of Open Access Journals (Sweden)

Ora C. McWilliams

2013-06-01

Full Text Available An Internet post asking about Spider-Man's race in a film turned into an Internet campaign about an actor that led fans to interact with each other as well as with the actor, which in turn led to the attention of media producers, which resulted in a change in Spider-Man's race in a print comic book.

Characteristics of the first recorded spider (Arthropoda: Arachnida fauna from Sheringal, Khyber Pakhtunkhwa, Pakistan

Directory of Open Access Journals (Sweden)

Farzana Khan Perveen

2015-12-01

Full Text Available The spiders (order: Aranae are an important environmental indicator and play a significant role as predators in biological control of the most of the key insect pests. The present study was conducted to establish the characteristics of the first recorded spider fauna from Sheringal, Dir Upper (DU, Khyber Pakhtunkhwa (KP, Pakistan during June 2013-July 2014. Their 10 species belong to 7 families, and 10 genera (nt=123: total; ni=77: identified; nui=46: unidentified were recorded in the 6 quadrates, i.e., Daramdala, Doki, Guryaal, Samang, Shahoor and Sia-Sheringal of Sheringal. The largest family was Lycosidae (wolf spiders with respect to size and numbers of specimens collected (n=20, which contained Arctosa littorali Simon, 1897; Hippasa partita Takidar, 1970; Pardosa distincta Backwall, 1867, while the smallest family was Gnphosidae (ground spiders (n=3 with Gnaphosa eucalyptus Ghafoor and Beg, 2002; while other families Sparassidae (huntsman spiders (n=19 Halconia insignis Thorell, 1836, and Isopeda tuhogniga Barrion and Litsinger, 1995, Opilionidae (harvestmen spiders (n=12 Hadrobunus grandis Sundevall, 1833; Pholcidae (cellar spider (n=10 have Crossopriza lyoni Blackwall, 1867; Hersiliidae (two-tailed spiders (n=6 is having Harsilia savignyi Lucas, 1836; (n=5 with Araneus diadematus Clerck, 1757 were recorded. It was concluded that 50% of the spiders collected from the study area were venomous. A detail study is required for further exploration of spider fauna of Sheringal, KP, Pakistan with special reference to their taxonomical, physiological and ecological characteristics.

Status of the CNESM diagnostic for SPIDER

International Nuclear Information System (INIS)

Muraro, A.; Croci, G.; Albani, G.; Cazzaniga, C.; Claps, G.; Cavenago, M.; Grosso, G.; Palma, M. Dalla; Fincato, M.; Murtas, F.; Pasqualotto, R.; Cippo, E. Perelli; Rebai, M.; Tollin, M.; Tardocchi, M.; Gorini, G.

2015-01-01

Highlights: • We have finished the design of the detector box of the CNESM diagnostic for SPIDER. • We have constructed the GEM detector of the CNESM detector for SPIDER. • We have tested the detector under fast neutron irradiation. - Abstract: The ITER neutral beam test facility under construction in Padova will host two experimental devices: SPIDER, a 100 kV negative H/D RF source, and MITICA, a full scale, 1 MeV deuterium beam injector. A detection system called close-contact neutron emission surface mapping (CNESM) is under development with the aim to resolve the horizontal beam intensity profile in MITICA and one of the eight beamlet groups in SPIDER, with a spatial resolution of 1.5 and 2.5 cm respectively. This is achieved by the evaluation of the map of the neutron emission due to interaction of the deuterium beam with the deuterons implanted in the beam dump surface. CNESM uses nGEM detectors, i.e. GEM detectors equipped with a cathode that also serves as neutron–proton converter foil. The diagnostic will be placed right behind the SPIDER and MITICA beam dump, i.e. in an UHV environment, but the nGEM detectors need to operate at atmospheric pressure: in order to maintain the detector at atmospheric pressure, a vacuum sealed box, that will be mounted inside the vacuum, has been designed. The box design was driven by the need to minimize the neutron attenuation and the distance between the beam dump surface and the detector active area. This paper presents the status of the CNESM diagnostic describing the design of the detector, the design of the sealed box and reporting the results obtained with the first full-size prototype under fast neutron irradiation.

Design of the interlock and protection system for the SPIDER experiment

International Nuclear Information System (INIS)

Pomaro, N.; Grando, L.; Luchetta, A.; Paolucci, F.; Sartori, F.

2013-01-01

Highlights: •A custom designed interlock and protection system for SPIDER experiment is described. •It includes two subsystems implementing slow and fast protection functions. •High reliability PLCs are adopted for slow protection. •Fiber-optic based, custom designed fast logic circuitry is proposed for fast protection. •Accelerators breakdown events are also managed by the fast subsystem. -- Abstract: Unprecedented levels of beam energy and power are required for ITER Neutral Beam Heating systems. SPIDER experiment is an experimental device aimed to test and optimize a full size beam source satisfying ITER requirements. SPIDER experiment operation involves high power, voltage, temperature, and gas pressure. All these critical conditions are present simultaneously, so that any failure if not properly detected and managed is likely to cause severe damage. The Interlock and Protection System is a high-reliability system devoted to the investment protection of SPIDER. Its main purpose is to manage abnormal events occurring in one or more plants in order to minimize adverse consequences. The Interlock System also manages the SPIDER Operating Modes, defining the set and status of the Plants used in the various possible experimental configurations. In addition, the Interlock and Protection System takes care of particular events occurring during normal SPIDER operation, i.e. electrical arcs between accelerator grids, named breakdowns. Their treatment is committed to the Interlock and Protection System, as they need to be managed timely and with absolute reliability like actual faults. To perform the required functions, the Interlock and Protection System is interfaced with most SPIDER plants and with the SPIDER Control and Data Acquisition System. The paper describes the rationale of the protection functions, their implementation in the design and the technical specifications of the system

Deer herbivory reduces web-building spider abundance by simplifying forest vegetation structure

Directory of Open Access Journals (Sweden)

Elizabeth J. Roberson

2016-09-01

Full Text Available Indirect ecological effects are a common feature of ecological systems, arising when one species affects interactions among two or more other species. We examined how browsing by white-tailed deer (Odocoileus virginianus indirectly affected the abundance and composition of a web-building spider guild through their effects on the structure of the ground and shrub layers of northern hardwood forests. We examined paired plots consisting of deer-free and control plots in the Allegheny Plateau region Pennsylvania and Northern Highlands region of Wisconsin. We recorded the abundance of seven types of webs, each corresponding to a family of web-building spiders. We quantified vegetation structure and habitat suitability for the spiders by computing a web scaffold availability index (WSAI at 0.5 m and 1.0 m above the ground. At Northern Highlands sites, we recorded prey availability. Spider webs were twice as abundant in deer-free plots compared to control plots, while WSAI was 7–12 times greater in deerfree plots. Prey availability was lower in deer-free plots. With the exception of funnel web-builders, all spider web types were significantly more abundant in deer-free plots. Both deer exclusion and the geographic region of plots were significant predictors of spider community structure. In closed canopy forests with high browsing pressure, the low density of tree saplings and shrubs provides few locations for web-building spiders to anchor webs. Recruitment of these spiders may become coupled with forest disturbance events that increase tree and shrub recruitment. By modifying habitat structure, deer appear to indirectly modify arthropod food web interactions. As deer populations have increased in eastern North America over the past several decades, the effects of deer on web-building spiders may be widespread.

Effects of attention manipulations on motivated attention to feared and nonfeared negative distracters in spider fear.

Science.gov (United States)

Norberg, Joakim; Wiens, Stefan

2013-11-09

When people view emotional and neutral pictures, the emotional pictures capture more attention than do neutral pictures. In support, studies with event-related potentials have shown that the early posterior negativity (EPN) and the late positive potential (LPP) to emotional versus neutral pictures are enhanced when pictures are attended. However, this motivated attention decreases when voluntary attention is directed away from the pictures. Most previous studies included only generally emotional pictures of either negative or positive valence. Because people with spider fear report intense fear of spiders, we examined whether directing attention away from emotional pictures at fixation decreases motivated attention less strongly for spiders than for generally negative distracters. We recorded event-related potentials from 128 channels to study whether manipulations of attention (i.e., spatial attention and perceptual load) decrease the EPN and the LPP to emotional distracters less strongly for spiders than for fear-irrelevant negative pictures in people with spider fear. Results confirmed that the EPN and the LPP to spiders (vs. neutral pictures) were particularly enhanced in participants with spider fear compared to participants without spider fear. When attention was directed away from the pictures, the EPN and the LPP to spiders (vs. neutral pictures) decreased similarly in fearful and nonfearful participants. Further, in fearful participants, the decrease in the EPN and the LPP was similar for spiders and for fear-irrelevant negative pictures. Our findings suggest that for people with spider fear, directing attention away from emotional pictures at fixation decreases motivated attention to these distracters similarly for spiders as for fear-irrelevant negative pictures. These findings imply that attention to spiders in spider fear does not exceed the level of attention expected from the spider pictures' high arousal and negative valence (i.e., their intrinsic

Dangerous mating systems: signal complexity, signal content and neural capacity in spiders.

Science.gov (United States)

Herberstein, M E; Wignall, A E; Hebets, E A; Schneider, J M

2014-10-01

Spiders are highly efficient predators in possession of exquisite sensory capacities for ambushing prey, combined with machinery for launching rapid and determined attacks. As a consequence, any sexually motivated approach carries a risk of ending up as prey rather than as a mate. Sexual selection has shaped courtship to effectively communicate the presence, identity, motivation and/or quality of potential mates, which help ameliorate these risks. Spiders communicate this information via several sensory channels, including mechanical (e.g. vibrational), visual and/or chemical, with examples of multimodal signalling beginning to emerge in the literature. The diverse environments that spiders inhabit have further shaped courtship content and form. While our understanding of spider neurobiology remains in its infancy, recent studies are highlighting the unique and considerable capacities of spiders to process and respond to complex sexual signals. As a result, the dangerous mating systems of spiders are providing important insights into how ecology shapes the evolution of communication systems, with future work offering the potential to link this complex communication with its neural processes. Copyright © 2014 Elsevier Ltd. All rights reserved.

Inactivation of complement by Loxosceles reclusa spider venom.

Science.gov (United States)

Gebel, H M; Finke, J H; Elgert, K D; Cambell, B J; Barrett, J T

1979-07-01

Zymosan depletion of serum complement in guinea pigs rendered them highly resistant to lesion by Loxosceles reclusa spider venom. Guinea pigs deficient in C4 of the complement system are as sensitive to the venom as normal guinea pigs. The injection of 35 micrograms of whole recluse venom intradermally into guinea pigs lowered their complement level by 35.7%. Brown recluse spider venom in concentrations as slight as 0.02 micrograms protein/ml can totally inactivate one CH50 of guinea pig complement in vitro. Bee, scorpion, and other spider venoms had no influence on the hemolytic titer of complement. Fractionation of recluse spider venom by Sephadex G-200 filtration separated the complement-inactivating property of the venom into three major regions which could be distinguished on the basis of heat stability as well as size. None was neutralized by antivenom. Polyacrylamide gel electrophoresis of venom resolved the complement inactivators into five fractions. Complement inactivated by whole venom or the Sephadex fractions could be restored to hemolytic activity by supplements of fresh serum but not by heat-inactivated serum, pure C3, pure C5, or C3 and C5 in combination.

SPIDER OPTIMIZATION. II. OPTICAL, MAGNETIC, AND FOREGROUND EFFECTS

International Nuclear Information System (INIS)

O'Dea, D. T.; Clark, C. N.; Contaldi, C. R.; Ade, P. A. R.; Amiri, M.; Burger, B.; Davis, G.; Benton, S. J.; Bock, J. J.; Crill, B. P.; Dore, O.; Filippini, J. P.; Bond, J. R.; Farhang, M.; Bonetti, J. A.; Bryan, S.; Chiang, H. C.; Fraisse, A. A.; Fissel, L. M.; Gandilo, N. N.

2011-01-01

SPIDER is a balloon-borne instrument designed to map the polarization of the cosmic microwave background (CMB) with degree-scale resolution over a large fraction of the sky. SPIDER's main goal is to measure the amplitude of primordial gravitational waves through their imprint on the polarization of the CMB if the tensor-to-scalar ratio, r, is greater than 0.03. To achieve this goal, instrumental systematic errors must be controlled with unprecedented accuracy. Here, we build on previous work to use simulations of SPIDER observations to examine the impact of several systematic effects that have been characterized through testing and modeling of various instrument components. In particular, we investigate the impact of the non-ideal spectral response of the half-wave plates, coupling between focal-plane components and Earth's magnetic field, and beam mismatches and asymmetries. We also present a model of diffuse polarized foreground emission based on a three-dimensional model of the Galactic magnetic field and dust, and study the interaction of this foreground emission with our observation strategy and instrumental effects. We find that the expected level of foreground and systematic contamination is sufficiently low for SPIDER to achieve its science goals.

The Spider Files

Science.gov (United States)

McDonald, James; Dominguez, Lynn

2012-01-01

As children develop misconceptions about animals they believe are dangerous, they also adopt attitudes that are difficult to change. Changing these attitudes is challenging for teachers. One animal that is easy to find but difficult for children to understand is a spider. As with most wild animals, they are difficult to teach about because…

Structure-function-property-design interplay in biopolymers: spider silk.

Science.gov (United States)

Tokareva, Olena; Jacobsen, Matthew; Buehler, Markus; Wong, Joyce; Kaplan, David L

2014-04-01

Spider silks have been a focus of research for almost two decades due to their outstanding mechanical and biophysical properties. Recent advances in genetic engineering have led to the synthesis of recombinant spider silks, thus helping to unravel a fundamental understanding of structure-function-property relationships. The relationships between molecular composition, secondary structures and mechanical properties found in different types of spider silks are described, along with a discussion of artificial spinning of these proteins and their bioapplications, including the role of silks in biomineralization and fabrication of biomaterials with controlled properties. Copyright © 2013 Acta Materialia Inc. Published by Elsevier Ltd. All rights reserved.

Inhibition of the spider heartbeat by gravity and vibration

Science.gov (United States)

Finck, A.

1984-01-01

The rate and vigor of the spider heartbeat is controlled by an external pacemaker. A mechanical feature of the spider cardio-vascular system is the production of high serum pressure in the prosoma and the legs. This appears to be the source for leg extension. The lyriform organ on the patella of the leg is sensitive to vibratory and kinesthetic stimuli. This sensitivity depends upon the degree of leg extension. Thus the activity of the heart and the response characteristics of the sense receptor are related. The effect of a supra-threshold vibratory or gravitational stimulus is to produce an inhibition and a tachycardia of the spider heartbeat.

Ineffective crypsis in a crab spider: a prey community perspective.

Science.gov (United States)

Brechbühl, Rolf; Casas, Jérôme; Bacher, Sven

2010-03-07

Cryptic coloration is assumed to be beneficial to predators because of an increased encounter rate with unwary prey. This hypothesis is, however, very rarely, if ever, studied in the field. The aim of this study was to quantify the encounter rate and capture success of an ambush predator, in the field, as a function of its level of colour-matching with the background. We used the crab spider Misumena vatia, which varies its body colour and can thereby match the colour of the flower it hunts upon. We carried out a manipulative field experiment using a complete factorial design resulting in six different colour combinations of crab spiders and flowers differing in their degree of colour-matching. A rich and diverse set of naturally occurring insects visited the flowers while we continuously video-recorded the spider's foraging activity. This enabled us to test the crypsis, the spider avoidance and the flower visitor attraction hypotheses, all three supported by previous studies. Flower visitors of different groups either avoided crab spiders independent of colour-matching, such as solitary bees and syrphid flies, or ignored them, such as bumble-bees and honeybees. Moreover, colour-matched spiders did not have a higher encounter rate and capture success compared to the visually apparent ones. Thus, our results support the spider avoidance hypothesis, reject the two other hypotheses and uncovered a fourth behaviour: indifference to predators. Because flower visitors reacted differently, a community approach is mandatory in order to understand the function of background colour-matching in generalist predators. We discuss our results in relation to the size and sociality of the prey and in relation to the functional significance of colour change in this predator.

Evolution of stenophagy in spiders (Araneae): evidence based on the comparative analysis of spider diets.

Science.gov (United States)

Pekár, Stano; Coddington, Jonathan A; Blackledge, Todd A

2012-03-01

Stenophagy (narrow diet breadth) represents an extreme of trophic specialization in carnivores, but little is known about the forces driving its evolution. We used spiders, the most diversified group of terrestrial predators, to investigate whether stenophagy (1) promoted diversification; (2) was phylogenetically conserved and evolutionarily derived state; and (3) was determined either by geographical distribution and foraging guild. We used published data on the prey of almost 600 species. Six categories of stenophagy were found: myrmecophagy, araneophagy, lepidopterophagy, termitophagy, dipterophagy, and crustaceophagy. We found that the species diversity of euryphagous genera and families was similar to stenophagous genera and families. At the family level, stenophagy evolved repeatedly and independently. Within families, the basal condition was oligophagy or euryphagy. Most types of stenophagy were clearly derived: myrmecophagy in Zodariidae; lepidopterophagy in Araneidae; dipterophagy in Theridiidae. In contrast, araneophagy was confined to basal and intermediate lineages, suggesting its ancestral condition. The diet breadth of species from the tropics and subtropics was less diverse than species from the temperate zone. Diet breadth was lower in cursorial spiders compared to web-building species. Thus, the evolution of stenophagy in spiders appears to be complex and governed by phylogeny as well as by ecological determinants. © 2011 The Author(s). Evolution© 2011 The Society for the Study of Evolution.

Three newly recorded Linyphiid spiders (Araneae: Linyphiidae from Korea

Directory of Open Access Journals (Sweden)

Sue Yeon Lee

2018-03-01

Full Text Available Three Linyphiid spiders, Caviphantes pseudosaxetorum Wunderlich, 1979, Erigone edentata Saito and Ono, 2001, and Savignia kawachiensis Oi, 1960, are reported for the first time from Korea with taxonomic illustrations and redescription. In this study, the genus Caviphantes Oi, 1960 is also newly recorded to Korean spider fauna.

First report of clinical presentation of a bite by a running spider ...

African Journals Online (AJOL)

This article describes the clinical progression of symptoms over a period of 5 days of a bite inflicted by a Philodromus sp. spider. Commonly known as 'running spiders', these are not considered to be harmful to humans. This report, however, is the first description of an actual bite by a member of this group of spiders ...

Web building and silk properties functionally covary among species of wolf spider.

Science.gov (United States)

Lacava, Mariángeles; Camargo, Arley; Garcia, Luis F; Benamú, Marco A; Santana, Martin; Fang, Jian; Wang, Xungai; Blamires, Sean J

2018-04-15

Although phylogenetic studies have shown covariation between the properties of spider major ampullate (MA) silk and web building, both spider webs and silks are highly plastic so we cannot be sure whether these traits functionally covary or just vary across environments that the spiders occupy. As MaSp2-like proteins provide MA silk with greater extensibility, their presence is considered necessary for spider webs to effectively capture prey. Wolf spiders (Lycosidae) are predominantly non-web building, but a select few species build webs. We accordingly collected MA silk from two web-building and six non-web-building species found in semirural ecosystems in Uruguay to test whether the presence of MaSp2-like proteins (indicated by amino acid composition, silk mechanical properties and silk nanostructures) was associated with web building across the group. The web-building and non-web-building species were from disparate subfamilies so we estimated a genetic phylogeny to perform appropriate comparisons. For all of the properties measured, we found differences between web-building and non-web-building species. A phylogenetic regression model confirmed that web building and not phylogenetic inertia influences silk properties. Our study definitively showed an ecological influence over spider silk properties. We expect that the presence of the MaSp2-like proteins and the subsequent nanostructures improves the mechanical performance of silks within the webs. Our study furthers our understanding of spider web and silk co-evolution and the ecological implications of spider silk properties. © 2018 European Society For Evolutionary Biology. Journal of Evolutionary Biology © 2018 European Society For Evolutionary Biology.

SPIDER: Probing the Early Universe with a Suborbital Polarimeter

Science.gov (United States)

Fraisse, Aurélien A.; SPIDER Collaboration

2012-01-01

SPIDER is a balloon-borne polarimeter designed to detect a divergence-free polarization pattern ("B-modes") in the Cosmic Microwave Background (CMB). In the inflationary scenario, the spectrum of the tensor perturbations that generate this signal is proportional to that of the primordial scalar perturbations through the tensor-to-scalar ratio r. The expected level of systematic error in the SPIDER instrument is significantly below the amplitude of an interesting cosmological B-mode signal with r=0.03. An optimized scanning strategy enables us to minimize uncertainty in the reconstruction of the Stokes parameters used to characterize the CMB, while providing access to a relatively wide range of angular scales. In the SPIDER field, the polarized emission from interstellar dust is as bright or brighter than the cosmological r=0.03 B-mode signal at all SPIDER frequencies (90, 150, and 280 GHz), a situation similar to that found in the "Southern Hole." Despite this foreground contamination, two 20-day flights of the SPIDER instrument will constrain the amplitude of the B-mode signal to rAPRA-NNX07AL64G), the National Science Foundation (ANT-1043515), the Gordon and Betty Moore Foundation, and the David and Lucile Packard Foundation. Support in Canada is provided by NSERC, the Canadian Space Agency, the Canada Foundation for Innovation, and CIFAR.

Spider (Araneae) predations on white-backed planthopper Sogatella furcifera in subtropical rice ecosystems, China.

Science.gov (United States)

Wang, Xue-Qin; Wang, Guang-Hua; Zhu, Zeng-Rong; Tang, Qi-Yi; Hu, Yang; Qiao, Fei; Heong, Kong Luen; Cheng, Jia-An

2017-06-01

Spiders are effective biological control agents in rice ecosystems, but the comparative study of predations among main spider species under field conditions has not been fully explored owing to a lack of practical methodology. In this study, more than 6000 spiders of dominant species were collected from subtropical rice ecosystems to compare their predations on Sogatella furcifera (Horváth) (white-backed planthopper, WBPH) using DNA-based gut content analysis. The positive rates for all spider taxa were closely related to prey densities, as well as their behaviors and niches. The relationships of positive rates to prey planthopper densities for Pardosa pseudoannulata (Böes. et Str.), Coleosoma octomaculata (Böes. et Str.), Tetragnatha maxillosa Thorell and Ummeliata insecticeps (Böes. et Str.) under field conditions could be described using saturated response curves. Quantitative comparisons of predations among the four spider species confirmed that P. pseudoannulata and C. octomaculata were more rapacious than U. insecticeps and T. maxillosa under field conditions. A comparison of ratio of spiders to WBPH and positive rates between fields revealed that biological control by spiders could be effectively integrated with variety resistance. Generalist spiders could follow up WBPH population timely, and assemblages of spiders coupled with variety resistance could effectively suppress WBPH population. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

Spider Web Pattern

Science.gov (United States)

2006-01-01

A delicate pattern, like that of a spider web, appears on top of the Mars residual polar cap, after the seasonal carbon-dioxide ice slab has disappeared. Next spring, these will likely mark the sites of vents when the carbon-dioxide ice cap returns. This Mars Global Surveyor, Mars Orbiter Camera image is about 3-kilometers wide (2-miles).

PATHWAYS TO SPIDER PHOBIA

NARCIS (Netherlands)

MERCKELBACH, H; ARNTZ, A; ARRINDELL, WA; DEJONG, PJ

Using a revised version of the Phobic Origin Questionnaire (POQ; Ost, L. G. & Hugdahl, K. Behaviour Research and Therapy, 19,439-477; 1981), the present study examined whether conditioning experiences, modeling experiences, and/or informational learning experiences were more often reported by spider

Evolutionary morphology of the hemolymph vascular system of basal araneomorph spiders (Araneae: Araneomorphae).

Science.gov (United States)

Huckstorf, Katarina; Michalik, Peter; Ramírez, Martín; Wirkner, Christian S

2015-11-01

The superfamily Austrochiloidea (Austrochilidae and Gradungulidae) take a pivotal position in araneomorph spider phylogeny. In this discussion crevice weaver spiders (Filistatidae) are of equal interest. Especially data from these phylogenetically uncertain yet basal off branching groups can enlighten our understanding on the evolution of organ systems. In the course of a survey on the evolutionary morphology of the circulatory system in spiders we therefore investigated the hemolymph vascular system in two austrochiloid and one filistatid species. Additionally some data on a hypochilid and a gradungulid species are included. Using up-to-date morphological methods, the vascular systems in these spiders are visualized three dimensionally. Ground pattern features of the circulatory systems in austrochiloid spiders are presented and the data discussed along recent lines of phylogenetic hypotheses. Special topics highlighted are the intraspecific variability of the origins of some prosomal arteries and the evolutionary correlation of respiratory and circulatory systems in spiders. Copyright © 2015 Elsevier Ltd. All rights reserved.

Captive spider monkeys (Ateles geoffroyi) arm-raise to solicit allo-grooming.

Science.gov (United States)

Scheel, Matthew H; Edwards, Dori

2012-03-01

Old World monkeys solicit allo-grooming from conspecifics. However, there are relatively few studies of allo-grooming among spider monkeys, and descriptions of allo-grooming solicitation among spider monkeys are anecdotal. In this study, eighty-one hours of video, shot over eight weeks, captured 271 allo-grooming bouts among small groups of captive spider monkeys. Six of eight monkeys made heretofore unreported arm-raises that solicited higher than normal rates of allo-grooming. Allo-grooming bout durations following arm-raises also tended to be longer than bouts not preceded by arm-raises. The efficacy of the arm-raise at soliciting allo-grooming suggests spider monkeys are capable of intentional communication. Copyright © 2012 Elsevier B.V. All rights reserved.

Vision in the nocturnal wandering spider Leucorchestris arenicola (Araneae: Sparassidae)

DEFF Research Database (Denmark)

Nørgaard, Thomas; Nilsson, Dan-Eric; Henschel, Joh R

2008-01-01

At night the Namib Desert spider Leucorchestris arenicola performs long-distance homing across its sand dune habitat. By disabling all or pairs of the spiders' eight eyes we found that homing ability was severely reduced when vision was fully abolished. Vision, therefore, seems to play a key role...... in the posterior and anteriomedian eyes, and at approximately 540 nm in the anteriolateral eyes. Theoretical calculations of photon catches showed that the eyes are likely to employ a combination of spatial and temporal pooling in order to function at night. Under starlit conditions, the raw spatial and temporal...... resolution of the eyes is insufficient for detecting any visual information on structures in the landscape, and bright stars would be the only objects visible to the spiders. However, by summation in space and time, the spiders can rescue enough vision to detect coarse landscape structures. We show that L...

When Spiders Bite: The Use, Misuse, and Unintended Consequences of ``Silent Information''

Science.gov (United States)

Keenan, Thomas P.

Spiders are the workhorses of the Internet, silently (and almost invisibly) traversing the online world, 24 hours a day, looking for information that may be of interest to someone. It is being archived, organized, and sold, usually without the knowledge or consent of the subject of the information. Serious consequences are starting to appear, such as the withdrawal of three candidates from the October 2008 Canadian Federal election because of previous online indiscretions. While these were intentional if mis-guided postings, information made available without our consent can have equally devastating effects. Advances in artificial intelligence, as well as the increasing tendency to post more and more information, such as videos, will make the gathering, aggregation, and republishing of this “silent information” an increasingly important issue that must be addressed from the technical, social, ethical and legal perspectives, and sooner rather than later.

Recombinant Spider Silks—Biopolymers with Potential for Future Applications

Directory of Open Access Journals (Sweden)

Thomas Scheibel

2011-03-01

Full Text Available Nature has evolved a range of materials that compete with man-made materials in physical properties; one of these is spider silk. Silk is a fibrous material that exhibits extremely high strength and toughness with regard to its low density. In this review we discuss the molecular structure of spider silk and how this understanding has allowed the development of recombinant silk proteins that mimic the properties of natural spider silks. Additionally, we will explore the material morphologies and the applications of these proteins. Finally, we will look at attempts to combine the silk structure with chemical polymers and how the structure of silk has inspired the engineering of novel polymers.

Impact of prescribed burning on a heathland inhabiting spider community

Directory of Open Access Journals (Sweden)

Krause, Rolf Harald

2016-04-01

Full Text Available Heathlands can provide refuge for many stenotopic and endangered arthropods, if habitat management practices are applied. A management measure that is rarely being used today, but which has the potential to support diversity of arthropod communities, is prescribed burning. In this study we investigated the effects of prescribed burning on spider assemblages on a burned site with Calluna vulgaris in the nature reserve Lueneburg Heath, northwest Germany. We used pitfall trapping with a sampling design of 39 traps over a period of one year and 17 sampling intervals on a burned and a control site. We compared overall species richness, activity abundance patterns and community composition of the two sites, with a particular focus on stenotopic and endangered species. We collected 5116 adult spiders and 99 species altogether in a relatively small sampling area. This number of species represents nearly one third of the regional species pool of heathland spider species. Twelve species occurred exclusively on the burned site in contrast to 28 species exclusively found on the unburned site. Although we found more than twice as many spider individuals and higher mean species richness on the control site than on the burned site, the species richness of red-listed spiders was higher on the burned site. Especially the fact that we found 24 endangered species on the burned site and only 20 on the control site indicates that the applied measure of prescribed burning can foster certain endangered spider species and contribute to preserving the overall biodiversity of heathland ecosystems.

Stable isotopes of Hawaiian spiders reflect substrate properties along a chronosequence

Science.gov (United States)

Dawson, Todd E.; Gillespie, Rosemary G.

2018-01-01

The Hawaiian Islands offer a unique opportunity to test how changes in the properties of an isolated ecosystem are propagated through the organisms that occur within that ecosystem. The age-structured arrangement of volcanic-derived substrates follows a regular progression over space and, by inference, time. We test how well documented successional changes in soil chemistry and associated vegetation are reflected in organisms at higher trophic levels—specifically, predatory arthropods (spiders)—across a range of functional groups. We focus on three separate spider lineages: one that builds capture webs, one that hunts actively, and one that specializes on eating other spiders. We analyze spiders from three sites across the Hawaiian chronosequence with substrate ages ranging from 200 to 20,000 years. To measure the extent to which chemical signatures of terrestrial substrates are propagated through higher trophic levels, we use standard stable isotope analyses of nitrogen and carbon, with plant leaves included as a baseline. The target taxa show the expected shift in isotope ratios of δ15N with trophic level, from plants to cursorial spiders to web-builders to spider eaters. Remarkably, organisms at all trophic levels also precisely reflect the successional changes in the soil stoichiometry of the island chronosequence, demonstrating how the biogeochemistry of the entire food web is determined by ecosystem succession of the substrates on which the organisms have evolved. PMID:29576984

Synthetic Spider Silk Production on a Laboratory Scale

Science.gov (United States)

Hsia, Yang; Gnesa, Eric; Pacheco, Ryan; Kohler, Kristin; Jeffery, Felicia; Vierra, Craig

2012-01-01

As society progresses and resources become scarcer, it is becoming increasingly important to cultivate new technologies that engineer next generation biomaterials with high performance properties. The development of these new structural materials must be rapid, cost-efficient and involve processing methodologies and products that are environmentally friendly and sustainable. Spiders spin a multitude of different fiber types with diverse mechanical properties, offering a rich source of next generation engineering materials for biomimicry that rival the best manmade and natural materials. Since the collection of large quantities of natural spider silk is impractical, synthetic silk production has the ability to provide scientists with access to an unlimited supply of threads. Therefore, if the spinning process can be streamlined and perfected, artificial spider fibers have the potential use for a broad range of applications ranging from body armor, surgical sutures, ropes and cables, tires, strings for musical instruments, and composites for aviation and aerospace technology. In order to advance the synthetic silk production process and to yield fibers that display low variance in their material properties from spin to spin, we developed a wet-spinning protocol that integrates expression of recombinant spider silk proteins in bacteria, purification and concentration of the proteins, followed by fiber extrusion and a mechanical post-spin treatment. This is the first visual representation that reveals a step-by-step process to spin and analyze artificial silk fibers on a laboratory scale. It also provides details to minimize the introduction of variability among fibers spun from the same spinning dope. Collectively, these methods will propel the process of artificial silk production, leading to higher quality fibers that surpass natural spider silks. PMID:22847722

SPIDERS (ARANEI OF THE REPUBLIC OF SOUTH OSSETIA

Directory of Open Access Journals (Sweden)

Alexander V. Ponomarev

2015-01-01

Full Text Available Aim. Until recently, spider fauna of the Republic of South Ossetia has been the least studied among the regional araneofaunas of the Caucasus. According to the literature data, as little as 30 spider species have been known from the republic’s territory (Mkheidze, 1997, Mikhailov, 1990; Ponomarev, Dvadnenko, 2013; Trilicauscas, Komarov, 2014. Therefore, the aim of the present article is to summarize available data on the spider fauna of South Ossetia.Location. Republic of South Ossetia.Methods. The material was collected in various districts of South Ossetia in 2011-2014 by Yu.E. Komarov. Mainly, the collecting was performed in the city of Tskhinvali and its environs, and in the South Ossetian State Reserve. Spiders were sampled with pitfall traps and sweep netting. The time of traps’ exposure is April–December.Results and main conclusions. To date, the spider fauna of the Republic of South Ossetia includes 230 species from 29 families. 222 species were registered by the authors, eight species (Clubiona pseudosimilis, Gnaphosa lugubris, Linyphia hortensis, Neriene peltata, Geolycosa vultuosa, Pardosa azerifalcata, Ero aphana, and Philodromus rufus are known from the literature only. Seven species are new to the Caucasus (Clubiona pseudosimilis, Gnaphosa lugubris, Linyphia hortensis, Neriene peltata, Geolycosa vultuosa, Pardosa azerifalcata, Ero aphana, and Philodromus rufus. Of these, two species were known earlier only from Turkey (Pardosa consimilis, Ozyptila spirembolus, and one species (Tegenaria pseudolyncea only from Azerbaijan. Against the background of the widespread species predominance, the Caucasian element is small and presented by twelve species (Tegenaria pseudolyncea, Dysdera tkibuliensis, Haplodrassus caucasius, Zelotes khostensis, Mansuphantes ovalis, Sintula oseticus, Tenuiphantes teberdaensis, Pardosa azerifalcata, P. caucasica, Piratula hurkai, Trochosa cachetiensis, and Xysticus ukrainicus.

Spider mite control and resistance management: does a genome help?

NARCIS (Netherlands)

Van Leeuwen, T.; Dermauw, W.; Grbic, M.; Tirry, L.; Feyereisen, R.

2012-01-01

The complete genome of the two-spotted spider mite, Tetranychus urticae, has been reported. This is the first sequenced genome of a highly polyphagous and resistant agricultural pest. The question as to what the genome offers the community working on spider mite control is addressed.

Low Health System Performance, Indigenous Status and Antivenom Underdosage Correlate with Spider Envenoming Severity in the Remote Brazilian Amazon.

Directory of Open Access Journals (Sweden)

Vanderson Souza Sampaio

Full Text Available A better knowledge of the burden and risk factors associated with severity due to spider bites would lead to improved management with a reduction of sequelae usually seen for this neglected health problem, and would ensure proper use of antivenoms in remote localities in the Brazilian Amazon. The aim of this study was to analyze the profile of spider bites reported in the state of Amazonas in the Western Brazilian Amazon, and to investigate potential risk factors associated with severity of envenomation.We used a case-control study in order to identify factors associated with spider bite severity in the Western Brazilian Amazon from 2007 to 2014. Patients evolving to any severity criteria were considered cases and those with non-severe bites were included in the control group. All variables were retrieved from the official Brazilian reporting systems. Socioeconomical and environmental components were also included in a multivariable analysis in order to identify ecological determinants of incidence and severity. A total of 1,181 spider bites were recorded, resulting in an incidence of 4 cases per 100,000 person/year. Most of the spider bites occurred in males (65.8%. Bites mostly occurred in rural areas (59.5%. The most affected age group was between 16 and 45 years old (50.9%. A proportion of 39.7% of the bites were related to work activities. Antivenom was prescribed to 39% of the patients. Envenomings recorded from urban areas [Odds ratio (OR = 0.40 (95%CI = 0.30-0.71; pmedian [OR = 0.64 (95%CI = 0.39-0.75; p300 km away from the state capital Manaus [OR = 1.90 (95%CI = 1.28-2.40; p300 km away from the state capital Manaus [OR = 1.53 (95%CI = 1.15-2.02; p = 0.003] and living in a municipality with a MHSPI 300 km away from the state capital Manaus could be contributing factors to higher severity of spider envenomings in this area, as well as to antivenom underdosage.

Does Trait Emotional Intelligence Predict Unique Variance in Early Career Success Beyond IQ and Personality?

OpenAIRE

Haro García, José Manuel de; Castejón Costa, Juan Luis

2014-01-01

In order to determine the contribution of emotional intelligence (EI) to career success, in this study, we analyzed the relationship between trait EI (TEI), general mental ability (GMA), the big five personality traits, and career success indicators, in a sample of 130 graduates who were in the early stages of their careers. Results from hierarchical regression analyses indicated that TEI, and especially its dimension “repair,” has incremental validity in predicting one of the career success ...

Intersexual Trophic Niche Partitioning in an Ant-Eating spider (Araneae: Zodariidae)

DEFF Research Database (Denmark)

Pekár, Stanislav; Martisová, Martina; Bilde, T.

2011-01-01

lead to higher energy demands in females driven by fecundity selection, while males invest in mate searching. We tested predictions of the two hypotheses underlying intersexual trophic niche partitioning in a natural population of spiders. Zodarion jozefienae spiders specialize on Messor barbarus ants...... that are polymorphic in body size and hence comprise potential trophic niches for the spider, making this system well-suited to study intersexual trophic niche partitioning. Methodology/Principal Findings Comparative analysis of trophic morphology (the chelicerae) and body size of males, females and juveniles...... demonstrated highly female biased SSD (Sexual Size Dimorphism) in body size, body weight, and in the size of chelicerae, the latter arising from sex-specific growth patterns in trophic morphology. In the field, female spiders actively selected ant sub-castes that were larger than the average prey size...

Association of spiders and lichen on Robben Island, South Africa: a case report

Directory of Open Access Journals (Sweden)

A. Mukherjee

2010-04-01

Full Text Available The present study is a firstrecord of spider occurrence on Robben Island, South Africa. Some habitats were rich in lichens. As we know, lichens enhance wildlife habitat in less direct ways. The objective of the study was to examine the potential importance of lichens in enriching spider diversity and abundance. A total of 260 spiders (170 from lichens and 90 from bush were collected following the visual search method over one year. Seasonal trends in overall species richness and abundance indicated that the relative density of spiders was greater in lichens than in bushes. The result suggests that habitat structure, such as branch size and epiphytic lichen abundance, can be an explanation for the greater number of spiders in lichen-rich patches of the island.

Programming spiders, bots, and aggregators in Java

CERN Document Server

Heaton, Jeff

2006-01-01

The content and services available on the web continue to be accessed mostly through direct human control. But this is changing. Increasingly, users rely on automated agents that save them time and effort by programmatically retrieving content, performing complex interactions, and aggregating data from diverse sources. Programming Spiders, Bots, and Aggregators in Java teaches you how to build and deploy a wide variety of these agents-from single-purpose bots to exploratory spiders to aggregators that present a unified view of information from multiple user accounts. You will quickly build on

Recombinant DNA production of spider silk proteins.

Science.gov (United States)

Tokareva, Olena; Michalczechen-Lacerda, Valquíria A; Rech, Elíbio L; Kaplan, David L

2013-11-01

Spider dragline silk is considered to be the toughest biopolymer on Earth due to an extraordinary combination of strength and elasticity. Moreover, silks are biocompatible and biodegradable protein-based materials. Recent advances in genetic engineering make it possible to produce recombinant silks in heterologous hosts, opening up opportunities for large-scale production of recombinant silks for various biomedical and material science applications. We review the current strategies to produce recombinant spider silks. © 2013 The Authors. Microbial Biotechnology published by John Wiley & Sons Ltd and Society for Applied Microbiology.

Spider genomes provide insight into composition and evolution of venom and silk

Science.gov (United States)

Sanggaard, Kristian W.; Bechsgaard, Jesper S.; Fang, Xiaodong; Duan, Jinjie; Dyrlund, Thomas F.; Gupta, Vikas; Jiang, Xuanting; Cheng, Ling; Fan, Dingding; Feng, Yue; Han, Lijuan; Huang, Zhiyong; Wu, Zongze; Liao, Li; Settepani, Virginia; Thøgersen, Ida B.; Vanthournout, Bram; Wang, Tobias; Zhu, Yabing; Funch, Peter; Enghild, Jan J.; Schauser, Leif; Andersen, Stig U.; Villesen, Palle; Schierup, Mikkel H; Bilde, Trine; Wang, Jun

2014-01-01

Spiders are ecologically important predators with complex venom and extraordinarily tough silk that enables capture of large prey. Here we present the assembled genome of the social velvet spider and a draft assembly of the tarantula genome that represent two major taxonomic groups of spiders. The spider genomes are large with short exons and long introns, reminiscent of mammalian genomes. Phylogenetic analyses place spiders and ticks as sister groups supporting polyphyly of the Acari. Complex sets of venom and silk genes/proteins are identified. We find that venom genes evolved by sequential duplication, and that the toxic effect of venom is most likely activated by proteases present in the venom. The set of silk genes reveals a highly dynamic gene evolution, new types of silk genes and proteins, and a novel use of aciniform silk. These insights create new opportunities for pharmacological applications of venom and biomaterial applications of silk. PMID:24801114

Spider-silk-like shape memory polymer fiber for vibration damping

International Nuclear Information System (INIS)

Yang, Qianxi; Li, Guoqiang

2014-01-01

In this study, the static and dynamic properties of shape memory polyurethane (SMPU) fiber are reported and compared to those of spider dragline silk. Although the polymeric fiber has a lower strength compared to spider dragline silks (0.2–0.3 GPa versus 1.1 GPa), it possesses much higher toughness (276–289 MJ m −3 versus 160 MJ m −3 ), due to its excellent extensibility. The dynamic mechanical tests reveal that SMPU fiber has a high damping capacity (tan δ = 0.10–0.35) which is comparable to or even higher than that of spider silks (tan δ = 0.15). In addition, we found that, different programming methods change the shape memory and damping properties of the fiber in different ways and cold-drawing programming is more advocated in structural applications. These results suggest that the SMPU fiber has similar vibration damping and mechanical properties as spider silk, and may find applications in lightweight engineering structures. (paper)

Applications of Artificial Intelligence in Education--A Personal View.

Science.gov (United States)

Richer, Mark H.

1985-01-01

Discusses: how artificial intelligence (AI) can advance education; if the future of software lies in AI; the roots of intelligent computer-assisted instruction; protocol analysis; reactive environments; LOGO programming language; student modeling and coaching; and knowledge-based instructional programs. Numerous examples of AI programs are cited.…

Plasticity in Major Ampullate Silk Production in Relation to Spider Phylogeny and Ecology

Science.gov (United States)

Boutry, Cecilia; Řezáč, Milan; Blackledge, Todd Alan

2011-01-01

Spider major ampullate silk is a high-performance biomaterial that has received much attention. However, most studies ignore plasticity in silk properties. A better understanding of silk plasticity could clarify the relative importance of chemical composition versus processing of silk dope for silk properties. It could also provide insight into how control of silk properties relates to spider ecology and silk uses. We compared silk plasticity (defined as variation in the properties of silk spun by a spider under different conditions) between three spider clades in relation to their anatomy and silk biochemistry. We found that silk plasticity exists in RTA clade and orbicularian spiders, two clades that differ in their silk biochemistry. Orbiculariae seem less dependent on external spinning conditions. They probably use a valve in their spinning duct to control friction forces and speed during spinning. Our results suggest that plasticity results from different processing of the silk dope in the spinning duct. Orbicularian spiders seem to display better control of silk properties, perhaps in relation to their more complex spinning duct valve. PMID:21818328

Plasticity in major ampullate silk production in relation to spider phylogeny and ecology.

Directory of Open Access Journals (Sweden)

Cecilia Boutry

Full Text Available Spider major ampullate silk is a high-performance biomaterial that has received much attention. However, most studies ignore plasticity in silk properties. A better understanding of silk plasticity could clarify the relative importance of chemical composition versus processing of silk dope for silk properties. It could also provide insight into how control of silk properties relates to spider ecology and silk uses. We compared silk plasticity (defined as variation in the properties of silk spun by a spider under different conditions between three spider clades in relation to their anatomy and silk biochemistry. We found that silk plasticity exists in RTA clade and orbicularian spiders, two clades that differ in their silk biochemistry. Orbiculariae seem less dependent on external spinning conditions. They probably use a valve in their spinning duct to control friction forces and speed during spinning. Our results suggest that plasticity results from different processing of the silk dope in the spinning duct. Orbicularian spiders seem to display better control of silk properties, perhaps in relation to their more complex spinning duct valve.

Riparian spiders as sentinels of polychlorinated biphenyl contamination across heterogeneous aquatic ecosystems

Science.gov (United States)

Kraus, Johanna M.; Gibson, Polly P.; Walters, David M.; Mills, Marc A.

2017-01-01

Riparian spiders are being used increasingly to track spatial patterns of contaminants in and fluxing from aquatic ecosystems.However, our understanding of the circumstances under which spiders are effective sentinels of aquatic pollution is limited. The present study tests the hypothesis that riparian spiders may be effectively used to track spatial patterns of sediment pollution by polychlorinated biphenyls (PCBs) in aquatic ecosystems with high habitat heterogeneity. The spatial pattern of ΣPCB concentrations in 2 common families of riparian spiders sampled in 2011 to 2013 generally tracked spatial variation in sediment ΣPCBs across all sites within the Manistique River Great Lakes Area of Concern (AOC), a rivermouth ecosystem located on the south shore of the Upper Peninsula, Manistique (MI,USA) that includes harbor, river, backwater, and lake habitats. Sediment ΣPCB concentrations normalized for total organic carbon explained 41% of the variation in lipid-normalized spider ΣPCB concentrations across 11 sites. Furthermore, 2 common riparian spider taxa (Araneidae and Tetragnathidae) were highly correlated (r2> 0.78) and had similar mean ΣPCB concentrations when averaged acrossall years. The results indicate that riparian spiders may be useful sentinels of relative PCB availability to aquatic and riparian food webs in heterogeneous aquatic ecosystems like rivermouths where habitat and contaminant variability may make the use of aquatic taxa lesseffective. Furthermore, the present approach appears robust to heterogeneity in shoreline development and riparian vegetation that support different families of large web-building spiders. Environ Toxicol Chem 2016;9999:1–9. Published 2016 Wiley Periodicals, Inc. on behalf of SETAC. This article is a US government work and, as such, is in the public domain in the United States of America.

Spider diversity in relation to habitat heterogeneity and an altitudinal ...

African Journals Online (AJOL)

Using pitfall traps, wandering spiders (Arachnida: Araneae) were sampled in a nested design from three different localities in the mountainous arid ecosystem of South Sinai at low, middle, and high altitudes. Habitat type and altitude were clearly different among the three localities. Spider diversity per trap varied spatially ...

Risk of spider predation alters food web structure and reduces local herbivory in the field.

Science.gov (United States)

Bucher, Roman; Menzel, Florian; Entling, Martin H

2015-06-01

Predators can indirectly enhance plant performance via herbivore suppression, with both prey consumption and changes in prey traits (e.g. changes in foraging behaviour) contributing to the reduction in herbivory. We performed a field experiment to determine the extent of such non-consumptive effects which consisted of repeatedly placing spiders (Pisaura mirabilis) on enclosed plants (Urtica dioica) for cue deposition. Control plants were enclosed in the same way but without spiders. After cue deposition, the enclosures were removed to allow arthropods to colonize the plants and feed on them. Arthropods were removed from the plants before the subsequent spider deposition or control enclosure. During six cycles of enclosure, we quantified leaf damage on the plants. After a seventh cycle, the colonizing arthropods were sampled to determine community composition in relation to the presence/absence of spider cues. We found that the presence of chemotactile spider cues reduced leaf damage by 50 %. In addition, spider cues led to changes in the arthropod community: smaller spiders avoided plants with spider cues. In contrast, the aphid-tending ant Myrmica rubra showed higher recruitment of workers on cue-bearing plants, possibly to protect aphids. Our results show that the risk of spider predation can reduce herbivory on wild plants and also demonstrate that non-consumptive effects can be particularly strong within the predator guild.

Emotional Intelligence and Personality Traits as Predictors of Occupational Therapy students' Practice Education Performance: A Cross-Sectional Study.

Science.gov (United States)

Brown, Ted; Williams, Brett; Etherington, Jamie

2016-12-01

This study investigated whether occupational therapy students' emotional intelligence and personality traits are predictive of specific aspects of their fieldwork performance. A total of 114 second and third year undergraduate occupational therapy students (86.6% response rate) completed the Genos Emotional Intelligence Inventory (Genos EI) and the Ten-Item Personality Inventory (TIPI). Fieldwork performance scores were obtained from the Student Practice Evaluation Form Revised (SPEF-R). Linear regressions were completed with the SPEF-R domains being the dependent variables and the Genos EI and TIPI factors being the independent variables. Regression analysis results revealed that the Genos EI subscales of Emotional Management of Others (EMO), Emotional Awareness of Others (EAO), Emotional Expression (EEX) and Emotional Reasoning (ERE) were significant predictors of various domains of students' fieldwork performance. EAO and ERE were significant predictors of students' Communication Skills accounting for 4.6% of its variance. EMO, EAO, EEX and ERE were significant predictors of students' Documentation Skills explaining 6.8% of its variance. EMO was a significant predictor of students' Professional Behaviour accounting for 3.2% of its variance. No TIPI factors were found to be significant predictors of the SPEF-R domains. Occupational therapy students' emotional intelligence was a significant predictor of components of their fieldwork performance while students' personality traits were not. The convenience sampling approach used, small sample size recruited and potential issue of social desirability of the self-reported Genos EI and TIPI data are acknowledged as study limitations. It is recommended that other studies be completed to investigate if any other relevant constructs or factors are predictive of occupational therapy students' fieldwork performance. Copyright © 2016 John Wiley & Sons, Ltd. Copyright © 2016 John Wiley & Sons, Ltd.

An insect-feeding guild of carnivorous plants and spiders: does optimal foraging lead to competition or facilitation?

Science.gov (United States)

Crowley, Philip H; Hopper, Kevin R; Krupa, James J

2013-12-01

Carnivorous plants and spiders, along with their prey, are main players in an insect-feeding guild found on acidic, poorly drained soils in disturbed habitat. Darwin's notion that these plants must actively attract the insects they capture raises the possibility that spiders could benefit from proximity to prey hotspots created by the plants. Alternatively, carnivorous plants and spiders may deplete prey locally or (through insect redistribution) more widely, reducing each other's gain rates from predation. Here, we formulate and analyze a model of this guild, parameterized for carnivorous sundews and lycosid spiders, under assumptions of random movement by insects and optimal foraging by predators. Optimal foraging here involves gain maximization via trap investment (optimal web sizes and sundew trichome densities) and an ideal free distribution of spiders between areas with and without sundews. We find no facilitation: spiders and sundews engage in intense exploitation competition. Insect attraction by plants modestly increases sundew gain rates but slightly decreases spider gain rates. In the absence of population size structure, optimal spider redistribution between areas with and without sundews yields web sizes that are identical for all spiders, regardless of proximity to sundews. Web-building spiders have higher gain rates than wandering spiders in this system at high insect densities, but wandering spiders have the advantage at low insect densities. Results are complex, indicating that predictions to be tested empirically must be based on careful quantitative assessment.

Effects of kaolin particle films on the life span of an orb-weaver spider.

Science.gov (United States)

Benhadi-Marín, Jacinto; Pereira, José Alberto; Santos, Sónia A P

2016-02-01

Araniella cucurbitina (Araneae: Araneidae) is a widespread orb-weaver spider commonly found in agroecosystems. Mineral particle films such as kaolin, due to their protective or anti-feeding action, can represent an alternative to pesticides, especially in organic farming systems, but little is known about its effects on A. cucurbitina. Therefore, we tested the effect of kaolin sprays on the life span of A. cucurbitina under laboratory conditions. Four treatments were tested encompassing different exposure routes. Thus, kaolin sprays were applied on (i) the surface, (ii) the prey (fly), (iii) the spider and (iv) both spider & prey. A control group was tested with water in each treatment. Results showed that sprays of kaolin significantly affected the survival of A. curcubitina when applications were done on the surface and on both spider & prey registering a reduction of 48% and 56%, respectively. Spiders in control obtained higher probability of reaching alive at the end of the assay than those treated with kaolin. Differences observed can be explained by the feeding behavior of the species and may depend on the consumption of the web by the spider and the ratio spider/fly for body size. Copyright © 2015 Elsevier Ltd. All rights reserved.

Mobilizing intelligence against nuclear terrorism: a personal perspective

International Nuclear Information System (INIS)

Ne'eman, Y.

1987-01-01

The acquisition of intelligence is best achieved when the following sequence of logical steps controls the process: 1. Definition of essential information. This step consists of identifying the most important items of required information and will be closely tied to the issue under consideration, such as a specific event, evolution, or deployment. It is also important to determine how much warning time is needed prior to an event's occurring. 2. Identification of indicators. This step involves the determination of observable facts or actions that are indicators of the essential information. Sometimes they may be indirect and worth noting but not sufficient in themselves - for example, an interesting characteristic of an envisaged evolution that may be emerging. 3. Intelligence acquisition program. This step can be thought of as a matrix in which the columns list the indicators, and the rows list the various means of acquiring information about them. 4. Ongoing review of the basic premises. Step 1 always involves a set of assumptions. Once the process of intelligence acquisition in underway, it is important to check and recheck whether the basic premises still hold or need to be modified on the basis of new intelligence. This process should be ongoing. Often, however, it is forgotten, albeit at heavy expense. Here the discussion centers mainly on steps 1 and 2

Can ant-eating Zodarion spiders (Araneae: Zodariidae) develop on a diet optimal for euryphagous arthropod predators?

DEFF Research Database (Denmark)

Pekar, Stano; Toft, Søren

2009-01-01

. Such adaptations may then entail trade-offs in handling and utilization of alternative prey. To investigate behavioural as well as nutritional adaptations and the occurrence of the corresponding trade-offs in two ant-eating spiders of the genus Zodarion [Zodarion atlanticum Pekár & Cardoso and Zodarion germanicum...... (C. L. Koch)], spiders are reared on two diets: ants (i.e. their preferred prey) and fruit flies (i.e. an alternative prey that is nutritionally optimal for euryphagous spiders). Food consumption is observed and several fitness-related life-history parameters are measured. Although spiders readily...... accept ants, more than one-third of 35 spiders refuse to consume fruit flies and starve. Furthermore, severe hunger does not induce these individuals to accept fruit flies. Starving spiders die before moulting to the second stadium. Spiders that eat fruit flies increase only little and slowly in weight...

Management intensity and vegetation complexity affect web-building spiders and their prey.

Science.gov (United States)

Diehl, Eva; Mader, Viktoria L; Wolters, Volkmar; Birkhofer, Klaus

2013-10-01

Agricultural management and vegetation complexity affect arthropod diversity and may alter trophic interactions between predators and their prey. Web-building spiders are abundant generalist predators and important natural enemies of pests. We analyzed how management intensity (tillage, cutting of the vegetation, grazing by cattle, and synthetic and organic inputs) and vegetation complexity (plant species richness, vegetation height, coverage, and density) affect rarefied richness and composition of web-building spiders and their prey with respect to prey availability and aphid predation in 12 habitats, ranging from an uncut fallow to a conventionally managed maize field. Spiders and prey from webs were collected manually and the potential prey were quantified using sticky traps. The species richness of web-building spiders and the order richness of prey increased with plant diversity and vegetation coverage. Prey order richness was lower at tilled compared to no-till sites. Hemipterans (primarily aphids) were overrepresented, while dipterans, hymenopterans, and thysanopterans were underrepresented in webs compared to sticky traps. The per spider capture efficiency for aphids was higher at tilled than at no-till sites and decreased with vegetation complexity. After accounting for local densities, 1.8 times more aphids were captured at uncut compared to cut sites. Our results emphasize the functional role of web-building spiders in aphid predation, but suggest negative effects of cutting or harvesting. We conclude that reduced management intensity and increased vegetation complexity help to conserve local invertebrate diversity, and that web-building spiders at sites under low management intensity (e.g., semi-natural habitats) contribute to aphid suppression at the landscape scale.

Comparative growth and development of spiders reared on live and dead prey.

Science.gov (United States)

Peng, Yu; Zhang, Fan; Gui, Shaolan; Qiao, Huping; Hose, Grant C

2013-01-01

Scavenging (feeding on dead prey) has been demonstrated across a number of spider families, yet the implications of feeding on dead prey for the growth and development of individuals and population is unknown. In this study we compare the growth, development, and predatory activity of two species of spiders that were fed on live and dead prey. Pardosa astrigera (Lycosidae) and Hylyphantes graminicola (Lyniphiidae) were fed live or dead fruit flies, Drosophila melanogaster. The survival of P. astrigera and H. graminicola was not affected by prey type. The duration of late instars of P. astrigera fed dead prey were longer and mature spiders had less protein content than those fed live prey, whereas there were no differences in the rate of H. graminicola development, but the mass of mature spiders fed dead prey was greater than those fed live prey. Predation rates by P. astrigera did not differ between the two prey types, but H. graminicola had a higher rate of predation on dead than alive prey, presumably because the dead flies were easier to catch and handle. Overall, the growth, development and reproduction of H. graminicola reared with dead flies was better than those reared on live flies, yet for the larger P. astrigera, dead prey may suit smaller instars but mature spiders may be best maintained with live prey. We have clearly demonstrated that dead prey may be suitable for rearing spiders, although the success of the spiders fed such prey appears size- and species specific.

Detection and phylogenetic analysis of bacteriophage WO in spiders (Araneae).

Science.gov (United States)

Yan, Qian; Qiao, Huping; Gao, Jin; Yun, Yueli; Liu, Fengxiang; Peng, Yu

2015-11-01

Phage WO is a bacteriophage found in Wolbachia. Herein, we represent the first phylogenetic study of WOs that infect spiders (Araneae). Seven species of spiders (Araneus alternidens, Nephila clavata, Hylyphantes graminicola, Prosoponoides sinensis, Pholcus crypticolens, Coleosoma octomaculatum, and Nurscia albofasciata) from six families were infected by Wolbachia and WO, followed by comprehensive sequence analysis. Interestingly, WO could be only detected Wolbachia-infected spiders. The relative infection rates of those seven species of spiders were 75, 100, 88.9, 100, 62.5, 72.7, and 100 %, respectively. Our results indicated that both Wolbachia and WO were found in three different body parts of N. clavata, and WO could be passed to the next generation of H. graminicola by vertical transmission. There were three different sequences for WO infected in A. alternidens and two different WO sequences from C. octomaculatum. Only one sequence of WO was found for the other five species of spiders. The discovered sequence of WO ranged from 239 to 311 bp. Phylogenetic tree was generated using maximum likelihood (ML) based on the orf7 gene sequences. According to the phylogenetic tree, WOs in N. clavata and H. graminicola were clustered in the same group. WOs from A. alternidens (WAlt1) and C. octomaculatum (WOct2) were closely related to another clade, whereas WO in P. sinensis was classified as a sole cluster.

Intelligence, temperament, and personality are related to over- or under-reporting of affective symptoms by patients with euthymic mood disorder.

Science.gov (United States)

Kim, Eun Young; Hwang, Samuel Suk-Hyun; Lee, Nam Young; Kim, Se Hyun; Lee, Hyun Jeong; Kim, Yong Sik; Ahn, Yong Min

2013-06-01

Many patients with mood disorders report subjective indicators of depression that are inconsistent with clinicians' objective ratings. This study used the self-report Beck Depressive Inventory (BDI) and the observer-rated Hamilton Depression Rating Scale (HAMD) to evaluate the extent to which temperament, personality traits, and clinical characteristics accounted for discrepancies between self-reports and clinician ratings of depressive symptoms in patients experiencing the euthymic period of a mood disorder. The sample consisted of 100 individuals with bipolar disorder (n=72) or major depressive disorder (n=28). The HAMD and Young Mania Rating Scale were administered, and participants completed the BDI and Barratt Impulsivity Scale. Intelligence was assessed with the Korean Wechsler Adult Intelligence Scale. Patients completed the Temperament Evaluation of the Memphis, Pisa, Paris, and San Diego Autoquestionnaire and the NEO-Five-Factor Inventory. The BDI and HAMD were significantly but modestly correlated with each other (r=0.319, pconscientious personality were independent contributors to differences between Z-scores for the BDI and the HAMD. Higher impulsivity and a more anxious temperament were also observed in the group that self-reported more symptoms than were noted by clinicians. Generalizability of results can be limited in ethnic difference. Subjective and objective assessments of the depressive symptoms of patients with mood disorders in a euthymic mood state are frequently discordant. Clinicians should consider the subjective aspects of depressive symptoms along with objective information about the influence of intelligence and personality on patients' self-reports. Copyright © 2012 Elsevier B.V. All rights reserved.

Riparian spiders as sentinels of PCB contamination across heterogeneous aquatic ecosystems

Science.gov (United States)

Riparian spiders are being used increasingly to track spatial patterns of contaminants in and fluxing from aquatic ecosystems. However, our understanding of the circumstances under which spiders are effective sentinels of aquatic pollution is limited. The present study tests the ...

Ecosystem services in the face of invasion: the persistence of native and nonnative spiders in an agricultural landscape.

Science.gov (United States)

Hogg, Brian N; Daane, Kent M

2011-03-01

The presence of intact natural ecosystems in agricultural landscapes can mitigate losses in the diversity of natural enemies and enhance ecosystem services. However, native natural enemies may fail to persist in agroecosystems if invaders dominate species interactions. In this study, native and nonnative spiders were sampled along transects that extended from oak woodland and riparian zones into surrounding California vineyards, to assess the role of natural habitat as a source for spider biodiversity in the vineyard landscape, and to compare the dominance of exotic Cheiracanthium spiders between habitats. Many spider species were more abundant in natural habitat than in vineyards, and numbers of spiders and spider species within vineyards were higher at the vineyard edge adjacent to oak woodland. These results suggest that natural habitat is a key source for spiders in vineyards. The positive effect of oak woodland on the vineyard spider community extended only to the vineyard edge, however. Proportions of Cheiracanthium spiders increased dramatically in the vineyard, while numbers of native wandering spiders (the native ecological homologues of Cheiracanthium spiders) decreased. Dispersal limitation and strong habitat preferences may have prevented native wandering spiders from establishing far from the vineyard edge. Exotic Cheiracanthium spiders, in contrast, may possess specific adaptations to vineyards or to a wide range of habitats. Results suggest that the ecosystem services provided by intact natural habitat may be limited in agricultural landscapes that are dominated by invasive species.

Prefrontal cognitive ability, intelligence, Big Five personality, and the prediction of advanced academic and workplace performance.

Science.gov (United States)

Higgins, Daniel M; Peterson, Jordan B; Pihl, Robert O; Lee, Alice G M

2007-08-01

Studies 1 and 2 assessed performance on a battery of dorsolateral prefrontal cognitive ability (D-PFCA) tests, personality, psychometric intelligence, and academic performance (AP) in 2 undergraduate samples. In Studies 1 and 2, AP was correlated with D-PFCA (r=.37, ppersonality. Studies 3 and 4 assessed D-PFCA, personality, and workplace performance among (a) managerial-administrative workers and (b) factory floor workers at a manufacturing company. Prefrontal cognitive ability correlated with supervisor ratings of manager performance at values of r ranging from .42 to .57 (ps<.001), depending on experience, and with factory floor performance at pr=.21 (p=.02), after controlling for experience, age, and education. Conscientiousness correlated with factory floor performance at r=.23.

Body burdens of metals in spiders from the Lidice coal dump near Ostrava (Czech Republic)

Energy Technology Data Exchange (ETDEWEB)

Wilczek, G.; Babczynska, A.; Majkus, Z. [Silesian University, Katowice (Poland)

2005-09-01

Spiders' feeding behaviour and external digestion expose them to man-made pollutants, especially those easily transferred along the food chain. The problem for this study was whether the levels of heavy metals in selected species of spiders from the Lidice coal dump reflect adaptation to environmental pollutants. We used flameless and flame AAS to measure the whole-body concentrations of Cd, Pb, Cu, Zn, Fe, Ni and Mg in male and female spiders differing in their hunting strategies, type of web construction, prey, and taxonomic position (Araneidae, Agelenidae, Linyphiidae, Theridiidae, Tetragnathidae, Lycosidae, Salticidae, Pisauridae, Clubionidae, Philodromidae). The levels of metals found in the spiders were species-dependent, indicating differences related to the hunting strategy and type of prey. Accumulation of Pb, Cu and Zn was always higher in ground spiders than in web-constructing species. Sheet-web spiders Linyphia triangularis and wandering spiders Clubiona lutescens had the lowest Cd, Mg and Cu content of all the studied species. Web-building spiders of the Tetragnathidae family showed the highest Cd, Cu and Pb content, even in species with feeding behaviour similar to spiders of other families. There were no interspecific differences in accumulation only for Fe and Mg. The concentrations of Cd, Ni and Pb were lower in females than in males, irrespective of their taxonomic position and the intensity of their hunting activity. This may suggest that females have better metal-excretion ability than males.

Functional Group of Spiders in Cultivated Landscape Dominated by Paddy Fields in West Java, Indonesia

Directory of Open Access Journals (Sweden)

I WAYAN SUANA

2009-03-01

Full Text Available Distribution of spiders in all colonized environments is limited by biotic and abiotic factors requiring adaptations with respect to, for example microhabitat choice and hunting behavior. These two factors were frequently used to group spiders into functional groups. In this study our objectives were to (i group of genera of spiders into functional group based on their microhabitat specificity, hunting behavior, and daily activity; and (ii compare the number and composition of functional group of spider at each habitat type and period of paddy growth. The study was conducted at a landscape dominated by paddy fields in Cianjur Watershed for a period of 9 months. Four different habitat types (paddy, vegetable, non-crop, and mixed garden, were sampled using five trapping techniques (pitfall traps, farmcop suction, sweep netting, yellow-pan traps, and sticky traps. The Unweighted Pair-Group Average and the Euclidean Distances were used to generate dendrogram of functional group of spider. We found 14 functional groups of spider at genus level. The number of functional group of spider at four habitat types was differing, but the composition was similar, because all habitats were closed to each other. Habitat structure diversity and disturbance level influenced the number of functional group of spider. Different architecture of vegetation and availability of differ prey during paddy growth, causing the composition of functional group of spider in each period of paddy growth was changed, although its number was unchanged.

Linking Native and Invader Traits Explains Native Spider Population Responses to Plant Invasion.

Directory of Open Access Journals (Sweden)

Jennifer N Smith

Full Text Available Theoretically, the functional traits of native species should determine how natives respond to invader-driven changes. To explore this idea, we simulated a large-scale plant invasion using dead spotted knapweed (Centaurea stoebe stems to determine if native spiders' web-building behaviors could explain differences in spider population responses to structural changes arising from C. stoebe invasion. After two years, irregular web-spiders were >30 times more abundant and orb weavers were >23 times more abundant on simulated invasion plots compared to controls. Additionally, irregular web-spiders on simulated invasion plots built webs that were 4.4 times larger and 5.0 times more likely to capture prey, leading to >2-fold increases in recruitment. Orb-weavers showed no differences in web size or prey captures between treatments. Web-spider responses to simulated invasion mimicked patterns following natural invasions, confirming that C. stoebe's architecture is likely the primary attribute driving native spider responses to these invasions. Differences in spider responses were attributable to differences in web construction behaviors relative to historic web substrate constraints. Orb-weavers in this system constructed webs between multiple plants, so they were limited by the overall quantity of native substrates but not by the architecture of individual native plant species. Irregular web-spiders built their webs within individual plants and were greatly constrained by the diminutive architecture of native plant substrates, so they were limited both by quantity and quality of native substrates. Evaluating native species traits in the context of invader-driven change can explain invasion outcomes and help to identify factors limiting native populations.

Formation of primary sperm conjugates in a haplogyne spider (Caponiidae, Araneae) with remarks on the evolution of sperm conjugation in spiders.

Science.gov (United States)

Lipke, Elisabeth; Michalik, Peter

2012-11-01

Sperm conjugation, where two or more sperm are physically united, is a rare but widespread pheno-menon across the animal kingdom. One group well known for its different types of sperm conjugation are spiders. Particularly, haplogyne spiders show a high diversity of sperm traits. Besides individual cleistospermia, primary (synspermia) and secondary (coenospermia, "spermatophore") sperm conjugation occurs. However, the evolution of sperm conjugates and sperm is not understood in this group. Here, we look at how sperm are transferred in Caponiidae (Haplogynae) in pursuit of additional information about the evolution of sperm transfer forms in spiders. Additionally, we investigated the male reproductive system and spermatozoa using light- and transmission electron-microscopy and provide a 3D reconstruction of individual as of well as conjugated spermatozoa. Mature spermatozoa are characterized by an extremely elongated, helical nucleus resulting in the longest spider sperm known to date. At the end of spermiogenesis, synspermia are formed by complete fusion of four spermatids. Thus, synspermia might have evolved early within ecribellate Haplogynae. The fused sperm cells are surrounded by a prominent vesicular area. The function of the vesicular area remains still unknown but might be correlated with the capacitation process inside the female. Further phylogenetic and functional implications of the spermatozoa and sperm conjugation are discussed. Copyright © 2012 Elsevier Ltd. All rights reserved.

Species richness and composition assessment of spiders in a Mediterranean scrubland

DEFF Research Database (Denmark)

Bondoso Cardoso, Pedro Miguel; Henriques, Sérgio S.; Gaspar, Clara

2009-01-01

Intensive fieldwork has been undertaken in Portugal in order to develop a standardized and optimized sampling protocol for Mediterranean spiders. The present study had the objectives of testing the use of semi-quantitative sampling for obtaining an exhaustive species richness assessment of spiders...

Gender and gender role differences in self- and other-estimates of multiple intelligences.

Science.gov (United States)

Szymanowicz, Agata; Furnham, Adrian

2013-01-01

This study examined participant gender and gender role differences in estimates of multiple intelligences for self, partner, and various hypothetical, stereotypical, and counter-stereotypical target persons. A general population sample of 261 British participants completed one of four questionnaires that required them to estimate their own and others' multiple intelligences and personality traits. Males estimated their general IQ slightly, but mathematic IQ significantly higher than females, who rated their social and emotional intelligence higher than males. Masculine individuals awarded themselves somewhat higher verbal and practical IQ scores than did female participants. Both participant gender and gender role differences in IQ estimates were found, with gender effects stronger in cognitive and gender role than in "personal" ability estimates. There was a significant effect of gender role on hypothetical persons' intelligence evaluations, with masculine targets receiving significantly higher intelligence estimates compared to feminine targets. More intelligent hypothetical figures were judged as more masculine and less feminine than less intelligent ones.

Methods of assembling and disassembling spider and burnable poison rod structures for nuclear reactors

International Nuclear Information System (INIS)

Edwards, G.T.; Schluderberg, D.C.

1981-01-01

A technique is provided for engaging and disengaging burnable poison rods from a spider in a nuclear reactor fuel assembly. A cap on the end of each of the burnable poison rods is provided with a shank or stem that is received in a respective bore formed in the spider. A frangible flange secures the shank and rod to the spider. Pressing the shank in the direction of the bore axis by means, e.g., of a plate ruptures the frangible flange to release the rod from the spider. (author)

Collections of spiders, scientific networks, and politics: the web of life of Cândido de Mello Leitão (1886-1948

Directory of Open Access Journals (Sweden)

Regina Horta Duarte

2010-01-01

Full Text Available Cândido de Mello Leitão (1886-1948 started his career as a pediatrician. Being extremely dedicated to the study of spiders, he became one of the greatest arachnologists of his time, and earned wide recognition from his peers. The present article deals with some aspects of his career, while trying to address the question of how one could become a biologist in Brazil in the first half of the 20th century, when there were no graduation courses in Biology and the profession held no official recognition. Research conducted on books, newspapers and Mello Leitão's personal documents has shown how this specialization came to being in the crossroads of practical experiences in various scientific institutions, national and international collaboration and the changing social-historic conditions. A spider expert, Mello Leitão had great knowledge on webs that allowed him to become a biologist. Amid these personal and institutional relationships, he built and spread knowledge, and carved a role for himself, his colleagues, the institutions he worked in and the biology he practiced.

The spider Harpactea sadistica: co-evolution of traumatic insemination and complex female genital morphology in spiders.

Science.gov (United States)

Rezác, Milan

2009-08-07

The males of invertebrates from a few phyla, including arthropods, have been reported to practise traumatic insemination (TI; i.e. injecting sperm by using the copulatory organ to penetrate the female's body wall). As all previously reported arthropod examples have been insects, there is considerable interest in whether TI might have evolved independently in other arthropods. The research reported here demonstrates the first case of TI in the arthropod subphylum Chelicerata, in particular how the genital morphology and mating behaviour of Harpactea sadistica (Rezác 2008), a spider from Israel, has become adapted specifically for reproduction based on TI. Males have needle-like intromittent organs and females have atrophied spermathecae. In other spiders, eggs are fertilized simultaneously with oviposition, but the eggs of H. sadistica are fertilized in the ovaries (internal fertilization) and develop as embryos before being laid. Sperm-storage organs of phylogenetically basal groups to H. sadistica provide males with last male sperm priority and allow removal of sperm by males that mate later, suggesting that TI might have evolved as an adaptive strategy to circumvent an unfavourable structure of the sperm-storage organs, allowing the first male to mate with paternity advantage. Understanding the functional significance of TI gives us insight into factors underlying the evolution of the genital and sperm-storage morphology in spiders.

Beneficial Effects of Ants and Spiders on the Reproductive Value of Eriotheca gracilipes (Malvaceae) in a Tropical Savanna.

Science.gov (United States)

Stefani, Vanessa; Pires, Tayna Lopes; Torezan-Silingardi, Helena Maura; Del-Claro, Kleber

2015-01-01

Predators affect plant fitness when they forage on them and reduce the action of herbivores. Our study evaluates the complementary effects of spiders and ants that visit the extrafloral nectaries of Eriotheca gracilipes (Malvaceae) on the production of fruits and viable seeds of these savanna trees. Four experimental groups were established: control group - with free access of spiders and ants; exclusion group - spiders and ants excluded; ant group - absence of spiders; and spider group - absence of ants. The presence of ants reduced the spider richness; however, the presence of spiders did not affect the ant richness. A significantly higher number of fruits per buds were found in the presence of spiders alone or spiders and ants together (control group) compared with the absence of both predators (exclusion group). The number of seeds per fruits and seed viability were higher in the control group. This is the first study showing that spiders and ants may exert a positive and complementary effect on the reproductive value of an extrafloral nectaried plant. Mostly the impact of ants and/or spiders on herbivores is considered, whereas our study reinforces the importance of evaluating the effect of multiple predators simultaneously, exploring how the interactions among predators with distinct skills may affect the herbivores and the plants on which they forage.

Measuring Emotional Intelligence: Where We Are Today.

Science.gov (United States)

Finegan, Jane E.

Emotional intelligence has been defined as "the ability to monitor one's own and others' feelings and emotions, to discriminate among them, and to use this information to guide one's thinking and actions" (P. Salovey and J. Mayer, 1990). As a subset of social intelligence and of personal intelligences (H. Gardner, 1983), emotional…

Riparian spiders as sentinels of polychlorinated biphenyl contamination across heterogeneous aquatic ecosystems.

Science.gov (United States)

Kraus, Johanna M; Gibson, Polly P; Walters, David M; Mills, Marc A

2017-05-01

Riparian spiders are being used increasingly to track spatial patterns of contaminants in and fluxing from aquatic ecosystems. However, our understanding of the circumstances under which spiders are effective sentinels of aquatic pollution is limited. The present study tests the hypothesis that riparian spiders may be effectively used to track spatial patterns of sediment pollution by polychlorinated biphenyls (PCBs) in aquatic ecosystems with high habitat heterogeneity. The spatial pattern of ΣPCB concentrations in 2 common families of riparian spiders sampled in 2011 to 2013 generally tracked spatial variation in sediment ΣPCBs across all sites within the Manistique River Great Lakes Area of Concern (AOC), a rivermouth ecosystem located on the south shore of the Upper Peninsula, Manistique (MI, USA) that includes harbor, river, backwater, and lake habitats. Sediment ΣPCB concentrations normalized for total organic carbon explained 41% of the variation in lipid-normalized spider ΣPCB concentrations across 11 sites. Furthermore, 2 common riparian spider taxa (Araneidae and Tetragnathidae) were highly correlated (r 2  > 0.78) and had similar mean ΣPCB concentrations when averaged across all years. The results indicate that riparian spiders may be useful sentinels of relative PCB availability to aquatic and riparian food webs in heterogeneous aquatic ecosystems like rivermouths where habitat and contaminant variability may make the use of aquatic taxa less effective. Furthermore, the present approach appears robust to heterogeneity in shoreline development and riparian vegetation that support different families of large web-building spiders. Environ Toxicol Chem 2017;36:1278-1286. Published 2016 Wiley Periodicals, Inc. on behalf of SETAC. This article is a US government work and, as such, is in the public domain in the United States of America. Published 2016 Wiley Periodicals, Inc. on behalf of SETAC. This article is a US government work and, as such, is in

Contributions of detrital subsidies to aboveground spiders during secondary succession, revealed by radiocarbon and stable isotope signatures.

Science.gov (United States)

Haraguchi, Takashi F; Uchida, Masao; Shibata, Yasuyuki; Tayasu, Ichiro

2013-04-01

Prey subsidies originating from detritus add nutrients and energy to arboreal communities. Measurement of this subsidy is required in the understanding of how food web dynamics respond to changes in surrounding environments. Shrub spiders are one of the key predators involved in food web coupling. We evaluate the effects of potential changes in prey availabilities during secondary succession on the contribution of subsidy from detrital food webs to shrub spiders and how different spider feeding guilds used the subsidy of prey from detrital food webs. We measured the relative importance of the subsidy for the spider feeding guilds, using the ratios of stable isotopes of C (δ(13)C), and N (δ(15)N) and C isotope discrimination (Δ(14)C). Diet age was calculated from Δ(14)C values, because old diet ages of spiders indicate that the spiders consume prey from detrital food sources. Dominant aerial prey (Diptera) had a distinctively old diet age compared with arboreal prey, which indicates that aerial prey were subsidized from detrital food webs. Sit-and-wait spiders tended to have an older diet age than active hunting spiders, which indicates that sit-and-wait spiders depended more on subsidies. Diet age varied only slightly for spiders in stands of different ages, indicating that rates at which spiders use grazing and detrital prey are probably determined more by foraging strategies and not by stand age. A dominance of sit-and-wait predators will lead to higher detrital subsidy inputs in shrub habitats. This study highlights the effect of shrub spider community structure (feeding guild composition) on the volume of the subsidy received from the detrital food web.

Considering Moral Intelligence as Part of a Holistic Education

Science.gov (United States)

Clarken, Rodney H.

2010-01-01

Morality and moral intelligence are important in our society and schools. Moral intelligence is discussed in the context of Gardener's theory of multiple intelligences. Moral intelligence helps apply ethical principles to personal goals, values and actions. It consists of four competencies related to integrity, three to responsibility, two to…

David and Goliath: potent venom of an ant-eating spider (Araneae) enables capture of a giant prey

Science.gov (United States)

Pekár, Stano; Šedo, Onřej; Líznarová, Eva; Korenko, Stanislav; Zdráhal, Zdeněk

2014-07-01

It is rare to find a true predator that repeatedly and routinely kills prey larger than itself. A solitary specialised ant-eating spider of the genus Zodarion can capture a relatively giant prey. We studied the trophic niche of this spider species and investigated its adaptations (behavioural and venomic) that are used to capture ants. We found that the spider captures mainly polymorphic Messor arenarius ants. Adult female spiders captured large morphs while tiny juveniles captured smaller morphs, yet in both cases ants were giant in comparison with spider size. All specimens used an effective prey capture strategy that protected them from ant retaliation. Juvenile and adult spiders were able to paralyse their prey using a single bite. The venom glands of adults were more than 50 times larger than those of juvenile spiders, but the paralysis latency of juveniles was 1.5 times longer. This suggests that this spider species possesses very potent venom already at the juvenile stage. Comparison of the venom composition between juvenile and adult spiders did not reveal significant differences. We discovered here that specialised capture combined with very effective venom enables the capture of giant prey.

Geophagy in brown spider monkeys (Ateles hybridus) in a lowland tropical rainforest in Colombia.

Science.gov (United States)

Link, Andres; de Luna, Ana Gabriela; Arango, Ricardo; Diaz, Maria Clara

2011-01-01

Spider monkeys and howler monkeys are the only Neotropical primates that eat soil from mineral licks. Not all species within these genera visit mineral licks, and geophagy has been restricted to populations of Ateles belzebuth belzebuth,Ateles belzebuth chamek and Alouatta seniculus in western Amazonian rainforests. With the aid of a camera trap we studied the visitation patterns of a group of brown spider monkeys (Ateles hybridus) to a mineral lick at Serrania de Las Quinchas, in Colombia. Spider monkeys visited the lick frequently throughout the year, with a monthly average of 21.7 ± 7.2 visits per 100 days of camera trapping (n = 14 months). Spider monkeys visited the mineral lick almost always on days with no rain, or very little (<3 mm) rain, suggesting that proximate environmental variables might determine spider monkeys' decisions to come to the ground at the licks. This study expands the geographical occurrence of mineral lick use by spider monkeys providing additional data for future assessments on the biogeographical correlates of mineral lick use by platyrrhines. Copyright © 2011 S. Karger AG, Basel.

Do depressive traits and hostility predict age-related decline in general intelligence?

DEFF Research Database (Denmark)

Mortensen, Erik Lykke; Barefoot, John Calvin; Avlund, Kirsten

2012-01-01

on decline in general intelligence over a 30-year period. The Minnesota Multiphasic Personality Inventory was administered at a 50-year baseline exam, and from this inventory the Obvious Depression Scale and an abbreviated version of the Cook-Medley Hostility Scale were derived. At the 50-year baseline...... and at the 60-, 70-, and 80-year followups the full version of Wechsler's Adult Intelligence Scale (WAIS) was administered to 673, 513, 136, and 184 participants. Mixed effects statistical models were used to evaluate both the effect of the personality scores on level of intelligence and the interaction between...... the personality scores and the time since followup. Analyses were adjusted for demographic background and a wide range of lifestyle factors. Both obvious depression and hostility were negatively associated with level of intelligence, but personality scores did not influence rate of decline in general intelligence....

Gamma irradiation as a quarantine treatment for spider mites (Acarina: tetranychidae) in horticultural products

International Nuclear Information System (INIS)

Ignatowicz, S.; Banasik-Solgala, K.

1999-01-01

The carmine spider mite, Tetranychus cinnabarinus (Boisd.), and the two-spotted spider mite, Tetranychus urticae Koch, are closely related species of tetranychid mites (Acarina, Tetranychidae) that respond to gamma irradiation in a similar way. Eggs of both species exposed to gamma radiation early in embryonic development were considerably more susceptible to irradiation than older eggs. The tolerance of eggs to gamma radiation increased in 3-4-day-old eggs, when eye-spots were formed. Nymphs were more resistant to gamma radiation than eggs and larvae. Deteriorative effects of irradiation treatment were reflected in the immatures by their mortality in subsequent developmental stages. A positive relationship between dosage and the percent egg mortality or the mortality of subsequent stages was usually found when the immature stages were irradiated. The sex ratio of adults developed from irradiated eggs, larvae, and nymphs was affected by the irradiation treatment; the ratio was usually skewed towards males. Irradiation of females resulted in increased mortality, lowered fecundity, reduced egg viability, and sex ratio distortion in their progeny. Two-day-old females of the carmine spider mite and the two-spotted spider mite irradiated with 200 or 300 Gy lived as long as the controls. Mortality occurred after 3 weeks. The number of eggs laid by irradiated females of spider mites was considerably lower than in the control, and it decreased as the absorbed dose increased. The higher the dose of gamma radiation applied to adults of the spider mites (the parental generation, P), the higher the mortality of the F1 mites during their embryonic development. Viability of eggs laid by irradiated females of spider mites mated with irradiated males was significantly reduced. Young females treated with a dose of 0.2 kGy produced 40-50% nonviable eggs, while control mites produced only 6.0-6.6% nonviable eggs. A dose of 0.3 kGy caused high mortality of eggs; 88% and 97% nonviable

Spider Transcriptomes Identify Ancient Large-Scale Gene Duplication Event Potentially Important in Silk Gland Evolution.

Science.gov (United States)

Clarke, Thomas H; Garb, Jessica E; Hayashi, Cheryl Y; Arensburger, Peter; Ayoub, Nadia A

2015-06-08

The evolution of specialized tissues with novel functions, such as the silk synthesizing glands in spiders, is likely an influential driver of adaptive success. Large-scale gene duplication events and subsequent paralog divergence are thought to be required for generating evolutionary novelty. Such an event has been proposed for spiders, but not tested. We de novo assembled transcriptomes from three cobweb weaving spider species. Based on phylogenetic analyses of gene families with representatives from each of the three species, we found numerous duplication events indicative of a whole genome or segmental duplication. We estimated the age of the gene duplications relative to several speciation events within spiders and arachnids and found that the duplications likely occurred after the divergence of scorpions (order Scorpionida) and spiders (order Araneae), but before the divergence of the spider suborders Mygalomorphae and Araneomorphae, near the evolutionary origin of spider silk glands. Transcripts that are expressed exclusively or primarily within black widow silk glands are more likely to have a paralog descended from the ancient duplication event and have elevated amino acid replacement rates compared with other transcripts. Thus, an ancient large-scale gene duplication event within the spider lineage was likely an important source of molecular novelty during the evolution of silk gland-specific expression. This duplication event may have provided genetic material for subsequent silk gland diversification in the true spiders (Araneomorphae). © The Author(s) 2015. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution.

The ITER Neutral Beam Test Facility towards SPIDER operation

Science.gov (United States)

Toigo, V.; Dal Bello, S.; Gaio, E.; Luchetta, A.; Pasqualotto, R.; Zaccaria, P.; Bigi, M.; Chitarin, G.; Marcuzzi, D.; Pomaro, N.; Serianni, G.; Agostinetti, P.; Agostini, M.; Antoni, V.; Aprile, D.; Baltador, C.; Barbisan, M.; Battistella, M.; Boldrin, M.; Brombin, M.; Dalla Palma, M.; De Lorenzi, A.; Delogu, R.; De Muri, M.; Fellin, F.; Ferro, A.; Gambetta, G.; Grando, L.; Jain, P.; Maistrello, A.; Manduchi, G.; Marconato, N.; Pavei, M.; Peruzzo, S.; Pilan, N.; Pimazzoni, A.; Piovan, R.; Recchia, M.; Rizzolo, A.; Sartori, E.; Siragusa, M.; Spada, E.; Spagnolo, S.; Spolaore, M.; Taliercio, C.; Valente, M.; Veltri, P.; Zamengo, A.; Zaniol, B.; Zanotto, L.; Zaupa, M.; Boilson, D.; Graceffa, J.; Svensson, L.; Schunke, B.; Decamps, H.; Urbani, M.; Kushwah, M.; Chareyre, J.; Singh, M.; Bonicelli, T.; Agarici, G.; Garbuglia, A.; Masiello, A.; Paolucci, F.; Simon, M.; Bailly-Maitre, L.; Bragulat, E.; Gomez, G.; Gutierrez, D.; Mico, G.; Moreno, J.-F.; Pilard, V.; Chakraborty, A.; Baruah, U.; Rotti, C.; Patel, H.; Nagaraju, M. V.; Singh, N. P.; Patel, A.; Dhola, H.; Raval, B.; Fantz, U.; Fröschle, M.; Heinemann, B.; Kraus, W.; Nocentini, R.; Riedl, R.; Schiesko, L.; Wimmer, C.; Wünderlich, D.; Cavenago, M.; Croci, G.; Gorini, G.; Rebai, M.; Muraro, A.; Tardocchi, M.; Hemsworth, R.

2017-08-01

SPIDER is one of two projects of the ITER Neutral Beam Test Facility under construction in Padova, Italy, at the Consorzio RFX premises. It will have a 100 keV beam source with a full-size prototype of the radiofrequency ion source for the ITER neutral beam injector (NBI) and also, similar to the ITER diagnostic neutral beam, it is designed to operate with a pulse length of up to 3600 s, featuring an ITER-like magnetic filter field configuration (for high extraction of negative ions) and caesium oven (for high production of negative ions) layout as well as a wide set of diagnostics. These features will allow a reproduction of the ion source operation in ITER, which cannot be done in any other existing test facility. SPIDER realization is well advanced and the first operation is expected at the beginning of 2018, with the mission of achieving the ITER heating and diagnostic NBI ion source requirements and of improving its performance in terms of reliability and availability. This paper mainly focuses on the preparation of the first SPIDER operations—integration and testing of SPIDER components, completion and implementation of diagnostics and control and formulation of operation and research plan, based on a staged strategy.

Extended survival of spiders (Aranaeae) feeding on whitefly (Homoptera: Aleyrodidae) honeydew

Science.gov (United States)

Honeydew produced by homopteran insects such as aphids, whiteflies and mealybugs, can be abundant in some crops and may represent an important food resource for spiders and other honeydew feeding natural enemies. Woolly whiteflies are common in south Texas citrus, and spiders consistently make up a...

Tests for attraction to prey and predator avoidance by chemical cues in spiders of the beech forest floor

Directory of Open Access Journals (Sweden)

Wetter, Melissa B.

2012-07-01

Full Text Available Spiders leave draglines, faeces and other secretions behind when traveling through their microhabitat. The presence of these secretions may unintentionally inform other animals, prey as well as predators, about a recent and possible current predation risk or food availability. For a wolf spider, other spiders including smaller conspecifics, form a substantial part of their prey, and larger wolf spiders, again including conspecifics, are potential predators. We tested two hypotheses: that large wolf spiders may locate patches of potential spider prey through the presence of silk threads and/or other secretions; and that prey spiders may use secretions from large wolf spiders to avoid patches with high predation risk. We used large (subadult or adult Pardosa saltans to provide predator cues and mixed dwarf spiders or small (juvenile P. saltans to provide prey cues. Subadult wolf spiders were significantly attracted to litter contaminated by dwarf spiders or small conspecifics after 6 hours but no longer after 24 hours. In contrast, neither dwarf spiders nor small P. saltans showed significant avoidance of substrate contaminated by adult P. saltans. However, small P. saltans showed different activity patterns on the two substrates. The results indicate that wolf spiders are able to increase the efficiency of foraging by searching preferentially in patches with the presence of intraguild prey. The lack of a clear patch selection response of the prey in spite of a modified activity pattern may possibly be associated with the vertical stratification of the beech litter habitat: the reduced volume of spaces in the deeper layers could make downward rather than horizontal movement a fast and safe tactic against a large predator that cannot enter these spaces.

Nanofibre production in spiders without electric charge.

Science.gov (United States)

Joel, Anna-Christin; Baumgartner, Werner

2017-06-15

Technical nanofibre production is linked to high voltage, because nanofibres are typically produced by electrospinning. In contrast, spiders have evolved a way to produce nanofibres without high voltage. These spiders are called cribellate spiders and produce nanofibres within their capture thread production. It is suggested that their nanofibres become frictionally charged when brushed over a continuous area on the calamistrum, a comb-like structure at the metatarsus of the fourth leg. Although there are indications that electrostatic charges are involved in the formation of the thread structure, final proof is missing. We proposed three requirements to validate this hypothesis: (1) the removal of any charge during or after thread production has an influence on the structure of the thread; (2) the characteristic structure of the thread can be regenerated by charging; and (3) the thread is attracted to or repelled from differently charged objects. None of these three requirements were proven true. Furthermore, mathematical calculations reveal that even at low charges, the calculated structural assembly of the thread does not match the observed reality. Electrostatic forces are therefore not involved in the production of cribellate capture threads. © 2017. Published by The Company of Biologists Ltd.

Multiple origins of subsociality in crab spiders (Thomisidae).

Science.gov (United States)

Ruch, Jasmin; Riehl, Torben; May-Collado, Laura J; Agnarsson, Ingi

2015-01-01

Determining factors that facilitate the transition from a solitary to a social lifestyle is a major challenge in evolutionary biology, especially in taxa that are usually aggressive towards conspecifics. Most spiders live solitarily and few species are known to be social. Nevertheless, sociality has evolved multiple times across several families and nearly all studied social lineages have originated from a periodically social (subsocial) ancestor. Group-living crab spiders (Thomisidae) are exclusively found in Australia and differ from most other social spiders because they lack a communal capture web. Three of the group-living species were placed in the genus Diaea and another in the genus Xysticus. Most Australian thomisids are, however, difficult to identify as most descriptions are old and of poor quality, and the genera Diaea and Xysticus may not correspond to monophyletic groups. Here, we clarify the phylogenetic relationships of the four group-living Australian thomisids and conclude that amongst these subsociality has evolved two to three times independently. The subsocial Xysticus bimaculatus is not closely related to any of the social Diaea and an independent origin of subsociality is likely in this case. The presented data indicates that within Diaea two origins of subsociality are possible. Our results help to understand the evolution of sociality in thomisids and support the hypothesis that permanent sociality in spiders has evolved multiple times relatively recently from subsocial ancestors. Copyright © 2014 Elsevier Inc. All rights reserved.

The embryonic origin of the ampullate silk glands of the spider Cupiennius salei.

Science.gov (United States)

Hilbrant, Maarten; Damen, Wim G M

2015-05-01

Silk production in spiders is considered a key innovation, and to have been vital for the diversification of the clade. The evolutionary origin of the organs involved in spider silk production, however, and in particular of the silk glands, is poorly understood. Homologies have been proposed between these and other glands found in arachnids, but lacking knowledge of the embryonic development of spider silk glands hampers an evaluation of hypotheses. This study focuses on the embryonic origin of the largest silk glands of the spider Cupiennius salei, the major and minor ampullate glands. We show how the ampullate glands originate from ectodermal invaginations on the embryonic spinneret limb buds, in relation to morphogenesis of these buds. Moreover, we visualize the subsequent growth of the ampullate glands in sections of the early postembryonic stages. The invaginations are shown to correlate with expression of the proneural gene CsASH2, which is remarkable since it has been proposed that spider silk glands and their nozzles originate from sensory bristles. Hence, by confirming the ectodermal origin of spider silk glands, and by describing the (post-)embryonic morphogenesis of the ampullate glands, this work provides a starting point for further investigating into the genetic program that underlies their development. Copyright © 2015 Elsevier Ltd. All rights reserved.

Emotional intelligence and psychological health in a sample of Kuwaiti college students.

Science.gov (United States)

Alkhadher, Othman

2007-06-01

This summary investigated correlations between emotional intelligence and psychological health amongst 191 Kuwaiti undergraduate students in psychology, 98 men and 93 women (M age=20.6 yr., SD=2.8). There were two measures of emotional intelligence, one based on the ability model, the Arabic Test for Emotional Intelligence, and the other on the mixed model, the Emotional Intelligence Questionnaire. Participants' psychological health was assessed using scales from the Personality Assessment Inventory. A weak relationship between the two types of emotional intelligence was found. A correlation for scores on the Emotional Intelligence Questionnaire with the Personality Assessment Inventory was found but not with those of the Arabic Test for Emotional Intelligence. Regression analysis indicated scores on Managing Emotions and Self-awareness accounted for most of the variance in the association with the Personality Assessment Inventory. Significant sex differences were found only on the Arabic Test for Emotional Intelligence; women scored higher than men. On Emotional Intelligence Questionnaire measures, men had significantly higher means on Managing Emotions and Self-motivation. However, no significant differences were found between the sexes on the Total Emotional Intelligence Questionnaire scores.

Whiteflies interfere with indirect plant defense against spider mites in Lima bean

Science.gov (United States)

Zhang, Peng-Jun; Zheng, Si-Jun; van Loon, Joop J. A.; Boland, Wilhelm; David, Anja; Mumm, Roland; Dicke, Marcel

2009-01-01

Plants under herbivore attack are able to initiate indirect defense by synthesizing and releasing complex blends of volatiles that attract natural enemies of the herbivore. However, little is known about how plants respond to infestation by multiple herbivores, particularly if these belong to different feeding guilds. Here, we report the interference by a phloem-feeding insect, the whitefly Bemisia tabaci, with indirect plant defenses induced by spider mites (Tetranychus urticae) in Lima bean (Phaseolus lunatus) plants. Additional whitefly infestation of spider-mite infested plants resulted in a reduced attraction of predatory mites (Phytoseiulus persimilis) compared to attraction to plants infested by spider mites only. This interference is shown to result from the reduction in (E)-β-ocimene emission from plants infested by both spider mites and whiteflies. When using exogenous salicylic acid (SA) application to mimic B. tabaci infestation, we observed similar results in behavioral and chemical analyses. Phytohormone and gene-expression analyses revealed that B. tabaci infestation, as well as SA application, inhibited spider mite-induced jasmonic acid (JA) production and reduced the expression of two JA-regulated genes, one of which encodes for the P. lunatus enzyme β-ocimene synthase that catalyzes the synthesis of (E)-β-ocimene. Remarkably, B. tabaci infestation concurrently inhibited SA production induced by spider mites. We therefore conclude that in dual-infested Lima bean plants the suppression of the JA signaling pathway by whitefly feeding is not due to enhanced SA levels. PMID:19965373

Progress on development of SPIDER diagnostics

Science.gov (United States)

Pasqualotto, R.; Agostini, M.; Barbisan, M.; Bernardi, M.; Brombin, M.; Cavazzana, R.; Croci, G.; Palma, M. Dalla; Delogu, R. S.; Gorini, G.; Lotto, L.; Muraro, A.; Peruzzo, S.; Pimazzoni, A.; Pomaro, N.; Rizzolo, A.; Serianni, G.; Spolaore, M.; Tardocchi, M.; Zaniol, B.; Zaupa, M.

2017-08-01

SPIDER experiment, the full size prototype of the beam source for the ITER heating neutral beam injector, has to demonstrate extraction and acceleration to 100 kV of a large negative ion hydrogen or deuterium beam with co-extracted electron fraction e-/D- SPIDER plant systems are being installed, the different diagnostic systems are in the procurement phase. Their final design is described here with a focus on some key solutions and most original and cost effective implementations. Thermocouples used to measure the power load distribution in the source and over the beam dump front surface will be efficiently fixed with proven technique and acquired through commercial and custom electronics. Spectroscopy needs to use well collimated lines of sight and will employ novel design spectrometers with higher efficiency and resolution and filtered detectors with custom built amplifiers. The electrostatic probes will be operated through electronics specifically developed to cope with the challenging environment of the RF source. The instrumented calorimeter STRIKE will use new CFC tiles, still under development. Two linear cameras, one built in house, have been tested as suitable for optical beam tomography. Some diagnostic components are off the shelf, others are custom developed: some of these are being prototyped or are under test before final production and installation, which will be completed before start of SPIDER operation.

Synthetic Adhesive Attachment Discs based on Spider Pyriform Silk Architecture

Science.gov (United States)

Jain, Dharamdeep; Sahni, Vasav; Dhinojwala, Ali

2014-03-01

Among the variety of silks produced by spiders, pyriform silk is used in conjunction with the dragline silk to attach webs to different surfaces. Cob weaver spiders employ different architectural patterns to utilize the pyriform silk and form attachment joints with each pattern having a characteristic adhesive performance. The staple pin architecture is a one of the strongest attachment designs employed by spiders to attach their webs. Here we use a synthetic approach to create the a similar patterned architecture attachment discs on aluminum substrate using thermoplastic polyurethane. Measurable pull off forces are generated when the synthetic discs are peeled off a surface. This innovative adhesive strategy can be a source of design in various biomedical applications. Financial Support from National Science Foundation.

Spider Silk Fibers Spun from Soluble Recombinant Silk Produced in Mammalian Cells

Science.gov (United States)

Lazaris, Anthoula; Arcidiacono, Steven; Huang, Yue; Zhou, Jiang-Feng; Duguay, François; Chretien, Nathalie; Welsh, Elizabeth A.; Soares, Jason W.; Karatzas, Costas N.

2002-01-01

Spider silks are protein-based ``biopolymer'' filaments or threads secreted by specialized epithelial cells as concentrated soluble precursors of highly repetitive primary sequences. Spider dragline silk is a flexible, lightweight fiber of extraordinary strength and toughness comparable to that of synthetic high-performance fibers. We sought to ``biomimic'' the process of spider silk production by expressing in mammalian cells the dragline silk genes (ADF-3/MaSpII and MaSpI) of two spider species. We produced soluble recombinant (rc)-dragline silk proteins with molecular masses of 60 to 140 kilodaltons. We demonstrated the wet spinning of silk monofilaments spun from a concentrated aqueous solution of soluble rc-spider silk protein (ADF-3; 60 kilodaltons) under modest shear and coagulation conditions. The spun fibers were water insoluble with a fine diameter (10 to 40 micrometers) and exhibited toughness and modulus values comparable to those of native dragline silks but with lower tenacity. Dope solutions with rc-silk protein concentrations >20% and postspinning draw were necessary to achieve improved mechanical properties of the spun fibers. Fiber properties correlated with finer fiber diameter and increased birefringence.

Reversing the mere exposure effect in spider fearfuls: Preliminary evidence of sensitization.

Science.gov (United States)

Becker, Eni S; Rinck, Mike

2016-12-01

A mere exposure effect (MEE) is said to occur when individuals' liking of a suboptimally and repeatedly presented stimulus increases compared to never-presented stimuli, while they are unable to indicate which stimuli were previously presented and which were not. In two experiments, we used the MEE to study automatic evaluative processes in highly spider-fearful individuals (SFs). Pictures of spiders and butterflies were repeatedly presented suboptimally to SFs and to non-anxious controls (NACs). In Experiment 1, both groups showed the MEE for butterflies, preferring previously presented butterfly pictures over new ones. For spider pictures, only NACs showed an MEE, whereas SFs showed no preference. Experiment 2 involved a more unpleasant presentation situation, because for each picture, participants had the difficult task to indicate what had been presented to them. This led to a reversed MEE for spiders in SFs: They preferred new spider pictures over previously presented ones. In both experiments, no evidence was observed for the ability to differentiate between old an new pictures. The results are tentatively explained within Zajonc' theory of the MEE, and they are related to the concept of sensitization in anxiety disorders. Copyright © 2016 Elsevier B.V. All rights reserved.

Perceived intelligence is associated with measured intelligence in men but not women.

Science.gov (United States)

Kleisner, Karel; Chvátalová, Veronika; Flegr, Jaroslav

2014-01-01

The ability to accurately assess the intelligence of other persons finds its place in everyday social interaction and should have important evolutionary consequences. We used static facial photographs of 40 men and 40 women to test the relationship between measured IQ, perceived intelligence, and facial shape. Both men and women were able to accurately evaluate the intelligence of men by viewing facial photographs. In addition to general intelligence, figural and fluid intelligence showed a significant relationship with perceived intelligence, but again, only in men. No relationship between perceived intelligence and IQ was found for women. We used geometric morphometrics to determine which facial traits are associated with the perception of intelligence, as well as with intelligence as measured by IQ testing. Faces that are perceived as highly intelligent are rather prolonged with a broader distance between the eyes, a larger nose, a slight upturn to the corners of the mouth, and a sharper, pointing, less rounded chin. By contrast, the perception of lower intelligence is associated with broader, more rounded faces with eyes closer to each other, a shorter nose, declining corners of the mouth, and a rounded and massive chin. By contrast, we found no correlation between morphological traits and real intelligence measured with IQ test, either in men or women. These results suggest that a perceiver can accurately gauge the real intelligence of men, but not women, by viewing their faces in photographs; however, this estimation is possibly not based on facial shape. Our study revealed no relation between intelligence and either attractiveness or face shape.

Hg-contaminated terrestrial spiders pose a potential risk to songbirds at Caddo Lake (Texas/Louisiana, USA).

Science.gov (United States)

Gann, Gretchen L; Powell, Cleveland H; Chumchal, Matthew M; Drenner, Ray W

2015-02-01

Methylmercury (MeHg) is an environmental contaminant that can have adverse effects on wildlife. Because MeHg is produced by bacteria in aquatic ecosystems, studies of MeHg contamination of food webs historically have focused on aquatic organisms. However, recent studies have shown that terrestrial organisms such as songbirds can be contaminated with MeHg by feeding on MeHg-contaminated spiders. In the present study, the authors examined the risk that MeHg-contaminated terrestrial long-jawed orb weaver spiders (Tetragnatha sp.) pose to songbirds at Caddo Lake (Texas/Louisiana, USA). Methylmercury concentrations in spiders were significantly different in river, wetland, and open-water habitats. The authors calculated spider-based wildlife values (the minimum spider MeHg concentrations causing physiologically significant doses in consumers) to assess exposure risks for arachnivorous birds. Methylmercury concentrations in spiders exceeded wildlife values for Carolina chickadee (Poecile carolinensis) nestlings, with the highest risk in the river habitat. The present study indicates that MeHg concentrations in terrestrial spiders vary with habitat and can pose a threat to small-bodied nestling birds that consume large amounts of spiders at Caddo Lake. This MeHg threat to songbirds may not be unique to Caddo Lake and may extend throughout the southeastern United States. © 2014 SETAC.

Untangling spider silk evolution with spidroin terminal domains

Directory of Open Access Journals (Sweden)

Garb Jessica E

2010-08-01

Full Text Available Abstract Background Spidroins are a unique family of large, structural proteins that make up the bulk of spider silk fibers. Due to the highly variable nature of their repetitive sequences, spidroin evolutionary relationships have principally been determined from their non-repetitive carboxy (C-terminal domains, though they offer limited character data. The few known spidroin amino (N-terminal domains have been difficult to obtain, but potentially contain critical phylogenetic information for reconstructing the diversification of spider silks. Here we used silk gland expression data (ESTs from highly divergent species to evaluate the functional significance and phylogenetic utility of spidroin N-terminal domains. Results We report 11 additional spidroin N-termini found by sequencing ~1,900 silk gland cDNAs from nine spider species that shared a common ancestor > 240 million years ago. In contrast to their hyper-variable repetitive regions, spidroin N-terminal domains have retained striking similarities in sequence identity, predicted secondary structure, and hydrophobicity. Through separate and combined phylogenetic analyses of N-terminal domains and their corresponding C-termini, we find that combined analysis produces the most resolved trees and that N-termini contribute more support and less conflict than the C-termini. These analyses show that paralogs largely group by silk gland type, except for the major ampullate spidroins. Moreover, spidroin structural motifs associated with superior tensile strength arose early in the history of this gene family, whereas a motif conferring greater extensibility convergently evolved in two distantly related paralogs. Conclusions A non-repetitive N-terminal domain appears to be a universal attribute of spidroin proteins, likely retained from the origin of spider silk production. Since this time, spidroin N-termini have maintained several features, consistent with this domain playing a key role in silk

Biased interpretation and memory in children with varying levels of spider fear

NARCIS (Netherlands)

Klein, A.M.; Titulaer, G.; Simons, C.; Allart, E.; de Gier, E.; Bögels, S.M.; Becker, E.S.; Rinck, M.

2014-01-01

This study investigated multiple cognitive biases in children simultaneously, to investigate whether spider-fearful children display an interpretation bias, a recall bias, and source monitoring errors, and whether these biases are specific for spider-related materials. Furthermore, the independent

 “Spiders and Webs in American Literature”

Directory of Open Access Journals (Sweden)

Vincent Dussol

2012-05-01

Full Text Available From Jonathan Edwards to Jorie Graham, spiders are strikingly present in American literature. The purpose of this article is first to show how that theme may have become something of a national tradition as very different writers, all of them careful observers of aranae, answered one another through the years. It is very likely that the attention paid to spiders by American authors was increased by those Native American myths in which spiders are a central figure. More than occasionally, on the female side of the American counter-culture, especially among its feminist and lesbian exponents, simple activists and creative writers have harnessed the symbolic power invested in the spider by Native Americans.There may be deeper reasons accounting for American authors’ fascination with spiders. The country’s phobia of disunion is one; a nation of settlers’ acute consciousness of the precariousness of its occupation of the territory is another. In demonstrating outstanding skills for adjustment to unknown places, spiders epitomize a form of identity permanence. The predominantly positive character of spider symbols in American literature will occasionally be inverted. Following the national logic of checks and balances, any web covering the whole of the United States will tend to come under suspicion.This study ends with an inventory of cultural productions linked with spiders and webs and whose Americanness is yet to be clearly determined.De Jonathan Edwards à Jorie Graham, l’araignée apparaît dans un nombre frappant de textes littéraires américains. On a d’abord voulu tenter de montrer comment a pu se construire cette tradition thématique et faire la preuve que différents écrivains, réunis par un souci de l’observation, se sont répondus à travers elle. L’attention prêtée à l’araignée s’est certainement trouvée renforcée par les récits mythologiques des peuples premiers américains qui font de l’araignée une

Structure to function: Spider silk and human collagen

Science.gov (United States)

Rabotyagova, Olena S.

Nature has the ability to assemble a variety of simple molecules into complex functional structures with diverse properties. Collagens, silks and muscles fibers are some examples of fibrous proteins with self-assembling properties. One of the great challenges facing Science is to mimic these designs in Nature to find a way to construct molecules that are capable of organizing into functional supra-structures by self-assembly. In order to do so, a construction kit consisting of molecular building blocks along with a complete understanding on how to form functional materials is required. In this current research, the focus is on spider silk and collagen as fibrous protein-based biopolymers that can shed light on how to generate nanostructures through the complex process of self-assembly. Spider silk in fiber form offers a unique combination of high elasticity, toughness, and mechanical strength, along with biological compatibility and biodegrability. Spider silk is an example of a natural block copolymer, in which hydrophobic and hydrophilic blocks are linked together generating polymers that organize into functional materials with extraordinary properties. Since silks resemble synthetic block copolymer systems, we adopted the principles of block copolymer design from the synthetic polymer literature to build block copolymers based on spider silk sequences. Moreover, we consider spider silk to be an important model with which to study the relationships between structure and properties in our system. Thus, the first part of this work was dedicated to a novel family of spider silk block copolymers, where we generated a new family of functional spider silk-like block copolymers through recombinant DNA technology. To provide fundamental insight into relationships between peptide primary sequence, block composition, and block length and observed morphological and structural features, we used these bioengineered spider silk block copolymers to study secondary structure

An Intelligent System Prototype to support and sharing diagnoses of maligned tumours, based on personalized medicine philosophy

Directory of Open Access Journals (Sweden)

Víctor Manuel Flores Fonseca

2016-12-01

Full Text Available Circulatory systems diseases are one of the most important causes of death in Chilean population according to a report presented by the Chilean National Bureau of Statistics (INE. Undoubtedly, these sad numbers arise an opportunity to analyse ways to improve this situation. Personalized Medicine is a new approach used to adapt standard medical treatments to individual characteristics of patients. Currently, several kinds of personalized-medicine software applications are building using Artificial Intelligent techniques and supported by techniques as Cloud Computing and Big Data. This architecture provides complex and varied information access, such as clinical data, genome data, patients’ treatment or drugs information, among others. This document describes a proposal to produce a method for generating and sharing medical information, particularly of maligned tumors in Chile. The prototype will be developed within the framework of the personalized medicine.

Biomimetic Spider Leg Joints: A Review from Biomechanical Research to Compliant Robotic Actuators

Directory of Open Access Journals (Sweden)

Stefan Landkammer

2016-07-01

Full Text Available Due to their inherent compliance, soft actuated joints are becoming increasingly important for robotic applications, especially when human-robot-interactions are expected. Several of these flexible actuators are inspired by biological models. One perfect showpiece for biomimetic robots is the spider leg, because it combines lightweight design and graceful movements with powerful and dynamic actuation. Building on this motivation, the review article focuses on compliant robotic joints inspired by the function principle of the spider leg. The mechanism is introduced by an overview of existing biological and biomechanical research. Thereupon a classification of robots that are bio-inspired by spider joints is presented. Based on this, the biomimetic robot applications referring to the spider principle are identified and discussed.

Contamination vs. harm-relevant outcome expectancies and covariation bias in spider phobia

NARCIS (Netherlands)

de Jong, Peter J.; Peters, Madelon L.

There is increasing evidence that spiders are not feared because of harmful outcome expectancies but because of disgust and contamination-relevant outcome expectancies. This study investigated the relative strength of contamination- and harm-relevant UCS expectancies and covariation bias in spider

Do Depressive Traits and Hostility Predict Age-Related Decline in General Intelligence?

Directory of Open Access Journals (Sweden)

Erik Lykke Mortensen

2012-01-01

Full Text Available Certain personality traits are likely to be associated with stress and distress through the lifespan, and as a consequence these traits may influence the rate of age-related cognitive decline. The present study uses data from the Glostrup 1914 cohort to analyze potential effects of personality on decline in general intelligence over a 30-year period. The Minnesota Multiphasic Personality Inventory was administered at a 50-year baseline exam, and from this inventory the Obvious Depression Scale and an abbreviated version of the Cook-Medley Hostility Scale were derived. At the 50-year baseline and at the 60-, 70-, and 80-year followups the full version of Wechsler's Adult Intelligence Scale (WAIS was administered to 673, 513, 136, and 184 participants. Mixed effects statistical models were used to evaluate both the effect of the personality scores on level of intelligence and the interaction between the personality scores and the time since followup. Analyses were adjusted for demographic background and a wide range of lifestyle factors. Both obvious depression and hostility were negatively associated with level of intelligence, but personality scores did not influence rate of decline in general intelligence.

Thin Film Assembly of Spider Silk-like Block Copolymers

Science.gov (United States)

2011-01-01

Shipley, N. H.; Lewis, R. V. Int. J. Biol.Macromol. 1999, 24, 271. (c) Thiel, B. L.; Guess, K. B.; Viney, C. Biopolymers 1997, 41, 703. (13) Silk ...Film Assembly of Spider Silk -like Block Copolymers Sreevidhya T. Krishnaji,†,‡ Wenwen Huang,§ Olena Rabotyagova,†,‡ Eugenia Kharlampieva, ) Ikjun Choi...Received November 26, 2010 We report the self-assembly of monolayers of spider silk -like block copolymers. Langmuir isotherms were obtained for a series of

The eunuch phenomenon: adaptive evolution of genital emasculation in sexually dimorphic spiders.

Science.gov (United States)

Kuntner, Matjaž; Agnarsson, Ingi; Li, Daiqin

2015-02-01

Under natural and sexual selection traits often evolve that secure paternity or maternity through self-sacrifice to predators, rivals, offspring, or partners. Emasculation-males removing their genitals-is an unusual example of such behaviours. Known only in insects and spiders, the phenomenon's adaptiveness is difficult to explain, yet its repeated origins and association with sexual size dimorphism (SSD) and sexual cannibalism suggest an adaptive significance. In spiders, emasculation of paired male sperm-transferring organs - secondary genitals - (hereafter, palps), results in 'eunuchs'. This behaviour has been hypothesized to be adaptive because (i) males plug female genitals with their severed palps (plugging hypothesis), (ii) males remove their palps to become better fighters in male-male contests (better-fighter hypothesis), perhaps reaching higher agility due to reduced total body mass (gloves-off hypothesis), and (iii) males achieve prolonged sperm transfer through severed genitals (remote-copulation hypothesis). Prior research has provided evidence in support of these hypotheses in some orb-weaving spiders but these explanations are far from general. Seeking broad macroevolutionary patterns of spider emasculation, we review the known occurrences, weigh the evidence in support of the hypotheses in each known case, and redefine more precisely the particular cases of emasculation depending on its timing in relation to maturation and mating: 'pre-maturation', 'mating', and 'post-mating'. We use a genus-level spider phylogeny to explore emasculation evolution and to investigate potential evolutionary linkage between emasculation, SSD, lesser genital damage (embolic breakage), and sexual cannibalism (females consuming their mates). We find a complex pattern of spider emasculation evolution, all cases confined to Araneoidea: emasculation evolved at least five and up to 11 times, was lost at least four times, and became further modified at least once. We also find

SPiDer: Smart Pill Dispenser

OpenAIRE

Moreno Vázquez, Jonatan

2013-01-01

Aquest projecte proposa el sistema SPiDer el qual te l'objectiu d'assistir a la gent gran en el procés de medicar-se evitant els problemes associats amb la baixa adherència existent actualment amb els calendaris farmacològics receptats pels doctors.

FORECAST - A cloud-based personalized intelligent virtual coaching platform for the well-being of cancer patients.

Science.gov (United States)

Kyriazakos, Sofoklis; Valentini, Vincenzo; Cesario, Alfredo; Zachariae, Robert

2018-01-01

Well-being of cancer patients and survivors is a challenge worldwide, considering the often chronic nature of the disease. Today, a large number of initiatives, products and services are available that aim to provide strategies to face the challenge of well-being in cancer patients; nevertheless the proposed solutions are often non-sustainable, costly, unavailable to those in need, and less well-received by patients. These challenges were considered in designing FORECAST, a cloud-based personalized intelligent virtual coaching platform for improving the well-being of cancer patients. Personalized coaching for cancer patients focuses on physical, mental, and emotional concerns, which FORECAST is able to identify. Cancer patients can benefit from coaching that addresses their emotional problems, helps them focus on their goals, and supports them in coping with their disease-related stressors. Personalized coaching in FORECAST offers support, encouragement, motivation, confidence, and hope and is a valuable tool for the wellbeing of a patient.

Brown Spider (Loxosceles genus Venom Toxins: Tools for Biological Purposes

Directory of Open Access Journals (Sweden)

Andrea Senff-Ribeiro

2011-03-01

Full Text Available Venomous animals use their venoms as tools for defense or predation. These venoms are complex mixtures, mainly enriched of proteic toxins or peptides with several, and different, biological activities. In general, spider venom is rich in biologically active molecules that are useful in experimental protocols for pharmacology, biochemistry, cell biology and immunology, as well as putative tools for biotechnology and industries. Spider venoms have recently garnered much attention from several research groups worldwide. Brown spider (Loxosceles genus venom is enriched in low molecular mass proteins (5–40 kDa. Although their venom is produced in minute volumes (a few microliters, and contain only tens of micrograms of protein, the use of techniques based on molecular biology and proteomic analysis has afforded rational projects in the area and permitted the discovery and identification of a great number of novel toxins. The brown spider phospholipase-D family is undoubtedly the most investigated and characterized, although other important toxins, such as low molecular mass insecticidal peptides, metalloproteases and hyaluronidases have also been identified and featured in literature. The molecular pathways of the action of these toxins have been reported and brought new insights in the field of biotechnology. Herein, we shall see how recent reports describing discoveries in the area of brown spider venom have expanded biotechnological uses of molecules identified in these venoms, with special emphasis on the construction of a cDNA library for venom glands, transcriptome analysis, proteomic projects, recombinant expression of different proteic toxins, and finally structural descriptions based on crystallography of toxins.

Intelligence and musical mode preference

DEFF Research Database (Denmark)

Bonetti, Leonardo; Costa, Marco

2016-01-01

The relationship between fluid intelligence and preference for major–minor musical mode was investigated in a sample of 80 university students. Intelligence was assessed by the Raven’s Advanced Progressive Matrices. Musical mode preference was assessed by presenting 14 pairs of musical stimuli...... differences at the cognitive and personality level related to the enjoyment of sad music....

Architecture of SPIDER control and data acquisition system

International Nuclear Information System (INIS)

Luchetta, A.; Manduchi, G.; Taliercio, C.; Soppelsa, A.; Barbalace, A.; Paolucci, F.; Sartori, F.; Barbato, P.; Breda, M.; Capobianco, R.; Molon, F.; Moressa, M.; Polato, S.; Simionato, P.; Zampiva, E.

2012-01-01

The ITER Heating Neutral Beam injectors will be implemented in three steps: development of the ion source prototype, development of the full injector prototype, and, finally, construction of up to three ITER injectors. The first two steps will be carried out in the ITER neutral beam test facility under construction in Italy. The ion source prototype, referred to as SPIDER, which is currently in the development phase, is a complex experiment involving more than 20 plant units and operating with beam-on pulses lasting up to 1 h. As for control and data acquisition it requires fast and slow control (cycle time around 0.1 ms and 10 ms, respectively), synchronization (10 ns resolution), and data acquisition for about 1000 channels (analogue and images) with sampling frequencies up to tens of MS/s, data throughput up to 200 MB/s, and data storage volume of up to tens of TB/year. The paper describes the architecture of the SPIDER control and data acquisition system, discussing the SPIDER requirements and the ITER CODAC interfaces and specifications for plant system instrumentation and control.

Development of intelligent model for personalized guidance on wheelchair tilt and recline usage for people with spinal cord injury: methodology and preliminary report.

Science.gov (United States)

Fu, Jicheng; Jones, Maria; Jan, Yih-Kuen

2014-01-01

Wheelchair tilt and recline functions are two of the most desirable features for relieving seating pressure to decrease the risk of pressure ulcers. The effective guidance on wheelchair tilt and recline usage is therefore critical to pressure ulcer prevention. The aim of this study was to demonstrate the feasibility of using machine learning techniques to construct an intelligent model to provide personalized guidance to individuals with spinal cord injury (SCI). The motivation stems from the clinical evidence that the requirements of individuals vary greatly and that no universal guidance on tilt and recline usage could possibly satisfy all individuals with SCI. We explored all aspects involved in constructing the intelligent model and proposed approaches tailored to suit the characteristics of this preliminary study, such as the way of modeling research participants, using machine learning techniques to construct the intelligent model, and evaluating the performance of the intelligent model. We further improved the intelligent model's prediction accuracy by developing a two-phase feature selection algorithm to identify important attributes. Experimental results demonstrated that our approaches held the promise: they could effectively construct the intelligent model, evaluate its performance, and refine the participant model so that the intelligent model's prediction accuracy was significantly improved.

Rhesus factor modulation of effects of smoking and age on psychomotor performance, intelligence, personality profile, and health in Czech soldiers.

Directory of Open Access Journals (Sweden)

Jaroslav Flegr

Full Text Available BACKGROUND: Rhesus-positive and rhesus-negative persons differ in the presence-absence of highly immunogenic RhD protein on the erythrocyte membrane. This protein is a component of NH(3 or CO(2 pump whose physiological role is unknown. Several recent studies have shown that RhD positivity protects against effects of latent toxoplasmosis on motor performance and personality. It is not known, however, whether the RhD phenotype modifies exclusively the response of the body to toxoplasmosis or whether it also influences effects of other factors. METHODOLOGY/PRINCIPAL FINDINGS: In the present cohort study, we searched for the effects of age and smoking on performance, intelligence, personality and self-estimated health and wellness in about 3800 draftees. We found that the positive effect of age on performance and intelligence was stronger in RhD-positive soldiers, while the negative effect of smoking on performance and intelligence was of similar size regardless of the RhD phenotype. The effect of age on four Cattell's personality factors, i.e., dominance (E, radicalism (Q(1, self-sentiment integration (Q(3, and ergic tension (Q(4, and on Cloninger's factor reward dependency (RD was stronger for RhD-negative than RhD-positive subjects, while the effect of smoking on the number of viral and bacterial diseases was about three times stronger for RhD-negative than RhD-positive subjects. CONCLUSIONS: RhD phenotype modulates the influence not only of latent toxoplasmosis, but also of at least two other potentially detrimental factors, age and smoking, on human behavior and physiology. The negative effect of smoking on health (estimated on the basis of the self-rated number of common viral and bacterial diseases in the past year was much stronger in RhD-negative than RhD-positive subjects. It is critically needed to confirm the differences in health response to smoking between RhD-positive and RhD-negative subjects by objective medical examination in

Social makes smart: rearing conditions affect learning and social behaviour in jumping spiders.

Science.gov (United States)

Liedtke, J; Schneider, J M

2017-11-01

There is a long-standing debate as to whether social or physical environmental aspects drive the evolution and development of cognitive abilities. Surprisingly few studies make use of developmental plasticity to compare the effects of these two domains during development on behaviour later in life. Here, we present rearing effects on the development of learning abilities and social behaviour in the jumping spider Marpissa muscosa. These spiders are ideally suited for this purpose because they possess the ability to learn and can be reared in groups but also in isolation without added stress. This is a critical but rarely met requirement for experimentally varying the social environment to test its impact on cognition. We split broods of spiders and reared them either in a physically or in a socially enriched environment. A third group kept under completely deprived conditions served as a 'no-enrichment' control. We tested the spiders' learning abilities by using a modified T-maze. Social behaviour was investigated by confronting spiders with their own mirror image. Results show that spiders reared in groups outperform their conspecifics from the control, i.e. 'no-enrichment', group in both tasks. Physical enrichment did not lead to such an increased performance. We therefore tentatively suggest that growing up in contact with conspecifics induces the development of cognitive abilities in this species.

Spider fauna of semi-dry grasslands on a military training base in Northwest Germany (Münster

Directory of Open Access Journals (Sweden)

Buchholz, Sascha

2008-07-01

Full Text Available The spider fauna of semi-dry grasslands on the military training area of Dorbaum near Münster (North Rhine-Westphalia was investigated. From 2002 to 2003 a total of 11,194 mature spiders from 141 species and 20 families was caught by pitfall trapping and hand sampling. Among them are 18 species listed in the Red Data Book of North Rhine-Westphalia, four species are rare or previously rarely recorded. Most of the spiders are habitat generalists that extend their occurrence into all types of habitats, while the number of species which are stenotopic to sand habitats is noticeably low (n = 13. The spider data were analysed with Principal Component Analysis (PCA. It is possible to distinguish spider communities of neighbouring forested habitats from species groups of open habitats, but there is no uniform spider community which is characteristic for semi-dry grassland.

The sejugal furrow in camel spiders and acariform mites

Directory of Open Access Journals (Sweden)

Dunlop, Jason A.

2012-07-01

Full Text Available Camel spiders (Arachnida: Solifugae are one of the arachnid groups characterised by a prosomal dorsal shield composed of three distinct elements: the pro-, meso- and metapeltidium. These are associated respectively with prosomal appendages one to four, five, and six. What is less well known, although noted in the historical literature, is that the coxae of the 4th and 5th prosomal segments (i.e. walking legs 2 and 3 of camel spiders are also separated ventrally by a distinct membranous region, which is absent between the coxae of the other legs. We suggest that this essentially ventral division of the prosoma specifically between coxae 2 and 3 is homologous with the so-called sejugal furrow (the sejugal interval sensu van der Hammen. This division constitutes a fundamental part of the body plan in acariform mites (Arachnida: Acariformes. If homologous, this sejugal furrow could represent a further potential synapomorphy for (Solifugae + Acariformes; a relationship with increasing morphological and molecular support. Alternatively, outgroup comparison with sea spiders (Pycnogonida and certain early Palaeozoic fossils could imply that the sejugal furrow defines an older tagma, derived from a more basal grade of organisation. In this scenario the (still divided prosoma of acariform mites and camel spiders would be plesiomorphic. This interpretation challenges the textbook arachnid character of a peltidium (or ‘carapace’ covering an undivided prosoma.

Influence of Imidacloprid and Horticultural Oil on Spider Abundance on Eastern Hemlock in the Southern Appalachians.

Science.gov (United States)

Hakeem, A; Grant, J F; Lambdin, P L; Hale, F A; Rhea, J R; Wiggins, G J; Coots, C

2018-05-08

Hemlock woolly adelgid, Adelges tsugae Annand (Hemiptera: Adelgidae), is an exotic pest of eastern hemlock, Tsuga canadensis (L.) Carrière (Pinales: Pinaceae), in the eastern United States. Two commonly used insecticides to manage adelgid are imidacloprid, a systemic neonicotinoid insecticide, and horticultural oil, a refined petroleum oil foliar spray. We have investigated the influence of imidacloprid and horticultural oil on spider abundance at different canopy strata in eastern hemlock. In total, 2,084 spiders representing 11 families were collected from the canopies of eastern hemlock. In beat-sheet and direct observation samples, the families Theridiidae, Araneidae, Salticidae, and Anyphaenidae were the most abundant. Significantly higher numbers of spiders were recorded on untreated control trees compared with trees treated with imidacloprid using soil drench and soil injection applications. Spider abundance in trees injected with imidacloprid and horticultural oil applications did not significantly differ from control trees. Spider abundance was significantly greater in the top and middle strata of the canopy than in the bottom stratum, where imidacloprid concentrations were the highest. Regression analysis showed that spider abundance was inversely associated with imidacloprid concentration. This research demonstrates that imidacloprid, when applied with selected methods, has the potential to result in reductions of spider densities at different strata. However, slight reductions in spider abundance may be an acceptable short-term ecological impact compared with the loss of an untreated hemlock and all the associated ecological benefits that it provides. Future studies should include investigations of long-term impact of imidacloprid on spiders associated with eastern hemlock.

Competition between introduced and native spiders (Araneae: Linyphiidae)

Science.gov (United States)

Houser, J.D.; Ginsberg, Howard S.; Jakob, Elizabeth M.

2014-01-01

The European sheet-web spider Linyphia triangularis (Araneae: Linyphiidae) has become established in Maine, where it often reaches very high densities. Two lines of evidence from previous work suggest that L. triangularis affects populations of the native linyphiid spider Frontinella communis. First, F. communis individuals are relatively scarce in both forest and coastal habitat where L. triangularis is common, but more common where L. triangularis is at low density. Second, in field experiments, F. communis species are less likely to settle in experimental plots when L. triangularis is present, and F. communis disappears from study plots when L. triangularis is introduced. Here we test two mechanisms that may underlie these patterns. First, we tested whether L. triangularis invades and usurps the webs of F. communis. When spiders were released onto webs of heterospecifics, L. triangularis was more likely to take over or share webs of F. communis than the reverse. We also observed natural takeovers of F. communis webs. Second, we explored the hypothesis that L. triangularis reduces prey availability for native species. We sampled flying prey in areas with L. triangularis and those where it had been removed, and found no effect of spider presence on measured prey density. We also found no effect of prey supplementation on web tenacity in F. communis, suggesting that F. communis movements are not highly dependent on prey availability. We conclude that web takeover is likely more important than prey reduction in driving negative effects of L. triangularis on F. communis.

Enhanced discriminative fear learning of phobia-irrelevant stimuli in spider-fearful individuals

Directory of Open Access Journals (Sweden)

Carina eMosig

2014-10-01

Full Text Available Avoidance is considered as a central hallmark of all anxiety disorders. The acquisition and expression of avoidance which leads to the maintenance and exacerbation of pathological fear is closely linked to Pavlovian and operant conditioning processes. Changes in conditionability might represent a key feature of all anxiety disorders but the exact nature of these alterations might vary across different disorders. To date, no information is available on specific changes in conditionability for disorder-irrelevant stimuli in specific phobia (SP. The first aim of this study was to investigate changes in fear acquisition and extinction in spider-fearful individuals as compared to non-fearful participants by using the de novo fear conditioning paradigm. Secondly, we aimed to determine whether differences in the magnitude of context-dependent fear retrieval exist between spider-fearful and non-fearful individuals. Our findings point to an enhanced fear discrimination in spider-fearful individuals as compared to non-fearful individuals at both the physiological and subjective level. The enhanced fear discrimination in spider-fearful individuals was neither mediated by increased state anxiety, depression, nor stress tension. Spider-fearful individuals displayed no changes in extinction learning and/or fear retrieval. Surprisingly, we found no evidence for context-dependent modulation of fear retrieval in either group. Here we provide first evidence that spider-fearful individuals show an enhanced discriminative fear learning of phobia-irrelevant (de novo stimuli. Our findings provide novel insights into the role of fear acquisition and expression for the development and maintenance of maladaptive responses in the course of SP.

Abundant and rare spiders on tree trunks in German forests (Arachnida, Araneae

Directory of Open Access Journals (Sweden)

Blick, Theo

2011-01-01

Full Text Available The spider fauna active on the bark of trees in forests on eight sites in different regions in Germany was investigated. Trunk eclectors at about 2-4 meters height on living trees were used in different regions of Germany (SW Bavaria, Hesse, Brandenburg between 1990 and 2003. In Hesse eclectors were also used on dead beech trees (standing and lying. In this study data, mainly from beech (Fagus sylvatica and spruce (Picea abies, from May to October are compared – whole year samples (including winter are only available from Hesse. A total of 334 spider species were recorded with these bark traps, i.e. about one third of the spider species known from Germany. On average, each of the eight regions yielded 140.5 (± 26.2 species, each single tree 40.5 (± 12.2 species and 502 (± 452 adult spiders per season (i.e. May to Oct.. The 20 most abundant species are listed and characterised in detail. Six of the 20 species were not known to be abundant on bark, three prefer conifers and three beech/broadleaf. Even in winter (December-March there was a remarkably high activity on the trunks. However, only a few species occur exclusively or mainly in winter. Finally, the rarity of some bark spider species is discussed and details (all known records in Germany, phenology of four of them are presented (Clubiona leucaspis, Gongylidiellum edentatum, Kratochviliella bicapitata, Oreonetides quadridentatus. The diversity and importance of the spider fauna on bark in Central Europe is still underestimated.

Perceived emotional intelligence, general intelligence and early professional success: predictive and incremental validity

Directory of Open Access Journals (Sweden)

José-Manuel de Haro

2014-05-01

Full Text Available Although the study of factors affecting career success has shown connections between biographical and other aspects related to ability, knowledge and personality, few studies have examined the relationship between emotional intelligence and professional success at the initial career stage. When these studies were carried out, the results showed significant relationships between the dimensions of emotional intelligence (emotional self-awareness, self-regulation, social awareness or social skills and the level of professional competence. In this paper, we analyze the relationship between perceived emotional intelligence, measured by the Trait Meta-Mood Scale (TMMS-24 questionnaire, general intelligence assessed by the Cattell factor "g" test, scale 3, and extrinsic indicators of career success, in a sample of 130 graduates at the beginning of their careers. Results from hierarchical regression analysis indicate that emotional intelligence makes a specific contribution to the prediction of salary, after controlling the general intelligence effect. The perceived emotional intelligence dimensions of TMMS repair, TMMS attention and sex show a higher correlation and make a greater contribution to professional success than general intelligence. The implications of these results for the development of socio-emotional skills among University graduates are discussed.

Battre sa (super) coulpe : Spider-Man (1962)

OpenAIRE

Tomasovic, Dick

2016-01-01

L’édification est l'une des grandes fonctions traditionnelles de la littérature de jeunesse. Spider-Man, héros populaire s'il en est, s'est révélé bien sûr l'ambassadeur de nombreuses valeurs sociétales américaines (le do it yourself, l'esprit d'entreprise et d'indépendance, la tolérance, la fidélité , la célébration du système éducationnel, la transmission et la solidarité intergénérationnelle, le sens des responsabilités, évidemment, etc.). Spider-Man se bat moins qu'il ne se débat. Il est ...

Silkworms transformed with chimeric silkworm/spider silk genes spin composite silk fibers with improved mechanical properties

Science.gov (United States)

The development of a spider silk manufacturing process is of great interest. piggyBac vectors were used to create transgenic silkworms encoding chimeric silkworm/spider silk proteins. The silk fibers produced by these animals were composite materials that included chimeric silkworm/spider silk prote...

The Role of Silk in the Behaviour and Sociality of Spiders

Directory of Open Access Journals (Sweden)

Bertrand Krafft

2012-01-01

Full Text Available This article describes the links between the production of silk by spiders and their behaviour. Silk allows the spider to change its physical environment, which in turn leads to behavioural changes and impacts in the new environment. The feedback between silk and the animal producer can explain the architecture of spider webs and their adaptation to the environment, by referring only to stereotypic stimulus-response reactions without necessarily resorting to a “representation” by the animal of the structure it builds. Silk can act as a means of protection against environmental stress, a snare for prey, a means of locomotion, and also as support for chemical signals or to act as a vector of vibratory signals. These last two functions have undoubtedly played a key role in spider socialization and explains the phenomena of group cohesion, collective decision making, and the coordination of activities, without resorting to mental “representations” for the overall situation. The bulk of this review describes silk as the chief agent directing the construction of traps, communication, social cohesion, and cooperation amongst its producers.

Personal Ethics in a Corporate World

OpenAIRE

Ronald D. Francis; Anona Armstrong

2014-01-01

This paper addresses the relationship between personal morality and ethical corporate behaviour. The main issue addressed here is the positing of the concept of moral intelligence – the relationship of personal moral stance and corporate behaviour. Just as there is intellectual competence (IQ) and emotional intelligence (EIQ), so too there is moral intelligence. This paper outlines the theoretical and practical basis for the case. Mention is made of confounding issues, such as the stability o...

Perceived Intelligence Is Associated with Measured Intelligence in Men but Not Women

Science.gov (United States)

Kleisner, Karel; Chvátalová, Veronika; Flegr, Jaroslav

2014-01-01

Background The ability to accurately assess the intelligence of other persons finds its place in everyday social interaction and should have important evolutionary consequences. Methodology/Principal Findings We used static facial photographs of 40 men and 40 women to test the relationship between measured IQ, perceived intelligence, and facial shape. Both men and women were able to accurately evaluate the intelligence of men by viewing facial photographs. In addition to general intelligence, figural and fluid intelligence showed a significant relationship with perceived intelligence, but again, only in men. No relationship between perceived intelligence and IQ was found for women. We used geometric morphometrics to determine which facial traits are associated with the perception of intelligence, as well as with intelligence as measured by IQ testing. Faces that are perceived as highly intelligent are rather prolonged with a broader distance between the eyes, a larger nose, a slight upturn to the corners of the mouth, and a sharper, pointing, less rounded chin. By contrast, the perception of lower intelligence is associated with broader, more rounded faces with eyes closer to each other, a shorter nose, declining corners of the mouth, and a rounded and massive chin. By contrast, we found no correlation between morphological traits and real intelligence measured with IQ test, either in men or women. Conclusions These results suggest that a perceiver can accurately gauge the real intelligence of men, but not women, by viewing their faces in photographs; however, this estimation is possibly not based on facial shape. Our study revealed no relation between intelligence and either attractiveness or face shape. PMID:24651120

Active optical sensor assessment of spider mite damage on greenhouse beans and cotton.

Science.gov (United States)

Martin, Daniel E; Latheef, Mohamed A

2018-02-01

The two-spotted spider mite, Tetranychus urticae Koch, is an important pest of cotton in mid-southern USA and causes yield reduction and deprivation in fiber fitness. Cotton and pinto beans grown in the greenhouse were infested with spider mites at the three-leaf and trifoliate stages, respectively. Spider mite damage on cotton and bean canopies expressed as normalized difference vegetation index indicative of changes in plant health was measured for 27 consecutive days. Plant health decreased incrementally for cotton until day 21 when complete destruction occurred. Thereafter, regrowth reversed decline in plant health. On spider mite treated beans, plant vigor plateaued until day 11 when plant health declined incrementally. Results indicate that pinto beans were better suited as a host plant than cotton for rearing T. urticae in the laboratory.

The relation between career anchors, emotional intelligence and ...

African Journals Online (AJOL)

a variety of career preferences, and to commit to attractive career options (Puffer ... evidence of the relationship between people's emotional intelligence and their ...... of competing measures of emotional intelligence', Personality and Social ...

An image filtering technique for SPIDER visible tomography

Energy Technology Data Exchange (ETDEWEB)

Fonnesu, N., E-mail: nicola.fonnesu@igi.cnr.it; Agostini, M.; Brombin, M.; Pasqualotto, R.; Serianni, G. [Consorzio RFX, Associazione EURATOM-ENEA sulla Fusione, Corso Stati Uniti 4, I-35127 Padova (Italy)

2014-02-15

The tomographic diagnostic developed for the beam generated in the SPIDER facility (100 keV, 50 A prototype negative ion source of ITER neutral beam injector) will characterize the two-dimensional particle density distribution of the beam. The simulations described in the paper show that instrumental noise has a large influence on the maximum achievable resolution of the diagnostic. To reduce its impact on beam pattern reconstruction, a filtering technique has been adapted and implemented in the tomography code. This technique is applied to the simulated tomographic reconstruction of the SPIDER beam, and the main results are reported.

An image filtering technique for SPIDER visible tomography

International Nuclear Information System (INIS)

Fonnesu, N.; Agostini, M.; Brombin, M.; Pasqualotto, R.; Serianni, G.

2014-01-01

The tomographic diagnostic developed for the beam generated in the SPIDER facility (100 keV, 50 A prototype negative ion source of ITER neutral beam injector) will characterize the two-dimensional particle density distribution of the beam. The simulations described in the paper show that instrumental noise has a large influence on the maximum achievable resolution of the diagnostic. To reduce its impact on beam pattern reconstruction, a filtering technique has been adapted and implemented in the tomography code. This technique is applied to the simulated tomographic reconstruction of the SPIDER beam, and the main results are reported

Investigating the Improvement of Decoding Abilities and Working Memory in Children with Incremental or Entity Personal Conceptions of Intelligence: Two Case Reports

Science.gov (United States)

Alesi, Marianna; Rappo, Gaetano; Pepi, Annamaria

2016-01-01

One of the most significant current discussions has led to the hypothesis that domain-specific training programs alone are not enough to improve reading achievement or working memory abilities. Incremental or Entity personal conceptions of intelligence may be assumed to be an important prognostic factor to overcome domain-specific deficits. Specifically, incremental students tend to be more oriented toward change and autonomy and are able to adopt more efficacious strategies. This study aims at examining the effect of personal conceptions of intelligence to strengthen the efficacy of a multidimensional intervention program in order to improve decoding abilities and working memory. Participants included two children (M age = 10 years) with developmental dyslexia and different conceptions of intelligence. The children were tested on a whole battery of reading and spelling tests commonly used in the assessment of reading disabilities in Italy. Afterwards, they were given a multimedia test to measure motivational factors such as conceptions of intelligence and achievement goals. The children took part in the T.I.R.D. Multimedia Training for the Rehabilitation of Dyslexia (Rappo and Pepi, 2010) reinforced by specific units to improve verbal working memory for 3 months. This training consisted of specific tasks to rehabilitate both visual and phonological strategies (sound blending, word segmentation, alliteration test and rhyme test, letter recognition, digraph recognition, trigraph recognition, and word recognition as samples of visual tasks) and verbal working memory (rapid words and non-words recognition). Posttest evaluations showed that the child holding the incremental theory of intelligence improved more than the child holding a static representation. On the whole this study highlights the importance of treatment programs in which both specificity of deficits and motivational factors are both taken into account. There is a need to plan multifaceted intervention

A Study of Ethnic Minority College Students: A Relationship among the Big Five Personality Traits, Cultural Intelligence, and Psychological Well-Being

Science.gov (United States)

Smith, Teresa Ann

2012-01-01

Institutions of Higher Education are challenged to educate an increasing, diverse ethnic minority population. This study examines (1) if the theory of the Big Five personality traits as a predictor of the cultural intelligence theoretical model remains constant with ethnic minority college students attending a southeastern United States…

Young Children's Role-Playing for Enhancing Personal Intelligences in Multiple Intelligences Theory

Science.gov (United States)

Wee, Su-Jeong; Shin, Hwa-Sik; Kim, Myung-Hee

2013-01-01

This article examines young children's role-play in an effort to develop methods with which teachers can enhance children's interpersonal and intrapersonal intelligences. Examining how MI practice is applied in different cultural and social contexts is important because it can provide new insights on enriching and enhancing curricula and…

Subsocial behaviour and brood adoption in mixed-species colonies of two theridiid spiders

DEFF Research Database (Denmark)

Grinsted, Lena; Agnarsson, Ingi; Bilde, Trine

2012-01-01

, aggression and cooperation through behavioural experiments and examine the potential for adoption of foreign brood. Morphological and genetic analyses confirmed that colonies consisted of two related species Chikunia nigra (O.P. Cambridge, 1880) new combination (previously Chrysso nigra) and a yet...... as in territorial, colonial spiders. Mixed species spider colonies, involving closely related species, have rarely been documented. We examined social interactions in newly discovered mixed-species colonies of theridiid spiders on Bali, Indonesia. Our aim was to test the degree of intra- and interspecific tolerance...

fMRI neurofeedback facilitates anxiety regulation in females with spider phobia

Directory of Open Access Journals (Sweden)

Anna eZilverstand

2015-06-01

Full Text Available Background: Spider phobics show an exaggerated fear response when encountering spiders. This fear response is aggravated by negative and irrational beliefs about the feared object. Cognitive reappraisal can target these beliefs, and therefore has a fear regulating effect. The presented study investigated if neurofeedback derived from functional magnetic resonance imaging (fMRI would facilitate anxiety regulation by cognitive reappraisal, using spider phobia as a model of anxiety disorders. Feedback was provided based on activation in left dorsolateral prefrontal cortex and right insula, as indicators of engagement and regulation success, respectively.Methods: Eighteen female spider phobics participated in a randomized, controlled, single-blinded study. All participants completed a training session in the MRI scanner. Participants assigned to the neurofeedback condition were instructed to shape their regulatory strategy based on the provided feedback. Participants assigned to the control condition were asked to adapt their strategy intuitively.Results: Neurofeedback participants exhibited lower anxiety levels than the control group at the end of the training. In addition, only neurofeedback participants achieved down-regulation of insula activation levels by cognitive reappraisal. Group differences became more pronounced over time, supporting learning as a mechanism behind this effect. Importantly, within the neurofeedback group, achieved changes in insula activation levels during training predicted long-term anxiety reduction.Conclusions: The conducted study provides first evidence that fMRI neurofeedback has a facilitating effect on anxiety regulation in spider phobia.

Mediterranean Recluse Spider, Loxosceles rufescens (Araneae: Sicariidae from Charkhab Cave, Southern Iran

Directory of Open Access Journals (Sweden)

Saber Sadeghi

2017-04-01

Full Text Available Background: The best-known dangerous spiders belong to the six genera. The genus Loxosceles or violin spiders are well known for their ability to cause skin necrosis or loxoscelism. All Loxosceles species have medical im­portance due to their necrotizing venom. The present article reports the occurrence of L. rufescens in Charkhab Cave, south of Iran (Larestan.Methods: The specimens were collected from the Charkhab Cave using handling forceps, paintbrush and aspirator and preserved in 96% ethanol.Results: Loxosceles rufescens, a medically important spider, is recorded from Charkhab Cave in Fars Province (southwest of Iran. Identification of L. rufescens was performed based on external morphology and the features of male genitalia.Conclusion: Presence of L. rufescens in south of Iran especially in a cave confirmed that this species is a widely distributed species in Iran. Therefore, cavers or cave visitors should be aware of this poisonous spider in caves.

Eocene and not Cretaceous origin of spider wasps: Fossil evidence from amber

Directory of Open Access Journals (Sweden)

Juanita Rodriguez

2016-02-01

Full Text Available Spider wasps had long been proposed to originate in the mid-Cretaceous based on the Burmese amber fossil Bryopompilus interfector Engel and Grimaldi, 2006. We performed a morphological examination of this fossil and determined it does not belong to Pompilidae or any other described hymenopteran family. Instead, we place it in the new family Bryopompilidae. The oldest verifiable member of the Pompilidae is from Baltic amber, which suggests the family probably originated in the Eocene, not in the mid-Cretaceous as previously proposed. The origin of spider wasps appears to be correlated with an increase in spider familial diversity in the Cenozoic. We also we add two genera to the extinct pompilid fauna: Tainopompilus gen. nov., and Paleogenia gen. nov., and describe three new species of fossil spider wasps: Anoplius planeta sp. nov., from Dominican amber (Burdigalian to Langhian; Paleogenia wahisi sp. nov., from Baltic amber (Lutetian to Priabonian; and Tainopompilus argentum sp. nov, from Dominican amber (Chattian to Langhian.

Analysis of transcriptomes of three orb-web spider species reveals gene profiles involved in silk and toxin.

Science.gov (United States)

Zhao, Ying-Jun; Zeng, Yan; Chen, Lei; Dong, Yang; Wang, Wen

2014-12-01

As an ancient arthropod with a history of 390 million years, spiders evolved numerous morphological forms resulting from adaptation to different environments. The venom and silk of spiders, which have promising commercial applications in agriculture, medicine and engineering fields, are of special interests to researchers. However, little is known about their genomic components, which hinders not only understanding spider biology but also utilizing their valuable genes. Here we report on deep sequenced and de novo assembled transcriptomes of three orb-web spider species, Gasteracantha arcuata, Nasoonaria sinensis and Gasteracantha hasselti which are distributed in tropical forests of south China. With Illumina paired-end RNA-seq technology, 54 871, 101 855 and 75 455 unigenes for the three spider species were obtained, respectively, among which 9 300, 10 001 and 10 494 unique genes are annotated, respectively. From these annotated unigenes, we comprehensively analyzed silk and toxin gene components and structures for the three spider species. Our study provides valuable transcriptome data for three spider species which previously lacked any genetic/genomic data. The results have laid the first fundamental genomic basis for exploiting gene resources from these spiders. © 2013 Institute of Zoology, Chinese Academy of Sciences.

A verified spider bite and a review of the literature confirm Indian ornamental tree spiders (Poecilotheria species) as underestimated theraphosids of medical importance.

Science.gov (United States)

Fuchs, Joan; von Dechend, Margot; Mordasini, Raffaella; Ceschi, Alessandro; Nentwig, Wolfgang

2014-01-01

Literature on bird spider or tarantula bites (Theraphosidae) is rare. This is astonishing as they are coveted pets and interaction with their keepers (feeding, cleaning the terrarium or taking them out to hold) might increase the possibility for bites. Yet, this seems to be a rare event and might be why most theraphosids are considered to be harmless, even though the urticating hairs of many American species can cause disagreeable allergic reactions. We are describing a case of a verified bite by an Indian ornamental tree spider (Poecilotheria regalis), where the patient developed severe, long lasting muscle cramps several hours after the bite. We present a comprehensive review of the literature on bites of these beautiful spiders and conclude that a delayed onset of severe muscle cramps, lasting for days, is characteristic for Poecilotheria bites. We discuss Poecilotheria species as an exception from the general assumption that theraphosid bites are harmless to humans. Copyright © 2013 Elsevier Ltd. All rights reserved.

Distributed neural system for emotional intelligence revealed by lesion mapping.

Science.gov (United States)

Barbey, Aron K; Colom, Roberto; Grafman, Jordan

2014-03-01

Cognitive neuroscience has made considerable progress in understanding the neural architecture of human intelligence, identifying a broadly distributed network of frontal and parietal regions that support goal-directed, intelligent behavior. However, the contributions of this network to social and emotional aspects of intellectual function remain to be well characterized. Here we investigated the neural basis of emotional intelligence in 152 patients with focal brain injuries using voxel-based lesion-symptom mapping. Latent variable modeling was applied to obtain measures of emotional intelligence, general intelligence and personality from the Mayer, Salovey, Caruso Emotional Intelligence Test (MSCEIT), the Wechsler Adult Intelligence Scale and the Neuroticism-Extroversion-Openness Inventory, respectively. Regression analyses revealed that latent scores for measures of general intelligence and personality reliably predicted latent scores for emotional intelligence. Lesion mapping results further indicated that these convergent processes depend on a shared network of frontal, temporal and parietal brain regions. The results support an integrative framework for understanding the architecture of executive, social and emotional processes and make specific recommendations for the interpretation and application of the MSCEIT to the study of emotional intelligence in health and disease.

Distributed neural system for emotional intelligence revealed by lesion mapping

Science.gov (United States)

Colom, Roberto; Grafman, Jordan

2014-01-01

Cognitive neuroscience has made considerable progress in understanding the neural architecture of human intelligence, identifying a broadly distributed network of frontal and parietal regions that support goal-directed, intelligent behavior. However, the contributions of this network to social and emotional aspects of intellectual function remain to be well characterized. Here we investigated the neural basis of emotional intelligence in 152 patients with focal brain injuries using voxel-based lesion-symptom mapping. Latent variable modeling was applied to obtain measures of emotional intelligence, general intelligence and personality from the Mayer, Salovey, Caruso Emotional Intelligence Test (MSCEIT), the Wechsler Adult Intelligence Scale and the Neuroticism-Extroversion-Openness Inventory, respectively. Regression analyses revealed that latent scores for measures of general intelligence and personality reliably predicted latent scores for emotional intelligence. Lesion mapping results further indicated that these convergent processes depend on a shared network of frontal, temporal and parietal brain regions. The results support an integrative framework for understanding the architecture of executive, social and emotional processes and make specific recommendations for the interpretation and application of the MSCEIT to the study of emotional intelligence in health and disease. PMID:23171618

Citrus-orchard ground harbours a diverse, well-established and abundant ground-dwelling spider fauna

Energy Technology Data Exchange (ETDEWEB)

Monzo, C.; Molla, O.; Vanaclocha, P.; Monton, H.; Melic, A.; Castanera, P.; Urbaneja, A.

2011-07-01

Ground-dwelling spider assemblages comprise one of the most representative predatory groups to be found in many crops. There is some evidence of the role that ground-dwelling spiders play in controlling certain citrus pests; however, there are almost no studies about the abundance and composition of this predatory group in citrus orchards. A three-year survey conducted using pitfall traps in three citrus orchards in Eastern Spain yielded more than five-thousand ground-dwelling spiders belonging to more than 50 species and 20 families. Wandering families such as Lycosidae, Gnaphosidae and Zodariidae were the most numerous in terms of captures. The generalist predator Pardosa cribata Simon (Araneae: Lycosidae) was the most common species, representing a quarter of all captures, followed by Zodarion cesari Pekar. (Araneae: Zodariidae) and Trachyzelotes fuscipes (Koch) (Araneae: Gnaphosidae). Spiders were active throughout the year with a peak population in summer. The species abundance data for the three spider assemblages sampled fitted a log normal statistical model which is consistent with a well-established community. The presence of a cover crop provided higher abundance of alternative prey and consequently higher abundance and diversity of ground-dwelling spiders. This work demonstrates that the citrus-orchard ground harbours a diverse and abundant ground-dwelling spider fauna, which is also active throughout the year. A challenge for future studies will be to establish conservation management strategies for these predators, that will improve biological control of those citrus pests that inhabit or spend part of their life cycle on the orchard floor. (Author) 49 refs.

Predator-Prey Interactions are Context Dependent in a Grassland Plant-Grasshopper-Wolf Spider Food Chain.

Science.gov (United States)

Laws, Angela N; Joern, Anthony

2015-06-01

Species interactions are often context dependent, where outcomes vary in response to one or more environmental factors. It remains unclear how abiotic conditions like temperature combine with biotic factors such as consumer density or food quality to affect resource availability or influence species interactions. Using the large grasshopper Melanoplus bivittatus (Say) and a common wolf spider [Rabidosa rabida (Walkenaer)], we conducted manipulative field experiments in tallgrass prairie to examine how spider-grasshopper interactions respond to manipulations of temperature, grasshopper density, and food quality. Grasshopper survival was density dependent, as were the effects of spider presence and food quality in context-dependent ways. In high grasshopper density treatments, predation resulted in increased grasshopper survival, likely as a result of reduced intraspecific competition in the presence of spiders. Spiders had no effect on grasshopper survival when grasshoppers were stocked at low densities. Effects of the experimental treatments were often interdependent so that effects were only observed when examined together with other treatments. The occurrence of trophic cascades was context dependent, where the effects of food quality and spider presence varied with temperature under high-density treatments. Temperature weakly affected the impact of spider presence on M. bivittatus survivorship when all treatments were considered simultaneously, but different context-dependent responses to spider presence and food quality were observed among the three temperature treatments under high-density conditions. Our results indicate that context-dependent species interactions are common and highlight the importance of understanding how key biotic and abiotic factors combine to influence species interactions. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

From Midges to Spiders: Mercury Biotransport in Riparian Zones Near the Buffalo River Area of Concern (AOC), USA.

Science.gov (United States)

Pennuto, C M; Smith, M

2015-12-01

Riparian communities can receive environmental contaminants from adjacent aquatic 'donor' habitats. We investigated mercury biotransport from aquatic to terrestrial habitats via aquatic insect emergence and uptake by riparian spiders at sites within and upstream of the Buffalo River Area of Concern (AOC), a site with known sediment Hg contamination. Mercury concentration in emerging midges was roughly 10× less than contaminated sediment levels with the AOC, but biomagnification factors from midges to spiders ranged from 2.0 to 2.65 between sites. There was a significantly negative body mass:total mercury relationship in spiders (p Spiders contained significantly more mercury than their midge prey and spiders upstream of the AOC had higher mercury concentrations than spiders from within the AOC. Collectively, these data indicate that riparian spiders can be good mercury sentinels in urban environments, and that riparian communities upstream from the AOC may be at greater risk to mercury than has been previously considered.

The moderating role of personality traits on emotional intelligence and conflict management styles.

Science.gov (United States)

Ann, Bao-Yi; Yang, Chun-Chi

2012-06-01

In a sample of 442 part-time MBA and undergraduate students, the relationships between emotional intelligence and the integrating style and between emotional intelligence and the dominating style of conflict management were moderated by extraversion. In addition, agreeableness moderated the relationships between emotional intelligence and compromising style and between emotional intelligence and dominating style.

Studies on the occurrence of true spiders as natural enemies in many Egyptian fields

Directory of Open Access Journals (Sweden)

Amira A. Ibrahim

2012-01-01

Full Text Available True spiders represent one of the most important natural predatory species in Egyptian fields. In this work, common true spiders were surveyed in wheat, cotton and maize fields, and were counted weekly by using the direct method. For evaluating the feeding consumption of true spiders, five feeding cases were tested (as preys. These cases were: eggs of Ephestia kuehniella, eggs of Phthorimaea operculella, one day eggs and larvae of E. kuehniella, larvae of E. kuehniella and P. operculella and larvae of E. kuehniella only. Results obtained revealed that, the highest average daily consumption for each spider was recorded in case of feeding on eggs of P. operculella. While, the longest survival period was recorded in case of feeding on larvae of E. kuehniella.

Logic circuits based on molecular spider systems.

Science.gov (United States)

Mo, Dandan; Lakin, Matthew R; Stefanovic, Darko

2016-08-01

Spatial locality brings the advantages of computation speed-up and sequence reuse to molecular computing. In particular, molecular walkers that undergo localized reactions are of interest for implementing logic computations at the nanoscale. We use molecular spider walkers to implement logic circuits. We develop an extended multi-spider model with a dynamic environment wherein signal transmission is triggered via localized reactions, and use this model to implement three basic gates (AND, OR, NOT) and a cascading mechanism. We develop an algorithm to automatically generate the layout of the circuit. We use a kinetic Monte Carlo algorithm to simulate circuit computations, and we analyze circuit complexity: our design scales linearly with formula size and has a logarithmic time complexity. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

Reproductive Seasonality in Nesticus (Araneae: Nesticidae) Cave Spiders.

Science.gov (United States)

Carver, Linnea M; Perlaky, Patricia; Cressler, Alan; Zigler, Kirk S

2016-01-01

Spiders of the family Nesticidae are members of cave communities around the world with cave-obligate (troglobiotic) species known from North America, Europe, Asia and the Indo-Pacific. A radiation of Nesticus (Araneae: Nesticidae) in the southern Appalachians includes ten troglobiotic species. Many of these species are of conservation interest due to their small ranges, with four species being single-cave endemics. Despite conservation concerns and their important role as predators in cave communities, we know little about reproduction and feeding in this group. We addressed this knowledge gap by examining populations of two species on a monthly basis for one year. We made further observations on several other species and populations, totaling 671 individual spider observations. This more than doubled the reported observations of reproduction and feeding in troglobiotic Nesticus. Female Nesticus carry egg sacs, facilitating the determination of the timing and frequency of reproduction. We found that Nesticus exhibit reproductive seasonality. Females carried egg sacs from May through October, with a peak in frequency in June. These spiders were rarely observed with prey; only 3.3% (22/671) of individuals were observed with prey items. The frequency at which prey items were observed did not vary by season. Common prey items were flies, beetles and millipedes. Troglobiotic species constituted approximately half of all prey items observed. This result represents a greater proportion of troglobiotic prey than has been reported for various troglophilic spiders. Although our findings shed light on the life history of troglobiotic Nesticus and on their role in cave ecosystems, further work is necessary to support effective conservation planning for many of these rare species.

Differential predictive power of self report and implicit measures on behavioural and physiological fear responses to spiders

NARCIS (Netherlands)

van Bockstaele, B.; Verschuere, B.; Koster, E.H.W.; Tibboel, H.; de Houwer, J.; Crombez, G.

2011-01-01

In this study, we investigated to what extent indirect measures predict behavioural and physiological fear responses towards spiders. Implicit attitudes towards spiders were assessed using an implicit association test and attentional bias towards spiders was assessed using a dot probe task and a

Exploring of the first recorded spider (Arachenida: Aranae) species of Sheringal, Khyber Pakhtunkhwa, Pakistan

OpenAIRE

Farzana Perveen; Numan Khan

2015-01-01

The spiders (Arthropoada: Arachenida) are one of the groups of grasping animals. Their carapaces are found on the dorsal side of the cephalothorax, which is an important characteristic of spiders. The present study was conducted to explore the first recorded spider species (nti=75) of Sheringal, Dir Upper (DU), Khyber Pakhtunkhwa (KP), Dir Upper, Khyber Pakhtunkhwa, Pakistan. The 10 genera with 10 species under 7 families were recorded from June 2013-July 2014. According to length of legs, th...

SVM-based prediction of propeptide cleavage sites in spider toxins identifies toxin innovation in an Australian tarantula.

Directory of Open Access Journals (Sweden)

Emily S W Wong

Full Text Available Spider neurotoxins are commonly used as pharmacological tools and are a popular source of novel compounds with therapeutic and agrochemical potential. Since venom peptides are inherently toxic, the host spider must employ strategies to avoid adverse effects prior to venom use. It is partly for this reason that most spider toxins encode a protective proregion that upon enzymatic cleavage is excised from the mature peptide. In order to identify the mature toxin sequence directly from toxin transcripts, without resorting to protein sequencing, the propeptide cleavage site in the toxin precursor must be predicted bioinformatically. We evaluated different machine learning strategies (support vector machines, hidden Markov model and decision tree and developed an algorithm (SpiderP for prediction of propeptide cleavage sites in spider toxins. Our strategy uses a support vector machine (SVM framework that combines both local and global sequence information. Our method is superior or comparable to current tools for prediction of propeptide sequences in spider toxins. Evaluation of the SVM method on an independent test set of known toxin sequences yielded 96% sensitivity and 100% specificity. Furthermore, we sequenced five novel peptides (not used to train the final predictor from the venom of the Australian tarantula Selenotypus plumipes to test the accuracy of the predictor and found 80% sensitivity and 99.6% 8-mer specificity. Finally, we used the predictor together with homology information to predict and characterize seven groups of novel toxins from the deeply sequenced venom gland transcriptome of S. plumipes, which revealed structural complexity and innovations in the evolution of the toxins. The precursor prediction tool (SpiderP is freely available on ArachnoServer (http://www.arachnoserver.org/spiderP.html, a web portal to a comprehensive relational database of spider toxins. All training data, test data, and scripts used are available from

Community structure of spiders in coastal habitats of a Mediterranean delta region (Nestos Delta, NE Greece

Directory of Open Access Journals (Sweden)

S. Buchholz

2009-01-01

Full Text Available (pp 101-115Habitat zonation and ecology of spider assemblages have been poorly studied in Mediterranean ecosystems. A first analysis of spider assemblages in coastal habitats in the east Mediterranean area is presented. The study area is the 250 km² Nestos Delta, located in East Macedonia in the North-East of Greece. Spiders were caught in pitfall traps at 17 sites from the beginning of April to the end of June 2004. Nonparametric estimators were used to determine species richness and alpha diversity. Ordination analysis (redundancy analysis indicated four clearly separable spider species groups (salt meadows, dunes, mea-dows and floodplain forests, along a soil salinity and moisture gradient. Based on these results we discuss the habitat preferences of these spiders and include the first ecological data on several species.

Inhibition of Return in Fear of Spiders: Discrepant Eye Movement and Reaction Time Data

Directory of Open Access Journals (Sweden)

Elisa Berdica

2014-01-01

Full Text Available Inhibition of return (IOR refers to a bias against returning the attention to a previously attended location. As a foraging facilitator it is thought to facilitate systematic visual search. With respect to neutral stimuli, this is generally thought to be adaptive, but when threatening stimuli appear in our environment, such a bias may be maladaptive. This experiment investigated the influence of phobia-related stimuli on the IOR effect using a discrimination task. A sample of 50 students (25 high, 25 low in spider fear completed an IOR task including schematic representations of spiders or butterflies as targets. Eye movements were recorded and to assess discrimination among targets, participants indicated with button presses if targets were spiders or butterflies. Reaction time data did not reveal a significant IOR effect but a significant interaction of group and target; spider fearful participants were faster to respond to spider targets than to butterflies. Furthermore, eye-tracking data showed a robust IOR effect independent of stimulus category. These results offer a more comprehensive assessment of the motor and oculomotor factors involved in the IOR effect.

Multivariate ordination identifies vegetation types associated with spider conservation in brassica crops

Directory of Open Access Journals (Sweden)

Hafiz Sohaib Ahmed Saqib

2017-10-01

Full Text Available Conservation biological control emphasizes natural and other non-crop vegetation as a source of natural enemies to focal crops. There is an unmet need for better methods to identify the types of vegetation that are optimal to support specific natural enemies that may colonize the crops. Here we explore the commonality of the spider assemblage—considering abundance and diversity (H—in brassica crops with that of adjacent non-crop and non-brassica crop vegetation. We employ spatial-based multivariate ordination approaches, hierarchical clustering and spatial eigenvector analysis. The small-scale mixed cropping and high disturbance frequency of southern Chinese vegetation farming offered a setting to test the role of alternate vegetation for spider conservation. Our findings indicate that spider families differ markedly in occurrence with respect to vegetation type. Grassy field margins, non-crop vegetation, taro and sweetpotato harbour spider morphospecies and functional groups that are also present in brassica crops. In contrast, pumpkin and litchi contain spiders not found in brassicas, and so may have little benefit for conservation biological control services for brassicas. Our findings also illustrate the utility of advanced statistical approaches for identifying spatial relationships between natural enemies and the land uses most likely to offer alternative habitats for conservation biological control efforts that generates testable hypotheses for future studies.