The Search for Extraterrestrial Intelligence (SETI)
Tarter, Jill
The search for evidence of extraterrestrial intelligence is placed in the broader astronomical context of the search for extrasolar planets and biomarkers of primitive life elsewhere in the universe. A decision tree of possible search strategies is presented as well as a brief history of the search for extraterrestrial intelligence (SETI) projects since 1960. The characteristics of 14 SETI projects currently operating on telescopes are discussed and compared using one of many possible figures of merit. Plans for SETI searches in the immediate and more distant future are outlined. Plans for success, the significance of null results, and some opinions on deliberate transmission of signals (as well as listening) are also included. SETI results to date are negative, but in reality, not much searching has yet been done.
Searching for Extraterrestrial Intelligence SETI Past, Present, and Future
Shuch, H Paul
2011-01-01
This book is a collection of essays written by the very scientists and engineers who have led, and continue to lead, the scientific quest known as SETI, the search for extraterrestrial intelligence. Divided into three parts, the first section, ‘The Spirit of SETI Past’, written by the surviving pioneers of this then emerging discipline, reviews the major projects undertaken during the first 50 years of SETI science and the results of that research. In the second section, ‘The Spirit of SETI Present’, the present-day science and technology is discussed in detail, providing the technical background to contemporary SETI instruments, experiments, and analytical techniques, including the processing of the received signals to extract potential alien communications. In the third and final section, ‘The Spirit of SETI Future’, the book looks ahead to the possible directions that SETI will take in the next 50 years, addressing such important topics as interstellar message construction, the risks and assump...
SETI pioneers scientists talk about their search for extraterrestrial intelligence
Swift, David W.
1990-01-01
Why did some scientists decide to conduct a search for extraterrestrial intelligence (SETI)? What factors in their personal development predisposed them to such a quest? What obstacles did they encounter along the way? David Swift interviewed the first scientists involved in the search & offers a fascinating overview of the emergence of this modern scientific endeavor. He allows some of the most imaginative scientific thinkers of our time to hold forth on their views regarding SETI & extraterrestrial life & on how the field has developed. Readers will react with a range of opinions as broad as those concerning the likelihood of success in SETI itself. ''A goldmine of original information.''
Chiar, J.; Phillips, C. B.; Rudolph, A.; Bonaccorsi, R.; Tarter, J.; Harp, G.; Caldwell, D. A.; DeVore, E. K.
2016-12-01
The SETI Institute hosts an Astrobiology Research Experience for Undergraduates (REU) program. Beginning in 2013, we partnered with the Physics and Astronomy Dept. at Cal Poly Pomona, a Hispanic-serving university, to recruit underserved students. Over 11 years, we have served 155 students. We focus on Astrobiology since the Institute's mission is to explore, understand and explain the origin, nature and prevalence of life in the universe. Our REU students work with mentors at the Institute - a non-profit organization located in California's Silicon Valley-and at the nearby NASA Ames Research Center. Projects span research on survival of microbes under extreme conditions, planetary geology, astronomy, the Search for Extraterrestrial Intelligence (SETI), extrasolar planets and more. The REU program begins with an introductory lectures by Institute scientists covering the diverse astrobiology subfields. A week-long field trip to the SETI Institute's Allen Telescope Array (Hat Creek Radio Astronomy Observatory in Northern California) and field experiences at hydrothermal systems at nearby Lassen Volcanic National Park immerses students in radio astronomy and SETI, and extremophile environments that are research sites for astrobiologists. Field trips expose students to diverse environments and allow them to investigate planetary analogs as our scientists do. Students also participate in local trips to the California Academy of Sciences and other nearby locations of scientific interest, and attend the weekly scientific colloquium hosted by the SETI Institute at Microsoft, other seminars and lectures at SETI Institute and NASA Ames. The students meet and present at a weekly journal club where they hone their presentation skills, as well as share their research progress. At the end of the summer, the REU interns present their research projects at a session of the Institute's colloquium. As a final project, students prepare a 2-page formal abstract and 15-minute
Traphagan, John
2015-01-01
The search for extraterrestrial intelligence (SETI) represents one of the most significant crossroads at which the assumptions and methods of scientific inquiry come into direct contact with—and in many cases conflict with—those of religion. Indeed, at the core of SETI is the same question that motivates many interested in religion: What is the place of humanity in the universe? Both scientists involved with SETI (and in other areas) and those interested in and dedicated to some religious traditions are engaged in contemplating these types of questions, even if their respective approaches and answers differ significantly. This book explores this intersection with a focus on three core points: 1) the relationship between science and religion as it is expressed within the framework of SETI research, 2) the underlying assumptions, many of which are tacitly based upon cultural values common in American society, that have shaped the ways in which SETI researchers have conceptualized the nature of their endeavo...
Carstairs, Ian R.
2002-12-01
Ian R Carstairs reports on efforts to extend the search for extraterrestrial intelligence to X and γ-ray regions. Traditional Search for Extra-Terrestrial Intelligence (SETI) strategies have used radio, microwave and, to a limited extent, optical searches. But this ignores the higher energy X and γ-ray regions that a technologically advanced extraterrestrial civilization might use to attract our attention - using messages encoded in discrete photon-counting exchange, much like the signals seen from pulsars. Here, the methods used in high-energy pulsar detection and analysis are reviewed and applied to this new SETI initiative.
Risk and value analysis of SETI
Billingham, J.
1990-01-01
This paper attempts to apply a traditional risk and value analysis to the Search for Extraterrestrial Intelligence--SETI. In view of the difficulties of assessing the probability of success, a comparison is made between SETI and a previous search for extraterrestrial life, the biological component of Project Viking. Our application of simple Utility Theory, given some reasonable assumptions, suggests that SETI is at least as worthwhile as the biological experiment on Viking.
The Order of the Dolphin: Origins of SETI
Temming, Maria; Crider, Anthony
2016-01-01
In 1961, the National Academy of Sciences organized a meeting on the search for extraterrestrial intelligence (SETI) at the National Radio Astronomy Observatory in Green Bank, West Virginia. The ten scientists who attended, including future SETI icons such as Frank Drake and Carl Sagan, represented a variety of scientific fields. At the conclusion of the meeting, the attendees adopted the moniker "The Order of the Dolphin," in honor of participant John Lilly's work on interspecies communication. Since this seminal meeting, researchers in each of the attendees' fields have contributed in some way to the search for intelligent life. This study investigates the circumstances that led to each attendee's invitation to Green Bank and explores SETI as the legacy of this meeting. We will focus in this talk on the SETI connections of two attendees, astronomer Otto Struve and physicist Philip Morrison, both in regards to their personal contributions to SETI and the influence of their work on subsequent SETI research. Specifically, we will examine proposals by Otto Struve for exoplanet discovery methods, and Philip Morrison for radio searches that laid the groundwork for modern SETI.
Dysonian Approach to SETI: A Fruitful Middle Ground?
Bradbury, R. J.; Cirkovic, M. M.; Dvorsky, G.
We critically assess the prevailing currents in the Search for Extraterrestrial Intelligence (SETI), embodied in the notion of radio-searches for intentional artificial signals as envisioned by pioneers such as Frank Drake, Philip Morrison, Michael Papagiannis and others. In particular, we emphasize (1) the necessity of integrating SETI into a wider astrobiological and future studies context, (2) the relevance of and lessons to be learnt from the anti-SETI arguments, in particular Fermi's paradox, and (3) a need for complementary approach which we dub the Dysonian SETI. It is meaningfully derived from the inventive and visionary ideas of Freeman J. Dyson and his imaginative precursors, like Konstantin E. Tsiolkovsky, Olaf Stapledon, Nikola Tesla or John B. S. Haldane, who suggested macro-engineering projects as the focal points in the context of extrapolations about the future of humanity and, by analogy, other intelligent species. We consider practical ramifications of the Dysonian SETI and indicate some of the promising directions for future work.
AN OPPORTUNISTIC SEARCH FOR EXTRATERRESTRIAL INTELLIGENCE (SETI) WITH THE MURCHISON WIDEFIELD ARRAY
Energy Technology Data Exchange (ETDEWEB)
Tingay, S. J.; Tremblay, C.; Walsh, A.; Urquhart, R. [International Centre for Radio Astronomy Research (ICRAR), Curtin University, Bentley, WA 6102 (Australia)
2016-08-20
A spectral line image cube generated from 115 minutes of MWA data that covers a field of view of 400 sq, deg. around the Galactic Center is used to perform the first Search for ExtraTerrestrial Intelligence (SETI) with the Murchison Widefield Array (MWA). Our work constitutes the first modern SETI experiment at low radio frequencies, here between 103 and 133 MHz, paving the way for large-scale searches with the MWA and, in the future, the low-frequency Square Kilometre Array. Limits of a few hundred mJy beam{sup −1} for narrowband emission (10 kHz) are derived from our data, across our 400 sq. deg. field of view. Within this field, 45 exoplanets in 38 planetary systems are known. We extract spectra at the locations of these systems from our image cube to place limits on the presence of narrow line emission from these systems. We then derive minimum isotropic transmitter powers for these exoplanets; a small handful of the closest objects (10 s of pc) yield our best limits of order 10{sup 14} W (Equivalent Isotropic Radiated Power). These limits lie above the highest power directional transmitters near these frequencies currently operational on Earth. A SETI experiment with the MWA covering the full accessible sky and its full frequency range would require approximately one month of observing time. The MWA frequency range, its southern hemisphere location on an extraordinarily radio quiet site, its very large field of view, and its high sensitivity make it a unique facility for SETI.
SETI - A Scientific Critique and a Proposal for Further Observational Modes
Ellery, A.; Tough, A.; Darling, D.
The Search for Extraterrestrial Intelligence (SETI) is one of the most exciting and fundamental scientific endeavours that the human race has undertaken. It falls under the banner of scientific research (unlike UFOlogy which must be classed as “pseudo-science”) but it is not clear that it follows the scientific method. Like astrobiology (also known as exobiology), it lacks a well-defined subject-matter in the form of physical evidence. However, although astrobiology is supported by a single data-set of terrestrial extremophile evidence and based upon extrapolation of physical mechanisms (life as a physico-chemical process), SETI is not. SETI is limited to a single data-point - the existence of ourselves as the sole intelligent inhabitants of Earth. To extrapolate from this is unwarranted as human intelligence is based on a unique evolutionary pathway (intelligence emerged through a contingent, historical process). We examine this problem and attempt to ascertain whether SETI is a scientific endeavour or whether it is more closely associated with other modes of human enquiry. In doing so, we review the SETI literature with an extensive bibiliography. We further suggest that the most appropriate course of action for scientific SETI is to diversify its experimental/observational techniques to resolve the Fermi paradox rather than remain reliant on the single mode of investigation currently adopted - radio astronomy.
Teaching Planetary Science as Part of the Search for Extraterrestrial Intelligence (SETI)
Margot, Jean-Luc; Greenberg, Adam H.
2017-10-01
In Spring 2016 and 2017, UCLA offered a course titled "EPSS C179/279 - Search for Extraterrestrial Intelligence: Theory and Applications". The course is designed for advanced undergraduate students and graduate students in the science, technical, engineering, and mathematical fields. Each year, students designed an observing sequence for the Green Bank telescope, observed known planetary systems remotely, wrote a sophisticated and modular data processing pipeline, analyzed the data, and presented their results. In 2016, 15 students participated in the course (9U, 5G; 11M, 3F) and observed 14 planetary systems in the Kepler field. In 2017, 17 students participated (15U, 2G; 10M, 7F) and observed 10 planetary systems in the Kepler field, TRAPPIST-1, and LHS 1140. In order to select suitable targets, students learned about planetary systems, planetary habitability, and planetary dynamics. In addition to planetary science fundamentals, students learned radio astronomy fundamentals, collaborative software development, signal processing techniques, and statistics. Evaluations indicate that the course is challenging but that students are eager to learn because of the engrossing nature of SETI. Students particularly value the teamwork approach, the observing experience, and working with their own data. The next offering of the course will be in Spring 2018. Additional information about our SETI work is available at seti.ucla.edu.
A Half-century of SETI Science
Shuch, H. Paul
We begin our journey with a brief review of half a century of SETI science. The material in this introductory chapter is offered for the benefit of those educated laypersons whose enthusiasm for the Search for Extraterrestrial Intelligence exceeds their detailed knowledge of the relevant technologies. It is my hope that readers of this volume will better appreciate the material which follows if they first have a basic understanding of SETI concepts. Hence, I offer an overview, which is intended not to be exhaustive, but rather representative. Together, we will explore the nature of radio telescopes, experimental design strategies, SETI instrumentation, signal analysis, and the hallmarks of artificiality that allow us to differentiate between natural astrophysical emissions and intelligent interstellar transmissions. If you are already a technical specialist in these areas, feel free to bypass this introduction, and proceed directly to the subsequent chapters.
Brin, D.
Understanding the controversy over "Messages to Extra Terrestrial Intelligence" or METI requires a grounding in the history and rationale of SETI (Search for ETI). Insights since the turn of the century have changed SETI's scientific basis. Continued null results from the radio search do not invalidate continuing effort, but they do raise questions about long-held assumptions. Modified search strategies are discussed. The Great Silence or Fermi Paradox is appraised, along with the disruptive plausibility of interstellar travel. Psychological motivations for METI are considered. With this underpinning, we consider why a small cadre of SETI-ist radio astronomers have resisted the notion of international consultations before humanity takes a brash and irreversible step into METI, shouting our presence into the cosmos.
Undergraduate Research at SETI in Astrobiology
Kress, Monika; Phillips, C.; DeVore, E.; Hubickyj, O.
2012-05-01
The SETI Institute and San Jose State University (SJSU) have begun a partnership (URSA: Undergraduate Research at the SETI Institute in Astrobiology) in which undergraduate science and engineering majors from SJSU participate in research at the SETI Institute during the academic year. We are currently in our second year of the three-year NASA-funded grant. The goal of this program is to expose future scientists, engineers and educators to the science of astrobiology and to NASA in general, and by so doing, to prepare them for the transition to their future career in the Silicon Valley or beyond. The URSA students are mentored by a SETI Institute scientist who conducts research at the SETI Institute headquarters or nearby at NASA Ames Research Center. The SETI Institute is a private, nonprofit organization dedicated to scientific research, education and public outreach. Its mission is to explore, understand and explain the origin, nature and prevalence of life in the universe. SJSU is a large urban public university that serves the greater Silicon Valley area in California. Students at SJSU come from diverse ethnic, cultural and socioeconomic backgrounds. Many of them face financial pressures that force them to pursue part-time work. URSA students are paid to work for 10 hours/week during the academic year, and also participate in monthly group meetings where they practice their presentation skills and discuss future plans. We encourage underserved and underrepresented students, including women, minority, and those who are the first in their family to go to college, to apply to the URSA program and provide ongoing mentoring and support as needed. While preparing students for graduate school is not a primary goal, some of our students have gone on to MS or PhD programs or plan to do so. The URSA program is funded by NASA EPOESS.
Morison, Ian
2006-08-01
SETI, the Search for Extraterrestrial Intelligence, has now been actively pursued for close to 50 years without success. However, this does not imply that we are alone in the Milky Way galaxy for, although most astronomers now agree that intelligent civilizations are far less common than were once thought, we cannot say that there are none. But it does mean that they are likely to be further away from us and, as yet, we have only seriously searched a tiny region of our galaxy. It will not be until the 2020s that an instrument, now on the drawing board, will give us the capability to detect radio signals of realistic power from the whole galaxy. It is also possible that light, rather than radio, might be the communication carrier chosen by an alien race, but optical-SETI searches seeking out pulsed laser signals have only just begun.
Are We Alone? GAVRT Search for Extra Terrestrial Intelligence (SETI) Project
Bensel, Holly; Cool, Ian; St. Mary's High School Astronomy Club; St. Mary's Middle School Astronomy Club
2017-01-01
The Goldstone Apple Valley Radio Telescope Program (GAVRT) is a partnership between NASA’s Jet Propulsion Laboratory and the Lewis Center for Educational Research. The program is an authentic science investigation program for students in grades K through 12 and offers them the ability to learn how to be a part of a science team while they are making a real contribution to scientific knowledge.Using the internet from their classroom, students take control of a 34-meter decommissioned NASA radio telescope located at the Goldstone Deep Space Network complex in California. Students collect data on strong radio sources and work in collaboration with professional radio astronomers to analyze the data.Throughout history man has wondered if we were alone in the Universe. SETI - or the Search for Extra Terrestrial Intelligence - is one of the programs offered through GAVRT that is designed to help answer that question. By participating in SETI, students learn about science by doing real science and maybe, if they get very lucky, they might make the most important discovery of our lifetime: Intelligent life beyond Earth!At St. Mary’s School, students in grades 6-12 have participated in the project since its inception. The St. Mary’s Middle School Astronomy Club is leading the way in their relentless search for ET and radio telescope studies. Students use the radio telescope to select a very small portion of the Milky Way Galaxy - or galactic plane - and scan across it over and over in the hopes of finding a signal that is not coming from humans or radio interference. The possibility of being the first to discover an alien signal has kept some students searching for the past three years. For them to discover something of this magnitude is like winning the lottery: small chance of winning - big payoff. To that end, the club is focusing on several portions of the Milky Way where they have detected a strong candidate in the past. The hope is to pick it up a second and
Dysonian SETI as a "Shortcut" to Detecting Habitable Planets
Wright, J. T.
2016-12-01
The search for habitable planets is ultimately motivated by the search for inhabited planets. On Earth, the most telling signature of life is that of humanity's technology. The Search for Extraterrestrial Intelligence (SETI) is thus the "ultimate" search for habitable planets.In 1960 two seminal papers in SETI were published, providing two visions for SETI. Giuseppe Cocconi and Philip Morrison's proposed detecting deliberate radio signals ("communication SETI"), while Freeman Dyson ("artifact SETI"), proposed detecting the inevitable effects of massive energy supplies and artifacts on their surroundings. While communication SETI has now had many career-long practitioners and major efforts, artifact SETI has, until recently, not been a vibrant field of study. The launch of the Kepler and WISE satellites have greatly renewed interest in the field, however, and the recent Breakthrough Listen Initiative has provided new motivation for finding good targets for communication SETI. I will discuss the progress of the Ĝ Search for Extraterrestrial Civilizations with Large Energy Supplies, including its justification and motivation, waste heat search strategy and first results, and the framework for a search for megastructures via transit light curves. The last of these led to the identification of KIC 8462852 (a.k.a. "Tabby's Star") as a candidate ETI host. This star, discovered by Boyajian and the Zooniverse Planet Hunters, exhibits several apparently unique and so-far unexplained photometric properties, and continues to confound natural explanation.
Billingham, J.; Brocker, D. H.
1991-01-01
In 1959, it was proposed that a sensible way to conduct interstellar communication would be to use radio at or near the frequency of hydrogen. In 1960, the first Search for Extraterrestrial Intelligence (SETI) was conducted using a radiotelescope at Green Bank in West Virginia. Since 1970, NASA has systematically developed a definitive program to conduct a sophisticated search for evidence of extraterrestrial intelligent life. The basic hypothesis is that life may be widespread in the univers, and that in many instances extraterrestrial life may have evolved into technological civilizations. The underlying scientific arguments are based on the continuously improving knowledge of astronomy and astrophysics, especially star system formation, and of planetary science, chemical evolution, and biological evolution. If only one in a million sun-like stars in our galaxy harbors species with cognitive intelligence, then there are 100,000 civilizations in the Milky Way alone. The fields of radioastronomy digital electronic engineering, spectrum analysis, and signal detection have advanced rapidly in the last twenty years and now allow for sophisticated systems to be built in order to attempt the detection of extraterrestrial intelligence signals. In concert with the scientific and engineering communities, NASA has developed, over the last several years, a Microwave Observing Project whose goal is to design, build, and operate SETI systems during the decade of the nineties in pursuit of the goal signal detection. The Microwave Observing Project is now approved and underway. There are two major components in the project: the Target Search Element and the Sky Survey Element.
Spin-Off Successes of SETI Research at Berkeley
Douglas, K. A.; Anderson, D. P.; Bankay, R.; Chen, H.; Cobb, J.; Korpela, E. J.; Lebofsky, M.; Parsons, A.; von Korff, J.; Werthimer, D.
2009-12-01
Our group contributes to the Search for Extra-Terrestrial Intelligence (SETI) by developing and using world-class signal processing computers to analyze data collected on the Arecibo telescope. Although no patterned signal of extra-terrestrial origin has yet been detected, and the immediate prospects for making such a detection are highly uncertain, the SETI@home project has nonetheless proven the value of pursuing such research through its impact on the fields of distributed computing, real-time signal processing, and radio astronomy. The SETI@home project has spun off the Center for Astronomy Signal Processing and Electronics Research (CASPER) and the Berkeley Open Infrastructure for Networked Computing (BOINC), both of which are responsible for catalyzing a smorgasbord of new research in scientific disciplines in countries around the world. Futhermore, the data collected and archived for the SETI@home project is proving valuable in data-mining experiments for mapping neutral galatic hydrogen and for detecting black-hole evaporation.
Searching for SETI: The Social Construction of Aliens and the Quest for a Technological Mythos
Bozeman, John Marvin
2015-01-01
This dissertation uses Actor Network Theory (ANT) and Stark and Bainbridge's rational choice theory of religion to analyze an established but controversial branch of science and technology, the Search for Extraterrestrial Intelligence (SETI). Of particular interest are the cultural, and sometimes religious, assumptions that its creators have built into it. The purpose of this analysis is not to discredit SETI, but instead to show how SETI, along with other avant-garde scientific projects, is...
The 1993 Finnish Interdisciplinary Seminar on SETI - A review of aims, approaches and conclusions
Seppanen, Jouko
1993-10-01
The communications of the International Interdisciplinary Seminar on SETI, held on March 6-7, 1993 in Vantaa, Finland, are reviewed and the contents and conclusions of papers summarized. The seminar was organized jointly by the Finnish Artificial Intelligence Society (FAIS), Finnish Astronomical Society, Ursa Astronomical Association and Heureka - The Finnish Science Centre. As the ninth in a series of intelligence-related seminars of FAIS, SETI was chosen as the topic for spring 1993, noting the new ten year NASA SETI program HRMS (High Resolution Micro-wave Survey), commenced on Columbus Day, October 12, 1992. The aims and the interdisciplinary format of the seminar are described, the main results and conclusions of papers are restated, and the seminar publications introduced. The summaries of papers are based on their abstracts and contain excerpts from texts.
Funding the Search for Extraterrestrial Intelligence with a Lottery Bond
Haqq-Misra, Jacob
2013-01-01
I propose the establishment of a SETI Lottery Bond to provide a continued source of funding for the search for extraterrestrial intelligence (SETI). The SETI Lottery Bond is a fixed rate perpetual bond with a lottery at maturity, where maturity occurs only upon discovery and confirmation of extraterrestrial intelligent life. Investors in the SETI Lottery Bond purchase shares that yield a fixed rate of interest that continues indefinitely until SETI succeeds---at which point a random subset of...
Lesyna, Larry; Margot, Jean-Luc; Greenberg, Adam; Shinde, Akshay; Alladi, Yashaswi; Prasad MN, Srinivas; Bowman, Oliver; Fisher, Callum; Gyalay, Szilard; McKibbin, William; Miles, Brittany E.; Nguyen, Donald; Power, Conor; Ramani, Namrata; Raviprasad, Rashmi; Santana, Jesse
2017-01-01
We advocate for the inclusion of a full-term course entirely devoted to SETI in the university curriculum. SETI usually warrants only a few lectures in a traditional astronomy or astrobiology course. SETI’s rich interdisciplinary character serves astronomy students by introducing them to scientific and technological concepts that will aid them in their dissertation research or later in their careers. SETI is also an exciting topic that draws students from other disciplines and teaches them astronomical concepts that they might otherwise never encounter in their university studies. We have composed syllabi that illustrate the breadth and depth that SETI courses provide for advanced undergraduate or graduate students. The syllabi can also be used as a guide for an effective SETI course taught at a descriptive level.After a pilot course in 2015, UCLA formally offered a course titled "EPSS C179/279 - Search for Extraterrestrial Intelligence: Theory and Applications" in Spring 2016. The course was designed for advanced undergraduate students and graduate students in the science, technical, engineering, and mathematical fields. In 2016, 9 undergraduate students and 5 graduate students took the course. Students designed an observing sequence for the Arecibo and Green Bank telescopes, observed known planetary systems remotely, wrote a sophisticated and modular data processing pipeline, analyzed the data, and presented the results. In the process, they learned radio astronomy fundamentals, software development, signal processing, and statistics. The instructor believes that the students were eager to learn because of the engrossing nature of SETI. The students rated the course highly, in part because of the observing experience and the teamwork approach. The next offering will be in Spring 2017.See lxltech.com and seti.ucla.edu
[An encounter with extraterrestrial intelligence].
Hisabayashi, Hisashi
2003-12-01
It is much easier to find extraterrestrial intelligence than to detect simple organisms living on other planets. However, it is hard to communicate with such intelligence without the mutual understanding of inter-stellar communication protocol. The radio SETI (The Search for Extra-Terrestrial Intelligence) was initiated with the pioneering work of F. Drake in 1960, one year after the historical SETI paper by Cocconi and Morrison. This talk explains that SETI evolves with two bases of science; the understanding of our universe and the development of technology. Since SETI has had strong connection with radio astronomy from its early beginning, the impacts of radio astronomical findings and technological breakthrough can be seen in many aspects of the SETI history. Topics of this talk include the detection of microwave 3 K background radiation in the universe. Interstellar atomic and molecular lines found in radio-wave spectra provide the evidence of pre-biotic chemical evolution in such region. Radio telescope imaging and spectral technique are closely associated with methodology of SETI. Topics of the talk extend to new Allen Telescope Array and projected Square Kilometer Array. Recent optical SETI and the discoveries of extra solar planets are also explained. In the end, the recent understanding of our universe is briefly introduced in terms of matter, dark matter and dark energy. Even our understanding of the universe has been evolutionarily revolved and accumulated after 1960, we must recognize that our universe is still poorly understood and that astronomy and SETI are required to proceed hand in hand.
From Ozma to Cyclops: The Beginnings of American SETI, 1959-70
Sullivan, W. T.
2002-12-01
The modern era in SETI (Search for Extraterrstrial Intelligence) began with two independent proposals in the late 1950s. In 1959 Phillip Morrison and Guiseppe Cocconi at Cornell published a short theoretical paper in ``Nature," while simultaneously Frank Drake at the brand-new NRAO in West Virginia developed a receiver for the first radio observations, called Project Ozma. In 1960 Drake monitored two nearby solar-like stars, Tau Ceti and Epsilon Eridani, for several months with a scanning one-channel radiometer at 21-cm on an 85-ft diameter dish. Drake's interest, along with that of his boss Otto Struve, then led to a remarkable small meeting at Green Bank in 1961, at which time the Drake Equation was first put forth as an organizing concept for estimating the possible number of extraterrestrial civilizations. The next milestone was the appearance of ``Intelligent Life in the Universe" by Iosif Shklovsky and Carl Sagan (1966), which widely circulated the idea of SETI. The growth of NASA's exobiology program (although primarily focused on microbial life and the origin of life) throughout the 1960s also legitimized the field and culminated in the Viking mission to Mars in 1976. In 1970 NASA sponsored a large summer workshop charged with the task of designing a feasible radio telescope for SETI. The resulting report, ``Project Cyclops: A Design Study of a System for Detecting Extraterrestrial Intelligent Life" (1971), was the first detailed look at all aspects of the problem, and set the tone for future NASA involvement in SETI. This talk will briefly cover this history, in particular the radio astronomy aspects, and will include a portion of a tape recording of a talk given by Drake in 1960 even as Project Ozma was in progress.
Maccone, C.
SETI searches are, by definition, the extraction of very weak radio signals out of the cosmic background noise. When SETI was born in 1959, it was "natural" to attempt this extraction by the only detection algorithm well known at the time: the Fourier Transform (FT). In fact: 1) SETI radio astronomers had adopted the viewpoint that a candidate ET signal would necessarily be a sinusoidal carrier, i.e. a very narrow-band signal. Over such a narrow band, the background noise is necessarily white. And so, the basic assumption behind the FT that the background noise must be white was "perfectly matched" to SETI for the next fifty years! 2) In addition, the Americans, J. W. Cooley and J. W. Tukey discovered in April 1965 that all the FT computations could be speeded up to N*ln(N) (rather than N2) (N is the number of numbers to be processed) by their own Fast Fourier Transform (FFT). Then, SETI radio astronomers all over the world gladly and unquestioningly adopted the new FFT forever. In 1983, however, the French SETI radio astronomer, François Biraud, dared to challenge this view (ref. [6]). He argued that we only can make guesses about ET's telecommunication systems, and that the shifting trend on Earth was from narrow-band to wide-band telecommunications. Thus, a new transform, other than the FFT, was needed that could detect signals over both narrow and wide bands, regardless of the colored noise distribution over any finite bandwidth. Such a transform had actually been pointed out as early as 1946 by the Finn mathematician, Kari Karhunen, and the French mathematician, Michel Loève, and is thus named KLT for them. In conclusion, François Biraud suggested to "look for the unknown in SETI" by adopting the KLT rather than the FFT. The same ideas were reached independently by this author also, and starting 1987, he too was "preaching the KLT": first at the SETI Institute, then (since 1990) at the Italian CNR (now called INAF) SETI facilities at Medicina, near Bologna
High resolution SETI: Experiences and prospects
Horowitz, Paul; Clubok, Ken
Megachannel spectroscopy with sub-Hertz resolution constitutes an attractive strategy for a microwave search for extraterrestrial intelligence (SETI), assuming the transmission of a narrowband radiofrequency beacon. Such resolution matches the properties of the interstellar medium, and the necessary Doppler corrections provide a high degree of interference rejection. We have constructed a frequency-agile receiver with an FFT-based 8 megachannel digital spectrum analyzer, on-line signal recognition, and multithreshold archiving. We are using it to conduct a meridian transit search of the northern sky at the Harvard-Smithsonian 26-m antenna, with a second identical system scheduled to begin observations in Argentina this month. Successive 400 kHz spectra, at 0.05 Hz resolution, are searched for features characteristic of an intentional narrowband beacon transmission. These spectra are centered on guessable frequencies (such as λ21 cm), referenced successively to the local standard of rest, the galactic barycenter, and the cosmic blackbody rest frame. This search has rejected interference admirably, but is greatly limited both in total frequency coverage and sensitivity to signals other than carriers. We summarize five years of high resolution SETI at Harvard, in the context of answering the questions "How useful is narrowband SETI, how serious are its limitations, what can be done to circumvent them, and in what direction should SETI evolve?" Increasingly powerful signal processing hardware, combined with ever-higher memory densities, are particularly relevant, permitting the construction of compact and affordable gigachannel spectrum analyzers covering hundreds of megahertz of instantaneous bandwidth.
Enriquez, J. Emilio; Breakthrough Listen Team
2018-01-01
The Breakthrough Listen (BL) Initiative is the largest campaign in human history on the search for extraterrestrial intelligence. The work presented here is the first BL search for engineered signals. This comprises a sample of 692 nearby stars within 50 pc. We used the Green Bank Telescope (GBT) to conduct observations over 1.1-1.9 GHz (L-band). Our observing strategy allows us to reject most of the detected signals as terrestrial interference. During the analysis, eleven stars show events that passed our thresholding algorithm, but detailed analysis of their properties indicates they are consistent with known examples of anthropogenic radio frequency interference. This small number of false positives and their understood properties give confidence on the techniques used for this search. We conclude that, at the time of our observations none of the observed systems host high-duty-cycle radio transmitters emitting at the observed frequencies with an EIRP of 10^13 W, readily achievable by our own civilization.We can place limits on the presence of engineered signals from putative extraterrestrial civilizations inhabiting the environs of the target stars. Our results suggest that fewer than ~0.1% of the stellar systems within 50 pc possess the type of transmitters searched in this survey. This work provides the most stringent limit on the number of low power radio transmitters around nearby stars to date. We explored several metics to compare our results to previous SETI efforts. We developed a new figure-of-merit that can encompass a wider set of parameters and can be used on future SETI experiments for a meaningful comparison.We note that the current BL state-of-the-art digital backend installed at the Green Bank Observatory is the fastest ever used for a SETI experiment by a factor of a few. Here we will describe the potential use of the BL backend by other groups on complementary science, as well as a mention the ongoing and potential collaborations focused in
Vaile, R. A.
SETI offers an extraordinary catalyst in our search for a better education. While the glamour of movie images increased the general public awareness of the term "SETI", we are challenged to improve the level of public understanding of the fundamental scientific and technological issues involved in SETI. It is also critical to keep in mind the reality of human existence. No country seems entirely at peace, whether one considers cultural, trade, military, or heritage issues; no country seems content with the breadth and standards of education for following generations. However, SETI requires generations to participate across cultures, and this long-term human involvement must be sustained through both education and communication across many disciplines and different cultures. For both these major roles, SETI appears to offer a tantalising range and depth, both in educational tools, and in superb tests of communication skills. This paper considers the educational influence of roles evoked by SETI issues. We will briefly consider the range in expertise needed in SETI, the means of improving the public SETI awareness, and mechanisms through which such education may explore the consequences of any SETI result (whether judged as successful or not). Examples of the use of SETI in formal secondary and University education are briefly reviewed.
Project Help Donate Porting Graphics Add-ons Science About SETI@home About Astropulse Science Community Message boards Questions and Answers Teams Profiles User search Web sites Pictures and music User University of California SETI@home and Astropulse are funded by grants from the National Science Foundation
Broadening and Simplifying the First SETI Protocol
Michaud, M. A. G.
The Declaration of Principles Concerning Activities Following the Detection of Extraterrestrial Intelligence, known informally as the First SETI Protocol, is the primary existing international guidance on this subject. During the fifteen years since the document was issued, several people have suggested revisions or additional protocols. This article proposes a broadened and simplified text that would apply to the detection of alien technology in our solar system as well as to electromagnetic signals from more remote sources.
Toward understanding the active SETI debate: Insights from risk communication and perception
Korbitz, Adam
2014-12-01
Insights from the robust field of risk communication and perception have to date been almost totally absent from the policy debate regarding the relative risks and merits of Active SETI or Messaging to Extraterrestrial Intelligence (METI). For many years, the practice (or proposed practice) of Active SETI has generated a vigorous and sometimes heated policy debate within the scientific community. There have also been some negative reactions in the media toward the activities of those engaged in Active SETI. Risk communication is a scientific approach to communication regarding situations involving potentially sensitive or controversial situations in which there may be high public concern and low public trust. The discipline has found wide acceptance and utility in fields such as public health, industrial regulation and environmental protection. Insights from the scientific field of risk communication (such as omission bias, loss aversion, the availability heuristic, probability neglect, and the general human preference for voluntary over involuntary risks) may help those who have participated in either side of the debate over Active SETI to better understand why the debate has taken on this posture. Principles of risk communication and risk perception may also help those engaged in Active SETI to communicate more effectively with other scientists, the public, with the media, and with policy makers regarding their activities and to better understand and respond to concerns expressed regarding the activity.
Back to the future: SETI before the space age
Dick, Steven J.
1995-02-01
In the late 1890s and early 1900s, before the advent of formalized search for extraterrestrial intelligence (SETI) programs, scientists such as Nikola Tesla and Gulielmo Marconi reported evidence of extraterrestrial radio signals. This paper reviews the history of 'interstellar/interplanetary radio communication'. The investigations of David P. Todd and Donald Menzel are discussed, and the fields of radio communication and radio astronomy are mentioned briefly.
SETI with Help from Five Million Volunteers: The Berkeley SETI Efforts
Korpela, E. J.; Anderson, D. P.; Bankay, R.; Cobb, J.; Foster, G.; Howard, A.; Lebofsky, M.; Marcy, G.; Parsons, A.; Siemion, A.; von Korff, J.; Werthimer, D.; Douglas, K. A.
2009-12-01
We summarize radio and optical SETI programs based at the University of California, Berkeley. The ongoing SERENDIP V sky survey searches for radio signals at the 300 meter Arecibo Observatory. The currently installed configuration supports 128 million channels over a 200 MHz bandwidth with 1.6 Hz spectral resolution. Frequency stepping allows the spectrometer to cover the full 300 MHz band of the Arecibo L-band receivers. The final configuration will allow data from all 14 receivers in the Arecibo L-band Focal Array to be monitored simultaneously with over 1.8 billion simultaneous channels. SETI@home uses desktop computers volunteers to analyze over 100 TB of at taken at Arecibo. Over 5 million volunteers have run SETI@home during its 10 year history. The SETI@home sky survey is 10 times more sensitive than SERENDIP V but it covers only a 2.5 MHz band, centered on 1420 MHz. SETI@home searches a much wider parameter space, including 14 octaves of signal bandwidth and 15 octaves of pulse period with Doppler drift corrections from -100 Hz/s to +100 Hz/s. The ASTROPULSE project is the first SETI search for μs time scale pulses in the radio spectrum. Because short pulses are dispersed by the interstellar medium, and amount of dispersion is unknown, ASTROPULSE must search through 30,000 possible dispersions. Substantial computing power is required to conduct this search, so the project will use volunteers and their personal computers to carry out the computation (using distributed computing similar to SETI@home). The SEVENDIP optical pulse search looks for ns time scale pulses at visible wavelengths. It utilizes an automated 30 inch telescope, three ultra fast photo multiplier tubes and a coincidence detector. The target list includes F,G,K and M stars, globular cluster and galaxies.
Search for extraterrestrial intelligence (SETI)
International Nuclear Information System (INIS)
Morrison, P.; Billingham, J.; Wolfe, J.
1977-01-01
Findings are presented of a series of workshops on the existence of extraterrestrial intelligent life and ways in which extraterrestrial intelligence might be detected. The coverage includes the cosmic and cultural evolutions, search strategies, detection of other planetary systems, alternate methods of communication, and radio frequency interference. 17 references
Broad horizons SETI, SF and education
Griffiths, Martin
2004-04-01
Science fiction (SF) is often perceived as a ‘fringe’ form of entertainment that excites the socially challenged. This misperception detracts from the critical, scientific and interpretive nature of the genre which can be directed into science teaching at school and university levels as an innovative way of exploring the cultural background, politics, leitmotif and themes of society, science and their operation. One example is the ‘alien’ theme in SF; it is perceptually one of the driving factors in the search for extraterrestrial intelligence (SETI). Such a topic can become an introduction to current technology, the motives and politics of science and the sociological implications inherent in a confrontation with the ideal of man's uniqueness in the cosmos. When applied to the SETI, SF engenders a constructive convergence in studies such as biological determinism, the evolution of life, communication, interstellar travel and methods of contact, thus enriching the consideration of possible life in the cosmos. Adopting elements of SF in lifelong learning therefore enables informed, imaginative reflection and debate that educates, trains and instructs, broadening the potential of students and their future roles by invoking an analysis of vital public, scientific and humanistic fields.
Evolution of Life and SETI (Evo-SETI)
Maccone, Claudio
When SETI scientists will be able to discover a signal or just some signs of an Extra-Terrestrial (ET) Civilization, those ETs should turn out to be technologically advanced at least as much as Humans, if not more, or much more so. Comparing the technological level of two different Civilizations is then a key issue in SETI. But at the moment we only know about the development of life on Earth over the last 3.5 billion years. We thus need to mathematically model the evolution of life on Earth (RNA to Humans) and then apply our results to other extra-solar planets to find out “where they stand” along their evolution of life. In a series of recent papers and in a book (refs. [1] through [4]) this author introduced a new statistical model embracing SETI, Darwinian Evolution and Human History into a unified statistical picture and concisely called Evo-SETI (Evolution & SETI). The relevant mathematical instruments are: 1) The statistical generalization of the Drake equation yielding the number N of communicating ET civilizations in the Galaxy. Assuming that each input variable in the Drake equation was a random variable, rather than just a pure number, N was shown to follow the lognormal probability distribution having as mean value the sum of the input mean values, and as variance the sum of the input variances (ref. [1]). 2) Geometric Brownian Motion (GBM), the stochastic process representing Evolution as the stochastic increase of the number of Species living on Earth over the last 3.5 billion years. This GBM is well-known in the mathematics of finances (Black-Sholes models). Its main features are that its probability density function (pdf) is a lognormal pdf, and its mean value is either an increasing, or, more rarely (as in the Mass Extinctions of the past) a decreasing exponential of the time. 3) The probability distributions known as b-lognormals, i.e. lognormals starting at a certain positive instant b>0 rather than at the origin. These b-lognormals were then
Charbonneau, Rebecca
2018-01-01
Cold War mythology is rife with stories about secrecy, competition, espionage, and animosity. Yet the history behind the myth-- the overlooked scientists collaborating outside of the aims of the state-- also tells an interesting story. This paper examines the challenges of international scientific collaboration during the Cold War, focusing especially on a case study concerning Soviet radio astronomer Iosif Samuilovich Shklovskii and U.S. astrophysicist Carl Sagan, and their collaborative work on the search for extraterrestrial intelligence (SETI). Despite the hyper-politics that instigated and fueled the Space Race, SETI was held up as an ideal internationalist science, with the lofty goal of uniting all of humanity by situating it within a cosmic community. Although the internationalism of SETI discourse is not entirely unfounded due to its roots in international collaboration, further research indicates that such internationalism was in reality instilled with geopolitics, international conflict, and even espionage. That said, however, the cultural and philosophical perspectives of individual SETI scientists led them to operate within the tensions between national and ideological restraints and their own personal philosophical perspectives. In reviewing the letters of correspondence, conference proceedings, interviews, transcripts of lectures, and autobiographical writings of early-SETI radio astronomers, this paper ultimately argues that, although SETI was not the ideal internationalist science it was portrayed as, SETI pioneers were able to connect and form international networks within a contentious system which often centred on the restriction of free information and international collaboration through their mutual unconventional scientific interests, and facilitated by their personal utopian futurist philosophies.
Werthimer, Dan; Anderson, David; Bowyer, Stuart; Cobb, Jeff; Demorest, Paul
2002-01-01
We summarize results from two radio and two optical SETI programs based at the University of California, Berkeley. We discuss the most promising candidate signals from these searches and present plans for future SETI searches, including SERENDIP V and SETI@home II. The ongoing SERENDIP sky survey searches for radio signals at the 300 meter Arecibo Observatory. SERENDIP IV uses a 168 million channel spectrum analyser and a dedicated receiver to take data 24 hours a day, year round. The sky survey covers a 100 MHz band centered at the 21 cm line (1420 MHz) and declinations from -2 to +38 degrees. SETI@home uses desktop computers of 3.5 million volunteers to analyse 50 Terabytes of data taken at Arecibo. The SETI@home sky survey is 10 times more sensitive and searches a much wider variety of signal types than SERRENDIP IV but covers only a 2.5 MHz band. SETI@home is the planet's largest supercomputer, averaging 25 Tflops. SETI@home participants have contributed over a million years of computing time so far. The SEVENDIP optical pulse search looks for nS time scale pulses at optical wavelengths. It utilizes an automated 30 inch telescope, three ultra fast photo multiplier tubes and a coincidence detector. The target list includes F,G,K and M stars, globular cluster and galaxies. The SPOCK optical SETI program searches for narrow band continuous signals using spectra taken by Marcy and his colleagues in their planet search at Keck observatory.
Shostak, Seth
2011-02-01
While modern SETI experiments are often highly sensitive, reaching detection limits of 10 -25 W/m 2 Hz in the radio, interstellar distances imply that if extraterrestrial societies are using isotropic or broad-beamed transmitters, the power requirements for their emissions are enormous. Indeed, isotropic transmissions to the entire Galaxy, sufficiently intense to be detectable by our current searches, would consume power comparable to the stellar insolation of an Earth-size planet. In this paper we consider how knowledge can be traded for power, and how, and to what degree, astronomical accuracy can reduce the energy costs of a comprehensive transmission program by putative extraterrestrials. Indeed, an exploration of how far this trade-off might be taken suggests that extraterrestrial transmitting strategies of civilizations only modestly more advanced than our own would be, as are our SETI receiving experiments, inexpensive enough to allow multiple efforts. We explore the consequences this supposition has for our SETI listening experiments.
L factor: hope and fear in the search for extraterrestrial intelligence
Rubin, Charles T.
2001-08-01
The L factor in the Drake equation is widely understood to account for most of the variance in estimates of the number of extraterrestrial intelligences that might be contacted by the search for extraterrestrial intelligence (SETI). It is also among the hardest to quantify. An examination of discussions of the L factor in the popular and technical SETI literature suggests that attempts to estimate L involve a variety of potentially conflicting assumptions about civilizational lifespan that reflect hopes and fears about the human future.
The lure of local SETI: Fifty years of field experiments
Ailleris, Philippe
2011-01-01
With the commemoration in October 2007 of the Sputnik launch, space exploration celebrated its 50th anniversary. Despite impressive technological and scientific achievements the fascination for space has weakened during the last decades. One contributing factor has been the gradual disappearance of mankind's hope of discovering extraterrestrial life within its close neighbourhood. In striking contrast and since the middle of the 20th century, a non-negligible proportion of the population have already concluded that intelligent beings from other worlds do exist and visit Earth through space vehicles popularly called Unidentified Flying Objects (UFOs). In light of the continuous public interest for the UFO enigma symbolized by the recent widely diffused media announcements on the release of French and English governmental files; and considering the approach of broadening the strategies of the "Active SETI" approach and the existence of a rich multi-disciplinary UFO documentation of potential interest for SETI; this paper describes some past scientific attempts to demonstrate the physical reality of the phenomena and potentially the presence on Earth of probes of extraterrestrial origin. Details of the different instrumented field studies deployed by scientists and organizations during the period 1950-1990 in the USA, Canada and Europe are provided. In conclusion it will be argued that while continuing the current radio/optical SETI searches, there is the necessity to maintain sustaining attention to the topic of anomalous aerospace phenomena and to develop new rigorous research approaches.
The Search for Extraterrestrial Intelligence in the 1960s: Science in Popular Culture
Smith, Sierra
2012-01-01
Building upon the advancement of technology during the Second World War and the important scientific discoveries which have been made about the structure and components of the universe, scientists, especially in radio astronomy and physics, began seriously addressing the possibility of extraterrestrial intelligence in the 1960s. The Search for Extraterrestrial Intelligence (SETI) quickly became one of the most controversial scientific issues in the post Second World War period. The controversy played out, not only in scientific and technical journals, but in newspapers and in popular literature. Proponents for SETI, including Frank Drake, Carl Sagan, and Philip Morrison, actively used a strategy of engagement with the public by using popular media to lobby for exposure and funding. This paper will examine the use of popular media by scientists interested in SETI to popularize and heighten public awareness and also to examine the effects of popularization on SETI's early development. My research has been generously supported by the National Radio Astronomy Observatory.
Quality of Institutions : Does Intelligence Matter?
Isaac Kalonda-Kanyama; Oasis Kodila-Tedika
2012-01-01
This paper analyzes the eect of the average level of intelligence on different measures of the quality of institutions, using a 2006 cross-sectional sample of 113 countries. The results show that average IQ positively affects all the measures of institutional quality considered in our study, namely government efficiency, regulatory quality, rule of law, political stability and voice and accountability. The positive effect of intelligence is robust to controlling for other determinants of inst...
The SETI episode in the 1967 discovery of pulsars
Penny, Alan John
2013-09-01
In the winter of 1967 Cambridge radio astronomers discovered a new type of radio source of such an artificial seeming nature that for a few weeks some members of the group had to seriously consider whether they had discovered an extraterrestrial intelligence. Although their investigations lead them to a natural explanation (they had discovered pulsars), they had discussed the implications if it was indeed an artificial source: how to verify such a conclusion and how to announce it, and whether such a discovery might be dangerous. In this they presaged many of the components of the SETI Detection Protocols and the proposed Reply Protocols which have been used to guide the responses of groups dealing with the detection of an extraterrestrial intelligence. These Protocols were only established some twenty five years later in the 1990s and 2000s. Using contemporary and near-contemporary documentation and later recollections, this paper discusses in detail what happened that winter.
Teodorani, M.
2003-02-01
In the ambit of the SETI Project, a new branch named SETV (Search for Extraterrestrial Visitation) was born very recently due to the international effort of some engineers, astronomers and other researchers, and it is now in a development phase with several monitoring projects. SETV is aimed at investigating, by using well-tested means of physical and technological sciences, the possible evidence of extraterrestrial visitations inside our solar system. On the basis of statistical calculations of galactic migration, and of models coming from standard stellar evolution, Dyson theory and advanced possibilities invoked by theoretical physics, the historical excursus which turned the SETA hypothesis (Search for Extraterrestrial Artifacts), developed in the 80', into the present SETV definition, is presented in detail. The possibility that extraterrestrial intelligences are present inside our solar system with inhabited and/or robotic probes is discussed, including the possibility that our planet is one of their targets. A proposal concerning instrumented multi-wavelength surveys and identification of such exogenous probes is presented.
SETI: A good introductory physics topic
Hobson, Art
1997-04-01
If America is to achieve the science literacy that is essential to industrialized democracy, all students must study such topics as scientific methodology, pseudoscience, ozone depletion, and global warming. My large-enrollment liberal-arts physics course covers the great principles of physics along with several such philosophical and societal topics. It is easy to include the interdisciplinary context of physics in courses for non-scientists, because these courses are flexible, conceptual, and taught to students whose interests span a broad range. Students find these topics relevant and fascinating, leading to large enrollments by non-scientists even in courses labeled ''physics.'' I will discuss my approach to teaching the search for extra-terrestrial intelligence (SETI), a topic with lots of good physics and with connections to scientific methodology and pseudoscience. A textbook for this kind of course has been published, Physics: Concepts and Connections (Prentice-Hall, 1995).
A language based on analogy to communicate cultural concepts in SETI
Musso, Paolo
2011-02-01
The present paper is a synthesis of three presentation given by myself at the Toulouse IAC 2001 ( Analogy as a tool to communicate abstract concepts in SETI), the Bremen IAC 2003 ( From maths to culture: towards an effective message), and the Vancouver IAC 2004 ( Philosophical and religious implications of extraterrestrial intelligent life). Its aim is to find a way to make our cultural concepts understandable to hypothetical extraterrestrials (ETs) in a SETI communication. First of all, I expose the reasons why I think that analogy could be a good tool for this purpose. Then, I try to show that this is possible only in the context of an integrated language, using both abstract symbols and pictures, also sketching two practical examples about some basic concepts of our moral and religious tradition. Further studies are required to determine whether this method could be extended to the higher-level abstract concepts in the other fields of our culture. Finally, I discuss the possible role of mathematics, logic and natural science in the construction of an analogy-based language for interstellar messages with a cultural content and a possible way of managing this matter from a social point of view.
SETI at the spin-flip line frequency of positronium.
Mauersberger, R.; Wilson, T. L.; Rood, R. T.; Bania, T. M.; Hein, H.; Linhart, A.
1996-02-01
A directed search for extraterrestrial intelligence (SETI) has been carried out using the IRAM 30m telescope. Following a suggestion by Kardashev (1979), the search was conducted at the spin-flip line of the lightest atom, namely positronium, at 203GHz. Most of the 17 targets are mature stars with excess infrared radiation, which might be the waste heat of a power-rich technological civilisation. The rest frame of the cosmic background radiation was chosen as the velocity frame. The spectral resolution used was 9.7kHz. From the noise level, which was determined by the limited telescope time and weather conditions, the upper limit for the power of artificial omnidirectional transmitters at the positronium line frequency is of order 10^15^W. The relevance of this non-detection is discussed.
New Evo-SETI results about civilizations and molecular clock
Maccone, Claudio
2017-01-01
In two recent papers (Maccone 2013, 2014) as well as in the book (Maccone 2012), this author described the Evolution of life on Earth over the last 3.5 billion years as a lognormal stochastic process in the increasing number of living Species. In (Maccone 2012, 2013), the process used was `Geometric Brownian Motion' (GBM), largely used in Financial Mathematics (Black-Sholes models). The GBM mean value, also called `the trend', always is an exponential in time and this fact corresponds to the so-called `Malthusian growth' typical of population genetics. In (Maccone 2014), the author made an important generalization of his theory by extending it to lognormal stochastic processes having an arbitrary trend m L (t), rather than just a simple exponential trend as the GBM have. The author named `Evo-SETI' (Evolution and SETI) his theory inasmuch as it may be used not only to describe the full evolution of life on Earth from RNA to modern human societies, but also the possible evolution of life on exoplanets, thus leading to SETI, the current Search for ExtraTerrestrial Intelligence. In the Evo-SETI Theory, the life of a living being (let it be a cell or an animal or a human or a Civilization of humans or even an ET Civilization) is represented by a b-lognormal, i.e. a lognormal probability density function starting at a precise instant b (`birth') then increasing up to a peak-time p, then decreasing to a senility-time s (the descending inflexion point) and then continuing as a straight line down to the death-time d (`finite b-lognormal'). (1) Having so said, the present paper describes the further mathematical advances made by this author in 2014-2015, and is divided in two halves: Part One, devoted to new mathematical results about the History of Civilizations as b-lognormals, and (2) Part Two, about the applications of the Evo-SETI Theory to the Molecular Clock, well known to evolutionary geneticists since 50 years: the idea is that our EvoEntropy grows linearly in time
Heller, René
2018-03-01
The SETI Encryption code, written in Python, creates a message for use in testing the decryptability of a simulated incoming interstellar message. The code uses images in a portable bit map (PBM) format, then writes the corresponding bits into the message, and finally returns both a PBM image and a text (TXT) file of the entire message. The natural constants (c, G, h) and the wavelength of the message are defined in the first few lines of the code, followed by the reading of the input files and their conversion into 757 strings of 359 bits to give one page. Each header of a page, i.e. the little-endian binary code translation of the tempo-spatial yardstick, is calculated and written on-the-fly for each page.
Visions of human futures in space and SETI
Wright, Jason T.; Oman-Reagan, Michael P.
2018-04-01
We discuss how visions for the futures of humanity in space and SETI are intertwined, and are shaped by prior work in the fields and by science fiction. This appears in the language used in the fields, and in the sometimes implicit assumptions made in discussions of them. We give examples from articulations of the so-called Fermi Paradox, discussions of the settlement of the Solar System (in the near future) and the Galaxy (in the far future), and METI. We argue that science fiction, especially the campy variety, is a significant contributor to the `giggle factor' that hinders serious discussion and funding for SETI and Solar System settlement projects. We argue that humanity's long-term future in space will be shaped by our short-term visions for who goes there and how. Because of the way they entered the fields, we recommend avoiding the term `colony' and its cognates when discussing the settlement of space, as well as other terms with similar pedigrees. We offer examples of science fiction and other writing that broaden and challenge our visions of human futures in space and SETI. In an appendix, we use an analogy with the well-funded and relatively uncontroversial searches for the dark matter particle to argue that SETI's lack of funding in the national science portfolio is primarily a problem of perception, not inherent merit.
Bright environments vision of the Intelligent Lighting Institute (ILI)
Özçelebi, T.
2014-01-01
The Bright Environments research program of the Eindhoven University of Technology Intelligent Lighting Institute aims to find new methods of intelligent lighting control and human interaction. We present a summary of the institute’s work on this research field and the research vision of the Bright
The Breakthrough Listen Initiative and the Future of the Search for Intelligent Life
Enriquez, J. Emilio; Siemion, Andrew; Croft, Steve; Hellbourg, Greg; Lebofsky, Matt; MacMahon, David; Price, Danny; DeBoer, David; Werthimer, Dan
2017-05-01
Unprecedented recent results in the fields of exoplanets and astrobiology have dramatically increased the interest in the potential existence of intelligent life elsewhere in the galaxy. Additionally, the capabilities of modern Searches for Extraterrestrial Intelligence (SETI) have increased tremendously. Much of this improvement is due to the ongoing development of wide bandwidth radio instruments and the Moore's Law increase in computing power over the previous decades. Together, these instrumentation improvements allow for narrow band signal searches of billions of frequency channels at once.The Breakthrough Listen Initiative (BL) was launched on July 20, 2015 at the Royal Society in London, UK with the goal to conduct the most comprehensive and sensitive search for advanced life in humanity's history. Here we detail important milestones achieved during the first year and a half of the program. We describe the key BL SETI surveys and briefly describe current facilities, including the Green Bank Telescope, the Automated Planet Finder and the Parkes Observatory. We also mention the ongoing and potential collaborations focused on complementary sciences, these include pulse searches of pulsars and FRBs, as well as astrophysically powered radio emission from stars targeted by our program.We conclude with a brief view towards future SETI searches with upcoming next-generation radio facilities such as SKA and ngVLA.
Smart, John M.
2012-09-01
civilizations, but constrained transcension should be by far the norm for all mature civilizations. The transcension hypothesis has significant and testable implications for our current and future METI and SETI agendas. If all universal intelligence eventually transcends to black-hole-like environments, after which some form of merger and selection occurs, and if two-way messaging (a send-receive cycle) is severely limited by the great distances between neighboring and rapidly transcending civilizations, then sending one-way METI or probes prior to transcension becomes the only real communication option. But one-way messaging or probes may provably reduce the evolutionary diversity in all civilizations receiving the message, as they would then arrive at their local transcensions in a much more homogenous fashion. If true, an ethical injunction against one-way messaging or probes might emerge in the morality and sustainability systems of all sufficiently advanced civilizations, an argument known as the Zoo hypothesis in Fermi paradox literature, if all higher intelligences are subject to an evolutionary attractor to maximize their local diversity, and a developmental attractor to merge and advance universal intelligence. In any such environment, the evolutionary value of sending any interstellar message or probe may simply not be worth the cost, if transcension is an inevitable, accelerative, and testable developmental process, one that eventually will be discovered and quantitatively described by future physics. Fortunately, transcension processes may be measurable today even without good physical theory, and radio and optical SETI may each provide empirical tests. If transcension is a universal developmental constraint, then without exception all early and low-power electromagnetic leakage signals (radar, radio, television), and later, optical evidence of the exoplanets and their atmospheres should reliably cease as each civilization enters its own technological singularities
Narusawa, Shin-ya; Aota, Tatusya; Kishimoto, Ryo
2018-04-01
In the case of radio SETI, there are predicted frequencies which extraterrestrial beings select to send messages to other civilizations. Those are called ;magic frequencies. Considering the optical region, terrestrial technologies can not transmit arbitrary wavelengths of high-power optical lasers, easily. In this article, we discuss communications among civilizations with the same level of technology as us to enhance the persuasive power. It might be possible to make a reasonable assumption about the laser wavelengths transmitted by extraterrestrial intelligences to benefit optical SETI (OSETI) methods. Therefore, we propose some ;magic wavelengths; for spectroscopic OSETI observations in this article. From the senders point of view, we argue that the most favorable wavelength used for interstellar communication would be the one of YAG lasers, at 1.064 μm or its Second Harmonic Generation (532.1 nm). On the contrary, there are basic absorption lines in the optical spectra, which are frequently observed by astrophysicists on Earth. It is possible that the extraterrestrials used lasers, which wavelengths are tuned to such absorption lines for sending messages. In that case, there is a possibility that SHG and/or Sum Frequency Generation of YAG and YLF lasers are used. We propose three lines at, 393.8 nm (near the Ca K line), 656.5 nm (near the Hα line) and 589.1 nm (Na D2 line) as the magic wavelengths.
Synchronized SETI-The Case for "Opposition"
Corbet, Robin H. D.
2003-06-01
If the signals being sought in search for extraterrestrial intelligence (SETI) programs exist but are brief (for example, they are produced intermittently to conserve energy), then it is essential to know when these signals will arrive at the Earth. Different types of transmitter/receiver synchronization schemes are possible, which vary in the relative amount of effort required by the transmitter and the receiver. The case is made for a scheme that is extremely simple for the receiver: Make observations of a target when it is at maximum angular distance from the Sun (i.e., "opposition"). This strategy requires that the transmitter has accurate knowledge of the distance and proper motion of the Sun and the orbit of the Earth. It is anticipated that within the next 10-20 years it will be possible to detect directly nearby extrasolar planets of approximately terrestrial mass. Since extraterrestrial transmitters are expected to have significantly more advanced technology, it is not unreasonable to expect that they would be able to detect the presence of the Earth and measure its orbit at even greater distances. This strategy is simple to implement, and opposition is also typically the time when observations are easiest to make. Limited opposition surveys contained in a number of all-sky surveys have already been performed. However, full-sky opposition surveys are best suited to detectors with very large fields of view.
1976-01-01
Preliminary (1977-1983), intermediate (1982-1988), and long term (1989+) phases of the search for extraterrestrial intelligence (SETI) program are examined as well as the benefits to be derived in radioastronomy and the problems to be surmounted in radio frequency interference. The priorities, intrinsic value, criteria, and strategy for the search are discussed for both terrestrial and lunar-based CYCLOPS and for a space SETI system located at lunar liberation point L4. New initiatives related to antenna independent technology, multichannel analyzers, and radio frequency interference shielding are listed. Projected SETI program costs are included.
Multiple intelligence: ethical leadership feature consistent financial institutions.
Directory of Open Access Journals (Sweden)
Diamela Nava
2015-03-01
Full Text Available This study aims to make a theoretical underpinning contrast analysis on the multiple intelligences: consistent feature of Ethical Leadership in Financial Institutions. However, this research was conducted under a qualitative approach, a descriptive, using document analysis, which eventually might be considered that would support multiple intelligences to implement certain capabilities, to achieve the objectives with the purpose and from the rational point of view, to know how to establish significant changes in some ways it is, the way to assess the cognitive abilities of integrating human talent in organizations. Therefore, the role of the leader is to guide and support the development of human potential in their group as a community of interest in order to achieve the aspirations of the organization using intelligence as a strategic tool in different ways to not limit your imagination, judgment, and cooperative action.
Distributed Processing of SETI Data
Korpela, Eric
As you have read in prior chapters, researchers have been performing progressively more sensitive SETI searches since 1960. Each search has been limited by the technologies available at the time. As radio frequency technologies have become more efficient and computers have become faster, the searches have increased in capacity and become more sensitive. Often the limits of the hardware that performs the calculations required to process the telescope data in order to expose any embedded signals is what limits the sensitivity of the search. Shortly before the start of the 21st century, projects began to appear that exploited the processing capabilities of computers connected to the Internet in order to solve problems that required a large amount of computing power. The SETI@home project, managed by myself and a group of researchers at the Space Sciences Laboratory of the University of California, Berkeley, was the first attempt to use large-scale distributed computing to solve the problems of performing a sensitive search for narrow band radio signals from extraterrestrial civilizations. (Korpela et al., 2001) A follow-on project, Astropulse, searches for extraterrestrial signals with wider bandwidths and shorter time durations. Both projects are ongoing at the present time (mid-2010).
OPTICAL SETI OBSERVATIONS OF THE ANOMALOUS STAR KIC 8462852
International Nuclear Information System (INIS)
Schuetz, Marlin; Vakoch, Douglas A.; Shostak, Seth; Richards, Jon
2016-01-01
To explore the hypothesis that KIC 8462852's aperiodic dimming is caused by artificial megastructures in orbit, rather than a natural cause such as cometary fragments in a highly elliptical orbit, we searched for electromagnetic signals from KIC 8462852 indicative of extraterrestrial intelligence. The primary observations were in the visible optical regime using the Boquete Optical SETI Observatory in Panama. In addition, as a recommended preparatory exercise for the possible future detection of a candidate signal, three of six observing runs simultaneously searched radio frequencies at the Allen Telescope Array in California. No periodic optical signals greater than 67 photons m −2 within a time frame of 25 ns were seen. If, for example, any inhabitants of KIC 8462852 were targeting our solar system with 5 MJ laser pulses, locally illuminating an approximately 3 au diameter disk, the signal could have been detected at the Boquete Observatory. The limits on narrowband radio signals were 180–300 Jy Hz at 1 and 8 GHz, respectively. While the power requirement for a detectable, isotropic narrowband radio transmission from KIC 8462852 is quite high, even modest targeting on the part of the putative extraterrestrials can lower this power substantially.
Optical SETI Observations of the Anomalous Star KIC 8462852
Schuetz, Marlin; Vakoch, Douglas A.; Shostak, Seth; Richards, Jon
2016-07-01
To explore the hypothesis that KIC 8462852's aperiodic dimming is caused by artificial megastructures in orbit, rather than a natural cause such as cometary fragments in a highly elliptical orbit, we searched for electromagnetic signals from KIC 8462852 indicative of extraterrestrial intelligence. The primary observations were in the visible optical regime using the Boquete Optical SETI Observatory in Panama. In addition, as a recommended preparatory exercise for the possible future detection of a candidate signal, three of six observing runs simultaneously searched radio frequencies at the Allen Telescope Array in California. No periodic optical signals greater than 67 photons m-2 within a time frame of 25 ns were seen. If, for example, any inhabitants of KIC 8462852 were targeting our solar system with 5 MJ laser pulses, locally illuminating an approximately 3 au diameter disk, the signal could have been detected at the Boquete Observatory. The limits on narrowband radio signals were 180-300 Jy Hz at 1 and 8 GHz, respectively. While the power requirement for a detectable, isotropic narrowband radio transmission from KIC 8462852 is quite high, even modest targeting on the part of the putative extraterrestrials can lower this power substantially.
Mathematical SETI Statistics, Signal Processing, Space Missions
Maccone, Claudio
2012-01-01
This book introduces the Statistical Drake Equation where, from a simple product of seven positive numbers, the Drake Equation is turned into the product of seven positive random variables. The mathematical consequences of this transformation are demonstrated and it is proven that the new random variable N for the number of communicating civilizations in the Galaxy must follow the lognormal probability distribution when the number of factors in the Drake equation is allowed to increase at will. Mathematical SETI also studies the proposed FOCAL (Fast Outgoing Cyclopean Astronomical Lens) space mission to the nearest Sun Focal Sphere at 550 AU and describes its consequences for future interstellar precursor missions and truly interstellar missions. In addition the author shows how SETI signal processing may be dramatically improved by use of the Karhunen-Loève Transform (KLT) rather than Fast Fourier Transform (FFT). Finally, he describes the efforts made to persuade the United Nations to make the central part...
Science, religion, and the search for extraterrestrial intelligence
Wilkinson, David
2013-01-01
If the discovery of life elsewhere in the universe is just around the corner, what would be the consequences for religion? Would it represent another major conflict between science and religion, even leading to the death of faith? Some would suggest that the discovery of any suggestion of extraterrestrial life would have a greater impact than even the Copernican and Darwinian revolutions. It is now over 50 years since the first modern scientific papers were published on the search for extraterrestrial intelligence (SETI). Yet the religious implications of this search and possible discovery have never been systematically addressed in the scientific or theological arena. SETI is now entering its most important era of scientific development. New observation techniques are leading to the discovery of extra-solar planets daily, and the Kepler mission has already collected over 1000 planetary candidates. This deluge of data is transforming the scientific and popular view of the existence of extraterrestrial intel...
SETI in vivo: testing the we-are-them hypothesis
Makukov, Maxim A.; Shcherbak, Vladimir I.
2018-04-01
After it was proposed that life on Earth might descend from seeding by an earlier extraterrestrial civilization motivated to secure and spread life, some authors noted that this alternative offers a testable implication: microbial seeds could be intentionally supplied with a durable signature that might be found in extant organisms. In particular, it was suggested that the optimal location for such an artefact is the genetic code, as the least evolving part of cells. However, as the mainstream view goes, this scenario is too speculative and cannot be meaningfully tested because encoding/decoding a signature within the genetic code is something ill-defined, so any retrieval attempt is doomed to guesswork. Here we refresh the seeded-Earth hypothesis in light of recent observations, and discuss the motivation for inserting a signature. We then show that `biological SETI' involves even weaker assumptions than traditional SETI and admits a well-defined methodological framework. After assessing the possibility in terms of molecular and evolutionary biology, we formalize the approach and, adopting the standard guideline of SETI that encoding/decoding should follow from first principles and be convention-free, develop a universal retrieval strategy. Applied to the canonical genetic code, it reveals a non-trivial precision structure of interlocked logical and numerical attributes of systematic character (previously we found these heuristically). To assess this result in view of the initial assumption, we perform statistical, comparison, interdependence and semiotic analyses. Statistical analysis reveals no causal connection of the result to evolutionary models of the genetic code, interdependence analysis precludes overinterpretation, and comparison analysis shows that known variations of the code lack any precision-logic structures, in agreement with these variations being post-LUCA (i.e. post-seeding) evolutionary deviations from the canonical code. Finally, semiotic
Maccone, Claudio
2014-08-01
Big History is an emerging academic discipline which examines history scientifically from the Big Bang to the present. It uses a multidisciplinary approach based on combining numerous disciplines from science and the humanities, and explores human existence in the context of this bigger picture. It is taught at some universities. In a series of recent papers ([11] through [15] and [17] through [18]) and in a book [16], we developed a new mathematical model embracing Darwinian Evolution (RNA to Humans, see, in particular, [17] and Human History (Aztecs to USA, see [16]) and then we extrapolated even that into the future up to ten million years (see 18), the minimum time requested for a civilization to expand to the whole Milky Way (Fermi paradox). In this paper, we further extend that model in the past so as to let it start at the Big Bang (13.8 billion years ago) thus merging Big History, Evolution on Earth and SETI (the modern Search for ExtraTerrestrial Intelligence) into a single body of knowledge of a statistical type. Our idea is that the Geometric Brownian Motion (GBM), so far used as the key stochastic process of financial mathematics (Black-Sholes models and related 1997 Nobel Prize in Economics!) may be successfully applied to the whole of Big History. In particular, in this paper we derive the Statistical Drake Equation (namely the statistical extension of the classical Drake Equation typical of SETI) can be regarded as the “frozen in time” part of GBM. This makes SETI a subset of our Big History Theory based on GBMs: just as the GBM is the “movie” unfolding in time, so the Statistical Drake Equation is its “still picture”, static in time, and the GBM is the time-extension of the Drake Equation. Darwinian Evolution on Earth may be easily described as an increasing GBM in the number of living species on Earth over the last 3.5 billion years. The first of them was RNA 3.5 billion years ago, and now 50 million living species or more exist, each
OPTICAL SETI OBSERVATIONS OF THE ANOMALOUS STAR KIC 8462852
Energy Technology Data Exchange (ETDEWEB)
Schuetz, Marlin; Vakoch, Douglas A. [METI International, 100 Pine Street, Suite 1250, San Francisco, CA 94111-5235 (United States); Shostak, Seth; Richards, Jon, E-mail: dvakoch@meti.org [Center for SETI Research, SETI Institute, 189 Bernardo Avenue, Mountain View, CA 94043 (United States)
2016-07-01
To explore the hypothesis that KIC 8462852's aperiodic dimming is caused by artificial megastructures in orbit, rather than a natural cause such as cometary fragments in a highly elliptical orbit, we searched for electromagnetic signals from KIC 8462852 indicative of extraterrestrial intelligence. The primary observations were in the visible optical regime using the Boquete Optical SETI Observatory in Panama. In addition, as a recommended preparatory exercise for the possible future detection of a candidate signal, three of six observing runs simultaneously searched radio frequencies at the Allen Telescope Array in California. No periodic optical signals greater than 67 photons m{sup −2} within a time frame of 25 ns were seen. If, for example, any inhabitants of KIC 8462852 were targeting our solar system with 5 MJ laser pulses, locally illuminating an approximately 3 au diameter disk, the signal could have been detected at the Boquete Observatory. The limits on narrowband radio signals were 180–300 Jy Hz at 1 and 8 GHz, respectively. While the power requirement for a detectable, isotropic narrowband radio transmission from KIC 8462852 is quite high, even modest targeting on the part of the putative extraterrestrials can lower this power substantially.
Life: Here? There? Elsewhere? The Search for Life on Venus and Mars. Life in the Universe Series.
1996
This classroom kit, designed by curriculum developers working with teachers and scientists from the SETI (Search for Extraterrestrial Intelligence) Institute, helps teachers guide students in the exploration of life through the multidisciplinary sciences of paleontology and exobiology. It reflects the real-life methods of science: making…
Space biology research development
Bonting, Sjoerd L.
1993-01-01
The purpose of the Search for Extraterrestrial Intelligence (SETI) Institute is to conduct and promote research related activities regarding the search for extraterrestrial life, particularly intelligent life. Such research encompasses the broad discipline of 'Life in the Universe', including all scientific and technological aspects of astronomy and the planetary sciences, chemical evolution, the origin of life, biological evolution, and cultural evolution. The primary purpose was to provide funding for the Principal Investigator to collaborate with the personnel of the SETI Institute and the NASA-Ames Research center in order to plan and develop space biology research on and in connection with Space Station Freedom; to promote cooperation with the international partners in the space station; to conduct a study on the use of biosensors in space biology research and life support system operation; and to promote space biology research through the initiation of an annual publication 'Advances in Space Biology and Medicine'.
PiHi Observations at the ATA, Conventional and Unconventional SETI
Harp, Gerald; Wilcox, B.; Arbunich, J.; Blair, S.; Backus, P. R.; Tarter, J. C.; Shostak, S.; Jordan, J.; Kilsdonk, T.; Ackermann, R. F.; Ross, J.; ATA Team
2010-01-01
Many radio SETI searches focus on the frequency range where the HI (1.42 GHz) and OH lines (1.6-1.7 GHz) lines are landmarks delineating the water hole This is only a small fraction of the terrestrial microwave window (TMW) from 1-10 GHz. This survey occurs near the center of the TMW at 4.462336275 GHz or π times the HI frequency. We call this the PiHI ("pie high") survey. The inspiration for PiHI observations comes from Carl Sagan in his book, Contact. This survey builds upon and extends a previous survey at PiHI (Blair, D. G. et al. (1992), MNRAS, 257, 105) with greater sensitivity, resolution, and coverage. We survey the nearest 94 main sequence stars in the HabCat catalog (Turnbull, M. C. and Tarter, J. C. (2003), ApJS, 145, 181) with spectral classes between F9 and G7 (max. radius 62 pc). The ATA's flexibility allows simultaneous measurements of targeted observations on stars (with beamformers) and 1° FOV "blind” observations of the areas around target stars (with imaging correlator). The targeted observations are carried out with a high resolution (0.7 Hz) spectrometer and integration times on the order of 200 s. The spectral imaging correlator measures a 50 x 50 grid of points with 3 kHz spectral resolution. This survey shows several signals of minor interest were discovered, though none of the signals reported are continuously "on,” which is an important characteristic for the positive identification of an ETI signal. The ATA has been funded through generous grants from the Paul G. Allen Family Foundation, the SETI Institute, UC Berkeley, the National Science Foundation (Grant No. 0540599), Sun Microsystems, Xilinx, Nathan Myhrvold, Greg Papadopoulos, and other corporations and individual donors.
Energy of Extra-Terrestrial Civilizations according to Evo-SETI Theory
Maccone, Claudio
2018-03-01
Consider two great scientists of the past: Kepler (1571-1630) and Newton (1642-1727). Kepler discovered his three laws of planetary motion by observing Mars: he knew experimentally that his three laws were correct, but he didn't even suspect that all three mathematical laws could be derived as purely mathematical consequences by a "superior" mathematical law. The latter was the Law of Gravitation that Newton gave the world together with his supreme mathematical discovery of the Calculus, necessary for that mathematical derivation. We think we did the same for the "molecular clock", the experimental law of genetics discovered in 1962 by Émile Zuckerkandl (1922-2013) and Linus Pauling (1901-1994) and derived by us as a purely mathematical consequence of our mathematical Evo-SETI Theory. Let us now summarize how this mathematical derivation was achieved. Darwinian evolution over the last 3.5 billion years was an increase in the number of living species from one (RNA ?) to the current (say) 50 million. This increasing trend in time looks like being exponential, but one may not assume an exact exponential curve since many species went extinct in the past, especially in the five, big mass extinctions. Thus, the simple exponential curve must be replaced by a stochastic process having an exponential mean value. Borrowing from financial mathematics (the "Black-Sholes models"), this "exponential" stochastic process is called Geometric Brownian Motion (GBM). Its probability density function (pdf) is a lognormal (and not a Gaussian) (Proof: see Ref. [3], Chapter 30, and Ref. [4], and, more in general, refs. [2] and [5]). Lognormal also is the pdf of the statistical number of communicating ExtraTerrestrial (ET) civilizations in the Galaxy at a certain fixed time, like a snapshot: this result was obtained in 2008 by this author as his solution to the Statistical Drake Equation of SETI (Proof: see Ref. [1]). Thus, the GBM of Darwinian evolution may also be regarded as the
Macroinvetebrate Assemblages as Indicators of Water Quality of the West Seti River, Bajhang, Nepal
Directory of Open Access Journals (Sweden)
Mohana Matangulu
2017-08-01
Full Text Available Water quality of the West Seti River, a tributary of the Karnali in West Nepal was assessed using macroinvertebrates as bioindicators. The main objective of the study was to assess the ecological water quality of the West Seti River and to generate a baseline data on macroinvertebrate assemblages. The sampling was conducted during December 2015 and a total of 11 sampling sites were selected from the West Seti River and its tributaries. Qualitative samples of macroinvertebrates were collected from different habitats. Selected physico-chemical parameters such as pH and temperature were estimated on-site. Dissolved oxygen (DO was estimated by Winkler’s method. The macroinvertebrate samples were enumerated and identified up to Family level following standard literature. Chi-square test was performed to see whether macroinvertebrate taxa varied significantly along the altitudinal gradient and between the West Seti River and its tributaries. An ecological assessment tool Nepalese Biotic Score/ Average Score Per Taxon (NEPBIOS/ASPT was applied to assess the water quality of the sampling sites. The pH value ranged from 7.9 to 8.7 indicating the alkaline nature of the river. A total of 1666 individuals belonging to 34 Families and 7 Orders of macro-invertebrates were observed. The highest diversity of the macroinvertebrate taxa was observed at site T5 with nineteen Families whereas the lowest taxa diversity was observed at R3 with only five Families. The variation in macroinvertebrate assemblages between the sub-tropical and temperate zones; and the West Seti River and its tributaries were not significant. NEPBIOS/ASPT revealed a score of Water Quality Class of III-IV at Site R3 indicating that the site was polluted. This site was characterized by the abundance of red Chironomids which are considered as the indicators of organic pollution.International Journal of EnvironmentVolume-6, Issue-3, Jun-Aug 2017, page: 25-45
Intelligence in Artificial Intelligence
Datta, Shoumen Palit Austin
2016-01-01
The elusive quest for intelligence in artificial intelligence prompts us to consider that instituting human-level intelligence in systems may be (still) in the realm of utopia. In about a quarter century, we have witnessed the winter of AI (1990) being transformed and transported to the zenith of tabloid fodder about AI (2015). The discussion at hand is about the elements that constitute the canonical idea of intelligence. The delivery of intelligence as a pay-per-use-service, popping out of ...
Race, Margaret S.; Randolph, Richard O.
While formal principles have been adopted for the eventuality of detecting intelligent life in our galaxy (SETI Principles), no such guidelines exist for the discovery of non-intelligent extraterrestrial life within the solar system. Current scientifically based planetary protection policies for solar system exploration address how to undertake exploration, but do not provide clear guidance on what to do if and when life is detected. Considering that martian life could be detected under several different robotic and human exploration scenarios in the coming decades, it is appropriate to anticipate how detection of non-intelligent, microbial life could impact future exploration missions and activities, especially on Mars. This paper discusses a proposed set of interim guidelines based loosely on the SETI Principles and addresses issues extending from the time of discovery through future handling and treatment of extraterrestrial life on Mars or elsewhere. Based on an analysis of both scientific and ethical considerations, there is a clear need for developing operating protocols applicable at the time of discovery and a decision making framework that anticipates future missions and activities, both robotic and human. There is growing scientific confidence that the discovery of extraterrestrial life in some form is nearly inevitable. If and when life is discovered beyond Earth, non-scientific dimensions may strongly influence decisions about the nature and scope of future missions and activities. It is appropriate to encourage international discussion and consideration of the issues prior to an event of such historical significance.
Eustaquio, William Rafael
2015-01-01
As manifested by various studies conducted, the present state of Mathematics education in the teaching-learning process is relatively declining and the existing effort to identify emotional intelligence and mathematics competencies of Mathematics major student-teachers at Higher Education Institutions in Isabela is an attempt to help alleviate the…
New Assumptions to Guide SETI Research
Colombano, S. P.
2018-01-01
The recent Kepler discoveries of Earth-like planets offer the opportunity to focus our attention on detecting signs of life and technology in specific planetary systems, but I feel we need to become more flexible in our assumptions. The reason is that, while it is still reasonable and conservative to assume that life is most likely to have originated in conditions similar to ours, the vast time differences in potential evolutions render the likelihood of "matching" technologies very slim. In light of these challenges I propose a more "aggressive"� approach to future SETI exploration in directions that until now have received little consideration.
Nnodum, B. I.; Ugwuegbulam, C. N.; Agbaenyi, I. G.
2016-01-01
This study is a descriptive survey that investigated the relationship between emotional intelligence and conflict resolution repertoire of couples in tertiary institutions. A sample of 250 married people were drawn from the population of couples in tertiary institutions in Imo State. Two researcher made and validated instruments were used in…
SETI VIA LEAKAGE FROM LIGHT SAILS IN EXOPLANETARY SYSTEMS
International Nuclear Information System (INIS)
Guillochon, James; Loeb, Abraham
2015-01-01
The primary challenge of rocket propulsion is the burden of needing to accelerate the spacecraft’s own fuel, resulting in only a logarithmic gain in maximum speed as propellant is added to the spacecraft. Light sails offer an attractive alternative in which fuel is not carried by the spacecraft, with acceleration being provided by an external source of light. By artificially illuminating the spacecraft with beamed radiation, speeds are only limited by the area of the sail, heat resistance of its material, and power use of the accelerating apparatus. In this paper, we show that leakage from a light sail propulsion apparatus in operation around a solar system analogue would be detectable. To demonstrate this, we model the launch and arrival of a microwave beam-driven light sail constructed for transit between planets in orbit around a single star, and find an optimal beam frequency on the order of tens of GHz. Leakage from these beams yields transients with flux densities of Jy and durations of tens of seconds at 100 pc. Because most travel within a planetary system would be conducted between the habitable worlds within that system, multiply transiting exoplanetary systems offer the greatest chance of detection, especially when the planets are in projected conjunction as viewed from Earth. If interplanetary travel via beam-driven light sails is commonly employed in our galaxy, this activity could be revealed by radio follow-up of nearby transiting exoplanetary systems. The expected signal properties define a new strategy in the search for extraterrestrial intelligence (SETI)
SETI via Leakage from Light Sails in Exoplanetary Systems
Guillochon, James; Loeb, Abraham
2015-10-01
The primary challenge of rocket propulsion is the burden of needing to accelerate the spacecraft’s own fuel, resulting in only a logarithmic gain in maximum speed as propellant is added to the spacecraft. Light sails offer an attractive alternative in which fuel is not carried by the spacecraft, with acceleration being provided by an external source of light. By artificially illuminating the spacecraft with beamed radiation, speeds are only limited by the area of the sail, heat resistance of its material, and power use of the accelerating apparatus. In this paper, we show that leakage from a light sail propulsion apparatus in operation around a solar system analogue would be detectable. To demonstrate this, we model the launch and arrival of a microwave beam-driven light sail constructed for transit between planets in orbit around a single star, and find an optimal beam frequency on the order of tens of GHz. Leakage from these beams yields transients with flux densities of Jy and durations of tens of seconds at 100 pc. Because most travel within a planetary system would be conducted between the habitable worlds within that system, multiply transiting exoplanetary systems offer the greatest chance of detection, especially when the planets are in projected conjunction as viewed from Earth. If interplanetary travel via beam-driven light sails is commonly employed in our galaxy, this activity could be revealed by radio follow-up of nearby transiting exoplanetary systems. The expected signal properties define a new strategy in the search for extraterrestrial intelligence (SETI).
SETI VIA LEAKAGE FROM LIGHT SAILS IN EXOPLANETARY SYSTEMS
Energy Technology Data Exchange (ETDEWEB)
Guillochon, James; Loeb, Abraham, E-mail: jguillochon@cfa.harvard.edu, E-mail: aloeb@cfa.harvard.edu [Harvard-Smithsonian Center for Astrophysics, The Institute for Theory and Computation, 60 Garden Street, Cambridge, MA 02138 (United States)
2015-10-01
The primary challenge of rocket propulsion is the burden of needing to accelerate the spacecraft’s own fuel, resulting in only a logarithmic gain in maximum speed as propellant is added to the spacecraft. Light sails offer an attractive alternative in which fuel is not carried by the spacecraft, with acceleration being provided by an external source of light. By artificially illuminating the spacecraft with beamed radiation, speeds are only limited by the area of the sail, heat resistance of its material, and power use of the accelerating apparatus. In this paper, we show that leakage from a light sail propulsion apparatus in operation around a solar system analogue would be detectable. To demonstrate this, we model the launch and arrival of a microwave beam-driven light sail constructed for transit between planets in orbit around a single star, and find an optimal beam frequency on the order of tens of GHz. Leakage from these beams yields transients with flux densities of Jy and durations of tens of seconds at 100 pc. Because most travel within a planetary system would be conducted between the habitable worlds within that system, multiply transiting exoplanetary systems offer the greatest chance of detection, especially when the planets are in projected conjunction as viewed from Earth. If interplanetary travel via beam-driven light sails is commonly employed in our galaxy, this activity could be revealed by radio follow-up of nearby transiting exoplanetary systems. The expected signal properties define a new strategy in the search for extraterrestrial intelligence (SETI)
Intelligent Information Systems Institute
National Research Council Canada - National Science Library
Gomes, Carla
2004-01-01
...) at Cornell during the first three years of operation. IISI's mandate is threefold: To perform and stimulate research in computational and data-intensive methods for intelligent decision making systems...
Winston, Patrick H.
1983-01-01
The primary goal of the Artificial Intelligence Laboratory is to understand how computers can be made to exhibit intelligence. Two corollary goals are to make computers more useful and to understand certain aspects of human intelligence. Current research includes work on computer robotics and vision, expert systems, learning and commonsense reasoning, natural language understanding, and computer architecture.
A new major SETI project based on Project SERENDIP data and 100,000 personal computers
Sullivan, Woodruff T., III; Werthimer, Dan; Bowyer, Stuart; Cobb, Jeff; Gedye, David; Anderson, David
1997-01-01
We are now developing an innovative SETI project involving massively parallel computation on desktop computers scattered around the world. The public will be uniquely involved in a real scientific project. Individuals will download a screensaver program that will not only provide the usual attractive graphics when their computer is idle, but will also perform sophisticated analysis of SETI data using the host computer. The data are tapped off Project SERENDIP IV's receiver and SETI survey operating on the 305-m-diameter Arecibo radio telescope. We make a continuous tape-recording of a 2-MHz bandwidth signal centered on the 21-cm H I line. The data on these tapes are then preliminarily screened and parceled out by a server that supplies small chunks of data over the Internet to clients possessing the screen-saver software. After the client computer has automatically analyzed a complete chunk of data a report on the best candidate signals is sent back to the server, whereupon a new chunk of data is sent out. If 50,000-100,000 customers can be achieved, the computing power will be equivalent to a substantial fraction of atypical supercomputer, and the project will cover a volume of parameter space comparable to that of SERENDIP IV.
From the Physical World to the Biological Universe: Historical Developments Underlying SETI
Dick, Steven J.
More than thirty years ago the French historian of science Alexandre Koyré (1957) wrote his classic volume, From the Closed World to the Infinite Universe, in which he argued that a fundamental shift in world view had taken place in 17th century cosmology. Between Nicholas of Cusa in the fifteenth century and Newton and Leibniz in the seventeenth, he found that the very terms in which humans thought about their universe had changed. These changes he characterized broadly as the destruction of the closed finite cosmos and the geometrization of space. The occasion of the Third International Bioastronomy Symposium in France is an especially appropriate time to argue that the SETI endeavor represents a test for a similar fundamental shift in cosmological world view, from the physical world to the biological universe. I define the biological universe, equivalent to what I have called before the biophysical cosmology (Dick, 1989), as the scientific world view which holds that life is widespread throughout the universe. In this case the biological universe does not necessarily supersede the physical universe, but a universe filled with life would certainly fundamentally alter our attitude toward the universe, and our place in it. Although Koyré mentioned life beyond the Earth as an adjunct to the revolution from the closed world to the infinite universe, only in the 1980s has the history of science begun to give full treatment to the subject. What follows is meant to be a contribution to that ongoing endeavor to understand where the extraterrestrial life debate fits in the history of science. The modern era in the extraterrestrial life debate is normally dated from Cocconi and Morrison's paper in 1959, and though one can always find precursors, this in my view is a valid perception. Cocconi and Morrison gave definite form to SETI, Frank Drake independently first carried out the experiment, a network of interested scientists began to form and met in Green Bank in
Cosmocentrism and the Active Search for Extraterrestrial Intelligence
Lupisella, M. L.
2010-04-01
Applies cosmocentric perspectives to the question of Active SETI, with a focus on "bootstrapped cosmocultural evolution", which has aspects of both pragmatism and cosmocentrism. Active SETI is supported along with international consultation.
Nexus between Intelligence Education and Intelligence Training: A South African Perspective
Directory of Open Access Journals (Sweden)
M. A. van den Berg
2015-10-01
Full Text Available This paper examines the nexus of intelligence education and training from a South African perspective with the focus on current practices in light of the country’s transition towards democracy. A brief overview is provided on the history and development of the South African intelligence community with specific focus on the civilian intelligence services from the period prior 1994 to date (2015. The main focus, however, is on intelligence education that is currently available from training institutions and universities in South Africa as registered with the Department of Higher Education as well as private training institutions on the one hand, and the intelligence training practices within the statutory intelligence environment on the other. To this extent, the relations between academic institutions and the intelligence structures in terms of education and training within South Africa are perused against other practices within the African continent and internationally. The approaches to the study of intelligence are also addressed within this paper. Likewise, the how, what as well as to whom – pertaining to intelligence education and training availability and accessibility to students and practitioners within South Africa, is reviewed and analysed with the focus on making recommendations for the enhancement and improvement thereof to enable a focus on preparing the next generation of professional intelligence officers.
Astrobiology, history, and society life beyond earth and the impact of discovery
2013-01-01
This book addresses important current and historical topics in astrobiology and the search for life beyond Earth, including the search for extraterrestrial intelligence (SETI). The first section covers the plurality of worlds debate from antiquity through the nineteenth century, while section two covers the extraterrestrial life debate from the twentieth century to the present. The final section examines the societal impact of discovering life beyond Earth, including both cultural and religious dimensions. Throughout the book, authors draw links between their own chapters and those of other contributors, emphasizing the interconnections between the various strands of the history and societal impact of the search for extraterrestrial life. The chapters are all written by internationally recognized experts and are carefully edited by Douglas Vakoch, professor of clinical psychology at the California Institute of Integral Studies and Director of Interstellar Message Composition at the SETI Institute. This interd...
Directory of Open Access Journals (Sweden)
Dr. Maria Luisa A. Valdez
2014-04-01
Full Text Available This research aims to assess the reports generated from the Dermatoglyphics Multiple Intelligence Test (DMIT administered by selected DMIT resource companies and consultancy firms in India with the end view of identifying its implication to career guidance program enhancement of academic institutions. This paper employed the descriptive research method which involved the use of documentary analysis, questionnaires and interviews with purposively selected respondents supported by the researchers’ analysis and insights with reference to the content of the data. Findings of this research revealed that the dermatoglyphics, as a scientific discipline, began with the publication of Purkinje’s thesis (1823 and Galton’s classic book, Fingerprints (1892; DMIT is a remarkable offshoot of Howard Gardner’s Theory of Multiple Intelligences which has the following salient features: Overview of the Dermatoglyphics and the Dermatoglyphics Multiple Intelligence Test/Analysis; Personality Assessment; Profile based on Gardner’s Multiple Intelligences and Dunn’s Brain Lateralization Theories; Learning Styles; Competency and Compatibility Profiles; Working Style; Leadership Style; Management Style; Report Interpretation; and Customized Academic and Relationship Advises; the respondents of this study gave their perceptions with reference to the beneficial results of the DMIT; and the foregoing findings have some implications that may be used by academic institutions to enhance their career guidance program.
Evo-SETI: A Mathematical Tool for Cladistics, Evolution, and SETI
Directory of Open Access Journals (Sweden)
Claudio Maccone
2017-04-01
Full Text Available The discovery of new exoplanets makes us wonder where each new exoplanet stands along its way to develop life as we know it on Earth. Our Evo-SETI Theory is a mathematical way to face this problem. We describe cladistics and evolution by virtue of a few statistical equations based on lognormal probability density functions (pdf in the time. We call b-lognormal a lognormal pdf starting at instant b (birth. Then, the lifetime of any living being becomes a suitable b-lognormal in the time. Next, our “Peak-Locus Theorem” translates cladistics: each species created by evolution is a b-lognormal whose peak lies on the exponentially growing number of living species. This exponential is the mean value of a stochastic process called “Geometric Brownian Motion” (GBM. Past mass extinctions were all-lows of this GBM. In addition, the Shannon Entropy (with a reversed sign of each b-lognormal is the measure of how evolved that species is, and we call it EvoEntropy. The “molecular clock” is re-interpreted as the EvoEntropy straight line in the time whenever the mean value is exactly the GBM exponential. We were also able to extend the Peak-Locus Theorem to any mean value other than the exponential. For example, we derive in this paper for the first time the EvoEntropy corresponding to the Markov-Korotayev (2007 “cubic” evolution: a curve of logarithmic increase.
Evo-SETI SCALE to measure Life on Exoplanets
Maccone, Claudio
2016-04-01
Darwinian Evolution over the last 3.5 billion years was an increase in the number of living species from 1 (RNA?) to the current 50 million. This increasing trend in time looks like being exponential, but one may not assume an exactly exponential curve since many species went extinct in the past, even in mass extinctions. Thus, the simple exponential curve must be replaced by a stochastic process having an exponential mean value. Borrowing from financial mathematics (;Black-Scholes models;), this ;exponential; stochastic process is called Geometric Brownian Motion (GBM), and its probability density function (pdf) is a lognormal (not a Gaussian) (Proof: see ref. Maccone [3], Chapter 30, and ref. Maccone [4]). Lognormal also is the pdf of the statistical number of communicating ExtraTerrestrial (ET) civilizations in the Galaxy at a certain fixed time, like a snapshot: this result was found in 2008 by this author as his solution to the Statistical Drake Equation of SETI (Proof: see ref. Maccone [1]). Thus, the GBM of Darwinian Evolution may also be regarded as the extension in time of the Statistical Drake equation (Proof: see ref. Maccone [4]). But the key step ahead made by this author in his Evo-SETI (Evolution and SETI) mathematical model was to realize that LIFE also is just a b-lognormal in time: every living organism (a cell, a human, a civilization, even an ET civilization) is born at a certain time b (;birth;), grows up to a peak p (with an ascending inflexion point in between, a for adolescence), then declines from p to s (senility, i.e. descending inflexion point) and finally declines linearly and dies at a final instant d (death). In other words, the infinite tail of the b-lognormal was cut away and replaced by just a straight line between s and d, leading to simple mathematical formulae (;History Formulae;) allowing one to find this ;finite b-lognormal; when the three instants b, s, and d are assigned. Next the crucial Peak-Locus Theorem comes. It means
Klein, M. J.
1993-01-01
Extraterrestrial Intelligence is intelligent life that developed somewhere other than the earth. Such life has not yet been discovered. However, scientific research, including astronomy, biology, planetary science and studies of fossils here on earth have led many scientists to conclude that such life may exist on planets orbiting at least some of the hundreds of billions of stars in our Milky Way Galaxy. Today, some researchers are trying to find evidence for extraterrestrial intelligence. This effort is often called SETI, which stands for Search for Extraterrestrial Intelligence. SETI researchers decided that looking for evidence of their technology might be the best way to discover other intelligent life in the Galaxy. They decided to use large radio telescopes to search the sky over a wide range of radio frequencies...
Long-term prospects: Mitigation of supernova and gamma-ray burst threat to intelligent beings
Ćirković, Milan M.; Vukotić, Branislav
2016-12-01
We consider global catastrophic risks due to cosmic explosions (supernovae, magnetars and gamma-ray bursts) and possible mitigation strategies by humans and other hypothetical intelligent beings. While by their very nature these events are so huge to daunt conventional thinking on mitigation and response, we wish to argue that advanced technological civilizations would be able to develop efficient responses in the domain of astroengineering within their home planetary systems. In particular, we suggest that construction of shielding swarms of small objects/particles confined by electromagnetic fields could be one way of mitigating the risk of cosmic explosions and corresponding ionizing radiation surges. Such feats of astroengineering could, in principle, be detectable from afar by advanced Dysonian SETI searches.
Leadership Institute: Building Leadership Capacity through Emotional Intelligence
Argabright, Karen J.; King, Jeff; Cochran, Graham R.; Chen, Claire Yueh-Ti
2013-01-01
Given the changing dynamics of society and the pressures on Extension organizations to adapt, leadership effectiveness has become a crucial element of success. The program presented here is designed to enhance individual emotional intelligence. Through in-depth engagement of the participants, they learn to apply dynamics of emotional intelligence,…
Directory of Open Access Journals (Sweden)
Vincent Nyalungu
2011-07-01
Full Text Available This article presents a discussion on the importance of business intelligence (BI and the role that a specific BI tool, Business Intelligence Enterprise Edition, plays in the strategic decision-making processes in an organisation. The University of the Witwatersrand, often referred to as Wits, was used as a case study. The main objective of a business intelligence tool is to improve the quality and timeliness of the input of data to the organisational decision-making process. The quality of the data, which is an organisational asset, is therefore of the utmost importance. Approaches for the identification of business intelligence from corporate information and knowledge management were also assessed. A questionnaire was administered among key informants within the university in order to address some of the pertinent issues at higher education institutions. In addition, the role of a data warehouse within the business intelligence framework was presented. The paper itself covers a wide range of disciplines from information technology, knowledge management to decision sciences. The article also presents a proposed framework to be used in line with the best practices in the implementation of business intelligence solutions. Keywords: Business Intelligence (BI, Business Intelligence Enterprise Edition (BIEE, Data Warehouse, Strategic Decision Making, Strategic Planning, Higher Education Institutions and Knowledge Management. Disciplines: Information Technology, Knowledge Management, Management Sciences, Decision Sciences & Management
Carl Sagan and Joseph Shklovsky: Intelligent Life in the Universe
Kurt, Vladimir
J. S. Shklovsky and Carl Sagan played an outstanding role in modern astronomy. Their names are well known not only to professional astronomers, but also to millions of educated people in many countries, which are interested in modern state of science research. Among these trends of modern science, which are difficult to define, are such problems, as the creation of Solar system, the origin of life on Earth, the evolution of living organisms on Earth from the simplest viruses to Homo Sapiens, the evolution of intelligence and technology. Finally, both outstanding scientists were deeply interested in the problem of SETI (Search Extraterrestrial Intelligence), i.e. search of extraterrestrial civilizations and methods of making contacts with them. And both scientists were high professionals in their fields. Joseph Shklovsky was a theoretical astronomer in all fields of modern astronomy (geophysics and physics of the upper atmosphere of the Earth, Sun and Solar Corona, Interplanetary Medium and Solar Wind, Interstellar Medium, Supernova and their remnants, the Galaxy and galaxies, Quasars and Cosmology). There is hardly a field in modern astrophysics (except perhaps the theory of the interior structure of stars), where Joseph Shklovsky has not l a bright stamp of his talent…
International Nuclear Information System (INIS)
Chela-Flores, Julian
2001-11-01
Within the context of how to search for life in the Solar System, we discuss the need to consider universal evolutionary biomarkers, in addition to those of biochemical nature that have already been selected for in the biology experiments of the old Viking and future Beagle-2 landers. For the wider problem of the evolution of intelligent behavior on other worlds (the SETI program), the type of experiments suggested below aim at establishing a direct connection between Solar System exploration and the first steps along the pathway toward the evolution of intelligent behavior. The two leading sites for the implementation of the proposed first whole-cell experiments would be, firstly, Europa after the Europa-Orbiter mission, either on the ice-crust, or in the ocean itself by means of a submersible; secondly, such experiments could be implemented once isolated liquid water oases are identified in the Martian substratum. (author)
Is the "Star trek" concept of aliens really naive?: A comment on Duric and Field
Directory of Open Access Journals (Sweden)
Ćirković Milan M.
2004-01-01
Full Text Available Several assumptions used in the recent review paper on the search for extraterrestrial intelligence (SETI by Duric and Field (2003 are critically discussed. New astrobiological results-in particular those on the age distribution of terrestrial planets-enable relaxing of some of these assumptions, which gives further justification to optimism regarding SETI projects.
Area Coverage of Expanding E.T. Signals in the Galaxy: SETI and Drake’s N
Grimaldi, Claudio; Marcy, Geoffrey W.; Tellis, Nathaniel K.; Drake, Frank
2018-05-01
The Milky Way Galaxy contains an unknown number, N, of civilizations that emit electromagnetic radiation (of unknown wavelengths) over a finite lifetime, L. Here we are assuming that the radiation is not produced indefinitely, but within L as a result of some unknown limiting event. When a civilization stops emitting, the radiation continues traveling outward at the speed of light, c, but is confined within a shell wall having constant thickness, cL. We develop a simple model of the Galaxy that includes both the birthrate and detectable lifetime of civilizations to compute the possibility of a SETI detection at the Earth. Two cases emerge for radiation shells that are (1) thinner than or (2) thicker than the size of the Galaxy, corresponding to detectable lifetimes, L, less than or greater than the light-travel time, ∼100,000 years, across the Milky Way, respectively. For case (1), each shell wall has a thickness smaller than the size of the Galaxy and intersects the Galactic plane in a donut shape (annulus) that fills only a fraction of the Galaxy’s volume, inhibiting SETI detection. But the ensemble of such shell walls may still fill our Galaxy, and indeed may overlap locally, given a sufficiently high birthrate of detectable civilizations. In the second case, each radiation shell is thicker than the size of our Galaxy. Yet, the ensemble of walls may or may not yield a SETI detection depending on the civilization birthrate. We compare the number of different electromagnetic transmissions arriving at Earth to Drake’s N, the number of currently emitting civilizations, showing that they are equal to each other for both cases (1) and (2). However, for L Earth may come from distant civilizations long extinct, while civilizations still alive are sending signals yet to arrive.
Analysis of nucleo-cytoplasmic shuttling of the proto-oncogene SET/I2PP2A
Lam, B. Daniel; Anthony, Eloise C.; Hordijk, Peter L.
2012-01-01
SET/I2PP2A is a nuclear protein that was initially identified as an oncogene in human undifferentiated acute myeloid leukemia, fused to the nuclear porin Nup-214. In addition, SET is a potent inhibitior of the phosphatase PP2A. Previously, we proposed a model in which the small GTPase Rac1 recruits
Intelligence and the machinery of government: conceptualizing the intelligence community
Davies, PHJ
2010-01-01
This article argues that the failure to address intelligence agencies as public organizations part and parcel with the overt machinery of government constitutes a significant lacuna both in the specialist study of intelligence and the broader discipline of public administration studies. The role and status of intelligence institutions as aspects of the machinery of central government is examined, along with the prospects of certain key paradigms in the field for understanding those institutio...
Chennamangalam, Jayanth
The transient radio universe is a relatively unexplored area of astronomy, offering a variety of phenomena, from solar and Jovian bursts, to flare stars, pulsars, and bursts of Galactic and potentially even cosmological origin. Among these, perhaps the most widely studied radio transients, pulsars are fast-spinning neutron stars that emit radio beams from their magnetic poles. In spite of over 40 years of research on pulsars, we have more questions than answers on these exotic compact objects, chief among them the nature of their emission mechanism. Nevertheless, the wealth of phenomena exhibited by pulsars make them one of the most useful astrophysical tools. With their high densities, pulsars are probes of the nature of ultra-dense matter. Characterized by their high timing stability, pulsars can be used to verify the predictions of general relativity, discover planets around them, study bodies in the solar system, and even serve as an interplanetary (and possibly some day, interstellar) navigation aid. Pulsars are also used to study the nature of the interstellar medium, much like a flashlight illuminating airborne dust in a dark room. Studies of pulsars in the Galactic center can help answer questions about the massive black hole in the region and the star formation history in its vicinity. Millisecond pulsars in globular clusters are long-lived tracers of their progenitors, low-mass X-ray binaries, and can be used to study the dynamical history of those clusters. Another source of interest in radio transient astronomy is the hitherto undetected engineered signal from extraterrestrial intelligence. The Search for Extraterrestrial Intelligence (SETI) is an ongoing attempt at discovering the presence of technological life elsewhere in the Galaxy. In this work, I present my forays into two aspects of the study of the radio transient universe---pulsars and SETI. Firstly, I describe my work on the luminosity function and population size of pulsars in the globular
International law implications of the detection of extraterrestrial intelligent signals
Kopal, Vladimir
This paper first considers whether the present law of outer space, as it has been enshrined in five United Nations treaties and other legal documents concerning outer space, provides a satisfactory basis for SETI/CETI activities. In the author's opinion, these activities may serve "the common interest of all mankind in the progress of the exploration and use of outer space for peaceful purposes," as recognized in the 1967 Outer Space Treaty. The use of the radio frequency spectrum for SETI/CETI purposes should be in conformity with the legal principles governing this valuable natural resource, as expressed in the International Telecommunication Convention and related documents, and with allocations of the relevant segments of the spectrum by the competent bodies of the International Telecommunication Union. In the second part the author examines the impact that the detection of extraterrestrial intelligent signals may have on the present body of space law. A possible role for the United Nations in this respect is also explored and a timely interest of the world body in discussing questions relating to this subject is recommended. Consideration of these questions could become a tool helping to concentrate the attention of the world community on problems of common concern and thus to strengthen international cooperation. However, the author believes that a law-making process that would aim at elaborating a special regulation of activities in this field would be premature at this stage. It should be initiated only when the boundary between possibilities and realities is crossed. Finally, the paper outlines some likely transformation in our space law thinking that would be the consequence of the detection of extraterrestrial intelligent signals. Elaboration of the principles and norms to govern relations between the international community of our own planet and other intelligent communities in the universe would add a new dimension to the present body of outer space
Wright, J. T.; Mullan, B.; Sigurdsson, S.; Povich, M. S.
2014-09-01
We motivate the Ĝ infrared search for extraterrestrial civilizations with large energy supplies. We discuss some philosophical difficulties of the search for extraterrestrial intelligence (SETI), and how communication SETI circumvents them. We review "Dysonian SETI," the search for artifacts of alien civilizations, and find that it is highly complementary to traditional communication SETI; the two together might succeed where either one alone has not. We discuss the argument of Hart that spacefaring life in the Milky Way should be either galaxy-spanning or non-existent, and examine a portion of his argument that we call the "monocultural fallacy." We discuss some rebuttals to Hart that invoke sustainability and predict long Galaxy colonization timescales. We find that the maximum Galaxy colonization timescale is actually much shorter than previous work has found (energy supplies and argue that detectably large energy supplies can plausibly be expected to exist because life has the potential for exponential growth until checked by resources or other limitations, and intelligence implies the ability to overcome such limitations. As such, if Hart's thesis is correct, then searches for large alien civilizations in other galaxies may be fruitful; if it is incorrect, then searches for civilizations within the Milky Way are more likely to succeed than Hart argued. We review some past Dysonian SETI efforts and discuss the promise of new mid-infrared surveys, such as that of WISE.
The 2012 Seti River flood disaster and alpine cryospheric hazards facing Pokhara, Nepal
Kargel, Jeffrey; Leonard, Gregory; Paudel, Lalu; Regmi, Dhananjay; Bajracharya, Samjwal; Fort, Monique; Joshi, Sharad; Poudel, Khagendra; Thapa, Bhabana; Watanabe, Teiji
2014-05-01
We have identified the likeliest cause of the Seti River disaster of May 5, 2012, in which a flash flood killed or left missing 72 people. A cascade of deadly physical Earth processes combined with imprudent habitation on the lowest flood terraces and floodplain. The process cascade started with rockfalls into the Seti River gorge (observed via repeat ASTER imaging). The last rockfall-one to several weeks prior to the disaster-affected a knickpoint in the Seti River gorge and impounded glacial meltwater and spring snowmelt. The trigger was a large rock/ice avalanche originating from cornice ice on Annapurna IV, where part of the mass was channeled into the impoundment reservoir. That violent ground-surge event, plus possibly an air blast caused by a violent gravity flow of airborne debris-then burst the rockfall dam. This was not a glacier lake outburst flood. Glaciers were involved in the disaster by supplying meltwater, which was impounded by the rockfall dam, by triggering the disaster with collapse of cornice ice, and by contributing ice to the landslide and outburst flood. Debuttressing of moraine debris and ancient glacial lake sediment by retreat and thinning of glaciers also may have played a role-this is the only possible indirect link of the disaster to climate change. The rockfall and avalanche mass movements occurred independently of climate change. The narrow and easily blocked Seti River gorge was a key factor in the 2012 disaster, and it remains a unique component of this physiographic setting. A similar flood in this area may happen by a different cascade of Earth surface processes. An enormous mass of ancient unconsolidated glaciolacustrine and moraine sediment-many cubic kilometers-was discovered and is vulnerable to production of debris flows and hyperconcentrated slurry flows. Some aggravating processes occurring in the Sabche Cirque are related to climate change. Glaciers in that area are melting, and small lakes are forming. Although the lakes
Representing culture in interstellar messages
Vakoch, Douglas A.
2008-09-01
As scholars involved with the Search for Extraterrestrial Intelligence (SETI) have contemplated how we might portray humankind in any messages sent to civilizations beyond Earth, one of the challenges they face is adequately representing the diversity of human cultures. For example, in a 2003 workshop in Paris sponsored by the SETI Institute, the International Academy of Astronautics (IAA) SETI Permanent Study Group, the International Society for the Arts, Sciences and Technology (ISAST), and the John Templeton Foundation, a varied group of artists, scientists, and scholars from the humanities considered how to encode notions of altruism in interstellar messages . Though the group represented 10 countries, most were from Europe and North America, leading to the group's recommendation that subsequent discussions on the topic should include more globally representative perspectives. As a result, the IAA Study Group on Interstellar Message Construction and the SETI Institute sponsored a follow-up workshop in Santa Fe, New Mexico, USA in February 2005. The Santa Fe workshop brought together scholars from a range of disciplines including anthropology, archaeology, chemistry, communication science, philosophy, and psychology. Participants included scholars familiar with interstellar message design as well as specialists in cross-cultural research who had participated in the Symposium on Altruism in Cross-cultural Perspective, held just prior to the workshop during the annual conference of the Society for Cross-cultural Research . The workshop included discussion of how cultural understandings of altruism can complement and critique the more biologically based models of altruism proposed for interstellar messages at the 2003 Paris workshop. This paper, written by the chair of both the Paris and Santa Fe workshops, will explore the challenges of communicating concepts of altruism that draw on both biological and cultural models.
Thinking style preference, emotional intelligence and leadership effectiveness
Directory of Open Access Journals (Sweden)
Tessie H. Herbst
2008-04-01
Full Text Available In this study, the researchers investigate the relationship between thinking style preference, emotional intelligence and leadership effectiveness in an institution of higher education. The measuring instruments used were the Neethling Brain Preference Profle (NBPP and the Mayer, Salovey and Caruso Emotional Intelligence Test (MSCEIT, as well as the Kouzes and Posner Leadership Practices Inventory (LPI. The sample comprised 138 managers within a higher education institution. The researchers found some evidence to support the relationship between thinking style, emotional intelligence (EI and leadership effectiveness. The researchers concluded that facets of brain dominance and emotional intelligence may be potentially useful predictors of transformational leadership behaviours.
Sharp, J. C.
1979-01-01
Research on the biological effects of RF radiation in the United States has undergone a series of swings during the last three decades. The resurgence of research during the past decade is examined in the light of two projects: the proposed Space Power Station and SETI.
National Geospatial-Intelligence Agency Academic Research Program
Loomer, S. A.
2004-12-01
"Know the Earth.Show the Way." In fulfillment of its vision, the National Geospatial-Intelligence Agency (NGA) provides geospatial intelligence in all its forms and from whatever source-imagery, imagery intelligence, and geospatial data and information-to ensure the knowledge foundation for planning, decision, and action. To achieve this, NGA conducts a multi-disciplinary program of basic research in geospatial intelligence topics through grants and fellowships to the leading investigators, research universities, and colleges of the nation. This research provides the fundamental science support to NGA's applied and advanced research programs. The major components of the NGA Academic Research Program (NARP) are: - NGA University Research Initiatives (NURI): Three-year basic research grants awarded competitively to the best investigators across the US academic community. Topics are selected to provide the scientific basis for advanced and applied research in NGA core disciplines. - Historically Black College and University - Minority Institution Research Initiatives (HBCU-MI): Two-year basic research grants awarded competitively to the best investigators at Historically Black Colleges and Universities, and Minority Institutions across the US academic community. - Director of Central Intelligence Post-Doctoral Research Fellowships: Fellowships providing access to advanced research in science and technology applicable to the intelligence community's mission. The program provides a pool of researchers to support future intelligence community needs and develops long-term relationships with researchers as they move into career positions. This paper provides information about the NGA Academic Research Program, the projects it supports and how other researchers and institutions can apply for grants under the program.
Dysfunction Junction: Intelligence, Peacekeeping, and the United Nations
National Research Council Canada - National Science Library
Maceda, Steven E
2007-01-01
.... The UN, however, lacks the institutional intelligence capacity to provide guidance, high-level assessments, and tactical/operational intelligence support for the over 100,000 peacekeepers around the world...
Forgan, D. H.; Nichol, R. C.
2011-04-01
The Square Kilometre Array (SKA) will operate in frequency ranges often used by military radar and other communications technology. It has been shown that if extraterrestrial intelligences (ETIs) communicate using similar technology, then the SKA should be able to detect such transmissions up to distances of ~100 pc (~300 light years) from Earth. However, Mankind has greatly improved its communications technology over the last century, dramatically reducing signal leakage and making the Earth ‘radio quiet’. If ETIs follow the same pattern as the human race, will we be able to detect their signal leakage before they become radio quiet? We investigate this question using Monte Carlo realization techniques to simulate the growth and evolution of intelligent life in the Galaxy. We show that if civilizations are ‘human’ in nature (i.e. they are only ‘radio loud’ for ~100 years, and can only detect each other with an SKA-like instrument out to 100 pc, within a maximum communication time of 100 years), then the probability for such civilizations accidentally detecting each other is low (~10-7), much lower than if other, dedicated communication techniques are permissible (e.g. optical SETI or neutrino communication).
Zimmerman, G. A.; Gulkis, S.
1991-01-01
The sensitivity of a matched filter-detection system to a finite-duration continuous wave (CW) tone is compared with the sensitivities of a windowed discrete Fourier transform (DFT) system and an ideal bandpass filter-bank system. These comparisons are made in the context of the NASA Search for Extraterrestrial Intelligence (SETI) microwave observing project (MOP) sky survey. A review of the theory of polyphase-DFT filter banks and its relationship to the well-known windowed-DFT process is presented. The polyphase-DFT system approximates the ideal bandpass filter bank by using as few as eight filter taps per polyphase branch. An improvement in sensitivity of approx. 3 dB over a windowed-DFT system can be obtained by using the polyphase-DFT approach. Sidelobe rejection of the polyphase-DFT system is vastly superior to the windowed-DFT system, thereby improving its performance in the presence of radio frequency interference (RFI).
Searching for alien artifacts on the moon
Davies, P. C. W.; Wagner, R. V.
2013-08-01
The Search for Extraterrestrial Intelligence (SETI) has a low probability of success, but it would have a high impact if successful. Therefore it makes sense to widen the search as much as possible within the confines of the modest budget and limited resources currently available. To date, SETI has been dominated by the paradigm of seeking deliberately beamed radio messages. However, indirect evidence for extraterrestrial intelligence could come from any incontrovertible signatures of non-human technology. Existing searchable databases from astronomy, biology, earth and planetary sciences all offer low-cost opportunities to seek a footprint of extraterrestrial technology. In this paper we take as a case study one particular new and rapidly-expanding database: the photographic mapping of the Moon's surface by the Lunar Reconnaissance Orbiter (LRO) to 0.5 m resolution. Although there is only a tiny probability that alien technology would have left traces on the moon in the form of an artifact or surface modification of lunar features, this location has the virtue of being close, and of preserving traces for an immense duration. Systematic scrutiny of the LRO photographic images is being routinely conducted anyway for planetary science purposes, and this program could readily be expanded and outsourced at little extra cost to accommodate SETI goals, after the fashion of the SETI@home and Galaxy Zoo projects.
Revolutionary Intelligence: The Expanding Intelligence Role of the Iranian Revolutionary Guard Corps
Directory of Open Access Journals (Sweden)
Udit Banerjea
2015-09-01
Full Text Available The Iranian Revolutionary Guard Corps (IRGC is a military and paramilitary organization that is meant to defend the ideals of the Iranian Islamic Revolution in 1979. Since its formation, the IRGC has grown in influence and its intelligence role has expanded. This paper examines the role of the IRGC in Iran’s intelligence system through a comprehensive analysis of the organization of the IRGC’s intelligence arm, along with its operations and capabilities. In doing so, the scope, objectives, resources, customers, and sponsors of the IRGC’s intelligence activities are also analyzed. Additionally, this paper explores how the IRGC interacts with the government of Iran, the Ministry of Intelligence and Security (MOIS, other key internal stakeholders, and foreign client organizations. A key focus of this analysis is the evolution of the relationship between the IRGC and the MOIS and the growing influence of the IRGC in Iran’s intelligence community over the last decade. The paper concludes that the IRGC has now eclipsed the MOIS within Iran’s intelligence community and is one of the most powerful institutions in Iranian politics today, using its intelligence activities as its key means of maintaining power and influence within the country.
Strategies to Foster Emotional Intelligence in Christian Higher Education
Gliebe, Sudi Kate
2012-01-01
This article proposes five initiatives to foster emotional intelligence (EI) education throughout institutions of Christian higher education. Goleman (1995) identifies self-awareness, managing emotions, motivation, empathy, and social intelligence as the hallmark skills of emotional intelligence. The importance of mastering these skills and their…
Pandit, Nitin S.
The U.S. electricity industry is being restructured to increase competition. Although existing policies may lead to efficient wholesale institutions, designing policies for the retail level is more complex because of intricate interactions between individuals and quasi-monopolistic institutions. It is argued that Hirshman's ideas of "exit" and "voice" (Hirshman, 1970) provide powerful abstractions for design of retail institutions. While competition is a known mechanism of "exit," a novel design of the "voice" mechanism is demonstrated through an artificial intelligence (AI) based software process model. The process model of "voice" in retail institutions is designed within the economic context of electricity distribution -- a common property resource (CPR), characterized by technological uncertainty and path-dependency. First, it is argued that participant feedback (voice) has to be used effectively to manage the CPR. Further, it is noted that the decision process, of using participant feedback (voice) to incrementally manage uncertainty and path-dependencies, is non-monotonic because it requires the decision makers to often retract previously made assumptions and decisions. An AI based process model of "voice" is developed using an assumption-based truth maintenance system. The model can emulate the non-monotonic decision making process and therefore assist in decision support. Such a systematic framework is flexible, consistent, and easily reorganized as assumptions change. It can provide an effective, formal "voice" mechanism to the retail customers and improve institutional performance.
Evaluating and Improving Online Intelligence Courses
Directory of Open Access Journals (Sweden)
Dr. Alexandra Luce
2013-08-01
Full Text Available Civilian, military and government institutions offer a wide range of courses on intelligence and are increasingly doing so online. While evaluation and improvement are critical to ensuring quality training and education, there is little research about how to evaluate and improve online intelligence courses. Based on the author’s experience developing and teaching such courses, this article offers four suggestions to those involved in online intelligence training and education: (1 conduct a key assumptions check; (2 ensure the course presentation embodies the principles of intelligence communication; (3 encourage creative freedom; and (4 build in mechanisms for feedback throughout the course.
International Nuclear Information System (INIS)
Wright, J. T.; Mullan, B.; Sigurdsson, S.; Povich, M. S.
2014-01-01
We motivate the Ĝ infrared search for extraterrestrial civilizations with large energy supplies. We discuss some philosophical difficulties of the search for extraterrestrial intelligence (SETI), and how communication SETI circumvents them. We review 'Dysonian SETI', the search for artifacts of alien civilizations, and find that it is highly complementary to traditional communication SETI; the two together might succeed where either one alone has not. We discuss the argument of Hart that spacefaring life in the Milky Way should be either galaxy-spanning or non-existent, and examine a portion of his argument that we call the 'monocultural fallacy'. We discuss some rebuttals to Hart that invoke sustainability and predict long Galaxy colonization timescales. We find that the maximum Galaxy colonization timescale is actually much shorter than previous work has found (<10 9 yr), and that many 'sustainability' counter-arguments to Hart's thesis suffer from the monocultural fallacy. We extend Hart's argument to alien energy supplies and argue that detectably large energy supplies can plausibly be expected to exist because life has the potential for exponential growth until checked by resources or other limitations, and intelligence implies the ability to overcome such limitations. As such, if Hart's thesis is correct, then searches for large alien civilizations in other galaxies may be fruitful; if it is incorrect, then searches for civilizations within the Milky Way are more likely to succeed than Hart argued. We review some past Dysonian SETI efforts and discuss the promise of new mid-infrared surveys, such as that of WISE.
Mikrodenetleyici Denetimli Televizyon Deney Seti Tasarımı ve Gerçekleştirilmesi
Directory of Open Access Journals (Sweden)
Serdar ÇİÇEK
2009-03-01
Full Text Available Bu çalışmada, teknik ve mesleki eğitim veren fakülteler, yüksekokullar, endüstri meslek liseleri, çıraklık ve yaygın eğitim merkezleri, meslek kursu veren belediyeler ve özel eğitim merkezleri vb. kurumlardaki görüntü sistemleri, televizyon tekniği, televizyon teknik servisliği gibi televizyon sisteminin ve televizyon arıza-onarım-bakım konularının işlendiği derslerde, derslerin pratik uygulama kısmında kullanılmak üzere bir televizyon deney seti tasarlanmış ve gerçekleştirilmiştir. Bu deney seti ile öğrenciler/ kursiyerler derste edindiği teorik bilgiler ışığında televizyon sistemlerini daha iyi kavrayabilecek, televizyon arızalarını bulma becerisini uygulamalı olarak geliştirebilecektir. Deney setine ek olarak televizyon ile bağlantılı bir ölçüm panosu da gerçekleştirilmiştir. Böylece televizyon üzerinde istenen ölçümler rahatça yapılabilmektedir. Geliştirilen deney setinde, kullanıcının birden fazla hatayı aynı anda gerçekleştirerek hata bulma adımlarını geliştirmesi mümkündür.
Study of Emotional Intelligence Patterns with Teachers Working in Public Education
Directory of Open Access Journals (Sweden)
Balázs László
2015-03-01
Full Text Available The data necessary for the empirical research presented it this study were provided by 572 people, from altogether 26 schools. The schools included 18 primary schools, 7 secondary training institutions and 1 primary and secondary school. The major question of the study related to the pedagogues' emotional intelligence, more precisely if the teachers of different institutions showed any individual differences in their emotional intelligence patterns according to the given type of their school's organisational culture. We also examined if the nature of the organizational culture had any influence on the development the individual's emotional intelligence pattern. On the basis of the results we can declare that the teachers of different institutions having their own particular organizational cultures evolve different emotional intelligence patterns. Accordingly, we can come to the conclusion that in the long term the organizational culture affects the evolution of the individual's emotional intelligence pattern and vice versa.
Tipler, F. J.
1982-10-01
An assessment is presented of the probability of the existence of intelligent extraterrestrial life in view of biological evolutionary constraints, in order to furnish some perspective for the hopes and claims of search of extraterrestrial intelligence (SETI) enthusiasts. Attention is given to a hypothetical extraterrestrial civilization's exploration/colonization of interstellar space by means of von Neumann machine-like, endlessly self-replicating space probes which would eventually reach the planetary systems of all stars in the Galaxy. These probes would be able to replicate the biology of their creator species, upon reaching a hospitable planet. It is suggested that the fundamental technological feasibility of such schemes, and their geometrically progressive comprehension of the Galaxy, would make actual colonization of the earth by extraterrestrials so probable as to destroy the hopes of SETI backers for occasional contact.
Exploration and thinking of dynamic scientific and technical intelligence research
International Nuclear Information System (INIS)
Zhang Xupu; Xia Yun
2014-01-01
This article discusses the concept and types of dynamic scientific and technical intelligence, describes the characteristics and role of dynamic scientific and technical intelligence, and analyzes methods and procedures of dynamic scientific and technical intelligence research. Combined with the status quo of dynamic scientific and technical intelligence research in library of China Institute of Atomic Energy, this article makes some suggestions for strengthening dynamic scientific and technical intelligence research. (authors)
Starry messages: Searching for signatures of interstellar archaeology
Energy Technology Data Exchange (ETDEWEB)
Carrigan, Richard A., Jr.; /Fermilab
2009-12-01
Searching for signatures of cosmic-scale archaeological artifacts such as Dyson spheres or Kardashev civilizations is an interesting alternative to conventional SETI. Uncovering such an artifact does not require the intentional transmission of a signal on the part of the original civilization. This type of search is called interstellar archaeology or sometimes cosmic archaeology. The detection of intelligence elsewhere in the Universe with interstellar archaeology or SETI would have broad implications for science. For example, the constraints of the anthropic principle would have to be loosened if a different type of intelligence was discovered elsewhere. A variety of interstellar archaeology signatures are discussed including non-natural planetary atmospheric constituents, stellar doping with isotopes of nuclear wastes, Dyson spheres, as well as signatures of stellar and galactic-scale engineering. The concept of a Fermi bubble due to interstellar migration is introduced in the discussion of galactic signatures. These potential interstellar archaeological signatures are classified using the Kardashev scale. A modified Drake equation is used to evaluate the relative challenges of finding various sources. With few exceptions interstellar archaeological signatures are clouded and beyond current technological capabilities. However SETI for so-called cultural transmissions and planetary atmosphere signatures are within reach.
2nd International Conference on Intelligent Computing, Communication & Devices
Popentiu-Vladicescu, Florin
2017-01-01
The book presents high quality papers presented at 2nd International Conference on Intelligent Computing, Communication & Devices (ICCD 2016) organized by Interscience Institute of Management and Technology (IIMT), Bhubaneswar, Odisha, India, during 13 and 14 August, 2016. The book covers all dimensions of intelligent sciences in its three tracks, namely, intelligent computing, intelligent communication and intelligent devices. intelligent computing track covers areas such as intelligent and distributed computing, intelligent grid and cloud computing, internet of things, soft computing and engineering applications, data mining and knowledge discovery, semantic and web technology, hybrid systems, agent computing, bioinformatics, and recommendation systems. Intelligent communication covers communication and network technologies, including mobile broadband and all optical networks that are the key to groundbreaking inventions of intelligent communication technologies. This covers communication hardware, soft...
Millions and Billions of Channels
Leigh, Darren; Horowitz, Paul
The history of the Harvard SETI group is inextricably linked with the history of Paul Horowitz. Horowitz became enamored with SETI as a student at Harvard, reading Ed Purcell's paper "Radio Astronomy and Communication Through Space" (Purcell, 1960), discussing with his roommates a class that Carl Sagan was teaching there using a draft of Shklovskii and Sagan's "Intelligent Life in the Universe" (Shklovskii and Sagan, 1966) as a text, and finally attending a Loeb Lecture series at Harvard by Frank Drake (Drake, 1969). The series was officially about pulsars but Drake did manage to slip in one inspiring talk about SETI. Horowitz says that "It was this lecture that launched me into this field; it was a revelation that you could go beyond idle speculation - you could actually calculate stuff."
Intelligence and gender (in)equality: empirical evidence from developing countries
Salahodjaev, Raufhon; Azam, Sardor
2015-01-01
This paper makes an attempt to explore whether intelligence of nations is related to gender inequality, measured by Social Institutions and Gender Index (SIGI), in developing countries. Related literature robustly links intelligence to economic development, poverty, quality of institutions and informal economic activity. Controlling for conventional antecedents of gender inequality (i.e. religion, political regime, legal origins and trade openness), this paper finds that, on average, a 10-poi...
Intelligent outdoor lighting systems
Özçelebi, T.
2014-01-01
Cities understand the advantages of branding themselves as unique, beautiful and secure places. Lighting plays a special part in establishing that identity. In 2014, TU/e Intelligent Lighting Institute, Philips Research and ST Microelectronics are collaborating in an EIT ICT Labs project called
2009-11-23
intelligent mobile robots. The competition has been highly praised by faculty advisors as an excellent multidisciplinary design experience for...States Naval Academy Robo -Goat 60 0:54 21 Oakland University Moonwalker 54 0:22 22 Tennessee Technological University Andros 53 1:06 23 California...Naval Academy Robo -Goat 622.00 20 University of Michigan – Dearborn Rhino 568.50 21 Georgia Institute of Technology Candiii 533.00 22 Rose-Hulman
Extraterrestrial altruism evolution and ethics in the cosmos
2014-01-01
Extraterrestrial Altruism examines a basic assumption of the Search for Extraterrestrial Intelligence (SETI): that extraterrestrials will be transmitting messages to us for our benefit. This question of whether extraterrestrials will be altruistic has become increasingly important in recent years as SETI scientists have begun contemplating transmissions from Earth to make contact. Should we expect altruism to evolve throughout the cosmos, or is this only wishful thinking? Would this make biological sense? Is it dangerous to send messages to other worlds, as Stephen Hawking has suggested? Would extraterrestrial societies be based on different ethical principles? Extraterrestrial Altruism explores these and related questions about the motivations of civilizations beyond Earth, providing new insights that are critical for SETI. Chapters are authored by leading scholars from diverse disciplines—anthropology, astronomy, biology, chemistry, computer science, cosmology, engineering, history of science, law, philos...
Coppola, M.; Bracci, S.; Cantisani, E.; Magrini, D.
2017-05-01
The tomb of Seti I (KV17) is a magnificent example of New Kingdom funerary architecture, among the longest tombs in the Valley of the Kings. As part of a collaboration between the Egyptian Museum in Florence, the University of Florence and CNR, a survey project was launched, with non-invasive methods, on the fragments from the Seti I tomb, in Florence, coming from a gate jamb connecting the chamber F to the corridor G, taken by the franco-tuscan expedition in 1829. The primary goal is to achieve the best level of documentation, knowledge of the material history and conservation assessment. Preliminary results allowed to focus some steps of the history of this fragment, from its realization to the present. The digital documentation created an excellent support for the mapping and management of the collected information. Even if still on a preliminary phase, this study shows how the combination of imaging and spectroscopic techniques allowed the characterization of many materials and the mapping of their distribution on the surface. Several original pigments have been identified as well as many anomalies due to subsequent interventions.
Directory of Open Access Journals (Sweden)
M. Coppola
2017-05-01
Full Text Available The tomb of Seti I (KV17 is a magnificent example of New Kingdom funerary architecture, among the longest tombs in the Valley of the Kings. As part of a collaboration between the Egyptian Museum in Florence, the University of Florence and CNR, a survey project was launched, with non-invasive methods, on the fragments from the Seti I tomb, in Florence, coming from a gate jamb connecting the chamber F to the corridor G, taken by the franco-tuscan expedition in 1829. The primary goal is to achieve the best level of documentation, knowledge of the material history and conservation assessment. Preliminary results allowed to focus some steps of the history of this fragment, from its realization to the present. The digital documentation created an excellent support for the mapping and management of the collected information. Even if still on a preliminary phase, this study shows how the combination of imaging and spectroscopic techniques allowed the characterization of many materials and the mapping of their distribution on the surface. Several original pigments have been identified as well as many anomalies due to subsequent interventions.
Creating Business Intelligence from Course Management Systems
van Dyk, Liezl; Conradie, Pieter
2007-01-01
Purpose: This article seeks to address the interface between individual learning facilitators that use course management systems (CMS) data to support decision-making and course design and institutional infrastructure providers that are responsible for institutional business intelligence. Design/methodology/approach: The design of a data warehouse…
How far are extraterrestrial life and intelligence after Kepler?
Wandel, Amri
2017-08-01
The Kepler mission has shown that a significant fraction of all stars may have an Earth-size habitable planet. A dramatic support was the recent detection of Proxima Centauri b. Using a Drake-equation like formalism I derive an equation for the abundance of biotic planets as a function of the relatively modest uncertainty in the astronomical data and of the (yet unknown) probability for the evolution of biotic life, Fb. I suggest that Fb may be estimated by future spectral observations of exoplanet biomarkers. It follows that if Fb is not very small, then a biotic planet may be expected within about 10 light years from Earth. Extending this analyses to advanced life, I derive expressions for the distance to putative civilizations in terms of two additional Drake parameters - the probability for evolution of a civilization, Fc, and its average longevity. Assuming "optimistic" values for the Drake parameters, (Fb Fc 1), and a broadcasting duration of a few thousand years, the likely distance to the nearest civilizations detectable by SETI is of the order of a few thousand light years. Finally I calculate the distance and probability of detecting intelligent signals with present and future radio telescopes such as Arecibo and SKA and how it could constrain the Drake parameters.
SETI OBSERVATIONS OF EXOPLANETS WITH THE ALLEN TELESCOPE ARRAY
Energy Technology Data Exchange (ETDEWEB)
Harp, G. R.; Richards, Jon; Tarter, Jill C.; Dreher, John; Jordan, Jane; Shostak, Seth; Smolek, Ken; Kilsdonk, Tom; Wilcox, Bethany R.; Wimberly, M. K. R.; Ross, John; Barott, W. C.; Ackermann, R. F.; Blair, Samantha [SETI Institute, Mountain View, CA 94043 (United States)
2016-12-01
We report radio SETI observations on a large number of known exoplanets and other nearby star systems using the Allen Telescope Array (ATA). Observations were made over about 19000 hr from 2009 May to 2015 December. This search focused on narrowband radio signals from a set totaling 9293 stars, including 2015 exoplanet stars and Kepler objects of interest and an additional 65 whose planets may be close to their habitable zones. The ATA observations were made using multiple synthesized beams and an anticoincidence filter to help identify terrestrial radio interference. Stars were observed over frequencies from 1 to 9 GHz in multiple bands that avoid strong terrestrial communication frequencies. Data were processed in near-real time for narrowband (0.7–100 Hz) continuous and pulsed signals with transmitter/receiver relative accelerations from −0.3 to 0.3 m s{sup −2}. A total of 1.9 × 10{sup 8} unique signals requiring immediate follow-up were detected in observations covering more than 8 × 10{sup 6} star-MHz. We detected no persistent signals from extraterrestrial technology exceeding our frequency-dependent sensitivity threshold of 180–310 × 10{sup −26} W m{sup −2}.
Re-Excavation of Seti First Tomb, Kv17, Luxor, Egypt
Directory of Open Access Journals (Sweden)
Ayman HAMED
2013-12-01
Full Text Available This article is discussing technical challenges within engineering works made during re-excavation of the 174 m long tunnel which was cut into bedrock of desert shale known as 'Esna shale'. Recent historical events, during the last decade, explained much of the tunnel deformations and dirt filling inside tunnel space "Debris", caused by multiple water runoff attack to king's valley. The author is also discussing the challenging work under severe financial regime; using non conventional solutions adopted with extraordinary actions in using junk yard equipment. Seti I tomb, is considered as the deepest opening in the valley, not mentioning the risk in re-excavation the tomb, harsh atmospheric conditions inside the tunnel, measured and monitored by author, needed a serious ventilation system to serve workers during removal of dirt. Through that, an interesting mathematical relation between atmospheric variables has been emphasized. Design of steel supporting system serving an inclined deep tunnel with irregular circumference, under strict condition of reversibility, has been performed as a remarkable topic, to solve and apply in such archaeological site. Finally, the article is considered as a scientific pattern for application of geo-engineering in conservation of underground archaeological sites.
Artificial intelligent e-learning architecture
Alharbi, Mafawez; Jemmali, Mahdi
2017-03-01
Many institutions and university has forced to use e learning, due to its ability to provide additional and flexible solutions for students and researchers. E-learning In the last decade have transported about the extreme changes in the distribution of education allowing learners to access multimedia course material at any time, from anywhere to suit their specific needs. In the form of e learning, instructors and learners live in different places and they do not engage in a classroom environment, but within virtual universe. Many researches have defined e learning based on their objectives. Therefore, there are small number of e-learning architecture have proposed in the literature. However, the proposed architecture has lack of embedding intelligent system in the architecture of e learning. This research argues that unexplored potential remains, as there is scope for e learning to be intelligent system. This research proposes e-learning architecture that incorporates intelligent system. There are intelligence components, which built into the architecture.
Database in Artificial Intelligence.
Wilkinson, Julia
1986-01-01
Describes a specialist bibliographic database of literature in the field of artificial intelligence created by the Turing Institute (Glasgow, Scotland) using the BRS/Search information retrieval software. The subscription method for end-users--i.e., annual fee entitles user to unlimited access to database, document provision, and printed awareness…
EU copyright protection of works created by artificial intelligence systems
Bøhler, Helene Margrethe
2017-01-01
This thesis is concerned with copyright regulation of works created by artificial intelligence systems. The rapid advances in artificial intelligence are calling into question some of the fundamental assumptions upon which intellectual property law rests. Currently, the European framework of copyright law does not take non-human innovation into account. Meanwhile, advances in artificial intelligence are quickly making machine-generation of creative works a reality. Institutions of the Europea...
Directory of Open Access Journals (Sweden)
Olga Marinova
2016-11-01
Full Text Available The purpose of this article is to explore the current situation and the main challenges in existing Business Intelligence (BI and Data Warehouse (DW curricula. On the base of this research, certain recommendations for their improvement are made. At the same time, the paper gives concrete guidelines for the development of a clear and comprehensive graduate profile with knowledge, skills and social competence in the field of BI and DW. This is particularly beneficial for universities and other higher education institutions, that seek to offer courses with high quality content and tendencies, adequate to the latest education, in the concerned area. The paper is written within the Erasmus plus KA2 project “Developing the innovative methodology of teaching Business Informatics” (DIMBI, 2015-1-PL01-KA203-0016636.
Inteligência social e inteligência competitivaSocial intelligence and competitive intelligence
Directory of Open Access Journals (Sweden)
Kira Tarapanoff
2004-01-01
Full Text Available Coloca os conceitos de inteligência social e coletiva no contexto da Sociedade da informação e do Conhecimento. Traça o desenvolvimento da inteligência econômica nos países e a aplicação da inteligência competitiva nas organizações. Defende que a ação conjunta do processo de gestão da informação e gestão do conhecimento, ambas em apoio às estratégia e missão organizacional, apresentam para o processo de tomada de decisão uma propriedade emergente que é a inteligência institucional.The concepts of social and collective intelligence are placed within the context of the Information and Knowledge Society. The development of the economic intelligence is given as well as its application and development in organizations as competitive intelligence. The thesis defended is that the joint action of the information and knowledge management processes, both in support to strategies and organization’s mission , have na emerging property for the decision making process – that is the institutional intelligence.
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-10-31
This is the report No. 98 issued by the Inorganic Material Research Institute. An intelligent material is a substance and/or material which responds intelligently to environmental conditions and exhibits functions. One of the features of amorphous materials including amorphous glass is a large freedom in chemical composition. These materials maintain order in short distance, but have as a whole the turbulent and specific atom orientation. Therefore, high tolerability in selecting the composition, and diverse synthesizing methods are available. A wide range of utilization may be conceived, such as introduction of the state of electrons having different valences in a structure, and the diverse chemical combinations. Patterns of existence of polyhedrons having different orientations, and how they are connected correlate closely with an external environment. Intelligent materials have high freedom against change in the external environment and are suitable to exhibit intelligent functions. Setting heat and light as the external conditions, attempts have been made on search and creation of intelligent materials based on state change induced by interactions between the two factors. Fundamental studies have been made on synthesis of different environment responding glasses and films, and on factors and phenomena for exhibition of the intelligence. 62 refs., 91 figs., 8 tabs.
Academic research opportunities at the National Geospatial-Intelligence Agency(NGA)
Loomer, Scott A.
2006-05-01
The vision of the National Geospatial-Intelligence Agency (NGA) is to "Know the Earth...Show the Way." To achieve this vision, the NGA provides geospatial intelligence in all its forms and from whatever source-imagery, imagery intelligence, and geospatial data and information-to ensure the knowledge foundation for planning, decision, and action. Academia plays a key role in the NGA research and development program through the NGA Academic Research Program. This multi-disciplinary program of basic research in geospatial intelligence topics provides grants and fellowships to the leading investigators, research universities, and colleges of the nation. This research provides the fundamental science support to NGA's applied and advanced research programs. The major components of the NGA Academic Research Program are: *NGA University Research Initiatives (NURI): Three-year basic research grants awarded competitively to the best investigators across the US academic community. Topics are selected to provide the scientific basis for advanced and applied research in NGA core disciplines. *Historically Black College and University - Minority Institution Research Initiatives (HBCU-MI): Two-year basic research grants awarded competitively to the best investigators at Historically Black Colleges and Universities, and Minority Institutions across the US academic community. *Intelligence Community Post-Doctoral Research Fellowships: Fellowships providing access to advanced research in science and technology applicable to the intelligence community's mission. The program provides a pool of researchers to support future intelligence community needs and develops long-term relationships with researchers as they move into career positions. This paper provides information about the NGA Academic Research Program, the projects it supports and how researchers and institutions can apply for grants under the program. In addition, other opportunities for academia to engage with NGA through
Intelligent tutoring systems for space applications
Luckhardt-Redfield, Carol A.
1990-01-01
Artificial Intelligence has been used in many space applications. Intelligent tutoring systems (ITSs) have only recently been developed for assisting training of space operations and skills. An ITS at Southwest Research Institute is described as an example of an ITS application for space operations, specifically, training console operations at mission control. A distinction is made between critical skills and knowledge versus routine skills. Other ITSs for space are also discussed and future training requirements and potential ITS solutions are described.
Computational Intelligence Agent-Oriented Modelling
Czech Academy of Sciences Publication Activity Database
Neruda, Roman
2006-01-01
Roč. 5, č. 2 (2006), s. 430-433 ISSN 1109-2777 R&D Projects: GA MŠk 1M0567 Institutional research plan: CEZ:AV0Z10300504 Keywords : multi-agent systems * adaptive agents * computational intelligence Subject RIV: IN - Informatics, Computer Science
First Euro-China Conference on Intelligent Data Analysis and Applications
Snasel, Vaclav; Corchado, Emilio; Abraham, Ajith; Wang, Shyue-Liang
2014-01-01
The First Euro-China Conference on Intelligent Data Analysis and Applications (ECC 2014), which was hosted by Shenzhen Graduate School of Harbin Institute of Technology and was held in Shenzhen City on June 13-15, 2014. ECC 2014 was technically co-sponsored by Shenzhen Municipal People’s Government, IEEE Signal Processing Society, Machine Intelligence Research Labs, VSB-Technical University of Ostrava (Czech Republic), National Kaohsiung University of Applied Sciences (Taiwan), and Secure E-commerce Transactions (Shenzhen) Engineering Laboratory of Shenzhen Institute of Standards and Technology.
Second Symposium on Chemical Evolution and the Origin of Life
International Nuclear Information System (INIS)
Devincenzi, D.L.; Dufour, P.A.
1986-05-01
Recent findings by NASA Exobiology investigators are reported. Scientific papers are presented in the following areas: cosmic evolution of biogenic compounds, prebiotic evolution (planetary and molecular), early evolution of life (biological and geochemical), evolution of advanced life, solar system exploration, and the Search for Extraterrestrial Intelligence (SETI)
Giberson, Karl; Brown, Laura
1997-01-01
Presents an activity that begins with a discussion that leads into the rationale behind the techniques used in the Search for Extraterrestrial Intelligence (SETI) program. Students decode a message intended for extraterrestrials and consider a number of topics related to the possible existence of extraterrestrials. (DDR)
The next steps in Seti-Italia science and technology
Montebugnoli, Stelio; Cosmovici, Cristiano; Monari, Jader; Pluchino, Salvatore; Zoni, Luca; Bartolini, Marco; Orlati, Andrea; Salerno, Emma; Schillirò, Francesco; Pupillo, Giuseppe; Perini, Federico; Bianchi, Germano; Tani, Mattia; Amico, Leonardo
2010-02-01
The Italian Medicina Radioastronomy Station (nearby Bologna) is equipped with two antennas: the 32 mt (VLBI) dish and the Northern Cross, a large T-shaped parabolic/cylindrical antenna (30.000 sqm). So far Seti observations have been performed using a SERENDIP IV high resolution spectrometer connected to the VLBI dish in "piggy back" mode configuration. In order to facilitate data interpretation and to introduce innovative methods to search for possible extraterrestrial signals, we are planning to make use of the large UHF Northern Cross transit telescope. Sky observations performed at least within two months, could provide for each day a number of matrices labeled according to the observing sidereal time. The entire set of matrices will be characterized by an averaged spectrum on each row per day. Keeping constant the transit antenna declination, a coherent signal coming from a definite position of the sky, would produce a "flag on" in the same submatrix at the same sidereal time. Detections collected in this way could be considered "confirmed" since they always come from the same region of the sky and are observed regularly. An extremely powerful processing board based on a multi-FPGAs (Field Programmable Gate Array) core was developed and is now under programming. This is conceived to be the processing core for this new kind of investigations.
Seventh Scandinavian Conference on Artificial Intelligence
DEFF Research Database (Denmark)
Lund, Henrik Hautop; Mayoh, Brian Henry; Perram, John
2001-01-01
The book covers the seventh Scandinavian Conference on Artificial Intelligence, held at the Maersk Mc-Kinney Moller Institute for Production Technology at the University of Southern Denmark during the period 20-21 February, 2001. It continues the tradition established by SCAI of being one...... of the most important regional AI conferences in Europe, attracting high quality submissions from Scandinavia and the rest of the world, including the Baltic countries. The contents include robotics, sensor/motor intelligence, evolutionary robotics, behaviour-based systems, multi-agent systems, applications...
Fermi's Paradox - The Last Challenge For Copernicanism?
Directory of Open Access Journals (Sweden)
Ćirković, M. M.
2009-06-01
Full Text Available We review Fermi's paradox (or the "Great Silence" problem, not only arguably the oldest and crucial problem for the Search for ExtraTerrestrial Intelligence (SETI, but also a conundrum of profound scientific, philosophical and cultural importance. By a simple analysis of observation selection effects, the correct resolution of Fermi's paradox is certain to tell us something about the future of humanity. Already more than three quarters of century old puzzle -- and a quarter of century since the last major review paper in the field by G. David Brin -- has generated many ingenious discussions and hypotheses. We analyze the often tacit methodological assumptions built in various answers to this puzzle and attempt a new classification of the numerous solutions proposed in an already huge literatureon the subject. Finally, we consider the ramifications of variousclasses of hypotheses for the practical SETI projects. Somewhatparadoxically, it seems that the class of (neocatastrophichypotheses gives, on the balance, the strongest justification tooptimism regarding our current and near-future SETI efforts.
Project Phoenix and beyond. Pesek Lecture.
Tarter, J
1997-01-01
Although there are no federally funded projects at this time, SETI (the search for extraterrestrial intelligence) is a vigorous exploratory science. There are currently eight observational programs on telescopes around the world, of which the Phoenix Project is the most comprehensive. Most of these projects are rooted in the conclusions of the pioneering studies of the early 1970's that are summarized in the Cyclops Report. Technology has experienced an exponential growth over the past two and a half decades. It is reasonable to reassess the Cyclops conclusions as SETI enters the next century. Listening for radio signals is still the preferred method of searching, however new technologies are making searches at other wavelengths possible and are modifying the ways in which the radio searches can and should be conducted. It may be economically feasible to undertake the construction of very large telescopes that can simultaneously provide multiple beams on the sky for use by SETI and the radioastronomy community.
Pesek lecture project Phoenix and beyond
Tarter, Jill
Although there are no federally funded projects at this time, SETI (the search for extraterrestrial intelligence) is a vigorous exploratory science. There are currently eight observational programs on telescopes around the world, of which the Phoenix Project is the most comprehensive. Most of these projects are rooted in the conclusions of the pioneering studies of the early 1970's that are summarized in the Cyclops Report1. Technology has experienced an exponential growth over the past two and a half decades. It is reasonable to reassess the Cyclops conclusions as SETI enters the next century. Listening for radio signals is still the preferred method of searching, however new technologies are making searches at other wavelengths possible and are modifying the ways in which the radio searches can and should be conducted. It may be economically feasible to undertake the construction of very large telescopes that can simultaneously provide multiple beams on the sky for use by SETI and the radioastronomy community.
Intelligences Developed by the Student Chess Player
Directory of Open Access Journals (Sweden)
Yuraima Margelis Matos De Rojas
2018-05-01
Full Text Available To strengthen cognitive development in students requires the use of innovative, creative and formative strategies that allow it to achieve, being one of the didactic strategies chess. For what was proposed as research purpose: Identify the intelligences developed by the student athlete of the Sports Talent Education Unit that play chess, to suggest some recommendations that can be put into practice in educational institutions. Methodologically it was approached from the qualitative paradigm through a phenomenological method that reveals the reality from the experiences and experiences of the social actors. Six key students of the institution were chess players, to whom an open interview was applied to obtain the necessary information, which was systematized to extract the categories, codifications and triangulate the information. As results, it was obtained that the students develop the intelligences: logical-mathematical, linguistic, spatial and visual, as the intrapersonal during the game of chess and in the learning processes. Configured in categories, analyzed and interpreted from the voices of social actors, theorists and researchers. Suggesting some recommendations that can be put into practice to strengthen the intelligences in the student.
Artificial Intelligence and Moral intelligence
Laura Pana
2008-01-01
We discuss the thesis that the implementation of a moral code in the behaviour of artificial intelligent systems needs a specific form of human and artificial intelligence, not just an abstract intelligence. We present intelligence as a system with an internal structure and the structural levels of the moral system, as well as certain characteristics of artificial intelligent agents which can/must be treated as 1- individual entities (with a complex, specialized, autonomous or selfdetermined,...
Henard, Ralph E.
Possible future developments in artificial intelligence (AI) as well as its limitations are considered that have implications for institutional research in higher education, and especially decision making and decision support systems. It is noted that computer software programs have been developed that store knowledge and mimic the decision-making…
Legal consequences of a SETI detection
Fasan, Ernst
If a detection of ETI takes place, this will in all probability be the result of either: (a) detecting and recognising a signal or other emission of ETI; or (b) the finding of an alien artifact (for instance on the Moon or other Celestial Body of our Solar System); or (c) the highly improbable event of an actual encounter. First and foremost, legal consequences regarding any of these contingencies will result from immediate consultations between nations on Earth. Understandings, memoranda and even agreements might be proposed and/or concluded. Such results within the field of terrestrial law will surely be a new branch of International Law, and particularly of International Space Law. At the same time, terrestrial nations will have to realize that any ETI will be self-determined intelligent individualities or organizations who might have their own understanding of "rules of behaviour" and thus, be legal subjects. Whether one calls such rules "law" or not: if two intelligent races—both of which have specific rules of behaviour—come into contact with each other, the basic understanding of such mutual rules will lead to a kind of "code of conduct". This might be the starting point for a kind of Law—Metalaw—between different races in the Universe.
Directory of Open Access Journals (Sweden)
Muhammad Asrar-ul-Haq
2017-12-01
Full Text Available This research paper aims at investigating the impact of emotional intelligence on teacher׳s job performance in the education sector of Pakistan. Sample size consists of 166 teachers from universities in the area of central Punjab, Pakistan. Theories of emotional intelligence proposed by Salovey and Mayer (1989â1990 were used as the conceptual framework and its relationship with the job performance of teachers was examined. Reliability and validity of variables was tested through measurement model of PLS-SEM. The result indicated that emotional intelligence has a significant impact on the teacher׳s job performance. Key research finding revealed that emotional self-awareness, self-confidence, achievement, developing others and conflict management have a positive and significant relationship with the teacher׳s job performance. Keywords: Emotional intelligence, Performance, Teachers, Pakistan
Depressive Symptoms, Academic Achievement, and Intelligence
Czech Academy of Sciences Publication Activity Database
Preiss, M.; Fráňová, Lenka
2006-01-01
Roč. 48, č. 1 (2006), s. 57-67 ISSN 0039-3320 R&D Projects: GA ČR GA406/05/0915 Institutional research plan: CEZ:AV0Z70250504 Keywords : academic achievement * depressive symptoms * intelligence Subject RIV: AN - Psychology Impact factor: 0.410, year: 2006
A Serendipitous MWA Search for Narrowband Signals from ‘Oumuamua
Tingay, S. J.; Kaplan, D. L.; Lenc, E.; Croft, S.; McKinley, B.; Beardsley, A.; Crosse, B.; Emrich, D.; Franzen, T. M. O.; Gaensler, B. M.; Horsley, L.; Johnston-Hollitt, M.; Kenney, D.; Morales, M. F.; Pallot, D.; Steele, K.; Trott, C. M.; Walker, M.; Wayth, R. B.; Williams, A.; Wu, C.
2018-04-01
We examine data from the Murchison Widefield Array (MWA) in the frequency range 72–102 MHz for a field of view that serendipitously contained the interstellar object ‘Oumuamua on 2017 November 28. Observations took place with a time resolution of 0.5 s and a frequency resolution of 10 kHz. Based on the interesting but highly unlikely suggestion that ‘Oumuamua is an interstellar spacecraft, due to some unusual orbital and morphological characteristics, we examine our data for signals that might indicate the presence of intelligent life associated with ‘Oumuamua. We searched our radio data for (1) impulsive narrowband signals, (2) persistent narrowband signals, and (3) impulsive broadband signals. We found no such signals with nonterrestrial origins and make estimates of the upper limits on equivalent isotropic radiated power (EIRP) for these three cases of approximately 7 kW, 840 W, and 100 kW, respectively. These transmitter powers are well within the capabilities of human technologies, and are therefore plausible for alien civilizations. While the chances of positive detection in any given search for extraterrestrial intelligence (SETI) experiment are vanishingly small, the characteristics of new generation telescopes such as the MWA (and, in the future, the Square Kilometre Array) make certain classes of SETI experiments easy, or even a trivial by-product of astrophysical observations. This means that the future costs of SETI experiments are very low, allowing large target lists to partially balance the low probability of a positive detection.
Intelligence Naturelle et Intelligence Artificielle
Dubois, Daniel
2011-01-01
Cet article présente une approche systémique du concept d’intelligence naturelle en ayant pour objectif de créer une intelligence artificielle. Ainsi, l’intelligence naturelle, humaine et animale non-humaine, est une fonction composée de facultés permettant de connaître et de comprendre. De plus, l'intelligence naturelle reste indissociable de la structure, à savoir les organes du cerveau et du corps. La tentation est grande de doter les systèmes informatiques d’une intelligence artificielle ...
Can a Higher Education Institution's Marketing Strategy Improve the Student-Institution Match?
Moogan, Yvonne J.
2011-01-01
Purpose: Issues such as managing brand image, assessing advertising medium effectiveness and collecting market intelligence are common practice for higher education institutions (HEIs). Consequently, understanding the information needs of potential students to the HEI when they make their decisions is paramount. The aim of this survey is to…
Bertka, Constance M.
The question of whether or not extraterrestrial life exists and its potential impact for religions, especially Christianity, is an ancient one addressed in numerous historical publications. The contemporary discussion has been dominated by a few notable scientists from the SETI and astrobiology communities, and by a few Christian theologians active in the science and religion field. This discussion amounts to scientists outside of the faith tradition predicting the demise of Christianity if extraterrestrial intelligent life is discovered and theologians within the tradition predicting the enrichment and reformulation of Christian doctrine. Missing from this discussion is insight drawn more broadly from the science and religion field and from the sociology of religion. A consideration of how possibilities for relating science and religion are reflected in the US public's varied acceptance of the theory of evolution; the growth of Christianity in the Global South; and a revised theory of secularization which inversely correlates religiosity to existential security, gives credence to the proposal that the response from those outside of academia would be much more varied and uncertain.
SME Internationalization Intelligence Information and Knowledge on International Opportunities
Directory of Open Access Journals (Sweden)
Zizah Che Senik
2014-12-01
Full Text Available Small and medium enterprises (SMEs internationalization intelligence, referring to the process of gathering information and knowledge on international opportunities, is crucial to initiate SMEs’ internationalization. The literature has stressed organizational resources, networks and information sharing as means to acquire internationalization intelligence, suggesting that the resource-based, network and social capital perspectives can be adopted to explore this issue. However, previous literature still lacks evidence on how SMEs acquire relevant intelligence, and who or what are involved with the process. To address this lack of evidence, we interviewed 54 SME owners/key personnel in the manufacturing sector to: identify sources of internationalization intelligence; examine how those sources assist SMEs to internationalize; and develop propositions on internationalization intelligence. Analyzing the data using NVivo, four themes emerged including institutions, business associates, personal efforts, and other means. The analysis suggests internationalization intelligence occurs mainly through the networks of the SME owners/key personnel, built on their firm’s resources through their internal and external information sharing activities, indicating the need of the SMEs to position themselves in their environments. These findings are developed into propositions. The study indicates multiple perspectives in conceptualizing the process of internationalization intelligence. This study advances a conceptualization of internationalization intelligence, and offers avenues for future research.
Intelligent e-Learning Systems: An Educational Paradigm Shift
Directory of Open Access Journals (Sweden)
Suman Bhattacharya
2016-12-01
Full Text Available Learning is the long process of transforming information as well as experience into knowledge, skills, attitude and behaviors. To make up the wide gap between the demand of increasing higher education and comparatively limited resources, more and more educational institutes are looking into instructional technology. Use of online resources not only reduces the cost of education but also meet the needs of society. Intelligent e-learning has become one of the important channels to reach out to students exceeding geographic boundaries. Besides this, the characteristics of e-learning have complicated the process of education, and have brought challenges to both instructors and students. This paper will focus on the discussion of different discipline of intelligent e-learning like scaffolding based e-learning, personalized e-learning, confidence based e-learning, intelligent tutoring system, etc. to illuminate the educational paradigm shift in intelligent e-learning system.
PLANNING INTELLIGENCE ACTIVITIES IN A DYNAMIC SECURITY ENVIRONMENT
Directory of Open Access Journals (Sweden)
Anca Pavel
2016-10-01
Full Text Available The hypothesis introduced by this article is that, in order to perform intelligence missions and to obtain valuable intelligence for the consumers it is necessary to implement processes and tools to support planning activities. Today's challenges consist rather in the ability of intelligence organizations to identify and initiate new connections, processes and communication flows with other partners operating in the security environment than to plan in their own name secret operations. From this point of view, planning activities should focus on new procedures, at a much more extensive level in order to align institutional efforts beyond the boundaries of their own organization and the national community of information. Also, in order to coordinate intelligence activities, strategic planning must be anchored into a complex analysis of the potential impact of existing and possible future global phenomena that shape the security environment and thus identify better ways of improving results.
The Class Initiatives of Intelligence Rhetoric: Implications of Racism for Scientific Inquiry.
Hall, Ronald E.
2002-01-01
Asserts that in a society that is not totalitarian, class disparities are enabled institutionally by science. A capital driven nation that associates intelligence with class and race can determine overall quality of life. Thus, perception of intelligence is an extremely powerful tool for reinforcing class. Suggests that in order to be better…
Cloud Computing Boosts Business Intelligence of Telecommunication Industry
Xu, Meng; Gao, Dan; Deng, Chao; Luo, Zhiguo; Sun, Shaoling
Business Intelligence becomes an attracting topic in today's data intensive applications, especially in telecommunication industry. Meanwhile, Cloud Computing providing IT supporting Infrastructure with excellent scalability, large scale storage, and high performance becomes an effective way to implement parallel data processing and data mining algorithms. BC-PDM (Big Cloud based Parallel Data Miner) is a new MapReduce based parallel data mining platform developed by CMRI (China Mobile Research Institute) to fit the urgent requirements of business intelligence in telecommunication industry. In this paper, the architecture, functionality and performance of BC-PDM are presented, together with the experimental evaluation and case studies of its applications. The evaluation result demonstrates both the usability and the cost-effectiveness of Cloud Computing based Business Intelligence system in applications of telecommunication industry.
POWER BEAMING LEAKAGE RADIATION AS A SETI OBSERVABLE
Energy Technology Data Exchange (ETDEWEB)
Benford, James N. [Microwave Sciences, 1041 Los Arabis Lane, Lafayette, CA 94549 (United States); Benford, Dominic J., E-mail: jimbenford@gmail.com [NASA’s Goddard Space Flight Center, Observational Cosmology Laboratory, Greenbelt, MD 20771 (United States)
2016-07-10
The most observable leakage radiation from an advanced civilization may well be from the use of power beaming to transfer energy and accelerate spacecraft. Applications suggested for power beaming involve launching spacecraft to orbit, raising satellites to a higher orbit, and interplanetary concepts involving space-to-space transfers of cargo or passengers. We also quantify beam-driven launch to the outer solar system, interstellar precursors, and ultimately starships. We estimate the principal observable parameters of power beaming leakage. Extraterrestrial civilizations would know their power beams could be observed, and so could put a message on the power beam and broadcast it for our receipt at little additional energy or cost. By observing leakage from power beams we may find a message embedded on the beam. Recent observations of the anomalous star KIC 8462852 by the Allen Telescope Array (ATA) set some limits on extraterrestrial power beaming in that system. We show that most power beaming applications commensurate with those suggested for our solar system would be detectable if using the frequency range monitored by the ATA, and so the lack of detection is a meaningful, if modest, constraint on extraterrestrial power beaming in that system. Until more extensive observations are made, the limited observation time and frequency coverage are not sufficiently broad in frequency and duration to produce firm conclusions. Such beams would be visible over large interstellar distances. This implies a new approach to the SETI search: instead of focusing on narrowband beacon transmissions generated by another civilization, look for more powerful beams with much wider bandwidth. This requires a new approach for their discovery by telescopes on Earth. Further studies of power beaming applications should be performed, potentially broadening the parameter space of the observable features that we have discussed here.
Fermi's paradox: The last challenge for copernicanism?
Directory of Open Access Journals (Sweden)
Ćirković M.M.
2009-01-01
Full Text Available We review Fermi's paradox (or the 'Great Silence' problem, not only arguably the oldest and crucial problem for the Search for ExtraTerrestrial Intelligence (SETI, but also a conundrum of profound scientific, philosophical and cultural importance. By a simple analysis of observation selection effects, the correct resolution of Fermi's paradox is certain to tell us something about the future of humanity. Already more than three quarters of century old puzzle and a quarter of century since the last major review paper in the field by G. David Brin has generated many ingenious discussions and hypotheses. We analyze the often tacit methodological assumptions built in various answers to this puzzle and attempt a new classification of the numerous solutions proposed in an already huge literature on the subject. Finally, we consider the ramifications of various classes of hypotheses for the practical SETI projects. Somewhat paradoxically, it seems that the class of (neocatastrophic hypotheses gives, on the balance, the strongest justification to optimism regarding our current and near-future SETI efforts.
International Conference on Computational Intelligence in Data Mining
Mohapatra, Durga
2017-01-01
The book presents high quality papers presented at the International Conference on Computational Intelligence in Data Mining (ICCIDM 2016) organized by School of Computer Engineering, Kalinga Institute of Industrial Technology (KIIT), Bhubaneswar, Odisha, India during December 10 – 11, 2016. The book disseminates the knowledge about innovative, active research directions in the field of data mining, machine and computational intelligence, along with current issues and applications of related topics. The volume aims to explicate and address the difficulties and challenges that of seamless integration of the two core disciplines of computer science. .
Use of competitive intelligence in curriculum enhancement through ...
African Journals Online (AJOL)
Therefore, academic libraries which play a pivotal role in curriculum enhancement should engage in strategic planning and collection of useful intelligence required to improve institutional operations. Challenges encountered during collection development process in academic libraries were identified. They include ...
Directory of Open Access Journals (Sweden)
Zarifeh Eynollahzadeh
2015-05-01
Full Text Available This paper investigates the relationship between emotional intelligence, organizational communications and organizational citizenship behavior (OCB for a case study of Islamic Azad University, Gorgan Branch, and Sama Institution in Iran. Statistical population includes all heads and assistants and employees of Islamic Azad University and Sama Institution in city of Gorgan, Iran as 300 people. Sample size was determined as 169 people according to Korjesi and Morgan table. This research is operational by goal, and survey and correlation by method. To determine questionnaire reliability and questionnaire validity, Cronbach Alpha coefficient for emotional intelligence questionnaire, organizational communications questionnaire, and OCB questionnaire were calculated as 0.86, 0.86, 0.87 and 0.85, respectively. To analyze data and information, Pearson correlation coefficient by inferential level was used. Results indicate that there was a significant relationship between emotional intelligence and organizational communication and OCB.
Are Emotionally Intelligent EFL Teachers More Satisfied Professionally?
Directory of Open Access Journals (Sweden)
Mohammad Hossein Hekmatzadeh
2016-03-01
Full Text Available Despite the fact that Intelligence Quotient (IQ is an important factor in one’s success in terms of working environment, it is believed that emotional quotient or EQ plays a more important role. With that in mind, this study investigated the relationship between emotional intelligence and job satisfaction of English as Foreign Language (EFL teachers who work at private language institutes in Iran/Shiraz. Furthermore, this study tried to answer whether there is a significant difference between emotional intelligence and job satisfaction of Iranian’s EFL teachers in terms of gender. A 90-item Bar-On questionnaire was used to measure the teachers’ emotional intelligence; also, a modified version of Karavas’s (2010 job satisfaction scale was used to see how satisfied our teachers are with their teaching career. To answer the research question, Pearson Product-Moment Correlation Coefficient statistical test was run. The results showed that there was a positive and significant correlation between emotional intelligence and job satisfaction of EFL teachers in Iran/Shiraz. Furthermore, the results revealed that there was a statistically significant difference in emotional intelligence between EFL male and female teachers, but there was no statistically significant relationship between Iranian EFL teachers’ job satisfaction in terms of gender. Based on our findings, it is suggested that some preparatory courses aiming at enhancing the important psychological traits such as emotional intelligence should be incorporated in educational programs designed for novice teachers so that it will contribute to pedagogical improvement.
Computational intelligence in automotive applications
Energy Technology Data Exchange (ETDEWEB)
Prokhorov, Danil (ed.) [Toyota Motor Engineering and Manufacturing (TEMA), Ann Arbor, MI (United States). Toyota Technical Center
2008-07-01
What is computational intelligence (CI)? Traditionally, CI is understood as a collection of methods from the fields of neural networks (NN), fuzzy logic and evolutionary computation. This edited volume is the first of its kind, suitable to automotive researchers, engineers and students. It provides a representative sample of contemporary CI activities in the area of automotive technology. The volume consists of 13 chapters, including but not limited to these topics: vehicle diagnostics and vehicle system safety, control of vehicular systems, quality control of automotive processes, driver state estimation, safety of pedestrians, intelligent vehicles. All chapters contain overviews of state of the art, and several chapters illustrate their methodologies on examples of real-world systems. About the Editor: Danil Prokhorov began his technical career in St. Petersburg, Russia, after graduating with Honors from Saint Petersburg State University of Aerospace Instrumentation in 1992 (MS in Robotics). He worked as a research engineer in St. Petersburg Institute for Informatics and Automation, one of the institutes of the Russian Academy of Sciences. He came to the US in late 1993 for Ph.D. studies. He became involved in automotive research in 1995 when he was a Summer intern at Ford Scientific Research Lab in Dearborn, MI. Upon his graduation from the EE Department of Texas Tech University, Lubbock, in 1997, he joined Ford to pursue application-driven research on neural networks and other machine learning algorithms. While at Ford, he took part in several production-bound projects including neural network based engine misfire detection. Since 2005 he is with Toyota Technical Center, Ann Arbor, MI, overseeing important mid- and long-term research projects in computational intelligence. (orig.)
Intelligent DC Microgrid Living Laboratories - A Chinese-Danish Cooperation Project
DEFF Research Database (Denmark)
Diaz, Enrique Rodriguez; Su, Xiaoling; Savaghebi, Mehdi
2015-01-01
This paper presents a research project focus on the development of future intelligent direct-current (DC) microgrids which is being deployed for highly efficient integration of distributed generation and modern electronic loads. The project is based on the collaboration between research institutes...... in China and Denmark, aiming to explore the different aspects of DC microgrids: design, modelling, control, coordination, communications and management. In addition, a future Living Laboratory will also be integrated into the Intelligent DC Microgrids Laboratory, which will serve as demonstration facility...... for low voltage direct-current (LVDC) distribution systems. Research is carried out in both Intelligent DC Microgrid Laboratories, focused on industry in China and residential applications in Denmark....
A New Dimension of Business Intelligence: Location-based Intelligence
Zeljko Panian
2012-01-01
Through the course of this paper we define Locationbased Intelligence (LBI) which is outgrowing from process of amalgamation of geolocation and Business Intelligence. Amalgamating geolocation with traditional Business Intelligence (BI) results in a new dimension of BI named Location-based Intelligence. LBI is defined as leveraging unified location information for business intelligence. Collectively, enterprises can transform location data into business intelligence applic...
Intelligence analysis – the royal discipline of Competitive Intelligence
Directory of Open Access Journals (Sweden)
František Bartes
2011-01-01
Full Text Available The aim of this article is to propose work methodology for Competitive Intelligence teams in one of the intelligence cycle’s specific area, in the so-called “Intelligence Analysis”. Intelligence Analysis is one of the stages of the Intelligence Cycle in which data from both the primary and secondary research are analyzed. The main result of the effort is the creation of added value for the information collected. Company Competiitve Intelligence, correctly understood and implemented in business practice, is the “forecasting of the future”. That is forecasting about the future, which forms the basis for strategic decisions made by the company’s top management. To implement that requirement in corporate practice, the author perceives Competitive Intelligence as a systemic application discipline. This approach allows him to propose a “Work Plan” for Competitive Intelligence as a fundamental standardized document to steer Competitive Intelligence team activities. The author divides the Competitive Intelligence team work plan into five basic parts. Those parts are derived from the five-stage model of the intelligence cycle, which, in the author’s opinion, is more appropriate for complicated cases of Competitive Intelligence.
Research on artificial intelligence systems for nuclear installations
International Nuclear Information System (INIS)
Sakuma, Minoru
1992-01-01
The development and utilization of atomic energy in Japan has be advanced in conformity with the long term plan of atomic energy development and utilization decided in 1987. As one of the basic targets, the upbringing of creative and innovative science and technology is put up. Artificial intelligence technology has been positioned as one of the important basic technologies for promoting future atomic energy development. The research and development of artificial intelligence technology have been advanced aiming at making nuclear power stations autonomous, by the guidance of Science and Technology Agency and the cooperation of several research institutes. The upbringing of creative science and technology, the preponderant development of basic technology, the concept of developing the basic technology for atomic energy, the concept of autonomous plants, the standard for autonomy, the approach to autonomous plants, the present state of the researches in respective research institutes on autonomous operation and autonomous maintenance are described. (K.I.)
Spiritual Intelligence, Emotional Intelligence and Auditor’s Performance
Hanafi, Rustam
2010-01-01
The objective of this research was to investigate empirical evidence about influence audi-tor spiritual intelligence on the performance with emotional intelligence as a mediator variable. Linear regression models are developed to examine the hypothesis and path analysis. The de-pendent variable of each model is auditor performance, whereas the independent variable of model 1 is spiritual intelligence, of model 2 are emotional intelligence and spiritual intelligence. The parameters were estima...
Framework for developing a regional system architecture for intelligent transportation systems
1997-01-01
Defining an architecture for intelligent transportation systems (ITS) at the regional level, where most ITS deployment occurs, is constrained by jurisdictional, institutional, financial, political, and regulatory factors. These constraints provide op...
USDOT's Intelligent Transportation Systems (ITS) ITS strategic plan, 2015-2019.
This document constitutes the Intelligent Transportation Systems Strategic Plan covering the years 2015 to 2019; it : builds on the progress of the 2010-2014 plan and presents a wide array of technical, policy, institutional, and : organizational con...
Vulnerability of terrestrial-trunked radio to intelligent intentional electromagnetic interference
Tanuhardja, Ray R.; van de Beek, G.S.; Bentum, Marinus Jan; Leferink, Frank Bernardus Johannes
2015-01-01
The terrestrial-trunked radio (TETRA) specification is produced by the European Telecommunication Standards Institute for private mobile radio systems. We investigated the resilience of TETRA against intelligent intentional electromagnetic interference (IEMI) with low amplitude. Low power signals
Intelligence analysis – the royal discipline of Competitive Intelligence
František Bartes
2011-01-01
The aim of this article is to propose work methodology for Competitive Intelligence teams in one of the intelligence cycle’s specific area, in the so-called “Intelligence Analysis”. Intelligence Analysis is one of the stages of the Intelligence Cycle in which data from both the primary and secondary research are analyzed. The main result of the effort is the creation of added value for the information collected. Company Competiitve Intelligence, correctly understood and implemented in busines...
Astrobiology in culture: the search for extraterrestrial life as "science".
Billings, Linda
2012-10-01
This analysis examines the social construction of authority, credibility, and legitimacy for exobiology/astrobiology and, in comparison, the search for extraterrestrial intelligence (SETI), considering English-language conceptions of these endeavors in scientific culture and popular culture primarily in the United States. The questions that define astrobiology as a scientific endeavor are multidisciplinary in nature, and this endeavor is broadly appealing to public audiences as well as to the scientific community. Thus, it is useful to examine astrobiology in culture-in scientific culture, official culture, and popular culture. A researcher may explore science in culture, science as culture, by analyzing its rhetoric, the primary means that people use to construct their social realities-their cultural environment, as it were. This analysis follows this path, considering scientific and public interest in astrobiology and SETI and focusing on scientific and official constructions of the two endeavors. This analysis will also consider whether and how scientific and public conceptions of astrobiology and SETI, which are related but at the same time separate endeavors, converge or diverge and whether and how these convergences or divergences affect the scientific authority, credibility, and legitimacy of these endeavors.
The process of deforestation in weak democracies and the role of Intelligence.
Obydenkova, Anastassia; Nazarov, Zafar; Salahodjaev, Raufhon
2016-07-01
This article examines the interconnection between national intelligence, political institutions, and the mismanagement of public resources (deforestations). The paper examines the reasons for deforestation and investigates the factors accountable for it. The analysis builds on authors-compiled cross-national dataset on 185 countries over the time period of twenty years, from 1990 to 2010. We find that, first, nation's intelligence reduces significantly the level of deforestation in a state. Moreover, the nations' IQ seems to play an offsetting role in the natural resource conservation (forest management) in the countries with weak democratic institutions. The analysis also discovered the presence of the U-shaped relationship between democracy and deforestation. Intelligence sheds more light on this interconnection and explains the results. Our results are robust to various sample selection strategies and model specifications. The main implication from our study is that intelligence not only shapes formal rules and informal regulations such as social trust, norms and traditions but also it has the ability to reverse the paradoxical process known as "resource curse." The study contributes to better understanding of reasons of deforestation and shed light on the debated impact of political regime on forest management. Copyright © 2016 Elsevier Inc. All rights reserved.
Taking Business Intelligence to Business Education Curriculum: Graduate Students’ Concerns
Directory of Open Access Journals (Sweden)
Philip Kissi
2017-06-01
Full Text Available Business intelligence systems are widely employed in industries. However, students concerns about Business Intelligence course are largely missed in the business education curriculum. To take a proper decision on Business intelligence integration in business education, it is important to understand students’ concerns. This study employed a survey questionnaire to investigate 142 graduate students concerns about integrating business intelligence into business education curriculum. The survey questionnaire was adopted from previous studies to measure students’ concerns on a Business Intelligence job opportunity, interest and relevance in the Business intelligence education. The survey items have a reliability scales of Cronbach’s alpha (α = 0.818, factor loading > 0.5, and Average Variance Extracted (AVE ≥ 0.5, and Composite Reliability (CR ≥ 0.6. Descriptive statistics and Independent sample t-test and Analysis of Variance (ANOVA test were performed on the survey data. Students revealed that Business intelligence knowledge is relevant (mean = 4.29, SD = 0.710, has several job opportunities (mean = 4.16, SD = 0.675, and should be integrated into business education curriculum (mean = 3.95.08, SD = 0.79. In addition, there was no statistically significant difference (t (140 = –0.027, p > 0.05 between the concerns of students with Business Intelligence lecture experience and those without. Further, perceived importance and job opportunity significantly, F = 24.601 and p = .000(< .05 relates to the Business intelligence integration in Business Education. The findings draw implications for university management and business institutions in updating curriculum so as to equip business students with the essential Business Intelligence knowledge and skills for the betterment of the business organizations.
Business intelligence as a tool in the management academic
Directory of Open Access Journals (Sweden)
Juan Jose Camargo Vega
2016-06-01
Full Text Available This paper presents a study, analyze and evaluate characteristics of existing data in the academic community, in order to recommend a model to apply Business Intelligence. It starts from the assumption that knowing the effects on the academic community, if you have a corporate strategy to facilitate decision-making in educational institutions. The results are based on a three dimensional cube, which are combining strong to make decisions with the information made. Finally, we come to different conclusions enabling give sufficient grounds to recommend a model that Integrate Business Intelligence in the academic environment.
Through Enemy Eyes: A Soviet View of U.S. Intelligence
1980-06-01
Pentagon, and frequently its intelligence departments, while possessing the newest technical means of espionage, artificial earth satellites included...government as proof of official membership in the intellignece community. The characterization of the Hoover Institute of Stanford University is typical
Web Intelligence and Artificial Intelligence in Education
Devedzic, Vladan
2004-01-01
This paper surveys important aspects of Web Intelligence (WI) in the context of Artificial Intelligence in Education (AIED) research. WI explores the fundamental roles as well as practical impacts of Artificial Intelligence (AI) and advanced Information Technology (IT) on the next generation of Web-related products, systems, services, and…
Global Research on Artificial Intelligence from 1990–2014: Spatially-Explicit Bibliometric Analysis
Directory of Open Access Journals (Sweden)
Jiqiang Niu
2016-05-01
Full Text Available In this article, we conducted the evaluation of artificial intelligence research from 1990–2014 by using bibliometric analysis. We introduced spatial analysis and social network analysis as geographic information retrieval methods for spatially-explicit bibliometric analysis. This study is based on the analysis of data obtained from database of the Science Citation Index Expanded (SCI-Expanded and Conference Proceedings Citation Index-Science (CPCI-S. Our results revealed scientific outputs, subject categories and main journals, author productivity and geographic distribution, international productivity and collaboration, and hot issues and research trends. The growth of article outputs in artificial intelligence research has exploded since the 1990s, along with increasing collaboration, reference, and citations. Computer science and engineering were the most frequently-used subject categories in artificial intelligence studies. The top twenty productive authors are distributed in countries with a high investment of research and development. The United States has the highest number of top research institutions in artificial intelligence, producing most single-country and collaborative articles. Although there is more and more collaboration among institutions, cooperation, especially international ones, are not highly prevalent in artificial intelligence research as expected. The keyword analysis revealed interesting research preferences, confirmed that methods, models, and application are in the central position of artificial intelligence. Further, we found interesting related keywords with high co-occurrence frequencies, which have helped identify new models and application areas in recent years. Bibliometric analysis results from our study will greatly facilitate the understanding of the progress and trends in artificial intelligence, in particular, for those researchers interested in domain-specific AI-driven problem-solving. This will be
Analysis of the relation between intelligence and criminal behavior
Directory of Open Access Journals (Sweden)
Dragan Jovanovic
2012-12-01
Full Text Available Introduction: One of the cognitive aspects of personality is intelligence. A large number of previous studies have shown that the intelligence within the criminal population is decreased, particularly in its verbal aspect.The aim of this study is to determine whether there is a link between intelligence and criminal behavior and how it is manifested.Methods: The research involved criminal inmates of the Correctional institutes of Republic of Srpska and Court Department of Psychiatry Clinic Sokolac who committed homicide and various non-homicide acts. Thetest group consisted of 60 inmates who have committed homicide (homicide offenders and a control group of 60 inmates who did not commit homicide (non-homicide offenders. The study was controlled, transverse or cross-sectional study.Results: Average intelligence of inmates (homicidal and non-homicidal was IQ 95.7. Intelligence of homicide inmates was IQ 97.4 and non-homicide IQ 94.09. Intelligence coeffi cients for non-homicide inmatesubgroups were as follows - subgroup consisting of robbery offenders (IQ 96.9, subgroup consisting of theft perpetrators (IQ 93.83, subgroups consisting of other criminal offenders (IQ 92.8. Verbal intellectual ability– IQw of homicide inmates was 91.22, and 91.10 IQw of non-homicide inmates. Intellectual abilities in nonverbal or manipulative part were average, but they were higher in homicide inmates group (IQm 103.65 than in the group of non-homicide inmates (IQm 97.08.Conclusion: Average intelligence of investigated inmates (homicide and non-homicide is lower than in the general population and corresponds to low average. Verbal part of intelligence is lowered while nonverbalpart is within the average range.
Artificial Intelligence and Moral intelligence
Directory of Open Access Journals (Sweden)
Laura Pana
2008-07-01
Full Text Available We discuss the thesis that the implementation of a moral code in the behaviour of artificial intelligent systems needs a specific form of human and artificial intelligence, not just an abstract intelligence. We present intelligence as a system with an internal structure and the structural levels of the moral system, as well as certain characteristics of artificial intelligent agents which can/must be treated as 1- individual entities (with a complex, specialized, autonomous or selfdetermined, even unpredictable conduct, 2- entities endowed with diverse or even multiple intelligence forms, like moral intelligence, 3- open and, even, free-conduct performing systems (with specific, flexible and heuristic mechanisms and procedures of decision, 4 – systems which are open to education, not just to instruction, 5- entities with “lifegraphy”, not just “stategraphy”, 6- equipped not just with automatisms but with beliefs (cognitive and affective complexes, 7- capable even of reflection (“moral life” is a form of spiritual, not just of conscious activity, 8 – elements/members of some real (corporal or virtual community, 9 – cultural beings: free conduct gives cultural value to the action of a ”natural” or artificial being. Implementation of such characteristics does not necessarily suppose efforts to design, construct and educate machines like human beings. The human moral code is irremediably imperfect: it is a morality of preference, of accountability (not of responsibility and a morality of non-liberty, which cannot be remedied by the invention of ethical systems, by the circulation of ideal values and by ethical (even computing education. But such an imperfect morality needs perfect instruments for its implementation: applications of special logic fields; efficient psychological (theoretical and technical attainments to endow the machine not just with intelligence, but with conscience and even spirit; comprehensive technical
Intelligible Artificial Intelligence
Weld, Daniel S.; Bansal, Gagan
2018-01-01
Since Artificial Intelligence (AI) software uses techniques like deep lookahead search and stochastic optimization of huge neural networks to fit mammoth datasets, it often results in complex behavior that is difficult for people to understand. Yet organizations are deploying AI algorithms in many mission-critical settings. In order to trust their behavior, we must make it intelligible --- either by using inherently interpretable models or by developing methods for explaining otherwise overwh...
Naturalist Intelligence Among the Other Multiple Intelligences [In Bulgarian
Directory of Open Access Journals (Sweden)
R. Genkov
2007-09-01
Full Text Available The theory of multiple intelligences was presented by Gardner in 1983. The theory was revised later (1999 and among the other intelligences a naturalist intelligence was added. The criteria for distinguishing of the different types of intelligences are considered. While Gardner restricted the analysis of the naturalist intelligence with examples from the living nature only, the present paper considered this problem on wider background including objects and persons of the natural sciences.
Qualitative Evaluation of the Java Intelligent Tutoring System
Directory of Open Access Journals (Sweden)
Edward Sykes
2005-10-01
Full Text Available In an effort to support the growing trend of the Java programming language and to promote web-based personalized education, the Java Intelligent Tutoring System (JITS was designed and developed. This tutoring system is unique in a number of ways. Most Intelligent Tutoring Systems require the teacher to author problems with corresponding solutions. JITS, on the other hand, requires the teacher to only supply the problem and problem specification. JITS is designed to "intelligently" examine the student's submitted code and determines appropriate feedback based on a number of factors such as JITS' cognitive model of the student, the student's skill level, and problem details. JITS is intended to be used by beginner programming students in their first year of College or University. This paper discusses the important aspects of the design and development of JITS, the qualitative methods and procedures, and findings. Research was conducted at the Sheridan Institute of Technology and Advanced Learning, Ontario, Canada.
Hunt, Earl B
1975-01-01
Artificial Intelligence provides information pertinent to the fundamental aspects of artificial intelligence. This book presents the basic mathematical and computational approaches to problems in the artificial intelligence field.Organized into four parts encompassing 16 chapters, this book begins with an overview of the various fields of artificial intelligence. This text then attempts to connect artificial intelligence problems to some of the notions of computability and abstract computing devices. Other chapters consider the general notion of computability, with focus on the interaction bet
DEFF Research Database (Denmark)
Rønn, Kira Vrist
2016-01-01
Questions concerning what constitutes a morally justified conduct of intelligence activities have received increased attention in recent decades. However, intelligence ethics is not yet homogeneous or embedded as a solid research field. The aim of this article is to sketch the state of the art...... of intelligence ethics and point out subjects for further scrutiny in future research. The review clusters the literature on intelligence ethics into two groups: respectively, contributions on external topics (i.e., the accountability of and the public trust in intelligence agencies) and internal topics (i.......e., the search for an ideal ethical framework for intelligence actions). The article concludes that there are many holes to fill for future studies on intelligence ethics both in external and internal discussions. Thus, the article is an invitation – especially, to moral philosophers and political theorists...
#%Applications of artificial intelligence in intelligent manufacturing: a review
Institute of Scientific and Technical Information of China (English)
#
2017-01-01
#%Based on research into the applications of artificial intelligence (AI) technology in the manufacturing industry in recent years, we analyze the rapid development of core technologies in the new era of 'Internet plus AI', which is triggering a great change in the models, means, and ecosystems of the manufacturing industry, as well as in the development of AI. We then propose new models, means, and forms of intelligent manufacturing, intelligent manufacturing system architecture, and intelligent man-ufacturing technology system, based on the integration of AI technology with information communications, manufacturing, and related product technology. Moreover, from the perspectives of intelligent manufacturing application technology, industry, and application demonstration, the current development in intelligent manufacturing is discussed. Finally, suggestions for the appli-cation of AI in intelligent manufacturing in China are presented.
Search for extraterrestrial intelligence/high resolution microwave survey team member
Steffes, Paul G.
1993-01-01
This semiannual status report describes activities conducted by the Principal Investigator during the first half of this third year of the NASA High Resolution Microwave Survey (HRMS) Investigator Working Group (IWG). As a (HRMS) Team Member with primary interest in the Sky Survey activity, this investigator attended IWG meetings at NASA/Ames and U.C.-Santa Cruz in Apr. and Aug. 1992, and has traveled independently to NRAO/Kitt Peak, Arizona (April 1993) and Woodbury, Georgia (July 1993). During the July 1993 visit to the Georgia Tech Research Corporation/Woodbury Research Facility, an experiment was conducted to study the effects of interference from C-band (3.7 - 4.2 GHz) geostationary spacecraft on the Sky Survey operation in that band. At the first IWG meeting in April of this year, results of a SETI observation conducted at the 203 GHz positronium hyperfine resonance using the NRAO facility at Kitt Peak, AZ, were presented, as well as updates on the development of the spaceborne RFI data bases developed for the project. At the second meeting, results of the study of interference from C-band geostationary spacecraft were presented. Likewise, a presentation was made at the accompanying 1993 Bioastronomy Symposium describing the SETI observation at the positronium hyperfine resonance.
Visual business ecosystem intelligence: lessons from the field.
Basole, Rahul C
2014-01-01
Macroscopic insight into business ecosystems is becoming increasingly important. With the emergence of new digital business data, opportunities exist to develop rich, interactive visual-analytics tools. Georgia Institute of Technology researchers have been developing and implementing visual business ecosystem intelligence tools in corporate settings. This article discusses the challenges they faced, the lessons learned, and opportunities for future research.
Artificial intelligence tool development and applications to nuclear power
International Nuclear Information System (INIS)
Naser, J.A.
1987-01-01
Two parallel efforts are being performed at the Electric Power Research Institute (EPRI) to help the electric utility industry take advantage of the expert system technology. The first effort is the development of expert system building tools, which are tailored to electric utility industry applications. The second effort is the development of expert system applications. These two efforts complement each other. The application development tests the tools and identifies additional tool capabilities that are required. The tool development helps define the applications that can be successfully developed. Artificial intelligence, as demonstrated by the developments described is being established as a credible technological tool for the electric utility industry. The challenge to transferring artificial intelligence technology and an understanding of its potential to the electric utility industry is to gain an understanding of the problems that reduce power plant performance and identify which can be successfully addressed using artificial intelligence
Emotional Intelligence and Graduates - Employers' Perspectives
Jameson, Ailish; Carthy, Aiden; McGuinness, Colm; McSweeney, Fiona
2016-01-01
Research has demonstrated that employers favour graduates who possess higher levels of emotional intelligence. Many initiatives to increase students’ levels of EI have involved ‘whole school’ approaches, whereby generic EI skills programmes are delivered to all students in a third level institute. This paper details an initial survey of employers’ (n = 500) opinions on the importance and current level of graduates’ social and emotional competencies. The survey was completed across fi...
Social intelligence, human intelligence and niche construction.
Sterelny, Kim
2007-04-29
This paper is about the evolution of hominin intelligence. I agree with defenders of the social intelligence hypothesis in thinking that externalist models of hominin intelligence are not plausible: such models cannot explain the unique cognition and cooperation explosion in our lineage, for changes in the external environment (e.g. increasing environmental unpredictability) affect many lineages. Both the social intelligence hypothesis and the social intelligence-ecological complexity hybrid I outline here are niche construction models. Hominin evolution is hominin response to selective environments that earlier hominins have made. In contrast to social intelligence models, I argue that hominins have both created and responded to a unique foraging mode; a mode that is both social in itself and which has further effects on hominin social environments. In contrast to some social intelligence models, on this view, hominin encounters with their ecological environments continue to have profound selective effects. However, though the ecological environment selects, it does not select on its own. Accidents and their consequences, differential success and failure, result from the combination of the ecological environment an agent faces and the social features that enhance some opportunities and suppress others and that exacerbate some dangers and lessen others. Individuals do not face the ecological filters on their environment alone, but with others, and with the technology, information and misinformation that their social world provides.
Distributed Computing and Artificial Intelligence, 12th International Conference
Malluhi, Qutaibah; Gonzalez, Sara; Bocewicz, Grzegorz; Bucciarelli, Edgardo; Giulioni, Gianfranco; Iqba, Farkhund
2015-01-01
The 12th International Symposium on Distributed Computing and Artificial Intelligence 2015 (DCAI 2015) is a forum to present applications of innovative techniques for studying and solving complex problems. The exchange of ideas between scientists and technicians from both the academic and industrial sector is essential to facilitate the development of systems that can meet the ever-increasing demands of today’s society. The present edition brings together past experience, current work and promising future trends associated with distributed computing, artificial intelligence and their application in order to provide efficient solutions to real problems. This symposium is organized by the Osaka Institute of Technology, Qatar University and the University of Salamanca.
Selected business intelligence methods for decision-making support in a finance institution
Mezera, Filip; Křupka, Jiří
2017-01-01
This article deals with decision-making support methods’ implementation in a medium size financial company with international operations. The objective of this article is to show the abilities of these methods to precise decision-making of management. At the beginning of this article there is briefly described the existing situation in this business sector in Central Europe. After that part Business Intelligence methods are described as well as the reasons while these methods have been introd...
Trends in ambient intelligent systems the role of computational intelligence
Khan, Mohammad; Abraham, Ajith
2016-01-01
This book demonstrates the success of Ambient Intelligence in providing possible solutions for the daily needs of humans. The book addresses implications of ambient intelligence in areas of domestic living, elderly care, robotics, communication, philosophy and others. The objective of this edited volume is to show that Ambient Intelligence is a boon to humanity with conceptual, philosophical, methodical and applicative understanding. The book also aims to schematically demonstrate developments in the direction of augmented sensors, embedded systems and behavioral intelligence towards Ambient Intelligent Networks or Smart Living Technology. It contains chapters in the field of Ambient Intelligent Networks, which received highly positive feedback during the review process. The book contains research work, with in-depth state of the art from augmented sensors, embedded technology and artificial intelligence along with cutting-edge research and development of technologies and applications of Ambient Intelligent N...
2014-12-01
The report documents policy considerations for the Intelligent Network Flow Optimization (INFLO) connected vehicle applications : bundle. INFLO aims to optimize network flow on freeways and arterials by informing motorists of existing and impen...
Putting intelligent structured intermittent auscultation (ISIA) into practice.
Maude, Robyn M; Skinner, Joan P; Foureur, Maralyn J
2016-06-01
Fetal monitoring guidelines recommend intermittent auscultation for the monitoring of fetal wellbeing during labour for low-risk women. However, these guidelines are not being translated into practice and low-risk women birthing in institutional maternity units are increasingly exposed to continuous cardiotocographic monitoring, both on admission to hospital and during labour. When continuous fetal monitoring becomes routinised, midwives and obstetricians lose practical skills around intermittent auscultation. To support clinical practice and decision-making around auscultation modality, the intelligent structured intermittent auscultation (ISIA) framework was developed. The purpose of this discussion paper is to describe the application of intelligent structured intermittent auscultation in practice. The intelligent structured intermittent auscultation decision-making framework is a knowledge translation tool that supports the implementation of evidence into practice around the use of intermittent auscultation for fetal heart monitoring for low-risk women during labour. An understanding of the physiology of the materno-utero-placental unit and control of the fetal heart underpin the development of the framework. Intelligent structured intermittent auscultation provides midwives with a robust means of demonstrating their critical thinking and clinical reasoning and supports their understanding of normal physiological birth. Copyright © 2015 The Authors. Published by Elsevier Ltd.. All rights reserved.
Ryoo, Young; Jang, Moon-soo; Bae, Young-Chul
2014-01-01
Intelligent systems have been initiated with the attempt to imitate the human brain. People wish to let machines perform intelligent works. Many techniques of intelligent systems are based on artificial intelligence. According to changing and novel requirements, the advanced intelligent systems cover a wide spectrum: big data processing, intelligent control, advanced robotics, artificial intelligence and machine learning. This book focuses on coordinating intelligent systems with highly integrated and foundationally functional components. The book consists of 19 contributions that features social network-based recommender systems, application of fuzzy enforcement, energy visualization, ultrasonic muscular thickness measurement, regional analysis and predictive modeling, analysis of 3D polygon data, blood pressure estimation system, fuzzy human model, fuzzy ultrasonic imaging method, ultrasonic mobile smart technology, pseudo-normal image synthesis, subspace classifier, mobile object tracking, standing-up moti...
Bergeron, Pierrette; Hiller, Christine A.
2002-01-01
Reviews the evolution of competitive intelligence since 1994, including terminology and definitions and analytical techniques. Addresses the issue of ethics; explores how information technology supports the competitive intelligence process; and discusses education and training opportunities for competitive intelligence, including core competencies…
Directory of Open Access Journals (Sweden)
Fariborz Bagheri
2011-11-01
Full Text Available Background: Spiritual intelligence defined as the capacity of human understanding for asking ultimate, questions about the meaning of life and relation between us and world we are living in it. It seems employing spiritual intelligence in the life will guide us to achieve happiness and wellbeing in the life. The goal of this survey is to investigate relation between of spiritual intelligence and happiness among nurses of two main hospitals, namely Fatemeh Zahra and Bentolhosa in Bousher. Methods: This is a cross-sectional descriptive and inferential designed study. A total of 125 hospital nurses, who were working in Boushehr, were recruited by convenience sampling. The questionnaires were completed by respondents themselves (self reporting. The questionnaires were combined from three parts. I Spiritual intelligence questionnaire Naseris four-point Linker-type inventory that made in Allameh of university in Iran. II Oxford happiness questionnaire. III Demographic characteristics. Results: The findings showed there were significant relationship between spiritual intelligence variables, self-conscious transcendence (p< 0.001, r=0.288, spiritual experiences (p<0.000, r=0.347, patience (p<0.002, r=0.274, and happiness of nurses. But neither happiness nor spiritual intelligence shows any correlation with demographic characteristic such as age, sex, marital status, education, degree, years of nursing experience, but only the ward were the nurses performing their duties with spiritual intelligence and happiness has significant relationship. Conclusion: Promoting spiritual intelligence of the nurses can help them have more stable happiness.
Recent advances in intelligent machine technologies
International Nuclear Information System (INIS)
Bartholet, T.G.
1987-01-01
Further developments in intelligent machine technologies have recently been accomplished under sponsorship by the Department of Energy (DOE), the Electric Power Research Institute (EPRI), the U.S. Army and NASA. This paper describes these developments and presents actual results achieved and demonstrated. These projects encompass new developments in manipulators, vision and walking machines. Continuing developments will add increasing degrees of autonomy as appropriate to applications in the fields of nuclear power, space, defense and industrial or commercial marketplaces
Modelling traffic flows with intelligent cars and intelligent roads
van Arem, Bart; Tampere, Chris M.J.; Malone, Kerry
2003-01-01
This paper addresses the modeling of traffic flows with intelligent cars and intelligent roads. It will describe the modeling approach MIXIC and review the results for different ADA systems: Adaptive Cruise Control, a special lane for Intelligent Vehicles, cooperative following and external speed
Energy Technology Data Exchange (ETDEWEB)
NONE
2012-07-01
Within the contribution under consideration the Fraunhofer Institute for Systems and Innovation Research ISI (Karlsruhe, Federal Republic of Germany) determines the total economic effects of intelligent networks for the German economy. For the first time, the contributions of the different areas (energy, health, traffic, education, administration) are shown detailed. On the whole, it arises a societal total benefit of intelligent networks of 55.7 billion Euro per year.
Sternberg, Robert J
2012-03-01
Intelligence is the ability to learn from experience and to adapt to, shape, and select environments. Intelligence as measured by (raw scores on) conventional standardized tests varies across the lifespan, and also across generations. Intelligence can be understood in part in terms of the biology of the brain-especially with regard to the functioning in the prefrontal cortex-and also correlates with brain size, at least within humans. Studies of the effects of genes and environment suggest that the heritability coefficient (ratio of genetic to phenotypic variation) is between .4 and .8, although heritability varies as a function of socioeconomic status and other factors. Racial differences in measured intelligence have been observed, but race is a socially constructed rather than biological variable, so such differences are difficult to interpret.
Sternberg, Robert J.
2012-01-01
Intelligence is the ability to learn from experience and to adapt to, shape, and select environments. Intelligence as measured by (raw scores on) conventional standardized tests varies across the lifespan, and also across generations. Intelligence can be understood in part in terms of the biology of the brain—especially with regard to the functioning in the prefrontal cortex—and also correlates with brain size, at least within humans. Studies of the effects of genes and environment suggest that the heritability coefficient (ratio of genetic to phenotypic variation) is between .4 and .8, although heritability varies as a function of socioeconomic status and other factors. Racial differences in measured intelligence have been observed, but race is a socially constructed rather than biological variable, so such differences are difficult to interpret. PMID:22577301
Best Practice in Using Business Intelligence to Determine Research Strategy
Green, John; Rutherford, Scott; Turner, Thomas
2009-01-01
The authors recognise that there is no "one-size-fits-all" approach to implementing business intelligence strategy within universities. Elements of best practice have been taken from a case study of Imperial College, which may be applied across other institutions. The process starts with implementing and developing systems that capture…
Combined Intelligent Control (CIC an Intelligent Decision Making Algorithm
Directory of Open Access Journals (Sweden)
Moteaal Asadi Shirzi
2007-03-01
Full Text Available The focus of this research is to introduce the concept of combined intelligent control (CIC as an effective architecture for decision-making and control of intelligent agents and multi-robot sets. Basically, the CIC is a combination of various architectures and methods from fields such as artificial intelligence, Distributed Artificial Intelligence (DAI, control and biological computing. Although any intelligent architecture may be very effective for some specific applications, it could be less for others. Therefore, CIC combines and arranges them in a way that the strengths of any approach cover the weaknesses of others. In this paper first, we introduce some intelligent architectures from a new aspect. Afterward, we offer the CIC by combining them. CIC has been executed in a multi-agent set. In this set, robots must cooperate to perform some various tasks in a complex and nondeterministic environment with a low sensory feedback and relationship. In order to investigate, improve, and correct the combined intelligent control method, simulation software has been designed which will be presented and considered. To show the ability of the CIC algorithm as a distributed architecture, a central algorithm is designed and compared with the CIC.
International Nuclear Information System (INIS)
George, D.G.
1990-01-01
This paper discusses the role of US intelligence during arms control negotiations between 1982 and 1987. It also covers : the orchestration of intelligence projects; an evaluation of the performance of intelligence activities; the effect intelligence work had on actual arms negotiations; and suggestions for improvements in the future
InSpiRe - Intelligent Spine Rehabilitation
DEFF Research Database (Denmark)
Bøg, Kasper Hafstrøm; Helms, Niels Henrik; Kjær, Per
InSpiRe er et projekt, der har haft omdrejningspunkt i etableringen af et nyt netværk indenfor intelligent genoptræning med særligt fokus på rygsmerter. Projektet er gennemført i perioden 1/3 2011 2011-1/3 2012, med støtte fra Syddansk Vækstforum, og er blevet drevet af projektparterne Knowledge ...... Lab, Syddansk Universitet (SDU), Institut for Idræt og Biomekanik (IoB), SDU, samt University College Lillebælt....
Intelligence and childlessness.
Kanazawa, Satoshi
2014-11-01
Demographers debate why people have children in advanced industrial societies where children are net economic costs. From an evolutionary perspective, however, the important question is why some individuals choose not to have children. Recent theoretical developments in evolutionary psychology suggest that more intelligent individuals may be more likely to prefer to remain childless than less intelligent individuals. Analyses of the National Child Development Study show that more intelligent men and women express preference to remain childless early in their reproductive careers, but only more intelligent women (not more intelligent men) are more likely to remain childless by the end of their reproductive careers. Controlling for education and earnings does not at all attenuate the association between childhood general intelligence and lifetime childlessness among women. One-standard-deviation increase in childhood general intelligence (15 IQ points) decreases women's odds of parenthood by 21-25%. Because women have a greater impact on the average intelligence of future generations, the dysgenic fertility among women is predicted to lead to a decline in the average intelligence of the population in advanced industrial nations. Copyright © 2014 Elsevier Inc. All rights reserved.
Perceived intelligence is associated with measured intelligence in men but not women.
Kleisner, Karel; Chvátalová, Veronika; Flegr, Jaroslav
2014-01-01
The ability to accurately assess the intelligence of other persons finds its place in everyday social interaction and should have important evolutionary consequences. We used static facial photographs of 40 men and 40 women to test the relationship between measured IQ, perceived intelligence, and facial shape. Both men and women were able to accurately evaluate the intelligence of men by viewing facial photographs. In addition to general intelligence, figural and fluid intelligence showed a significant relationship with perceived intelligence, but again, only in men. No relationship between perceived intelligence and IQ was found for women. We used geometric morphometrics to determine which facial traits are associated with the perception of intelligence, as well as with intelligence as measured by IQ testing. Faces that are perceived as highly intelligent are rather prolonged with a broader distance between the eyes, a larger nose, a slight upturn to the corners of the mouth, and a sharper, pointing, less rounded chin. By contrast, the perception of lower intelligence is associated with broader, more rounded faces with eyes closer to each other, a shorter nose, declining corners of the mouth, and a rounded and massive chin. By contrast, we found no correlation between morphological traits and real intelligence measured with IQ test, either in men or women. These results suggest that a perceiver can accurately gauge the real intelligence of men, but not women, by viewing their faces in photographs; however, this estimation is possibly not based on facial shape. Our study revealed no relation between intelligence and either attractiveness or face shape.
Information Technology Quarterly, 1985
1985-01-01
This issue of "Information Technology Quarterly" is devoted to the theme of "Artificial Intelligence." It contains two major articles: (1) Artificial Intelligence and Law" (D. Peter O'Neill and George D. Wood); (2) "Artificial Intelligence: A Long and Winding Road" (John J. Simon, Jr.). In addition, it contains two sidebars: (1) "Calculating and…
Sensor Technologies for Intelligent Transportation Systems.
Guerrero-Ibáñez, Juan; Zeadally, Sherali; Contreras-Castillo, Juan
2018-04-16
Modern society faces serious problems with transportation systems, including but not limited to traffic congestion, safety, and pollution. Information communication technologies have gained increasing attention and importance in modern transportation systems. Automotive manufacturers are developing in-vehicle sensors and their applications in different areas including safety, traffic management, and infotainment. Government institutions are implementing roadside infrastructures such as cameras and sensors to collect data about environmental and traffic conditions. By seamlessly integrating vehicles and sensing devices, their sensing and communication capabilities can be leveraged to achieve smart and intelligent transportation systems. We discuss how sensor technology can be integrated with the transportation infrastructure to achieve a sustainable Intelligent Transportation System (ITS) and how safety, traffic control and infotainment applications can benefit from multiple sensors deployed in different elements of an ITS. Finally, we discuss some of the challenges that need to be addressed to enable a fully operational and cooperative ITS environment.
Sensor Technologies for Intelligent Transportation Systems
Guerrero-Ibáñez, Juan; Zeadally, Sherali
2018-01-01
Modern society faces serious problems with transportation systems, including but not limited to traffic congestion, safety, and pollution. Information communication technologies have gained increasing attention and importance in modern transportation systems. Automotive manufacturers are developing in-vehicle sensors and their applications in different areas including safety, traffic management, and infotainment. Government institutions are implementing roadside infrastructures such as cameras and sensors to collect data about environmental and traffic conditions. By seamlessly integrating vehicles and sensing devices, their sensing and communication capabilities can be leveraged to achieve smart and intelligent transportation systems. We discuss how sensor technology can be integrated with the transportation infrastructure to achieve a sustainable Intelligent Transportation System (ITS) and how safety, traffic control and infotainment applications can benefit from multiple sensors deployed in different elements of an ITS. Finally, we discuss some of the challenges that need to be addressed to enable a fully operational and cooperative ITS environment. PMID:29659524
Sensor Technologies for Intelligent Transportation Systems
Directory of Open Access Journals (Sweden)
Juan Guerrero-Ibáñez
2018-04-01
Full Text Available Modern society faces serious problems with transportation systems, including but not limited to traffic congestion, safety, and pollution. Information communication technologies have gained increasing attention and importance in modern transportation systems. Automotive manufacturers are developing in-vehicle sensors and their applications in different areas including safety, traffic management, and infotainment. Government institutions are implementing roadside infrastructures such as cameras and sensors to collect data about environmental and traffic conditions. By seamlessly integrating vehicles and sensing devices, their sensing and communication capabilities can be leveraged to achieve smart and intelligent transportation systems. We discuss how sensor technology can be integrated with the transportation infrastructure to achieve a sustainable Intelligent Transportation System (ITS and how safety, traffic control and infotainment applications can benefit from multiple sensors deployed in different elements of an ITS. Finally, we discuss some of the challenges that need to be addressed to enable a fully operational and cooperative ITS environment.
Self-Assessing of the Emotional Intelligence and Organizational Intelligence in Schools
Dagiene, Valentina; Juškeviciene, Anita; Carneiro, Roberto; Child, Camilla; Cullen, Joe
2015-01-01
The paper presents the results of an evaluation of the Emotional Intelligence (EI) and Organisational Intelligence (OI) competences self-assessment tools developed and applied by the IGUANA project. In the paper Emotional Intelligence and Organisational Intelligence competences are discussed, their use in action research experiments to assess and…
Perceived Intelligence Is Associated with Measured Intelligence in Men but Not Women
Kleisner, Karel; Chvátalová, Veronika; Flegr, Jaroslav
2014-01-01
Background The ability to accurately assess the intelligence of other persons finds its place in everyday social interaction and should have important evolutionary consequences. Methodology/Principal Findings We used static facial photographs of 40 men and 40 women to test the relationship between measured IQ, perceived intelligence, and facial shape. Both men and women were able to accurately evaluate the intelligence of men by viewing facial photographs. In addition to general intelligence, figural and fluid intelligence showed a significant relationship with perceived intelligence, but again, only in men. No relationship between perceived intelligence and IQ was found for women. We used geometric morphometrics to determine which facial traits are associated with the perception of intelligence, as well as with intelligence as measured by IQ testing. Faces that are perceived as highly intelligent are rather prolonged with a broader distance between the eyes, a larger nose, a slight upturn to the corners of the mouth, and a sharper, pointing, less rounded chin. By contrast, the perception of lower intelligence is associated with broader, more rounded faces with eyes closer to each other, a shorter nose, declining corners of the mouth, and a rounded and massive chin. By contrast, we found no correlation between morphological traits and real intelligence measured with IQ test, either in men or women. Conclusions These results suggest that a perceiver can accurately gauge the real intelligence of men, but not women, by viewing their faces in photographs; however, this estimation is possibly not based on facial shape. Our study revealed no relation between intelligence and either attractiveness or face shape. PMID:24651120
Third International Symposium on Artificial Intelligence, Robotics, and Automation for Space 1994
1994-01-01
The Third International Symposium on Artificial Intelligence, Robotics, and Automation for Space (i-SAIRAS 94), held October 18-20, 1994, in Pasadena, California, was jointly sponsored by NASA, ESA, and Japan's National Space Development Agency, and was hosted by the Jet Propulsion Laboratory (JPL) of the California Institute of Technology. i-SAIRAS 94 featured presentations covering a variety of technical and programmatic topics, ranging from underlying basic technology to specific applications of artificial intelligence and robotics to space missions. i-SAIRAS 94 featured a special workshop on planning and scheduling and provided scientists, engineers, and managers with the opportunity to exchange theoretical ideas, practical results, and program plans in such areas as space mission control, space vehicle processing, data analysis, autonomous spacecraft, space robots and rovers, satellite servicing, and intelligent instruments.
The relationship of Emotional Intelligence with Academic Intelligence and the Big Five
Van der Zee, K.I.; Thijs, Melanie; Schakel, Lolle
The present study examines the relationship of self- and other ratings of emotional intelligence with academic intelligence and personality, as well as the incremental validity of emotional intelligence beyond academic intelligence and personality in predicting academic and social success. A sample
The relationship of emotional intelligence with academic intelligence and the Big Five
van der Zee, K; Thijs, M; Schakel, L
2002-01-01
The present study examines the relationship of self- and other ratings of emotional intelligence with academic intelligence and personality, as well as the incremental validity of emotional intelligence beyond academic intelligence and personality in predicting academic and social success. A sample
Social Media and U.S. Intelligence Agencies: Just Trending or a Real Tool to Engage and Educate?
Directory of Open Access Journals (Sweden)
Michael Landon-Murray
2015-10-01
Full Text Available Social media use has become ubiquitous not just among individuals, groups, and businesses, but also government institutions. In turn, the adoption of services like Facebook and Twitter in the public sector has increasingly become the focus of academic study. U.S. intelligence agencies, however, have been excluded from examination. The potential benefits—engagement, education, and transparency, among others—are significant, and studying how U.S. intelligence uses social media will help us realize those benefits. In the arcane, complex and potentially intrusive world of intelligence, new opportunities to bolster public knowledge and accountability must be utilized. Today, understanding government requires studying e-government, and in intelligence, social media likely represents the most direction connection between citizens and the public agencies that serve them. To take a first step, this study maps how U.S. intelligence agencies are using Facebook and Twitter, examines other social media practices, and presents findings from correspondence with four intelligence and security journalists.
A Business Intelligence Framework for Sustainability Information Management in Higher Education
Scholtz, Brenda; Calitz, Andre; Haupt, Ross
2018-01-01
Purpose: Higher education institutions (HEIs) face a number of challenges in effectively managing and reporting on sustainability information, such as siloes of data and a limited distribution of information. Business intelligence (BI) can assist in addressing the challenges faced by organisations. The purpose of this study was to propose a BI…
Artificial Intelligence Project
1990-01-01
Symposium on Aritificial Intelligence and Software Engineering Working Notes, March 1989. Blumenthal, Brad, "An Architecture for Automating...Artificial Intelligence Project Final Technical Report ARO Contract: DAAG29-84-K-OGO Artificial Intelligence LaboratO"ry The University of Texas at...Austin N>.. ~ ~ JA 1/I 1991 n~~~ Austin, Texas 78712 ________k A,.tificial Intelligence Project i Final Technical Report ARO Contract: DAAG29-84-K-0060
A critical examination of factors that might encourage secrecy
Tough, Allen
If a signal is detected someday from extraterrestrial intelligence, several factors might encourage complete and immediate secrecy. As a result, all data might be restricted to the receiving facility or nation instead of being shared promptly with SETI scientists around the world. Seven factors seem particularly like to encourage secrecy: (1) the belief that people may panic; (2) the fear of a negative impact on religion, science, and culture; (3) embarrassment; (4) the individual and national competitive urge; (5) avoiding a harmful premature reply; (6) a national trade or military advantage; and (7) the fear of a Trojan Horse. Three steps might alleviate the particularly difficult factors (numbers 4, 5, 6): an international treaty for immediate sharing of possible signals with SETI scientists in several other countries; implementation and frequent use of an actual network of scientists for such sharing; and further study of the possible need for partial restriction of data about the location and channel of a suspected signal.
2005-01-01
After the success of SETI@home, many other scientists have found computer power donated by the public to be a valuable resource - and sometimes the only possibility to achieve their goals. In July, representatives of several “public resource computing” projects came to CERN to discuss technical issues and R&D activities on the common computing platform they are using, BOINC. This photograph shows the LHC@home screen-saver which uses the BOINC platform: the dots represent protons and the position of the status bar indicates the progress of the calculations. This summer, CERN hosted the first “pangalactic workshop” on BOINC (Berkeley Open Interface for Network Computing). BOINC is modelled on SETI@home, which millions of people have downloaded to help search for signs of extraterrestrial intelligence in radio-astronomical data. BOINC provides a general-purpose framework for scientists to adapt their software to, so that the public can install and run it. An important part of BOINC is managing the...
CERN Physics Screen Saver: Help LHC tracking studies on your PC
2004-01-01
Many PC users are familiar with screensavers such as SETI@home and FightAIDS@home. These screensavers take advantage of times when your PC is idle to do useful computing on a particular scientific problem. SETI@home, which analyses radio-astronomy data for signs of extraterrestrial intelligence, has been downloaded by over 5 million people. Similar programs are now sold commercially, and installed in major corporations to provide extra computing power at low cost. CERN 's IT Department is interested in evaluating this sort of technology for the future. Most of the scientific computing challenges that the LHC experiments are facing will require access to large amounts of storage, and cannot be run on individual PCs. However, there are exceptions. A program called SixTrack, which simulates particles traveling around the LHC to study the stability of their orbits, can fit on a single PC and requires relatively little input or output. SixTrack, which was developed by Frank Schmidt of the AB Department, produces r...
Routledge companion to intelligence studies
Dover, Robert; Hillebrand, Claudia
2013-01-01
The Routledge Companion to Intelligence Studies provides a broad overview of the growing field of intelligence studies. The recent growth of interest in intelligence and security studies has led to an increased demand for popular depictions of intelligence and reference works to explain the architecture and underpinnings of intelligence activity. Divided into five comprehensive sections, this Companion provides a strong survey of the cutting-edge research in the field of intelligence studies: Part I: The evolution of intelligence studies; Part II: Abstract approaches to intelligence; Part III: Historical approaches to intelligence; Part IV: Systems of intelligence; Part V: Contemporary challenges. With a broad focus on the origins, practices and nature of intelligence, the book not only addresses classical issues, but also examines topics of recent interest in security studies. The overarching aim is to reveal the rich tapestry of intelligence studies in both a sophisticated and accessible way. This Companion...
4th International Joint Conference on Computational Intelligence
Correia, António; Rosa, Agostinho; Filipe, Joaquim
2015-01-01
The present book includes extended and revised versions of a set of selected papers from the Fourth International Joint Conference on Computational Intelligence (IJCCI 2012)., held in Barcelona, Spain, from 5 to 7 October, 2012. The conference was sponsored by the Institute for Systems and Technologies of Information, Control and Communication (INSTICC) and was organized in cooperation with the Association for the Advancement of Artificial Intelligence (AAAI). The conference brought together researchers, engineers and practitioners in computational technologies, especially those related to the areas of fuzzy computation, evolutionary computation and neural computation. It is composed of three co-located conferences, each one specialized in one of the aforementioned -knowledge areas. Namely: - International Conference on Evolutionary Computation Theory and Applications (ECTA) - International Conference on Fuzzy Computation Theory and Applications (FCTA) - International Conference on Neural Computation Theory a...
International Nuclear Information System (INIS)
Zheng, M.; Minglu, W.
2016-01-01
Full text: Nuclear R&D is highly knowledge-intensive. With the rapid advent and development of modern information technology, knowledge management in nuclear industry has been provided with new approaches and possibilities. This article introduces a framework of intelligent digitized design system in nuclear R&D phase and finds answer to knowledge application, internal process optimization, experience feedback and further innovation. This framework utilizing digitalization and informatization finds a way to incorporate the process of the “Socialization, Externalization, Combination, Internalization” (SECI) model which include intelligent design process, integrated design software, smart verification and validation simulation platform, experiment data management platform, online monitoring platform and digital twin nuclear power plant, etc. The following case study gives a clear picture of what and how knowledge management has been performed under this framework. Furthermore, important lessons have been summarized. (author
2013-01-02
... DEPARTMENT OF DEFENSE Office of the Secretary Defense Intelligence Agency National Intelligence University Board of Visitors Closed Meeting AGENCY: National Intelligence University, Defense Intelligence... hereby given that a closed meeting of the National Intelligence University Board of Visitors has been...
Study of Emotional Intelligence Patterns with Teachers Working in Public Education
Balázs, László
2015-01-01
The data necessary for the empirical research presented it this study were provided by 572 people, from altogether 26 schools. The schools included 18 primary schools, 7 secondary training institutions and 1 primary and secondary school. The major question of the study related to the pedagogues' emotional intelligence, more precisely if the…
Civil control over the security institutions in South Africa ...
African Journals Online (AJOL)
security policy. The main aim of this article is therefore to assist critical new thinking regarding security.6. Then, to draw policy implications for the governance of security and intelligence ...... network of institutions and relationships that involve vertical and horizontal accountability . Important is Karl s observation that ...
Intelligent products : A survey
Meyer, G.G.; Främling, K.; Holmström, J.
This paper presents an overview of the field of Intelligent Products. As Intelligent Products have many facets, this paper is mainly focused on the concept behind Intelligent Products, the technical foundations, and the achievable practical goals of Intelligent Products. A novel classification of
Benefits of collective intelligence: Swarm intelligent foraging, an ethnographic research
Directory of Open Access Journals (Sweden)
Sivave Mashingaidze
2014-12-01
Full Text Available Wisdom of crowds; bees, colonies of ants, schools of fish, flocks of birds, and fireflies flashing synchronously are all examples of highly coordinated behaviors that emerge from collective, decentralized intelligence. This article is an ethnographic study of swarm intelligence foraging of swarms and the benefits derived from collective decision making. The author used using secondary data analysis to look at the benefits of swarm intelligence in decision making to achieve intended goals. Concepts like combined decision making and consensus were discussed and four principles of swarm intelligence were also discussed viz; coordination, cooperation, deliberation and collaboration. The research found out that collective decision making in swarms is the touchstone of achieving their goals. The research further recommended corporate to adopt collective intelligence for business sustainability.
Intelligence: Real or artificial?
Schlinger, Henry D.
1992-01-01
Throughout the history of the artificial intelligence movement, researchers have strived to create computers that could simulate general human intelligence. This paper argues that workers in artificial intelligence have failed to achieve this goal because they adopted the wrong model of human behavior and intelligence, namely a cognitive essentialist model with origins in the traditional philosophies of natural intelligence. An analysis of the word “intelligence” suggests that it originally r...
Directory of Open Access Journals (Sweden)
Helen Alizadeh
2014-05-01
Full Text Available After Gardner’s Multiple Intelligences Theory (MIT, some language teaching practitioners set out to teach students in a way to help their dominant intelligence(s blossom. In an EFL context, usually teachers’ main focus is to develop communication skills. Nowadays, writing is one of the main ways by which people communicate. Thus, this study aimed at investigating possible relationship between Multiple Intelligences and writing performance of Iranian EFL learners across different genders. To conduct this study, 15 male and 15 female advanced EFL learners from a reputable institute in Tabriz participated. They passed through a placement test to enter the course, yet the researchers administered a Test of English as a Foreign Language (TOEFL to ensure homogeneity in the group. After a session of introducing the project’s purpose, Multiple Intelligence Developmental Assessment (MIDAS questionnaire was administered for obtaining participants’ Multiple Intelligence profile. Later, the participants were given a text and asked to read and summarize it. The collected writings were analyzed for grammatical accuracy, complexity and quality of the writing based on Jacob et al.’s (1981 scale. The results of the correlational analysis revealed that overall Multiple Intelligences correlated positively with the quality of the female learners’ writing. The findings suggest that English teachers consider the role of multiple intelligences in learning and teaching process and provide more effective activities to help learners of different intelligences improve their foreign language writing skill.
Quality control of intelligence research
International Nuclear Information System (INIS)
Lu Yan; Xin Pingping; Wu Jian
2014-01-01
Quality control of intelligence research is the core issue of intelligence management, is a problem in study of information science This paper focuses on the performance of intelligence to explain the significance of intelligence research quality control. In summing up the results of the study on the basis of the analysis, discusses quality control methods in intelligence research, introduces the experience of foreign intelligence research quality control, proposes some recommendations to improve quality control in intelligence research. (authors)
Intelligence Issues for Congress
2013-04-23
open source information— osint (newspapers...by user agencies. Section 1052 of the Intelligence Reform Act expressed the sense of Congress that there should be an open source intelligence ...center to coordinate the collection, analysis, production, and dissemination of open source intelligence to other intelligence agencies. An Open Source
Phan, Sieu; Famili, Fazel; Liu, Ziying; Peña-Castillo, Lourdes
The advancement of omics technologies in concert with the enabling information technology development has accelerated biological research to a new realm in a blazing speed and sophistication. The limited single gene assay to the high throughput microarray assay and the laborious manual count of base-pairs to the robotic assisted machinery in genome sequencing are two examples to name. Yet even more sophisticated, the recent development in literature mining and artificial intelligence has allowed researchers to construct complex gene networks unraveling many formidable biological puzzles. To harness these emerging technologies to their full potential to medical applications, the Bio-intelligence program at the Institute for Information Technology, National Research Council Canada, aims to develop and exploit artificial intelligence and bioinformatics technologies to facilitate the development of intelligent decision support tools and systems to improve patient care - for early detection, accurate diagnosis/prognosis of disease, and better personalized therapeutic management.
Orchestrating Multiple Intelligences
Moran, Seana; Kornhaber, Mindy; Gardner, Howard
2006-01-01
Education policymakers often go astray when they attempt to integrate multiple intelligences theory into schools, according to the originator of the theory, Howard Gardner, and his colleagues. The greatest potential of a multiple intelligences approach to education grows from the concept of a profile of intelligences. Each learner's intelligence…
Semantic Business Intelligence - a New Generation of Business Intelligence
Directory of Open Access Journals (Sweden)
Dinu AIRINEI
2012-01-01
Full Text Available Business Intelligence Solutions represents applications used by companies to manage process and analyze data to provide substantiated decision. In the context of Semantic Web develop-ment trend is to integrate semantic unstructured data, making business intelligence solutions to be redesigned in such a manner that can analyze, process and synthesize, in addition to traditional data and data integrated with semantic another form and structure. This invariably leads appearance of new BI solution, called Semantic Business Intelligence.
13th International Symposium on Distributed Computing and Artificial Intelligence 2016
Semalat, Ali; Bocewicz, Grzegorz; Sitek, Paweł; Nielsen, Izabela; García, Julián; Bajo, Javier
2016-01-01
The 13th International Symposium on Distributed Computing and Artificial Intelligence 2016 (DCAI 2016) is a forum to present applications of innovative techniques for studying and solving complex problems. The exchange of ideas between scientists and technicians from both the academic and industrial sector is essential to facilitate the development of systems that can meet the ever-increasing demands of today’s society. The present edition brings together past experience, current work and promising future trends associated with distributed computing, artificial intelligence and their application in order to provide efficient solutions to real problems. This symposium is organized by the University of Sevilla (Spain), Osaka Institute of Technology (Japan), and the Universiti Teknologi Malaysia (Malaysia).
Emotional intelligence in orthopedic surgery residents.
Chan, Kevin; Petrisor, Brad; Bhandari, Mohit
2014-04-01
Emotional intelligence (EI) is the ability to understand and manage emotions in oneself and others. It was originally popularized in the business literature as a key attribute for success that was distinct from cognitive intelligence. Increasing focus is being placed on EI in medicine to improve clinical and academic performance. Despite the proposed benefits, to our knowledge, there have been no previous studies on the role of EI in orthopedic surgery. We evaluated baseline data on EI in a cohort of orthopedic surgery residents. We asked all orthopedic surgery residents at a single institution to complete an electronic version of the Mayer-Salovey-Caruso Emotional Intelligence Test (MSCEIT). We used completed questionnaires to calculate total EI scores and 4 branch scores. Data were analyzed according to a priori cutoff values to determine the proportion of residents who were considered competent on the test. Data were also analyzed for possible associations with age, sex, race and level of training. Thirty-nine residents (100%) completed the MSCEIT. The mean total EI score was 86 (maximum score 145). Only 4 (10%) respondents demonstrated competence in EI. Junior residents (p = 0.026), Caucasian residents (p = 0.009) and those younger than 30 years (p = 0.008) had significantly higher EI scores. Our findings suggest that orthopedic residents score low on EI based on the MSCEIT. Optimizing resident competency in noncognitive skills may be enhanced by dedicated EI education, training and testing.
Šimović, Vladimir
2001-01-01
The objective of this study is to present research on classical and intelligent information system solutions used in criminal intelligence analysis in Croatian security system theory. The study analyses objective and classical methods of information science, including artificial intelligence and other scientific methods. The intelligence and classical software solutions researched, proposed, and presented in this study were used in developing the integrated information system for the Croatian...
Selective dissemination of information of library in scientific research institution
International Nuclear Information System (INIS)
Liu Wenping
2010-01-01
Selective Dissemination of Information (SDI) Service, which is an important component of intelligence, is the intelligence researcher to select key subjects and major issues and key technology or innovation goals under the actual needs of scientific research personnel issues, using network communication technology and database technology and information retrieval technologies, sustained and in a timely manner to track all kinds of literature for the front-line services, until the completion of research topics or key problem-solving. Library of China Institute of Atomic Energy is struggling to meet the diverse needs of customers, targeted to provide a lot of useful information for scientific researchers to use less time as possible to obtain as much intelligence information, and to research workers and leading to the successful completion of research tasks, and various decisions. The implementation of SDI services to identify clients and scope, to format SDI service team, to determine the SDI service principles and service mode. SDI services Selective demand intelligence researchers have been asked to improve their quality, to improve their interpersonal communication skills. (author)
SOME PARADIGMS OF ARTIFICIAL INTELLIGENCE IN FINANCIAL COMPUTER SYSTEMS
Jerzy Balicki
2015-01-01
The article discusses some paradigms of artificial intelligence in the context of their applications in computer financial systems. The proposed approach has a significant po-tential to increase the competitiveness of enterprises, including financial institutions. However, it requires the effective use of supercomputers, grids and cloud computing. A reference is made to the computing environment for Bitcoin. In addition, we characterized genetic programming and artificial neural networks to p...
Artificial Consciousness or Artificial Intelligence
Spanache Florin
2017-01-01
Artificial intelligence is a tool designed by people for the gratification of their own creative ego, so we can not confuse conscience with intelligence and not even intelligence in its human representation with conscience. They are all different concepts and they have different uses. Philosophically, there are differences between autonomous people and automatic artificial intelligence. This is the difference between intelligence and artificial intelligence, autonomous versus a...
Intelligent mechatronics; Intelligent mechatronics
Energy Technology Data Exchange (ETDEWEB)
Hashimoto, H. [The University of Tokyo, Tokyo (Japan). Institute of Industrial Science
1995-10-01
Intelligent mechatronics (IM) was explained as follows: a study of IM essentially targets realization of a robot namely, but in the present stage the target is a creation of new values by intellectualization of machine, that is, a combination of the information infrastructure and the intelligent machine system. IM is also thought to be constituted of computers positively used and micromechatronics. The paper next introduces examples of IM study, mainly those the author is concerned with as shown below: sensor gloves, robot hands, robot eyes, tele operation, three-dimensional object recognition, mobile robot, magnetic bearing, construction of remote controlled unmanned dam, robot network, sensitivity communication using neuro baby, etc. 27 figs.
Brain Intelligence: Go Beyond Artificial Intelligence
Lu, Huimin; Li, Yujie; Chen, Min; Kim, Hyoungseop; Serikawa, Seiichi
2017-01-01
Artificial intelligence (AI) is an important technology that supports daily social life and economic activities. It contributes greatly to the sustainable growth of Japan's economy and solves various social problems. In recent years, AI has attracted attention as a key for growth in developed countries such as Europe and the United States and developing countries such as China and India. The attention has been focused mainly on developing new artificial intelligence information communication ...
Directory of Open Access Journals (Sweden)
Bogdan NEDELCU
2014-02-01
Full Text Available The aim of this article is to show the importance of business intelligence and its growing influence. It also shows when the concept of business intelligence was used for the first time and how it evolved over time. The paper discusses the utility of a business intelligence system in any organization and its contribution to daily activities. Furthermore, we highlight the role and the objectives of business intelligence systems inside an organization and the needs to grow the incomes and reduce the costs, to manage the complexity of the business environment and to cut IT costs so that the organization survives in the current competitive climate. The article contains information about architectural principles of a business intelligence system and how such a system can be achieved.
Professionalizing Intelligence Analysis
Directory of Open Access Journals (Sweden)
James B. Bruce
2015-09-01
Full Text Available This article examines the current state of professionalism in national security intelligence analysis in the U.S. Government. Since the introduction of major intelligence reforms directed by the Intelligence Reform and Terrorism Prevention Act (IRTPA in December, 2004, we have seen notable strides in many aspects of intelligence professionalization, including in analysis. But progress is halting, uneven, and by no means permanent. To consolidate its gains, and if it is to continue improving, the U.S. intelligence community (IC should commit itself to accomplishing a new program of further professionalization of analysis to ensure that it will develop an analytic cadre that is fully prepared to deal with the complexities of an emerging multipolar and highly dynamic world that the IC itself is forecasting. Some recent reforms in intelligence analysis can be assessed against established standards of more fully developed professions; these may well fall short of moving the IC closer to the more fully professionalized analytical capability required for producing the kind of analysis needed now by the United States.
Emotional intelligence as a determinant of leadership potential
Directory of Open Access Journals (Sweden)
Anita D. Stuart
2001-09-01
Full Text Available Emotional intelligence scores of employees of a financial institution who displayed leadership potential (n = 31 were compared with scores of a groupwho displayed little leadership potential. Leadershipwas rated by ascertaining the presence of transformational behaviour. All rated employees completed an emotional intelligence scale. Results indicated that the factors of optimism and self-actualisationwere significantly higher for the leader group. The non-leader group indicated higher scores on the positive impression scale, indicating possible positive skewing of results for that group. Generally, the research data indicates a link between the fundamental postulates of transformational leadership theory and emotional intelligence. Opsomming Emosionele intelligensie-tellings van’n groep werknemers binne ’n finansiele instelling wie leierskapspotensiaal getoon het (n = 31 is vergelyk met ’n groepwat min leierskapspotensiaal getoon het. Leierskapspotensiaal is bepaal op grond van die teenwoordigheid van transformasionele gedrag. Alle werknemerswat gemeet is het ’n emosionele intelligensieskaal voltooi. Resultate toon dat optimisme en selfaktualisasie beduidend hoer was vir die leiergroep. Die nie-leiergroep het hoer tellings getoon op die positiewe indruk-skaal, wat ’nmoontlike positiewe skeefheid van daardie groep se resultate aandui. Die navorsingsdata toon oor die algemeen’n koppeling tussen die fundamentele beginsels van transformasionele leierskapsteorie en emosionele intelligensie.
2012-06-04
... DEPARTMENT OF DEFENSE Office of the Secretary Defense Intelligence Agency National Intelligence University Board of Visitors Closed Meeting AGENCY: Department of Defense, Defense Intelligence Agency, National Intelligence University. ACTION: Notice of closed meeting. SUMMARY: Pursuant to the provisions of...
DEFF Research Database (Denmark)
Larsen, Lasse Juel
2009-01-01
This paper examines play, gaming and learning in regard to intelligent playware developed for outdoor use. The key questions are how does these novel artefacts influence the concept of play, gaming and learning. Up until now play and game have been understood as different activities. This paper...... examines if the sharp differentiation between the two can be uphold in regard to intelligent playware for outdoor use. Play and game activities will be analysed and viewed in conjunction with learning contexts. This paper will stipulate that intelligent playware facilitates rapid shifts in contexts...
Ennals, J R
1987-01-01
Artificial Intelligence: State of the Art Report is a two-part report consisting of the invited papers and the analysis. The editor first gives an introduction to the invited papers before presenting each paper and the analysis, and then concludes with the list of references related to the study. The invited papers explore the various aspects of artificial intelligence. The analysis part assesses the major advances in artificial intelligence and provides a balanced analysis of the state of the art in this field. The Bibliography compiles the most important published material on the subject of
Advanced intelligence and mechanism approach
Institute of Scientific and Technical Information of China (English)
ZHONG Yixin
2007-01-01
Advanced intelligence will feature the intelligence research in next 50 years.An understanding of the concept of advanced intelligence as well as its importance will be provided first,and detailed analysis on an approach,the mechanism approach.suitable to the advanced intelligence research will then be flolowed.And the mutual relationship among mechanism approach,traditional approaches existed in artificial intelligence research,and the cognitive informatics will be discussed.It is interesting to discover that mechanism approach is a good one to the Advanced Intelligence research and a tmified form of the existed approaches to artificial intelligence.
Computational Intelligence in Intelligent Data Analysis
Nürnberger, Andreas
2013-01-01
Complex systems and their phenomena are ubiquitous as they can be found in biology, finance, the humanities, management sciences, medicine, physics and similar fields. For many problems in these fields, there are no conventional ways to mathematically or analytically solve them completely at low cost. On the other hand, nature already solved many optimization problems efficiently. Computational intelligence attempts to mimic nature-inspired problem-solving strategies and methods. These strategies can be used to study, model and analyze complex systems such that it becomes feasible to handle them. Key areas of computational intelligence are artificial neural networks, evolutionary computation and fuzzy systems. As only a few researchers in that field, Rudolf Kruse has contributed in many important ways to the understanding, modeling and application of computational intelligence methods. On occasion of his 60th birthday, a collection of original papers of leading researchers in the field of computational intell...
Directory of Open Access Journals (Sweden)
Alexander Halman
2015-10-01
Full Text Available Crowdsourcing is a new tool for businesses, academics, and now intelligence analysts. Enabled by recent technology, crowdsourcing allows researchers to harness the wisdom of crowds and provide recommendations and insight into complex problems. This paper examines the potential benefits and limitations of crowdsourcing for intelligence analysis and the intelligence community beyond its primary use: anticipatory intelligence. The author constructs a model and compares it to existing crowdsourcing theories in business, information science, and public policy. Finally, he offers advice for intelligence analysis and public policy.
2015 Chinese Intelligent Systems Conference
Du, Junping; Li, Hongbo; Zhang, Weicun; CISC’15
2016-01-01
This book presents selected research papers from the 2015 Chinese Intelligent Systems Conference (CISC’15), held in Yangzhou, China. The topics covered include multi-agent systems, evolutionary computation, artificial intelligence, complex systems, computation intelligence and soft computing, intelligent control, advanced control technology, robotics and applications, intelligent information processing, iterative learning control, and machine learning. Engineers and researchers from academia, industry and the government can gain valuable insights into solutions combining ideas from multiple disciplines in the field of intelligent systems.
Secular gains in fluid intelligence: evidence from the Culture-Fair intelligence test.
Colom, Roberto; García-López, Oscar
2003-01-01
There is no doubt about the reality of the secular increase in cognitive test scores. However, there is disagreement about a key issue: does the observed increase reflect a genuine upward trend in intelligence? Evidence from the Raven test is clear, although there are some doubts about its adequacy as a fine-grained measure of fluid intelligence. Evidence from the so-called 'method of correlated vectors' is much less clear. When a crystallized battery is considered, the results leave little doubt: the increase does not reflect gains in general intelligence. However, when a fluid battery is analysed, the increase does reflect gains in general intelligence. The present study uses one of the best available measures of fluid intelligence (the Culture-Fair intelligence test) to provide new evidence for the secular increase in fluid intelligence, beyond the findings from the Raven test and the method of correlated vectors. A total of 4498 Spanish high school students and high school graduates were tested within a time interval of 20 and 23 years, respectively. The results show that there is a clear upward trend in intelligence. Moreover, students show an average increase equivalent to 6 IQ points, while graduates show an average increase of 4 IQ points. Therefore, more selected people (graduates) show a smaller increase than less selected people (students). Some implications are discussed.
Scholastic Success: Fluid Intelligence, Personality, and Emotional Intelligence
Downey, Luke A.; Lomas, Justine; Billings, Clare; Hansen, Karen; Stough, Con
2014-01-01
The aim of the current study was to examine the role of fluid intelligence, personality traits, and emotional intelligence (EI) in predicting female Year 9 students' grade point average (GPA) and to determine whether any differences in scholastic performance were related to differences in EI or Personality. Two-hundred and forty-three female…
Directory of Open Access Journals (Sweden)
José-Manuel de Haro
2014-05-01
Full Text Available Although the study of factors affecting career success has shown connections between biographical and other aspects related to ability, knowledge and personality, few studies have examined the relationship between emotional intelligence and professional success at the initial career stage. When these studies were carried out, the results showed significant relationships between the dimensions of emotional intelligence (emotional self-awareness, self-regulation, social awareness or social skills and the level of professional competence. In this paper, we analyze the relationship between perceived emotional intelligence, measured by the Trait Meta-Mood Scale (TMMS-24 questionnaire, general intelligence assessed by the Cattell factor "g" test, scale 3, and extrinsic indicators of career success, in a sample of 130 graduates at the beginning of their careers. Results from hierarchical regression analysis indicate that emotional intelligence makes a specific contribution to the prediction of salary, after controlling the general intelligence effect. The perceived emotional intelligence dimensions of TMMS repair, TMMS attention and sex show a higher correlation and make a greater contribution to professional success than general intelligence. The implications of these results for the development of socio-emotional skills among University graduates are discussed.
Fiebag, Johannes
1989-12-01
Present SETI projects are described, emphasizing search methods alternative to investigations in the radio range. The possibility that the human race is being studied by alien presences within the solar system is addressed in the context of the 'zoo hypothesis' and the 'leaky embargo' hypothesis. In the former, the aliens prevent any contact with humans, while in the latter occasional contact is permitted.
Chou, Chih-Yueh; Huang, Bau-Hung; Lin, Chi-Jen
2011-01-01
This study proposes a virtual teaching assistant (VTA) to share teacher tutoring tasks in helping students practice program tracing and proposes two mechanisms of complementing machine intelligence and human intelligence to develop the VTA. The first mechanism applies machine intelligence to extend human intelligence (teacher answers) to evaluate…
A Belief-Space Approach to Integrated Intelligence - Research Area 10.3: Intelligent Networks
2017-12-05
A Belief-Space Approach to Integrated Intelligence- Research Area 10.3: Intelligent Networks The views, opinions and/or findings contained in this...Technology (MIT) Title: A Belief-Space Approach to Integrated Intelligence- Research Area 10.3: Intelligent Networks Report Term: 0-Other Email: tlp...students presented progress and received feedback from the research group . o wrote papers on their research and submitted them to leading conferences
Warwick, Kevin
2011-01-01
if AI is outside your field, or you know something of the subject and would like to know more then Artificial Intelligence: The Basics is a brilliant primer.' - Nick Smith, Engineering and Technology Magazine November 2011 Artificial Intelligence: The Basics is a concise and cutting-edge introduction to the fast moving world of AI. The author Kevin Warwick, a pioneer in the field, examines issues of what it means to be man or machine and looks at advances in robotics which have blurred the boundaries. Topics covered include: how intelligence can be defined whether machines can 'think' sensory
Energy Technology Data Exchange (ETDEWEB)
Novak, D
1982-01-01
A general discussion about the level of artificial intelligence in computer programs is presented. The suitability of various languages for the development of complex, intelligent programs is discussed, considering fourth-generation language as well as the well established structured COBOL language. It is concluded that the success of automation in many administrative fields depends to a large extent on the development of intelligent programs.
Creativity Styles and Emotional Intelligence of Filipino Student Teachers: A Search for Congruity
Directory of Open Access Journals (Sweden)
Gilbert C. Magulod Jr.
2017-02-01
Full Text Available The purpose of this study is to determine the congruity between the creativity styles and emotional intelligence of Filipino student teachers. Descriptive correlational research design was employed. The participants of the study were the 76 fourth year students of Bachelor in Elementary Education (BEED and Bachelor in Secondary Education (BSED in one state university in the Philippines. Data of the study were obtained using two standardized instruments relating to creativity styles and emotional intelligence. Findings of the study revealed that the student teachers espoused themselves to have high creative capacity while they assessed themselves to have high creativity styles along belief in unconscious processes, use of techniques, use of other people and final product orientation. With regards to their emotional intelligence, they assessed themselves to have high attributes on self-awareness, management of emotions, self-motivation, empathy and social skills. Significantly, this study also revealed that gender, birth order, course and scholastic standing in high school spelled differences on the creativity styles of Filipino student teachers. Moreover, test of difference also showed that scholastic standing in high school and family income defined differences along emotional intelligence. Finally, it was also revealed in the study that there is a significant relationship between creativity styles and emotional intelligence of Filipino student teachers. Implications of the congruity between emotional intelligence and creativity styles would help Teacher Education Institutions (TEIs to implement curriculum enhancement which is vital to the preparation of twenty-first century teachers.
Walters, Steven O; Weaver, Kenneth A
2003-06-01
The Kaufman Brief Intelligence Test detects learning problems of young students and is a screen for whether a more comprehensive test of intelligence is needed. A study to assess whether this test was valid as an adult intelligence test was conducted with 20 undergraduate psychology majors. The correlations between the Kaufman Brief Intelligence Test's Composite, Vocabulary, and Matrices test scores and their corresponding Wechsler Adult Intelligence Scale-Third Edition test scores, the Full Scale (r=.88), Verbal (r=.77), and Performance scores (r=.87), indicated very strong relationships. In addition, no significant differences were obtained between the Composite, Vocabulary, and Matrices means of the Kaufman Brief Intelligence Test and the Full Scale, Verbal, and Performance means of the WAIS-III. The Kaufman Brief Intelligence Test appears to be a valid test of intelligence for adults.
Fluid intelligence: A brief history.
Kent, Phillip
2017-01-01
The concept of fluid and crystallized intelligence was introduced to the psychological community approximately 75 years ago by Raymond B. Cattell, and it continues to be an area of active research and controversy. The purpose of this paper is to provide a brief overview of the origin of the concept, early efforts to define intelligence and uses of intelligence tests to address pressing social issues, and the ongoing controversies associated with fluid intelligence and the structure of intelligence. The putative neuropsychological underpinnings and neurological substrates of fluid intelligence are discussed.
12th International Conference on Intelligent Information Hiding and Multimedia Signal Processing
Tsai, Pei-Wei; Huang, Hsiang-Cheh
2017-01-01
This volume of Smart Innovation, Systems and Technologies contains accepted papers presented in IIH-MSP-2016, the 12th International Conference on Intelligent Information Hiding and Multimedia Signal Processing. The conference this year was technically co-sponsored by Tainan Chapter of IEEE Signal Processing Society, Fujian University of Technology, Chaoyang University of Technology, Taiwan Association for Web Intelligence Consortium, Fujian Provincial Key Laboratory of Big Data Mining and Applications (Fujian University of Technology), and Harbin Institute of Technology Shenzhen Graduate School. IIH-MSP 2016 is held in 21-23, November, 2016 in Kaohsiung, Taiwan. The conference is an international forum for the researchers and professionals in all areas of information hiding and multimedia signal processing. .
Educational Programs for Intelligence Professionals.
Miller, Jerry P.
1994-01-01
Discusses the need for education programs for competitive intelligence professionals. Highlights include definitions of intelligence functions, focusing on business intelligence; information utilization by decision makers; information sources; competencies for intelligence professionals; and the development of formal education programs. (38…
Harmonizing intelligence terminologies in business: Literature review
Directory of Open Access Journals (Sweden)
Sivave Mashingaidze
2014-11-01
Full Text Available The principal objective of this article is to do a literature review of different intelligence terminology with the aim of establishing the common attributes and differences, and to propose a universal and comprehensive definition of intelligence for common understanding amongst users. The findings showed that Competitive Intelligence has the broadest scope of intelligence activities covering the whole external operating environment of the company and targeting all levels of decision-making for instance; strategic intelligence, tactical intelligence and operative intelligence. Another terminology was found called Cyber IntelligenceTM which encompasses competitor intelligence, strategic intelligence, market intelligence and counterintelligence. In conclusion although CI has the broadest scope of intelligence and umbrella to many intelligence concepts, still Business Intelligence, and Corporate Intelligence are often used interchangeably as CI
Malware and Disease: Lessons from Cyber Intelligence for Public Health Surveillance.
Smith, Frank L
2016-01-01
Malicious software and infectious diseases are similar is several respects, as are the functional requirements for surveillance and intelligence to defend against these threats. Given these similarities, this article compares and contrasts the actors, relationships, and norms at work in cyber intelligence and disease surveillance. Historical analysis reveals that civilian cyber defense is more decentralized, private, and voluntary than public health in the United States. Most of these differences are due to political choices rather than technical necessities. In particular, political resistance to government institutions has shaped cyber intelligence over the past 30 years, which is a troubling sign for attempts to improve disease surveillance through local, state, and federal health departments. Information sharing about malware is also limited, despite information technology being integral to cyberspace. Such limits suggest that automation through electronic health records will not automatically improve public health surveillance. Still, certain aspects of information sharing and analysis for cyber defense are worth emulating or, at the very least, learning from to help detect and manage health threats.
Development of a New Intelligent Joystick for People with Reduced Mobility
Directory of Open Access Journals (Sweden)
Makrem Mrabet
2018-01-01
Full Text Available Despite the diversity of electric wheelchairs, many people with physical limitations and seniors have difficulty using their standard joystick. As a result, they cannot meet their needs or ensure safe travel. Recent assistive technologies can help to give them autonomy and independence. This work deals with the real-time implementation of an artificial intelligence device to overcome these problems. Following a review of the literature from previous work, we present the methodology and process for implementing our intelligent control system on an electric wheelchair. The system is based on a neural algorithm that overcomes problems with standard joystick maneuvers such as the inability to move correctly in one direction. However, this implies the need for an appropriate methodology to map the position of the joystick handle. Experiments on a real wheelchair are carried out with real patients of the Mohamed Kassab National Institute Orthopedic, Physical and Functional Rehabilitation Hospital of Tunis. The proposed intelligent system gives good results compared to the use of a standard joystick.
Business Intelligence using Software Agents
Ana-Ramona BOLOGA; Razvan BOLOGA
2011-01-01
This paper presents some ideas about business intelligence today and the importance of developing real time business solutions. The authors make an exploration of links between business intelligence and artificial intelligence and focuses specifically on the implementation of software agents-based systems in business intelligence. There are briefly presented some of the few solutions proposed so far that use software agents properties for the benefit of business intelligence. The authors then...
2013-05-29
... DEPARTMENT OF DEFENSE Office of the Secretary Defense Intelligence Agency National Intelligence University Board of Visitors; Notice of Closed Meeting AGENCY: National Intelligence University, Defense Intelligence Agency, Department of Defense. ACTION: Notice of closed meeting. SUMMARY: Pursuant to the...
2010-12-08
... DEPARTMENT OF DEFENSE Office of the Secretary Defense Intelligence Agency National Defense Intelligence College Board of Visitors Closed Meeting AGENCY: National Defense Intelligence College, Defense Intelligence Agency, Department of Defense. ACTION: Notice of Closed Meeting. SUMMARY: Pursuant to the...
2011-05-19
... DEPARTMENT OF DEFENSE Office of the Secretary Defense Intelligence Agency National Defense Intelligence College Board of Visitors Closed Meeting AGENCY: National Defense Intelligence College, Defense Intelligence Agency, Department of Defense. ACTION: Notice of Closed Meeting. SUMMARY: Pursuant to the...
Open source intelligence, open social intelligence and privacy by design
Casanovas, Pompeu; Royal Melbourne Institute of Technology (Austràlia). Centre for Applied Social Research
2014-01-01
Ponència presentada a European Conference on Social Intelligence (ECSI-2014) OSINT stands for Open Source Intelligence, (O)SI for (Open) Social Intelligence, PbD for Privacy by Design. The CAPER project has built an OSINT solution oriented to the prevention of organized crime. How to balance freedom and security? This position paper describes a way to embed the legal and ethical issues raised by the General Data Reform Package (GDRP) in Europe into this kind of surveillance platforms. It f...
Stephen Fox
2017-01-01
Framing strongly influences actions among technology proponents and end-users. Underlying much debate about artificial intelligence (AI) are several fundamental shortcomings in its framing. First, discussion of AI is atheoretical, and therefore has limited potential for addressing the complexity of causation. Second, intelligence is considered from an anthropocentric perspective that sees human intelligence, and intelligence developed by humans, as superior to all other intelligences. Thus, t...
Wash, Darrel Patrick
1989-01-01
Making a machine seem intelligent is not easy. As a consequence, demand has been rising for computer professionals skilled in artificial intelligence and is likely to continue to go up. These workers develop expert systems and solve the mysteries of machine vision, natural language processing, and neural networks. (Editor)
Intelligent energy systems. A White Paper with Danish perspectives
Energy Technology Data Exchange (ETDEWEB)
2010-07-01
This White Paper is intended as a basis for developing a partnership and a strategy on intelligent energy systems including all stakeholders: businesses, energy companies, research institutions, energy consumers and public authorities. The partnership initiative for intelligent energy systems is initiated by The Danish Energy Industries Federation together with DI ITEK (the Danish ICT and electronics federation for it, telecommunications, electronics and communication enterprises), EC Power A/S, Dong Energy A/S, Danfoss Solutions A/S, Dantherm A/S, Vestas A/S, Siemens A/S, SydEnergi Partner A/S, Technical University of Denmark (DTU), Aalborg University (AAU), the network VE-net and Ea Energy Analyses A/S. The White Paper has been prepared by Ea Energy Analyses with valuable assistance from the project participants. The proposed partnership initiative is presented in the first section: 'Strategy and partnership for intelligent energy'. The remaining chapters 1-9 of the report constitute the White Paper. Chapters 1 and 2 introduce the energy system, chapter 3 discusses the markets for energy and reserves, and chapter 4 covers some of the new active elements in the system - consumers and storage. Key technologies and solutions of the intelligent energy system are outlined in chapter 5, and chapter 6 describes the strategies for smart grids pursued by the EU, the International Energy Agency and the USA. Selected Danish research, development and demonstration projects related to demand management and other smart grid solutions are briefly described in chapter 7, and chapter 8 outlines current Danish policy and initiatives working towards the intelligent energy system. A list of references is given in chapter 6, and appendix 1 contains a preliminary list of potential members of the partnership. (LN)
Intelligent energy systems. A White Paper with Danish perspectives
Energy Technology Data Exchange (ETDEWEB)
2010-07-01
This White Paper is intended as a basis for developing a partnership and a strategy on intelligent energy systems including all stakeholders: businesses, energy companies, research institutions, energy consumers and public authorities. The partnership initiative for intelligent energy systems is initiated by The Danish Energy Industries Federation together with DI ITEK (the Danish ICT and electronics federation for it, telecommunications, electronics and communication enterprises), EC Power A/S, Dong Energy A/S, Danfoss Solutions A/S, Dantherm A/S, Vestas A/S, Siemens A/S, SydEnergi Partner A/S, Technical University of Denmark (DTU), Aalborg University (AAU), the network VE-net and Ea Energy Analyses A/S. The White Paper has been prepared by Ea Energy Analyses with valuable assistance from the project participants. The proposed partnership initiative is presented in the first section: 'Strategy and partnership for intelligent energy'. The remaining chapters 1-9 of the report constitute the White Paper. Chapters 1 and 2 introduce the energy system, chapter 3 discusses the markets for energy and reserves, and chapter 4 covers some of the new active elements in the system - consumers and storage. Key technologies and solutions of the intelligent energy system are outlined in chapter 5, and chapter 6 describes the strategies for smart grids pursued by the EU, the International Energy Agency and the USA. Selected Danish research, development and demonstration projects related to demand management and other smart grid solutions are briefly described in chapter 7, and chapter 8 outlines current Danish policy and initiatives working towards the intelligent energy system. A list of references is given in chapter 6, and appendix 1 contains a preliminary list of potential members of the partnership. (LN)
Merchan-Naranjo, Jessica; Mayoral, Maria; Rapado-Castro, Marta; Llorente, Cloe; Boada, Leticia; Arango, Celso; Parellada, Mara
2012-01-01
Asperger syndrome (AS) patients show heterogeneous intelligence profiles and the validity of short forms for estimating intelligence has rarely been studied in this population. We analyzed the validity of Wechsler Intelligence Scale (WIS) short forms for estimating full-scale intelligence quotient (FSIQ) and assessing intelligence profiles in 29…
Business Intelligence using Software Agents
Directory of Open Access Journals (Sweden)
Ana-Ramona BOLOGA
2011-12-01
Full Text Available This paper presents some ideas about business intelligence today and the importance of developing real time business solutions. The authors make an exploration of links between business intelligence and artificial intelligence and focuses specifically on the implementation of software agents-based systems in business intelligence. There are briefly presented some of the few solutions proposed so far that use software agents properties for the benefit of business intelligence. The authors then propose some basic ideas for developing real-time agent-based software system for business intelligence in supply chain management, using Case Base Reasoning Agents.
Generative Artificial Intelligence : Philosophy and Theory of Artificial Intelligence
van der Zant, Tijn; Kouw, Matthijs; Schomaker, Lambertus; Mueller, Vincent C.
2013-01-01
The closed systems of contemporary Artificial Intelligence do not seem to lead to intelligent machines in the near future. What is needed are open-ended systems with non-linear properties in order to create interesting properties for the scaffolding of an artificial mind. Using post-structuralistic
Progress and Challenge of Artificial Intelligence
Institute of Scientific and Technical Information of China (English)
Zhong-Zhi Shi; Nan-Ning Zheng
2006-01-01
Artificial Intelligence (AI) is generally considered to be a subfield of computer science, that is concerned to attempt simulation, extension and expansion of human intelligence. Artificial intelligence has enjoyed tremendous success over the last fifty years. In this paper we only focus on visual perception, granular computing, agent computing, semantic grid. Human-level intelligence is the long-term goal of artificial intelligence. We should do joint research on basic theory and technology of intelligence by brain science, cognitive science, artificial intelligence and others. A new cross discipline intelligence science is undergoing a rapid development. Future challenges are given in final section.
SOME PARADIGMS OF ARTIFICIAL INTELLIGENCE IN FINANCIAL COMPUTER SYSTEMS
Directory of Open Access Journals (Sweden)
Jerzy Balicki
2015-12-01
Full Text Available The article discusses some paradigms of artificial intelligence in the context of their applications in computer financial systems. The proposed approach has a significant po-tential to increase the competitiveness of enterprises, including financial institutions. However, it requires the effective use of supercomputers, grids and cloud computing. A reference is made to the computing environment for Bitcoin. In addition, we characterized genetic programming and artificial neural networks to prepare investment strategies on the stock exchange market.
CAMPARE and Cal-Bridge: Two Institutional Networks Increasing Diversity in Astronomy
Rudolph, Alexander L.; Impey, Chris David; Phillips, Cynthia B.; Povich, Matthew S.; Prather, Edward E.; Smecker-Hane, Tammy A.
2015-01-01
We describe two programs, CAMPARE and Cal-Bridge, with the common mission of increasing participation of groups traditionally underrepresented in astronomy, particularly underrepresented minorities and women, through summer research opportunities, in the case of CAMPARE, scholarships in the case of Cal-Bridge, and significant mentoring in both programs, leading to an increase in their numbers successfully pursuing a PhD in the field.CAMPARE is an innovative REU-like summer research program, currently in its sixth year, comprising a network of comprehensive universities and community colleges in Southern California and Arizona (most of which are minority serving institutions), and ten major research institutions (University of Arizona Steward Observatory, the SETI Institute, JPL, Caltech, and the five Southern California UC campuses, UCLA, UCI, UCSD, UCR, and UCSB).In its first five summers, CAMPARE sent a total of 49 students from 10 different CSU and community college campuses to 5 research sites of the program. Of these 49 participants, 25 are women and 24 are men; 22 are Hispanic, 4 are African American, and 1 is Native American, including 6 female Hispanic and 2 female African-American participants. Twenty-one (21) CAMPARE participants have graduated from college, and more than half (11) have attended or are attending a graduate program, including 8 enrolled in PhD or Master's-to-PhD programs. Over twenty CAMPARE students have presented at the AAS and other national meetings.The Cal-Bridge program is a diverse network of higher education institutions in Southern California, including 5 UC campuses, 8 CSU campuses, and 7 community colleges dedicated to the goal of increasing the number of underrepresented minority and female students attending graduate school in astronomy or related fields. We have recently selected our inaugural group of five 2014 Cal-Bridge Scholars, including four women (two Hispanic and one part Native American), and one Hispanic man
Intelligence and treaty ratification
International Nuclear Information System (INIS)
Sojka, G.L.
1990-01-01
What did the intelligence community and the Intelligence Committee di poorly in regard to the treaty ratification process for arms control? We failed to solve the compartmentalization problem/ This is a second-order problem, and, in general, analysts try to be very open; but there are problems nevertheless. There are very few, if any, people within the intelligence community who are cleared for everything relevant to our monitoring capability emdash short of probably the Director of Central Intelligence and the president emdash and this is a major problem. The formal monitoring estimates are drawn up by individuals who do not have access to all the information to make the monitoring judgements. This paper reports that the intelligence community did not present a formal document on either Soviet incentives of disincentives to cheat or on the possibility of cheating scenarios, and that was a mistake. However, the intelligence community was very responsive in producing those types of estimates, and, ultimately, the evidence behind them in response to questions. Nevertheless, the author thinks the intelligence community would do well to address this issue up front before a treaty is submitted to the Senate for advice and consent
Rural architecture between artificial intelligence and natural intelligence
Energy Technology Data Exchange (ETDEWEB)
Cennamo, M.; Palma, P. di; Ricciardelli, A. [University of Naples Frederico II (Italy). Dept. of Configurazione e Attuazione dell Architettra
2000-02-01
Following the field of research carried out and reported in the Second International Conference for Teachers of Architecture held in Florence on October 16, 17 and 18, 1997, which stated the central position of Architectural project in relation to Human Intelligence, Natural Intelligence and Artificial Intelligence, the present paper suggests a phase of application of the theoretical assumptions to spacial models paradigmatic of the complexity of projects and building technique, as well as of the relationship between man-made environment and natural one. Among the different typologies in architecture, this research focuses on the rural buildings in Campania, mainly on the ones in the Vesuvius area, as those are the most suitable to be studied and salvaged with the help of biology, mathematics and high engineering. (author)
Algorithms in ambient intelligence
Aarts, E.H.L.; Korst, J.H.M.; Verhaegh, W.F.J.; Weber, W.; Rabaey, J.M.; Aarts, E.
2005-01-01
We briefly review the concept of ambient intelligence and discuss its relation with the domain of intelligent algorithms. By means of four examples of ambient intelligent systems, we argue that new computing methods and quantification measures are needed to bridge the gap between the class of
Directory of Open Access Journals (Sweden)
ARDIMEN
2016-07-01
Full Text Available Educational institution is an institution of the brain industry. Therefore, education is a vehicle for mental exercise. With education will be able to sharpen the brain to form human beings quality. Qualified people are intelligent human beings comprehensive and competitive savvy are reflected in personal moral, creative, and productive and full responsibility in living our daily lives. But the spotlight and complaints against educational institutions still occur, various perceived problems among students learn the lower interest. Students tend to subjects who tested nationally (National Examination, the methods used by teachers in teaching the more commonly used methods of lecture and question and answer, sometimes the discussion so that the lessons seem monotonous and less innovative, subjects received more students cederung nature doctrine in the form of memorization alone and rarely developed in the context of everyday life so that lessons just more leads to mastery of concepts and tend to train cognitive abilities-intellectual, not a lot of touching the realm of other intelligence in accordance with the potential of the students. The other problem is the tendency of the still rampant behavior is not commendable at this time in various forms, for example, students commit suicide because they do not pass the exam, involved in drugs, fighting between students, the behavior of cheating, careless, style punky, smoking, going out, and so become a reason for choosing this topic as study materials. The problem is what strengthens the belief writers to examine and assess the importance of the development of multiple intelligence through integrative learning-based game in an attempt to develop students' potential intelligence to realize a comprehensive and intelligent smart students competitive. This paper formulated into some discussion that begins with an introduction that lists reasons for the importance of this issue is discussed, and then
Moral Intelligence in the Schools
Clarken, Rodney H.
2009-01-01
Moral intelligence is newer and less studied than the more established cognitive, emotional and social intelligences, but has great potential to improve our understanding of learning and behavior. Moral intelligence refers to the ability to apply ethical principles to personal goals, values and actions. The construct of moral intelligence consists…
Galton's legacy to research on intelligence.
Jensen, Arthur R
2002-04-01
In the 1999 Galton Lecture for the annual conference of The Galton Institute, the author summarizes the main elements of Galton's ideas about human mental ability and the research paradigm they generated, including the concept of 'general' mental ability, its hereditary component, its physical basis, racial differences, and methods for measuring individual differences in general ability. Although the conclusions Galton drew from his empirical studies were seldom compelling for lack of the needed technology and methods of statistical inference in his day, contemporary research has generally borne out most of Galton's original and largely intuitive ideas, which still inspire mainstream scientific research on intelligence.
Modelling intelligent behavior
Green, H. S.; Triffet, T.
1993-01-01
An introductory discussion of the related concepts of intelligence and consciousness suggests criteria to be met in the modeling of intelligence and the development of intelligent materials. Methods for the modeling of actual structure and activity of the animal cortex have been found, based on present knowledge of the ionic and cellular constitution of the nervous system. These have led to the development of a realistic neural network model, which has been used to study the formation of memory and the process of learning. An account is given of experiments with simple materials which exhibit almost all properties of biological synapses and suggest the possibility of a new type of computer architecture to implement an advanced type of artificial intelligence.
Multiple intelligences: Can they be measured?
Kirsi Tirri; Petri Nokelainen; Erkki Komulainen
2013-01-01
This paper is about issues relating to the assessment of multiple intelligences. The first section introduces the authors’ work on building measures of multiple intelligences and moral sensitivities. It also provides a conceptual definition of multiple intelligences based on Multiple Intelligences theory by Howard Gardner (1983). The second section discusses the context specificity of intelligences and alternative approaches to measuring multiple intelligences. The third section analyses the ...
Reflection on robotic intelligence
Bartneck, C.
2006-01-01
This paper reflects on the development or robots, both their physical shape as well as their intelligence. The later strongly depends on the progress made in the artificial intelligence (AI) community which does not yet provide the models and tools necessary to create intelligent robots. It is time
Multiple Intelligences and quotient spaces
Malatesta, Mike; Quintana, Yamilet
2006-01-01
The Multiple Intelligence Theory (MI) is one of the models that study and describe the cognitive abilities of an individual. In [7] is presented a referential system which allows to identify the Multiple Intelligences of the students of a course and to classify the level of development of such Intelligences. Following this tendency, the purpose of this paper is to describe the model of Multiple Intelligences as a quotient space, and also to study the Multiple Intelligences of an individual in...
Watanabe, Toyohide; Phillips-Wren, Gloria; Howlett, Robert; Jain, Lakhmi
2012-01-01
The Intelligent Decision Technologies (IDT) International Conference encourages an interchange of research on intelligent systems and intelligent technologies that enhance or improve decision making. The focus of IDT is interdisciplinary and includes research on all aspects of intelligent decision technologies, from fundamental development to real applications. IDT has the potential to expand their support of decision making in such areas as finance, accounting, marketing, healthcare, medical and diagnostic systems, military decisions, production and operation, networks, traffic management, crisis response, human-machine interfaces, financial and stock market monitoring and prediction, and robotics. Intelligent decision systems implement advances in intelligent agents, fuzzy logic, multi-agent systems, artificial neural networks, and genetic algorithms, among others. Emerging areas of active research include virtual decision environments, social networking, 3D human-machine interfaces, cognitive interfaces,...
A study on intelligent nuclear systems, (HASP: human acts simulation program)
International Nuclear Information System (INIS)
Asai, Kiyoshi; Uenaka, Junji; Kambayashi, Shaw; Higuchi, Kenji; Kume, Etsuo; Fujisaki, Masahide; Fujii, Minoru; Yokokawa, Mitsuo
1989-03-01
In 1987 Japan Atomic Energy Research Institute has started a ten-years program named HASP, i.e., Human Acts Simulation Program, for artificial intelligence and robotics research. In the HASP, a human-shaped robot reads and understands orders written in natural language, planning and producing a required sequence of actions, accesses to a device or an instrument recognizing its entity and dose the ordered work for plant maintenance. All of these processes including calculation of the radiation exposure of the robot are simulated by logical and numerical computations. The simulated actions of the robot in three-dimensional environments are displayed using a high speed computer for graphics. The aim of the HASP project is threefold, i.e., (1) to develop fundamental technologies for design of intelligent robots, (2) to develop technologies for automated and/or intelligent plants, (3) to provide researchers and engineers in nuclear field with basic and systematized artificial intelligence techniques. The research items are natural language understanding, goal planning by LISP calculus, pattern recognitions by neural network methods, plant modelling by solid modeller, biped robot simulations, graphic display of the robot motion, and a study of design concept of a Monte Carlo vector processor for high speed calculation of the radiation exposure. In this report research results attained in the second year of the HASP project are described. (author)
The impact of emotional intelligence on faculty members' knowledge sharing behaviors
Directory of Open Access Journals (Sweden)
Masoomeh Arabshahi,
2013-12-01
Full Text Available Universities and institutions of higher education with a professional, special, educational and cultural environment, play an important role in effective knowledge management and preparing the background for knowledge sharing. Faculty members are known as the main elements of the university who own mental and intellectual property. Their knowledge sharing under certain conditions along with knowledge sharing behaviors improve individual and organizational operations. Moreover, the tendency to do these actions is the most important factor in knowledge sharing behavior and emotional intelligence (EQ, as one of the social intelligence factors, can guide individual thinking and activity. This study examines the impact of emotional intelligence on faculty members' knowledge sharing behaviors. Regarding the purpose and nature, this study was functional and its methodology was exploratory and due to evaluation of the relations and impacts among variables, it was a correlational method. Data collection included interviews with experts for the qualitative part and a questionnaire for the quantitative part. The qualitative findings indicate different emotional intelligence dimensions, which includes self-awareness, social skills, coping with pressure, adaptability and overall creation. In addition, the result of EQ dimensions on knowledge sharing behavior reveal that “social skills, coping with pressure, and overall creation” share a link with faculty members' research behavior among the four dimensions of knowledge sharing behavior and that “adaptability” has no significant relationship with knowledge sharing behavior.
The Epistemic Status of Intelligence
DEFF Research Database (Denmark)
Rønn, Kira Vrist; Høffding, Simon
2012-01-01
We argue that the majority of intelligence definitions fail to recognize that the normative epistemic status of intelligence is knowledge and not an inferior alternative. We refute the counter-arguments that intelligence ought not to be seen as knowledge because of 1) its action-oriented scope...... and robustness of claims to intelligence-knowledge can be assessed....
Multiple Intelligences: Current Trends in Assessment
Harman, Marsha J.; Kordinak, S. Thomas; Bruce, A. Jerry
2009-01-01
With his theory of multiple intelligences, Howard Gardner challenged the presumption that intelligence is a single innate entity. He maintained that multiple intelligences exist and are related to specific brain areas and symbol systems. Each of the intelligences has its merits and limits, but by using a multiple intelligences approach, more…
Designing with computational intelligence
Lopes, Heitor; Mourelle, Luiza
2017-01-01
This book discusses a number of real-world applications of computational intelligence approaches. Using various examples, it demonstrates that computational intelligence has become a consolidated methodology for automatically creating new competitive solutions to complex real-world problems. It also presents a concise and efficient synthesis of different systems using computationally intelligent techniques.
7th IEEE International Conference Intelligent Systems
Atanassov, KT; Doukovska, L; Hadjiski, M; Jotsov, V; Kacprzyk, J; Kasabov, N; Sotirov, S; Szmidt, E; Zadrożny, S; Filev, D; Jabłkowski, J; Kacprzyk, J; Krawczak, M; Popchev, I; Rutkowski, L; Sgurev, V; Sotirova, E; Szynkarczyk, P
2015-01-01
This two volume set of books constitutes the proceedings of the 2014 7th IEEE International Conference Intelligent Systems (IS), or IEEE IS’2014 for short, held on September 24‐26, 2014 in Warsaw, Poland. Moreover, it contains some selected papers from the collocated IWIFSGN'2014-Thirteenth International Workshop on Intuitionistic Fuzzy Sets and Generalized Nets.The conference was organized by the Systems Research Institute, Polish Academy of Sciences, Department IV of Engineering Sciences, Polish Academy of Sciences, and Industrial Institute of Automation and Measurements - PIAP.The papers included in the two proceedings volumes have been subject to a thorough review process by three highly qualified peer reviewers.Comments and suggestions from them have considerable helped improve the quality of the papers but also the division of the volumes into parts, and assignment of the papers to the best suited parts.
Alzheimer's disease and intelligence.
Yeo, R A; Arden, R; Jung, R E
2011-06-01
A significant body of evidence has accumulated suggesting that individual variation in intellectual ability, whether assessed directly by intelligence tests or indirectly through proxy measures, is related to risk of developing Alzheimer's disease (AD) in later life. Important questions remain unanswered, however, such as the specificity of risk for AD vs. other forms of dementia, and the specific links between premorbid intelligence and development of the neuropathology characteristic of AD. Lower premorbid intelligence has also emerged as a risk factor for greater mortality across myriad health and mental health diagnoses. Genetic covariance contributes importantly to these associations, and pleiotropic genetic effects may impact diverse organ systems through similar processes, including inefficient design and oxidative stress. Through such processes, the genetic underpinnings of intelligence, specifically, mutation load, may also increase the risk of developing AD. We discuss how specific neurobiologic features of relatively lower premorbid intelligence, including reduced metabolic efficiency, may facilitate the development of AD neuropathology. The cognitive reserve hypothesis, the most widely accepted account of the intelligence-AD association, is reviewed in the context of this larger literature.
Greer, Kieran
2014-01-01
Our understanding of intelligence is directed primarily at the level of human beings. This paper attempts to give a more unifying definition that can be applied to the natural world in general. The definition would be used more to verify a degree of intelligence, not to quantify it and might help when making judgements on the matter. A version of an accepted test for AI is then put forward as the 'acid test' for Artificial Intelligence itself. It might be what a free-thinking program or robot...
Directory of Open Access Journals (Sweden)
Stephen Fox
2017-06-01
Full Text Available Framing strongly influences actions among technology proponents and end-users. Underlying much debate about artificial intelligence (AI are several fundamental shortcomings in its framing. First, discussion of AI is atheoretical, and therefore has limited potential for addressing the complexity of causation. Second, intelligence is considered from an anthropocentric perspective that sees human intelligence, and intelligence developed by humans, as superior to all other intelligences. Thus, the extensive post-anthropocentric research into intelligence is not given sufficient consideration. Third, AI is discussed often in reductionist mechanistic terms. Rather than in organicist emergentist terms as a contributor to multi-intelligence (MI hybrid beings and/or systems. Thus, current framing of AI can be a self-validating reduction within which AI development is focused upon AI becoming the single-variable mechanism causing future effects. In this paper, AI is reframed as a contributor to MI.
Artificial Consciousness or Artificial Intelligence
Directory of Open Access Journals (Sweden)
Spanache Florin
2017-05-01
Full Text Available Artificial intelligence is a tool designed by people for the gratification of their own creative ego, so we can not confuse conscience with intelligence and not even intelligence in its human representation with conscience. They are all different concepts and they have different uses. Philosophically, there are differences between autonomous people and automatic artificial intelligence. This is the difference between intelligence and artificial intelligence, autonomous versus automatic. But conscience is above these differences because it is neither conditioned by the self-preservation of autonomy, because a conscience is something that you use to help your neighbor, nor automatic, because one’s conscience is tested by situations which are not similar or subject to routine. So, artificial intelligence is only in science-fiction literature similar to an autonomous conscience-endowed being. In real life, religion with its notions of redemption, sin, expiation, confession and communion will not have any meaning for a machine which cannot make a mistake on its own.
Directory of Open Access Journals (Sweden)
Aysun Kanbur
2015-03-01
Full Text Available In today, life fiction of humanbeing has intensively focused on work and home dilemma. Greedy expectations of these two institution (which are always tried to be protected are always in the mind of the individual. If harmony between competing expectations cannot be achieved, work-family/family-work conflict arises. It is wondered that whether or not the tension between work and family can be managed with social intelligence, in which it makes strong the ability of establishing good relations with other people. The aim of this study is examining social intelligence in organizational context and exhibiting whether or not social intelligence takes a reducing role for work-family/family-work conflict. Findings of the study suggest that social intelligence and its all dimensions have negatively and significantly related with family-work conflict and social intelligence takes a role in reducing family-work conflict.
DEFF Research Database (Denmark)
Hjorth, Poul G.
2005-01-01
Forestillingen om at naturen er designet af en guddommelig 'intelligens' er et smukt filosofisk princip. Teorier om Intelligent Design som en naturvidenskabeligt baseret teori er derimod helt forfærdelig.......Forestillingen om at naturen er designet af en guddommelig 'intelligens' er et smukt filosofisk princip. Teorier om Intelligent Design som en naturvidenskabeligt baseret teori er derimod helt forfærdelig....
National Research Council Canada - National Science Library
Wirth, Kevin E
2007-01-01
.... Although the United States Coast Guard has utilized intelligence capabilities since the service's inception in 1790, the Coast Guard was not included as a formal member of the Intelligence Community until December 2002. Mr...
Artificial Intelligence for Controlling Robotic Aircraft
Krishnakumar, Kalmanje
2005-01-01
A document consisting mostly of lecture slides presents overviews of artificial-intelligence-based control methods now under development for application to robotic aircraft [called Unmanned Aerial Vehicles (UAVs) in the paper] and spacecraft and to the next generation of flight controllers for piloted aircraft. Following brief introductory remarks, the paper presents background information on intelligent control, including basic characteristics defining intelligent systems and intelligent control and the concept of levels of intelligent control. Next, the paper addresses several concepts in intelligent flight control. The document ends with some concluding remarks, including statements to the effect that (1) intelligent control architectures can guarantee stability of inner control loops and (2) for UAVs, intelligent control provides a robust way to accommodate an outer-loop control architecture for planning and/or related purposes.
Toward New-Generation Intelligent Manufacturing
Directory of Open Access Journals (Sweden)
Ji Zhou
2018-02-01
Full Text Available Intelligent manufacturing is a general concept that is under continuous development. It can be categorized into three basic paradigms: digital manufacturing, digital-networked manufacturing, and new-generation intelligent manufacturing. New-generation intelligent manufacturing represents an in-depth integration of new-generation artificial intelligence (AI technology and advanced manufacturing technology. It runs through every link in the full life-cycle of design, production, product, and service. The concept also relates to the optimization and integration of corresponding systems; the continuous improvement of enterprises’ product quality, performance, and service levels; and reduction in resources consumption. New-generation intelligent manufacturing acts as the core driving force of the new industrial revolution and will continue to be the main pathway for the transformation and upgrading of the manufacturing industry in the decades to come. Human-cyber-physical systems (HCPSs reveal the technological mechanisms of new-generation intelligent manufacturing and can effectively guide related theoretical research and engineering practice. Given the sequential development, cross interaction, and iterative upgrading characteristics of the three basic paradigms of intelligent manufacturing, a technology roadmap for “parallel promotion and integrated development” should be developed in order to drive forward the intelligent transformation of the manufacturing industry in China. Keywords: Advanced manufacturing, New-generation intelligent manufacturing, Human-cyber-physical system, New-generation AI, Basic paradigms, Parallel promotion, Integrated development
Intelligence and Prosocial Behavior
DEFF Research Database (Denmark)
Han, Ru; Shi, Jiannong; Yong, W.
2012-01-01
Results of prev ious studies of the relationship between prosocial behav ior and intelligence hav e been inconsistent. This study attempts to distinguish the dif f erences between sev eral prosocial tasks, and explores the way s in which cognitiv e ability inf luences prosocial behav ior. In Study...... One and Two, we reexamined the relationship between prosocial behav ior and intelligence by employ ing a costly signaling theory with f our games. The results rev ealed that the prosocial lev el of smarter children is higher than that of other children in more complicated tasks but not so in simple...... tasks. In Study Three, we tested the moderation ef f ect of the av erage intelligence across classes, and the results did not show any group intelligence ef f ect on the relationship between intelligence and prosocial behav ior....
McFarlane, Donovan A.
2011-01-01
This paper examines the theory of Multiple Intelligences (MI) as the most viable and effective platform for 21st century educational and instructional methodologies based on the understanding of the value of diversity in today's classrooms and educational institutions, the unique qualities and characteristics of individual learners, the…
Lipavská, Helena; Žárský, Viktor
2009-01-01
The concept of plant intelligence, as proposed by Anthony Trewavas, has raised considerable discussion. However, plant intelligence remains loosely defined; often it is either perceived as practically synonymous to Darwinian fitness, or reduced to a mere decorative metaphor. A more strict view can be taken, emphasizing necessary prerequisites such as memory and learning, which requires clarifying the definition of memory itself. To qualify as memories, traces of past events have to be not only stored, but also actively accessed. We propose a criterion for eliminating false candidates of possible plant intelligence phenomena in this stricter sense: an “intelligent” behavior must involve a component that can be approximated by a plausible algorithmic model involving recourse to stored information about past states of the individual or its environment. Re-evaluation of previously presented examples of plant intelligence shows that only some of them pass our test. “You were hurt?” Kumiko said, looking at the scar. Sally looked down. “Yeah.” “Why didn't you have it removed?” “Sometimes it's good to remember.” “Being hurt?” “Being stupid.”—(W. Gibson: Mona Lisa Overdrive) PMID:19816094
Elementary epistemological features of machine intelligence
Horvat, Marko
2008-01-01
Theoretical analysis of machine intelligence (MI) is useful for defining a common platform in both theoretical and applied artificial intelligence (AI). The goal of this paper is to set canonical definitions that can assist pragmatic research in both strong and weak AI. Described epistemological features of machine intelligence include relationship between intelligent behavior, intelligent and unintelligent machine characteristics, observable and unobservable entities and classification of in...
Snowden, Austyn; Stenhouse, Rosie; Young, Jenny; Carver, Hannah; Carver, Fiona; Brown, Norrie
2015-01-01
Emotional Intelligence (EI), previous caring experience and mindfulness training may have a positive impact on nurse education. More evidence is needed to support the use of these variables in nurse recruitment and retention. To explore the relationship between EI, gender, age, programme of study, previous caring experience and mindfulness training. Cross sectional element of longitudinal study. 938year one nursing, midwifery and computing students at two Scottish Higher Education Institutes (HEIs) who entered their programme in September 2013. Participants completed a measure of 'trait' EI: Trait Emotional Intelligence Questionnaire Short Form (TEIQue-SF); and 'ability' EI: Schutte's et al. (1998) Emotional Intelligence Scale (SEIS). Demographics, previous caring experience and previous training in mindfulness were recorded. Relationships between variables were tested using non-parametric tests. Emotional intelligence increased with age on both measures of EI [TEIQ-SF H(5)=15.157 p=0.001; SEIS H(5)=11.388, p=0.044]. Females (n=786) scored higher than males (n=149) on both measures [TEIQ-SF, U=44,931, z=-4.509, pemotional intelligence. Mindfulness training was associated with higher 'ability' emotional intelligence. Implications for recruitment, retention and further research are explored. Copyright © 2014. Published by Elsevier Ltd.
Intelligence Community Spending: Trends and Issues
2016-11-08
The Deputy Director CIA manages the CIAP. Funds CIA activities to include HUMINT and OSINT . The CIAP funds everything related to the CIA. It...Human Intelligence (HUMINT); Imagery Intelligence (IMINT); Measurement and Signature Intelligence (MASINT); Open Source Intelligence ( OSINT ); and
GABA predicts visual intelligence.
Cook, Emily; Hammett, Stephen T; Larsson, Jonas
2016-10-06
Early psychological researchers proposed a link between intelligence and low-level perceptual performance. It was recently suggested that this link is driven by individual variations in the ability to suppress irrelevant information, evidenced by the observation of strong correlations between perceptual surround suppression and cognitive performance. However, the neural mechanisms underlying such a link remain unclear. A candidate mechanism is neural inhibition by gamma-aminobutyric acid (GABA), but direct experimental support for GABA-mediated inhibition underlying suppression is inconsistent. Here we report evidence consistent with a global suppressive mechanism involving GABA underlying the link between sensory performance and intelligence. We measured visual cortical GABA concentration, visuo-spatial intelligence and visual surround suppression in a group of healthy adults. Levels of GABA were strongly predictive of both intelligence and surround suppression, with higher levels of intelligence associated with higher levels of GABA and stronger surround suppression. These results indicate that GABA-mediated neural inhibition may be a key factor determining cognitive performance and suggests a physiological mechanism linking surround suppression and intelligence. Copyright © 2016 The Authors. Published by Elsevier Ireland Ltd.. All rights reserved.
The First Workshop on Artificial Intelligence Techniques for Ambient Intelligence (AITAmI '06)
Augusto, Juan Carlos; Shapiro, Daniel
2007-01-01
The first annual workshop on the role of AI in ambient intelligence was held in Riva de Garda, Italy, on August 29, 2006. The workshop was colocated with the European Conference on Artificial Intelligence (ECAI 2006). It provided an opportunity for researchers in a variety of AI subfields together with representatives of commercial interests to explore ambient intelligence technology and applications.
Intelligent editor/printer enhancements
Woodfill, M. C.; Pheanis, D. C.
1983-01-01
Microprocessor support hardware, software, and cross assemblers relating to the Motorola 6800 and 6809 process systems were developed. Pinter controller and intelligent CRT development are discussed. The user's manual, design specifications for the MC6809 version of the intelligent printer controller card, and a 132-character by 64-line intelligent CRT display system using a Motorola 6809 MPU, and a one-line assembler and disassembler are provided.
Directory of Open Access Journals (Sweden)
Degtyarev A.V.,
2014-11-01
Full Text Available The problem of social-psychological adaptation of adolescents with deviant behavioral today is of particular relevance in relation to the current process of restructuring of educational institutions - the merging of general and specialized schools for adolescents with behavioral problems in a unified educational complexes. In these circumstances it is necessary to find an efficient tool that will simultaneously accelerate the process of adaptation and have a positive preventive effect. In this article, the author shows that such a tool can become the emotional intelligence as a construct that includes various abilities of the emotional sphere. The main hypothesis of the study was that the socio-psychological adaptation of adolescents with deviant behavior has its own characteristics, different from the norm group, and is interconnected with the components of emotional intelligence. The study was conducted on the basis of general education school № 2077 formed by the merger of five educational institutions: the former school № 738, № 703, № 702, № 7 and № 77. The study involved 222 teenagers from 14 to 16 years (111 girls and 111 boys.
B. K. Punia; Priyanka Yadav
2015-01-01
The piece of writing investigates the relationship between employees’ emotional and Spiritual intelligence. A conversation of spirituality and emotions within the workplace can be an unthinkable topic. However, emotional intelligence and spiritual intelligence are, at present, more widely acknowledged. Drawing a research connected with these construct we suggest that emotional intelligence within the employees in organisations may provide employees with a medium to better understand and mix s...
Artificial Intelligence and Economic Theories
Marwala, Tshilidzi; Hurwitz, Evan
2017-01-01
The advent of artificial intelligence has changed many disciplines such as engineering, social science and economics. Artificial intelligence is a computational technique which is inspired by natural intelligence such as the swarming of birds, the working of the brain and the pathfinding of the ants. These techniques have impact on economic theories. This book studies the impact of artificial intelligence on economic theories, a subject that has not been extensively studied. The theories that...
Hughes, Stephanie; White, Rebecca J.
2005-01-01
Institutions of higher education can use competitive intelligence (CI) techniques to become more relevant to their communities. In Stepping Forward as Stewards of Place the American Association of State Colleges and Universities (AASCU) provides a model for public engagement that emphasizes internal strategic planning, implementation, and…
DEFF Research Database (Denmark)
Diderichsen, Adam; Rønn, Kira Vrist
2017-01-01
This article contributes to the current discussions concerning an adequate framework for intelligence ethics. The first part critically scrutinises the use of Just War Theory in intelligence ethics with specific focus on the just cause criterion. We argue that using self-defence as justifying cau...
The City Intelligence Quotient (City IQ Evaluation System: Conception and Evaluation
Directory of Open Access Journals (Sweden)
Zhiqiang Wu
2016-06-01
Full Text Available After a systematic review of 38 current intelligent city evaluation systems (ICESs from around the world, this research analyzes the secondary and tertiary indicators of these 38 ICESs from the perspectives of scale structuring, approaches and indicator selection, and determines their common base. From this base, the fundamentals of the City Intelligence Quotient (City IQ Evaluation System are developed and five dimensions are selected after a clustering analysis. The basic version, City IQ Evaluation System 1.0, involves 275 experts from 14 high-end research institutions, which include the Chinese Academy of Engineering, the National Academy of Science and Engineering (Germany, the Royal Swedish Academy of Engineering Sciences, the Planning Management Center of the Ministry of Housing and Urban-Rural Development of China, and the Development Research Center of the State Council of China. City IQ Evaluation System 2.0 is further developed, with improvements in its universality, openness, and dynamic adjustment capability. After employing deviation evaluation methods in the IQ assessment, City IQ Evaluation System 3.0 was conceived. The research team has conducted a repeated assessment of 41 intelligent cities around the world using City IQ Evaluation System 3.0. The results have proved that the City IQ Evaluation System, developed on the basis of intelligent life, features more rational indicators selected from data sources that can offer better universality, openness, and dynamics, and is more sensitive and precise.
Position Paper on Intelligent Supply Chains
DEFF Research Database (Denmark)
Møller, Charles
This paper is intended to present and to analyze the concept of the Intelligent Supply Chain (ISC). The purpose of the paper is to: 1) Clarify the concept of the intelligent supply chain; 2) Identify emerging research opportunities; and 3) Specify a research engagement model for further explorati...... of intelligent supply chains. It is concluded that information management is critical to intelligent supply chains and a research agenda is outlined.......This paper is intended to present and to analyze the concept of the Intelligent Supply Chain (ISC). The purpose of the paper is to: 1) Clarify the concept of the intelligent supply chain; 2) Identify emerging research opportunities; and 3) Specify a research engagement model for further exploration...... the concept of Intelligent Supply Chain and to establish an overall perspective based on information management. The claim made here is that the notion of the intelligent enterprise contributes with a new perspective on supply chain management that addresses the current challenges in an industrial supply...
What Is Artificial Intelligence Anyway?
Kurzweil, Raymond
1985-01-01
Examines the past, present, and future status of Artificial Intelligence (AI). Acknowledges the limitations of AI but proposes possible areas of application and further development. Urges a concentration on the unique strengths of machine intelligence rather than a copying of human intelligence. (ML)
Competitive Intelligence and Social Advantage.
Davenport, Elisabeth; Cronin, Blaise
1994-01-01
Presents an overview of issues concerning civilian competitive intelligence (CI). Topics discussed include competitive advantage in academic and research environments; public domain information and libraries; covert and overt competitive intelligence; data diversity; use of the Internet; cooperative intelligence; and implications for library and…
Soft computing in artificial intelligence
Matson, Eric
2014-01-01
This book explores the concept of artificial intelligence based on knowledge-based algorithms. Given the current hardware and software technologies and artificial intelligence theories, we can think of how efficient to provide a solution, how best to implement a model and how successful to achieve it. This edition provides readers with the most recent progress and novel solutions in artificial intelligence. This book aims at presenting the research results and solutions of applications in relevance with artificial intelligence technologies. We propose to researchers and practitioners some methods to advance the intelligent systems and apply artificial intelligence to specific or general purpose. This book consists of 13 contributions that feature fuzzy (r, s)-minimal pre- and β-open sets, handling big coocurrence matrices, Xie-Beni-type fuzzy cluster validation, fuzzy c-regression models, combination of genetic algorithm and ant colony optimization, building expert system, fuzzy logic and neural network, ind...
Factors Affecting Acoustics and Speech Intelligibility in the Operating Room: Size Matters.
McNeer, Richard R; Bennett, Christopher L; Horn, Danielle Bodzin; Dudaryk, Roman
2017-06-01
Noise in health care settings has increased since 1960 and represents a significant source of dissatisfaction among staff and patients and risk to patient safety. Operating rooms (ORs) in which effective communication is crucial are particularly noisy. Speech intelligibility is impacted by noise, room architecture, and acoustics. For example, sound reverberation time (RT60) increases with room size, which can negatively impact intelligibility, while room objects are hypothesized to have the opposite effect. We explored these relationships by investigating room construction and acoustics of the surgical suites at our institution. We studied our ORs during times of nonuse. Room dimensions were measured to calculate room volumes (VR). Room content was assessed by estimating size and assigning items into 5 volume categories to arrive at an adjusted room content volume (VC) metric. Psychoacoustic analyses were performed by playing sweep tones from a speaker and recording the impulse responses (ie, resulting sound fields) from 3 locations in each room. The recordings were used to calculate 6 psychoacoustic indices of intelligibility. Multiple linear regression was performed using VR and VC as predictor variables and each intelligibility index as an outcome variable. A total of 40 ORs were studied. The surgical suites were characterized by a large degree of construction and surface finish heterogeneity and varied in size from 71.2 to 196.4 m (average VR = 131.1 [34.2] m). An insignificant correlation was observed between VR and VC (Pearson correlation = 0.223, P = .166). Multiple linear regression model fits and β coefficients for VR were highly significant for each of the intelligibility indices and were best for RT60 (R = 0.666, F(2, 37) = 39.9, P the size and contents of an OR can predict a range of psychoacoustic indices of speech intelligibility. Specifically, increasing OR size correlated with worse speech intelligibility, while increasing amounts of OR contents
Relationship between Emotional Intelligence and
Directory of Open Access Journals (Sweden)
Vahid Rafieyan
2014-07-01
Full Text Available Language learners’ awareness of target language pragmatic features is influenced by individual difference variables, the least explored one being emotional intelligence. To investigate the relationship between emotional intelligence and pragmatic awareness, the current study was conducted over 120 Iranian senior undergraduates of English as a Foreign Language at a university in Iran. Pragmatic awareness was measured through a 12-scenario contextualized pragmatic judgment task. Emotional intelligence was also measured through the EQ-i. The results of the Pearson correlation revealed a strong positive relationship between emotional intelligence and pragmatic awareness. The pedagogical implications of the findings suggested incorporation of emotion-driven authentic materials in English language classes to invoke emotional intelligence in language learners.
Emotional intelligence of mental health nurses.
van Dusseldorp, Loes R L C; van Meijel, Berno K G; Derksen, Jan J L
2011-02-01
The aim of this study is to gain insight into the level of emotional intelligence of mental health nurses in the Netherlands. The focus in research on emotional intelligence to date has been on a variety of professionals. However, little is known about emotional intelligence in mental health nurses. The emotional intelligence of 98 Dutch nurses caring for psychiatric patients is reported. Data were collected with the Bar-On Emotional Quotient Inventory within a cross-sectional research design. The mean level of emotional intelligence of this sample of professionals is statistically significant higher than the emotional intelligence of the general population. Female nurses score significantly higher than men on the subscales Empathy, Social Responsibility, Interpersonal Relationship, Emotional Self-awareness, Self-Actualisation and Assertiveness. No correlations are found between years of experience and age on the one hand and emotional intelligence on the other hand. The results of this study show that nurses in psychiatric care indeed score above average in the emotional intelligence required to cope with the amount of emotional labour involved in daily mental health practice. The ascertained large range in emotional intelligence scores among the mental health nurses challenges us to investigate possible implications which higher or lower emotional intelligence levels may have on the quality of care. For instance, a possible relation between the level of emotional intelligence and the quality of the therapeutic nurse-patient relationship or the relation between the level of emotional intelligence and the manner of coping with situations characterised by a great amount of emotional labour (such as caring for patients who self-harm or are suicidal). © 2010 The Authors. Journal compilation © 2010 Blackwell Publishing Ltd.
Intelligent Environmental Nanomaterials
Chang, Jian
2018-01-30
Due to the inherent complexity of environmental problems, especially water and air pollution, the utility of single-function environmental nanomaterials used in conventional and unconventional environmental treatment technologies are gradually reaching their limits. Intelligent nanomaterials with environmentally-responsive functionalities have shown potential to improve the performance of existing and new environmental technologies. By rational design of their structures and functionalities, intelligent nanomaterials can perform different tasks in response to varying application scenarios for the purpose of achieving the best performance. This review offers a critical analysis of the design concepts and latest progresses on the intelligent environmental nanomaterials in filtration membranes with responsive gates, materials with switchable wettability for selective and on-demand oil/water separation, environmental materials with self-healing capability, and emerging nanofibrous air filters for PM2.5 removal. We hope that this review will inspire further research efforts to develop intelligent environmental nanomaterials for the enhancement of the overall quality of environmental or human health.
Intelligent Environmental Nanomaterials
Chang, Jian; Zhang, Lianbin; Wang, Peng
2018-01-01
Due to the inherent complexity of environmental problems, especially water and air pollution, the utility of single-function environmental nanomaterials used in conventional and unconventional environmental treatment technologies are gradually reaching their limits. Intelligent nanomaterials with environmentally-responsive functionalities have shown potential to improve the performance of existing and new environmental technologies. By rational design of their structures and functionalities, intelligent nanomaterials can perform different tasks in response to varying application scenarios for the purpose of achieving the best performance. This review offers a critical analysis of the design concepts and latest progresses on the intelligent environmental nanomaterials in filtration membranes with responsive gates, materials with switchable wettability for selective and on-demand oil/water separation, environmental materials with self-healing capability, and emerging nanofibrous air filters for PM2.5 removal. We hope that this review will inspire further research efforts to develop intelligent environmental nanomaterials for the enhancement of the overall quality of environmental or human health.
Inadequate Evidence for Multiple Intelligences, Mozart Effect, and Emotional Intelligence Theories
Waterhouse, Lynn
2006-01-01
I (Waterhouse, 2006) argued that, because multiple intelligences, the Mozart effect, and emotional intelligence theories have inadequate empirical support and are not consistent with cognitive neuroscience findings, these theories should not be applied in education. Proponents countered that their theories had sufficient empirical support, were…
Understanding the Globalization of Intelligence
DEFF Research Database (Denmark)
Svendsen, Adam David Morgan
"This book provides an introduction to the complexities of contemporary Western Intelligence and its dynamics during an era of globalization. Towards an understanding of the globalization of intelligence process, Svendsen focuses on the secretive phenomenon of international or foreign intelligence...... cooperation ('liaison'), as it occurs in both theory and practice. Reflecting a complex coexistence plurality of several different and overlapping concepts in action, the challenging process of the globalization of intelligence emerges as essential for complex issue management purposes during a globalized era...
Reliability and Validity of the New Tanaka B Intelligence Scale Scores: A Group Intelligence Test
Uno, Yota; Mizukami, Hitomi; Ando, Masahiko; Yukihiro, Ryoji; Iwasaki, Yoko; Ozaki, Norio
2014-01-01
OBJECTIVE: The present study evaluated the reliability and concurrent validity of the new Tanaka B Intelligence Scale, which is an intelligence test that can be administered on groups within a short period of time. METHODS: The new Tanaka B Intelligence Scale and Wechsler Intelligence Scale for Children-Third Edition were administered to 81 subjects (mean age ± SD 15.2 ± 0.7 years) residing in a juvenile detention home; reliability was assessed using Cronbach's alpha coefficient, and concurre...
Hybrid-augmented intelligence:collaboration and cognition
Institute of Scientific and Technical Information of China (English)
Nan-ning ZHENG; Zi-yi LIU; Peng-ju REN; Yong-qiang MA; Shi-tao CHEN; Si-yu YU; Jian-ru XUE
2017-01-01
The long-term goal of artificial intelligence (AI) is to make machines learn and think like human beings. Due to the high levels of uncertainty and vulnerability in human life and the open-ended nature of problems that humans are facing, no matter how intelligent machines are, they are unable to completely replace humans. Therefore, it is necessary to introduce human cognitive capabilities or human-like cognitive models into AI systems to develop a new form of AI, that is, hybrid-augmented intelligence. This form of AI or machine intelligence is a feasible and important developing model. Hybrid-augmented intelligence can be divided into two basic models:one is human-in-the-loop augmented intelligence with human-computer collaboration, and the other is cognitive computing based augmented intelligence, in which a cognitive model is embedded in the machine learning system. This survey describes a basic framework for human-computer collaborative hybrid-augmented intelligence, and the basic elements of hybrid-augmented intelligence based on cognitive computing. These elements include intuitive reasoning, causal models, evolution of memory and knowledge, especially the role and basic principles of intuitive reasoning for complex problem solving, and the cognitive learning framework for visual scene understanding based on memory and reasoning. Several typical applications of hybrid-augmented intelligence in related fields are given.
International Nuclear Information System (INIS)
Farkas, J.
1992-01-01
In this paper we discuss the relevance of artificial intelligence to the automatic indexing of natural language text. We describe the use of domain-specific semantically-based thesauruses and address the problem of creating adequate knowledge bases for intelligent indexing systems. We also discuss the relevance of the Hilbert space ι 2 to the compact representation of documents and to the definition of the similarity of natural language texts. (author). 17 refs., 2 figs
Energy Technology Data Exchange (ETDEWEB)
Farkas, J
1993-12-31
In this paper we discuss the relevance of artificial intelligence to the automatic indexing of natural language text. We describe the use of domain-specific semantically-based thesauruses and address the problem of creating adequate knowledge bases for intelligent indexing systems. We also discuss the relevance of the Hilbert space {iota}{sup 2} to the compact representation of documents and to the definition of the similarity of natural language texts. (author). 17 refs., 2 figs.
How to Improve Artificial Intelligence through Web
Adrian Lupasc
2005-01-01
Intelligent agents, intelligent software applications and artificial intelligent applications from artificial intelligence service providers may make their way onto the Web in greater number as adaptive software, dynamic programming languages and Learning Algorithms are introduced into Web Services. The evolution of Web architecture may allow intelligent applications to run directly on the Web by introducing XML, RDF and logic layer. The Intelligent Wireless Web’s significant potential for ra...
Artificial Intelligence--Applications in Education.
Poirot, James L.; Norris, Cathleen A.
1987-01-01
This first in a projected series of five articles discusses artificial intelligence and its impact on education. Highlights include the history of artificial intelligence and the impact of microcomputers; learning processes; human factors and interfaces; computer assisted instruction and intelligent tutoring systems; logic programing; and expert…
Political Orientations, Intelligence and Education
Rindermann, Heiner; Flores-Mendoza, Carmen; Woodley, Michael A.
2012-01-01
The social sciences have traditionally assumed that education is a major determinant of citizens' political orientations and behavior. Several studies have also shown that intelligence has an impact. According to a theory that conceptualizes intelligence as a "burgher" (middle-class, civil) phenomenon--intelligence should promote civil…
Storek, Josephine; Furnham, Adrian
2013-01-01
Over 120 participants completed three timed intelligence tests, a self-estimated Domain Masculine (DMIQ) Intelligence scale, and a mindset "beliefs about intelligence" measure (Dweck, 2012) to examine correlates of the Hubris-Humility Effect (HHE) which shows males believe they are more intelligent than females. As predicted males gave…
Quo Vadis, Artificial Intelligence?
Berrar, Daniel; Sato, Naoyuki; Schuster, Alfons
2010-01-01
Since its conception in the mid 1950s, artificial intelligence with its great ambition to understand and emulate intelligence in natural and artificial environments alike is now a truly multidisciplinary field that reaches out and is inspired by a great diversity of other fields. Rapid advances in research and technology in various fields have created environments into which artificial intelligence could embed itself naturally and comfortably. Neuroscience with its desire to understand nervou...
Methodology, Birth Order, Intelligence, and Personality.
Michalski, Richard L.; Shackelford, Todd K.
2001-01-01
Critiques recent research on the effects of birth order on intelligence and personality, which found that the between-family design revealed that birth order negatively related to intelligence, while the within-family design revealed that birth order was unrelated to intelligence. Suggests that it may not be intelligence that co-varies with birth…
Challenging problems and solutions in intelligent systems
Grzegorzewski, Przemysław; Kacprzyk, Janusz; Owsiński, Jan; Penczek, Wojciech; Zadrożny, Sławomir
2016-01-01
This volume presents recent research, challenging problems and solutions in Intelligent Systems– covering the following disciplines: artificial and computational intelligence, fuzzy logic and other non-classic logics, intelligent database systems, information retrieval, information fusion, intelligent search (engines), data mining, cluster analysis, unsupervised learning, machine learning, intelligent data analysis, (group) decision support systems, intelligent agents and multi-agent systems, knowledge-based systems, imprecision and uncertainty handling, electronic commerce, distributed systems, etc. The book defines a common ground for sometimes seemingly disparate problems and addresses them by using the paradigm of broadly perceived intelligent systems. It presents a broad panorama of a multitude of theoretical and practical problems which have been successfully dealt with using the paradigm of intelligent computing.
Yaratan, Huseyin
2003-01-01
An ITS (Intelligent Tutoring System) is a teaching-learning medium that uses artificial intelligence (AI) technology for instruction. Roberts and Park (1983) defines AI as the attempt to get computers to perform tasks that if performed by a human-being, intelligence would be required to perform the task. The design of an ITS comprises two distinct…
Directory of Open Access Journals (Sweden)
Marian Pompiliu CRISTESCU
2016-01-01
Full Text Available The focus of this paper is on the one hand on the importance of business intelligence in large and medium-sized businesses and on the other side on the evaluation and implementation of Business Intelligence. It shows how companies make better and faster decisions regarding their customers, partners and operations by converting data into valuable business information. The paper describes how to bring business intelligence information, people and technology together to help to create a successful business strategy. The conclusion of the paper is the assessment of the possibility of business intelligence to develop projects in large and medium-sized companies and the discussion of the possible alternatives with respect to the different functions.
Intelligence Campaign Planning: An Opportunity for the Army in Defense Intelligence Synchronization
National Research Council Canada - National Science Library
McAninch, Kevin A
2007-01-01
...) Intelligence Community (IC) implementation and execution of Intelligence Campaign Planning (ICP). ICP is emerging as a new procedure for the DoD IC to centrally plan ISR Synchronization in support of regional combatant commander operation plans...
The Construction of Intelligent English Teaching Model Based on Artificial Intelligence
Directory of Open Access Journals (Sweden)
Xiaoguang Li
2017-12-01
Full Text Available In order to build a modernized tool platform that can help students improve their English learning efficiency according to their mastery of knowledge and personality, this paper develops an online intelligent English learning system that uses Java and artificial intelligence language Prolog as the software system. This system is a creative reflection of the thoughts of expert system in artificial intelligence. Established on the Struts Spring Hibernate lightweight JavaEE framework, the system modules are coupled with each other in a much lower degree, which is convenient to future function extension. Combined with the idea of expert system in artificial intelligence, the system developed appropriate learning strategies to help students double the learning effect with half the effort; Finally, the system takes into account the forgetting curve of memory, on which basis the knowledge that has been learned will be tested periodically, intending to spare students’ efforts to do a sea of exercises and obtain better learning results.
Sahin, Feyzullah
2016-01-01
Creativity of the individual is dependent on numerous factors, such as knowledge, general intelligence and emotional intelligence. The general purpose of this study is to investigate the effect of general intelligence, emotional intelligence and academic knowledge on the emerging of domain-specific creativity. The study was conducted on 178…
Intelligent environmental sensing
Mukhopadhyay, Subhas
2015-01-01
Developing environmental sensing and monitoring technologies become essential especially for industries that may cause severe contamination. Intelligent environmental sensing uses novel sensor techniques, intelligent signal and data processing algorithms, and wireless sensor networks to enhance environmental sensing and monitoring. It finds applications in many environmental problems such as oil and gas, water quality, and agriculture. This book addresses issues related to three main approaches to intelligent environmental sensing and discusses their latest technological developments. Key contents of the book include: Agricultural monitoring Classification, detection, and estimation Data fusion Geological monitoring Motor monitoring Multi-sensor systems Oil reservoirs monitoring Sensor motes Water quality monitoring Wireless sensor network protocol
Computer automation and artificial intelligence
International Nuclear Information System (INIS)
Hasnain, S.B.
1992-01-01
Rapid advances in computing, resulting from micro chip revolution has increased its application manifold particularly for computer automation. Yet the level of automation available, has limited its application to more complex and dynamic systems which require an intelligent computer control. In this paper a review of Artificial intelligence techniques used to augment automation is presented. The current sequential processing approach usually adopted in artificial intelligence has succeeded in emulating the symbolic processing part of intelligence, but the processing power required to get more elusive aspects of intelligence leads towards parallel processing. An overview of parallel processing with emphasis on transputer is also provided. A Fuzzy knowledge based controller for amination drug delivery in muscle relaxant anesthesia on transputer is described. 4 figs. (author)
Artificial intelligence and the future.
Clocksin, William F
2003-08-15
We consider some of the ideas influencing current artificial-intelligence research and outline an alternative conceptual framework that gives priority to social relationships as a key component and constructor of intelligent behaviour. The framework starts from Weizenbaum's observation that intelligence manifests itself only relative to specific social and cultural contexts. This is in contrast to a prevailing view, which sees intelligence as an abstract capability of the individual mind based on a mechanism for rational thought. The new approach is not based on the conventional idea that the mind is a rational processor of symbolic information, nor does it require the idea that thought is a kind of abstract problem solving with a semantics that is independent of its embodiment. Instead, priority is given to affective and social responses that serve to engage the whole agent in the life of the communities in which it participates. Intelligence is seen not as the deployment of capabilities for problem solving, but as constructed by the continual, ever-changing and unfinished engagement with the social group within the environment. The construction of the identity of the intelligent agent involves the appropriation or 'taking up' of positions within the conversations and narratives in which it participates. Thus, the new approach argues that the intelligent agent is shaped by the meaning ascribed to experience, by its situation in the social matrix, and by practices of self and of relationship into which intelligent life is recruited. This has implications for the technology of the future, as, for example, classic artificial intelligence models such as goal-directed problem solving are seen as special cases of narrative practices instead of as ontological foundations.
Creationism and intelligent design.
Pennock, Robert T
2003-01-01
Creationism, the rejection of evolution in favor of supernatural design, comes in many varieties besides the common young-earth Genesis version. Creationist attacks on science education have been evolving in the last few years through the alliance of different varieties. Instead of calls to teach "creation science," one now finds lobbying for "intelligent design" (ID). Guided by the Discovery Institute's "Wedge strategy," the ID movement aims to overturn evolution and what it sees as a pernicious materialist worldview and to renew a theistic foundation to Western culture, in which human beings are recognized as being created in the image of God. Common ID arguments involving scientific naturalism, "irreducible complexity," "complex specified information," and "icons of evolution," have been thoroughly examined and refuted. Nevertheless, from Kansas to Ohio to the U.S. Congress, ID continues lobbying to teach the controversy, and scientists need to be ready to defend good evolution education.
Intelligent Mission Controller Node
National Research Council Canada - National Science Library
Perme, David
2002-01-01
The goal of the Intelligent Mission Controller Node (IMCN) project was to improve the process of translating mission taskings between real-world Command, Control, Communications, Computers, and Intelligence (C41...
Li, Tianrui
2012-01-01
Proceedings of The Sixth International Conference on Intelligent System and Knowledge Engineering presents selected papers from the conference ISKE 2011, held December 15-17 in Shanghai, China. This proceedings doesn’t only examine original research and approaches in the broad areas of intelligent systems and knowledge engineering, but also present new methodologies and practices in intelligent computing paradigms. The book introduces the current scientific and technical advances in the fields of artificial intelligence, machine learning, pattern recognition, data mining, information retrieval, knowledge-based systems, knowledge representation and reasoning, multi-agent systems, natural-language processing, etc. Furthermore, new computing methodologies are presented, including cloud computing, service computing and pervasive computing with traditional intelligent methods. The proceedings will be beneficial for both researchers and practitioners who want to utilize intelligent methods in their specific resea...
Emotional Intelligence: Requiring Attention
Directory of Open Access Journals (Sweden)
Monica Tudor
2016-01-01
Full Text Available This article aims to highlight the need for emotional intelligence. Two methods of measurementare presented in this research, in order to better understand the necessity of a correct result. Theresults of research can lead to recommendations for improving levels of emotional intelligence andare useful for obtaining data to better compare past and present result. The papers presented inthis research are significant for future study of this subject. The first paper presents the evolutionof emotional intelligence in the past two years, more specifically its decrease concerning certaincharacteristics. The second one presents a research on the differences between generations. Thethird one shows a difference in emotional intelligence levels of children from rural versus urbanenvironments and the obstacles that they encounter in their own development.
Towards Intelligent Supply Chains
DEFF Research Database (Denmark)
Siurdyban, Artur; Møller, Charles
2012-01-01
applied to the context of organizational processes can increase the success rate of business operations. The framework is created using a set of theoretical based constructs grounded in a discussion across several streams of research including psychology, pedagogy, artificial intelligence, learning...... of deploying inapt operations leading to deterioration of profits. To address this problem, we propose a unified business process design framework based on the paradigm of intelligence. Intelligence allows humans and human-designed systems cope with environmental volatility, and we argue that its principles......, business process management and supply chain management. It outlines a number of system tasks combined in four integrated management perspectives: build, execute, grow and innovate, put forward as business process design propositions for Intelligent Supply Chains....
Multiple Intelligences, the Mozart Effect, and Emotional Intelligence: A Critical Review
Waterhouse, Lynn
2006-01-01
This article reviews evidence for multiple intelligences theory, the Mozart effect theory, and emotional intelligence theory and argues that despite their wide currency in education these theories lack adequate empirical support and should not be the basis for educational practice. Each theory is compared to theory counterparts in cognitive…
Semantic Business Intelligence - a New Generation of Business Intelligence
Dinu AIRINEI; Dora-Anca BERTA
2012-01-01
Business Intelligence Solutions represents applications used by companies to manage process and analyze data to provide substantiated decision. In the context of Semantic Web develop-ment trend is to integrate semantic unstructured data, making business intelligence solutions to be redesigned in such a manner that can analyze, process and synthesize, in addition to traditional data and data integrated with semantic another form and structure. This invariably leads appearance of new BI solutio...
Cooperation and the evolution of intelligence.
McNally, Luke; Brown, Sam P; Jackson, Andrew L
2012-08-07
The high levels of intelligence seen in humans, other primates, certain cetaceans and birds remain a major puzzle for evolutionary biologists, anthropologists and psychologists. It has long been held that social interactions provide the selection pressures necessary for the evolution of advanced cognitive abilities (the 'social intelligence hypothesis'), and in recent years decision-making in the context of cooperative social interactions has been conjectured to be of particular importance. Here we use an artificial neural network model to show that selection for efficient decision-making in cooperative dilemmas can give rise to selection pressures for greater cognitive abilities, and that intelligent strategies can themselves select for greater intelligence, leading to a Machiavellian arms race. Our results provide mechanistic support for the social intelligence hypothesis, highlight the potential importance of cooperative behaviour in the evolution of intelligence and may help us to explain the distribution of cooperation with intelligence across taxa.
Recent Advances on Hybrid Intelligent Systems
Melin, Patricia; Kacprzyk, Janusz
2013-01-01
This book presents recent advances on hybrid intelligent systems using soft computing techniques for intelligent control and robotics, pattern recognition, time series prediction and optimization of complex problems. Soft Computing (SC) consists of several intelligent computing paradigms, including fuzzy logic, neural networks, and bio-inspired optimization algorithms, which can be used to produce powerful hybrid intelligent systems. The book is organized in five main parts, which contain groups of papers around a similar subject. The first part consists of papers with the main theme of hybrid intelligent systems for control and robotics, which are basically state of the art papers that propose new models and concepts, which can be the basis for achieving intelligent control and mobile robotics. The second part contains papers with the main theme of hybrid intelligent systems for pattern recognition and time series prediction, which are basically papers using nature-inspired techniques, like evolutionary algo...
Bogdan Mohor Dumitrita
2011-01-01
The purpose of this work is to present business intelligence systems. These systems can be extremely complex and important in modern market competition. Its effectiveness also reflects in price, so we have to exlore their financial potential before investment. The systems have 20 years long history and during that time many of such tools have been developed, but they are rarely still in use. Business intelligence system consists of three main areas: Data Warehouse, ETL tools and tools f...
Putting Emotional Intelligence To Work
Ryback, David
2012-01-01
Putting Emotional Intelligence to Work offers a new paradigm of communication for the 21st-century workplace. Beginning with the thoughts of communication pioneer Carl Rogers, this book covers the origins and history of emotional intelligence, why it is essential at this point in the changing marketplace, how to delegate and negotiate more effectively, and how to change yourself to become a more effective player. An EQ (Emotional Quotient) survey helps you determine where you are on the scale of executive intelligence. Putting Emotional Intelligence to Work leaves you with a greater understand
2017-06-09
Doctrine Publication (ADP) 2-0, Intelligence (Washington, DC: Government Printing Office, 2012), 1. 2 Scott D. Berrier, “ILE Branch Day” (Lecture, Command...Combat Intelligence (Washington, DC: Government Printing Office, 1951), 11-15. 6 groups of MI specialist teams within a larger tactical unit; allowing...Department of the Army, TOE 30- 115T, Combat Electronic Warfare Intelligence Battalion, Division (Washington, DC: Government Printing Office, 1976
Students’ logical-mathematical intelligence profile
Arum, D. P.; Kusmayadi, T. A.; Pramudya, I.
2018-04-01
One of students’ characteristics which play an important role in learning mathematics is logical-mathematical intelligence. This present study aims to identify profile of students’ logical-mathematical intelligence in general and specifically in each indicator. It is also analyzed and described based on students’ sex. This research used qualitative method with case study strategy. The subjects involve 29 students of 9th grade that were selected by purposive sampling. Data in this research involve students’ logical-mathematical intelligence result and interview. The results show that students’ logical-mathematical intelligence was identified in the moderate level with the average score is 11.17 and 51.7% students in the range of the level. In addition, the level of both male and female students are also mostly in the moderate level. On the other hand, both male and female students’ logical-mathematical intelligence is strongly influenced by the indicator of ability to classify and understand patterns and relationships. Furthermore, the ability of comparison is the weakest indicator. It seems that students’ logical-mathematical intelligence is still not optimal because more than 50% students are identified in moderate and low level. Therefore, teachers need to design a lesson that can improve students’ logical-mathematical intelligence level, both in general and on each indicator.
The foundations of plant intelligence.
Trewavas, Anthony
2017-06-06
Intelligence is defined for wild plants and its role in fitness identified. Intelligent behaviour exhibited by single cells and systems similarity between the interactome and connectome indicates neural systems are not necessary for intelligent capabilities. Plants sense and respond to many environmental signals that are assessed to competitively optimize acquisition of patchily distributed resources. Situations of choice engender motivational states in goal-directed plant behaviour; consequent intelligent decisions enable efficient gain of energy over expenditure. Comparison of swarm intelligence and plant behaviour indicates the origins of plant intelligence lie in complex communication and is exemplified by cambial control of branch function. Error correction in behaviours indicates both awareness and intention as does the ability to count to five. Volatile organic compounds are used as signals in numerous plant interactions. Being complex in composition and often species and individual specific, they may represent the plant language and account for self and alien recognition between individual plants. Game theory has been used to understand competitive and cooperative interactions between plants and microbes. Some unexpected cooperative behaviour between individuals and potential aliens has emerged. Behaviour profiting from experience, another simple definition of intelligence, requires both learning and memory and is indicated in the priming of herbivory, disease and abiotic stresses.
Dental ethics and emotional intelligence.
Rosenblum, Alvin B; Wolf, Steve
2014-01-01
Dental ethics is often taught, viewed, and conducted as an intell enterprise, uninformed by other noncognitive factors. Emotional intelligence (EQ) is defined distinguished from the cognitive intelligence measured by Intelligence Quotient (IQ). This essay recommends more inclusion of emotional, noncognitive input to the ethical decision process in dental education and dental practice.
Implications of directed energy for SETI
Lubin, Philip
2016-09-01
We compute the detectability of directed-energy (DE) sources from distant civilizations that may exist. Recent advances in our own DE technology suggest that our eventual capabilities will radically enhance our capacity to broadcast our presence and hence allow us to ponder the reverse case of detection. We show that DE systems are detectable at vast distances, possibly across the entire horizon, which profoundly alters conceivable search strategies for extra-terrestrial, technologically-advanced civilizations. Even modest searches are extremely effective at detecting or constraining many civilization classes. A single civilization anywhere in our galaxy of comparable technological advancement to our own can be detected with near unity probability with a cluster of 0.1 m telescopes on Earth. A 1 m class telescope can detect a single civilization anywhere in the Andromeda galaxy. A search strategy is proposed using small Earth-based telescopes to observe 1012-1020 stellar and planetary systems. Such observations could address whether there exist other civilizations which are broadcasting with similar or more advanced DE capability. We show that such searches have near-unity probability of detecting comparably advanced civilizations anywhere in our galaxy within a few years, assuming the civilization: (1) adopts a simple "intelligent targeting" beacon strategy; (2) is beaconing at a wavelength we can detect; (3) broadcast the beacon long enough for the light to reach Earth now. In this blind-beacon, blind-search strategy, the civilization need not know where we are nor do we need to know where they are. The same basic strategy can be extended to extragalactic distances.
Intelligence Is What the Intelligence Test Measures. Seriously
Directory of Open Access Journals (Sweden)
Han L. J. van der Maas
2014-02-01
Full Text Available The mutualism model, an alternative for the g-factor model of intelligence, implies a formative measurement model in which “g” is an index variable without a causal role. If this model is accurate, the search for a genetic of brain instantiation of “g” is deemed useless. This also implies that the (weighted sum score of items of an intelligence test is just what it is: a weighted sum score. Preference for one index above the other is a pragmatic issue that rests mainly on predictive value.
Artificial Intelligence in Civil Engineering
Directory of Open Access Journals (Sweden)
Pengzhen Lu
2012-01-01
Full Text Available Artificial intelligence is a branch of computer science, involved in the research, design, and application of intelligent computer. Traditional methods for modeling and optimizing complex structure systems require huge amounts of computing resources, and artificial-intelligence-based solutions can often provide valuable alternatives for efficiently solving problems in the civil engineering. This paper summarizes recently developed methods and theories in the developing direction for applications of artificial intelligence in civil engineering, including evolutionary computation, neural networks, fuzzy systems, expert system, reasoning, classification, and learning, as well as others like chaos theory, cuckoo search, firefly algorithm, knowledge-based engineering, and simulated annealing. The main research trends are also pointed out in the end. The paper provides an overview of the advances of artificial intelligence applied in civil engineering.
Applying Multiple Intelligences
Christodoulou, Joanna A.
2009-01-01
The ideas of multiple intelligences introduced by Howard Gardner of Harvard University more than 25 years ago have taken form in many ways, both in schools and in other sometimes-surprising settings. The silver anniversary of Gardner's learning theory provides an opportunity to reflect on the ways multiple intelligences theory has taken form and…
Principles of artificial intelligence
Nilsson, Nils J
1980-01-01
A classic introduction to artificial intelligence intended to bridge the gap between theory and practice, Principles of Artificial Intelligence describes fundamental AI ideas that underlie applications such as natural language processing, automatic programming, robotics, machine vision, automatic theorem proving, and intelligent data retrieval. Rather than focusing on the subject matter of the applications, the book is organized around general computational concepts involving the kinds of data structures used, the types of operations performed on the data structures, and the properties of th
2016-01-01
different variables. Specifically, this component consisted of a mixture of organizational, psychological , and cognitive sciences and has not been...organizational science, etc.) and a branch of terms strongly associated with cognitive science, psychology , linguistics, and artificial intelligence. We binned...blog post, n.d.; Jeffrey Goldstein , “Resource Guide and Glossary for Nonlinear/Complex Systems Terms,” PlexusInstitute.org, n.d
Directory of Open Access Journals (Sweden)
C. Seijo
2013-10-01
Full Text Available This study has for aim offer an analysis as for the brain triuno and the ethical intelligence: fundamental Counterfoil of the multifocal intelligence, taking in tells one of the theories that it sustains her like they are the different types of multiple intelligences established by Beauport and Cury (2004. The theoretical sustenance, it is based on the contents of Martin (2005, Belohlavek (2007, Galicians (2002, Beauport and Cury (2004, between others, being realized under a symbolic interpretive approach, across a qualitative methodology, type descriptive and not experimental design, by means of a documentary analysis. In this regard, it is found that the ethical intelligence is a mental mechanism that constructs the structural preconceptos and the rules of game with which an individual approaches the reality, that is to say, it is the capacity of the general formation, predicting the behavior for the achievement of aims organizacionales. As for the final considerations they focused in obtaining the most wide knowledge inside the organizations, allowing to reflect before the weaknesses that they present thinking about the brain triuno applying the multifocal intelligence, fundamental counterfoil of the ethical intelligence and of what way the rationing visualizes the strengths, nevertheless of the weaknesses that they present.
Assessing Cognitive Abilities: Intelligence and More
Directory of Open Access Journals (Sweden)
Keith E. Stanovich
2014-02-01
Full Text Available In modern cognitive science, rationality and intelligence are measured using different tasks and operations. Furthermore, in several contemporary dual process theories of cognition, rationality is a more encompassing construct than intelligence. Researchers need to continue to develop measures of rational thought without regard to empirical correlations with intelligence. The measurement of individual differences in rationality should not be subsumed by the intelligence concept.
Badica, Costin; Malgeri, Michele; Unland, Rainer
2013-01-01
This book represents the combined peer-reviewed proceedings of the Sixth International Symposium on Intelligent Distributed Computing -- IDC~2012, of the International Workshop on Agents for Cloud -- A4C~2012 and of the Fourth International Workshop on Multi-Agent Systems Technology and Semantics -- MASTS~2012. All the events were held in Calabria, Italy during September 24-26, 2012. The 37 contributions published in this book address many topics related to theory and applications of intelligent distributed computing and multi-agent systems, including: adaptive and autonomous distributed systems, agent programming, ambient assisted living systems, business process modeling and verification, cloud computing, coalition formation, decision support systems, distributed optimization and constraint satisfaction, gesture recognition, intelligent energy management in WSNs, intelligent logistics, machine learning, mobile agents, parallel and distributed computational intelligence, parallel evolutionary computing, trus...
New Perspectives on Intelligence Collection and Processing
2016-06-01
MASINT Measurement and Signature Intelligence NPS Naval Postgraduate School OSINT Open Source Intelligence pdf Probability Density Function SIGINT...MASINT): different types of sensors • Open Source Intelligence ( OSINT ): from all open sources • Signals Intelligence (SIGINT): intercepting the
Intelligence-Augmented Rat Cyborgs in Maze Solving.
Directory of Open Access Journals (Sweden)
Yipeng Yu
Full Text Available Cyborg intelligence is an emerging kind of intelligence paradigm. It aims to deeply integrate machine intelligence with biological intelligence by connecting machines and living beings via neural interfaces, enhancing strength by combining the biological cognition capability with the machine computational capability. Cyborg intelligence is considered to be a new way to augment living beings with machine intelligence. In this paper, we build rat cyborgs to demonstrate how they can expedite the maze escape task with integration of machine intelligence. We compare the performance of maze solving by computer, by individual rats, and by computer-aided rats (i.e. rat cyborgs. They were asked to find their way from a constant entrance to a constant exit in fourteen diverse mazes. Performance of maze solving was measured by steps, coverage rates, and time spent. The experimental results with six rats and their intelligence-augmented rat cyborgs show that rat cyborgs have the best performance in escaping from mazes. These results provide a proof-of-principle demonstration for cyborg intelligence. In addition, our novel cyborg intelligent system (rat cyborg has great potential in various applications, such as search and rescue in complex terrains.
Intelligence-Augmented Rat Cyborgs in Maze Solving.
Yu, Yipeng; Pan, Gang; Gong, Yongyue; Xu, Kedi; Zheng, Nenggan; Hua, Weidong; Zheng, Xiaoxiang; Wu, Zhaohui
2016-01-01
Cyborg intelligence is an emerging kind of intelligence paradigm. It aims to deeply integrate machine intelligence with biological intelligence by connecting machines and living beings via neural interfaces, enhancing strength by combining the biological cognition capability with the machine computational capability. Cyborg intelligence is considered to be a new way to augment living beings with machine intelligence. In this paper, we build rat cyborgs to demonstrate how they can expedite the maze escape task with integration of machine intelligence. We compare the performance of maze solving by computer, by individual rats, and by computer-aided rats (i.e. rat cyborgs). They were asked to find their way from a constant entrance to a constant exit in fourteen diverse mazes. Performance of maze solving was measured by steps, coverage rates, and time spent. The experimental results with six rats and their intelligence-augmented rat cyborgs show that rat cyborgs have the best performance in escaping from mazes. These results provide a proof-of-principle demonstration for cyborg intelligence. In addition, our novel cyborg intelligent system (rat cyborg) has great potential in various applications, such as search and rescue in complex terrains.
Reliability and validity of the new Tanaka B Intelligence Scale scores: a group intelligence test.
Directory of Open Access Journals (Sweden)
Yota Uno
Full Text Available OBJECTIVE: The present study evaluated the reliability and concurrent validity of the new Tanaka B Intelligence Scale, which is an intelligence test that can be administered on groups within a short period of time. METHODS: The new Tanaka B Intelligence Scale and Wechsler Intelligence Scale for Children-Third Edition were administered to 81 subjects (mean age ± SD 15.2 ± 0.7 years residing in a juvenile detention home; reliability was assessed using Cronbach's alpha coefficient, and concurrent validity was assessed using the one-way analysis of variance intraclass correlation coefficient. Moreover, receiver operating characteristic analysis for screening for individuals who have a deficit in intellectual function (an FIQ<70 was performed. In addition, stratum-specific likelihood ratios for detection of intellectual disability were calculated. RESULTS: The Cronbach's alpha for the new Tanaka B Intelligence Scale IQ (BIQ was 0.86, and the intraclass correlation coefficient with FIQ was 0.83. Receiver operating characteristic analysis demonstrated an area under the curve of 0.89 (95% CI: 0.85-0.96. In addition, the stratum-specific likelihood ratio for the BIQ≤65 stratum was 13.8 (95% CI: 3.9-48.9, and the stratum-specific likelihood ratio for the BIQ≥76 stratum was 0.1 (95% CI: 0.03-0.4. Thus, intellectual disability could be ruled out or determined. CONCLUSION: The present results demonstrated that the new Tanaka B Intelligence Scale score had high reliability and concurrent validity with the Wechsler Intelligence Scale for Children-Third Edition score. Moreover, the post-test probability for the BIQ could be calculated when screening for individuals who have a deficit in intellectual function. The new Tanaka B Intelligence Test is convenient and can be administered within a variety of settings. This enables evaluation of intellectual development even in settings where performing intelligence tests have previously been difficult.
International Conference on Computational Intelligence 2015
Saha, Sujan
2017-01-01
This volume comprises the proceedings of the International Conference on Computational Intelligence 2015 (ICCI15). This book aims to bring together work from leading academicians, scientists, researchers and research scholars from across the globe on all aspects of computational intelligence. The work is composed mainly of original and unpublished results of conceptual, constructive, empirical, experimental, or theoretical work in all areas of computational intelligence. Specifically, the major topics covered include classical computational intelligence models and artificial intelligence, neural networks and deep learning, evolutionary swarm and particle algorithms, hybrid systems optimization, constraint programming, human-machine interaction, computational intelligence for the web analytics, robotics, computational neurosciences, neurodynamics, bioinspired and biomorphic algorithms, cross disciplinary topics and applications. The contents of this volume will be of use to researchers and professionals alike....
Digital power - Electricity gets intelligent; Digitalstrom - Strom wird intelligent
Energy Technology Data Exchange (ETDEWEB)
Lieberherr, M.; Staub, R.
2007-07-01
This article takes a look at the setting up of the 'Viagialla' digital power alliance on the 7{sup th} of July 2007 at the Swiss Federal Institute of Technology in Zurich, Switzerland. The name 'Viagialla' is derived from the Italian for 'the yellow way'. The idea behind the project - to encourage the work of young students on machines and new developments - is discussed. The alliance encourages the use of energy forms that are available in great abundance such as solar energy and wind, thus preventing the so-called 'power-gap' and making the construction of new nuclear power stations unnecessary. The name 'digital power' refers to a new method of transmitting data over power lines on the basis of a new microchip controller. This chip can even be placed in small terminal blocks thus allowing electrical apparatus to communicate with switches and other devices. In this way, the apparatus can be remotely controlled. The developers of the system hope that their system will enable 'intelligent living' and intercommunication between normal domestic devices. External communication over the Internet is also foreseen.
Intelligent Design and Intelligent Failure
Jerman, Gregory
2015-01-01
Good Evening, my name is Greg Jerman and for nearly a quarter century I have been performing failure analysis on NASA's aerospace hardware. During that time I had the distinct privilege of keeping the Space Shuttle flying for two thirds of its history. I have analyzed a wide variety of failed hardware from simple electrical cables to cryogenic fuel tanks to high temperature turbine blades. During this time I have found that for all the time we spend intelligently designing things, we need to be equally intelligent about understanding why things fail. The NASA Flight Director for Apollo 13, Gene Kranz, is best known for the expression "Failure is not an option." However, NASA history is filled with failures both large and small, so it might be more accurate to say failure is inevitable. It is how we react and learn from our failures that makes the difference.
Intelligent Control Wheelchair Using a New Visual Joystick
Directory of Open Access Journals (Sweden)
Yassine Rabhi
2018-01-01
Full Text Available A new control system of a hand gesture-controlled wheelchair (EWC is proposed. This smart control device is suitable for a large number of patients who cannot manipulate a standard joystick wheelchair. The movement control system uses a camera fixed on the wheelchair. The patient’s hand movements are recognized using a visual recognition algorithm and artificial intelligence software; the derived corresponding signals are thus used to control the EWC in real time. One of the main features of this control technique is that it allows the patient to drive the wheelchair with a variable speed similar to that of a standard joystick. The designed device “hand gesture-controlled wheelchair” is performed at low cost and has been tested on real patients and exhibits good results. Before testing the proposed control device, we have created a three-dimensional environment simulator to test its performances with extreme security. These tests were performed on real patients with diverse hand pathologies in Mohamed Kassab National Institute of Orthopedics, Physical and Functional Rehabilitation Hospital of Tunis, and the validity of this intelligent control system had been proved.
Algorithms in ambient intelligence
Aarts, E.H.L.; Korst, J.H.M.; Verhaegh, W.F.J.; Verhaegh, W.F.J.; Aarts, E.H.L.; Korst, J.H.M.
2004-01-01
In this chapter, we discuss the new paradigm for user-centered computing known as ambient intelligence and its relation with methods and techniques from the field of computational intelligence, including problem solving, machine learning, and expert systems.
Neuronal factors determining high intelligence.
Dicke, Ursula; Roth, Gerhard
2016-01-05
Many attempts have been made to correlate degrees of both animal and human intelligence with brain properties. With respect to mammals, a much-discussed trait concerns absolute and relative brain size, either uncorrected or corrected for body size. However, the correlation of both with degrees of intelligence yields large inconsistencies, because although they are regarded as the most intelligent mammals, monkeys and apes, including humans, have neither the absolutely nor the relatively largest brains. The best fit between brain traits and degrees of intelligence among mammals is reached by a combination of the number of cortical neurons, neuron packing density, interneuronal distance and axonal conduction velocity--factors that determine general information processing capacity (IPC), as reflected by general intelligence. The highest IPC is found in humans, followed by the great apes, Old World and New World monkeys. The IPC of cetaceans and elephants is much lower because of a thin cortex, low neuron packing density and low axonal conduction velocity. By contrast, corvid and psittacid birds have very small and densely packed pallial neurons and relatively many neurons, which, despite very small brain volumes, might explain their high intelligence. The evolution of a syntactical and grammatical language in humans most probably has served as an additional intelligence amplifier, which may have happened in songbirds and psittacids in a convergent manner. © 2015 The Author(s).
中島, 正世; Nakajima, Masayo
2015-01-01
In this paper, the author have revealed the transition about the concept of emotional intelligence from overseas literature, and have tried to clarify the subject to the definition of emotional intelligence, the difference from similar concepts, the measuring method of emotional intelligence, the related element of emotional intelligence, and emotional intelligence training for the man-power development to current adolescence. As a result, the base element which constitutes emotional intellig...
10th International Symposium on Intelligent Distributed Computing
Seghrouchni, Amal; Beynier, Aurélie; Camacho, David; Herpson, Cédric; Hindriks, Koen; Novais, Paulo
2017-01-01
This book presents the combined peer-reviewed proceedings of the tenth International Symposium on Intelligent Distributed Computing (IDC’2016), which was held in Paris, France from October 10th to 12th, 2016. The 23 contributions address a range of topics related to theory and application of intelligent distributed computing, including: Intelligent Distributed Agent-Based Systems, Ambient Intelligence and Social Networks, Computational Sustainability, Intelligent Distributed Knowledge Representation and Processing, Smart Networks, Networked Intelligence and Intelligent Distributed Applications, amongst others.
P300 correlates with learning & memory abilities and fluid intelligence.
Amin, Hafeez Ullah; Malik, Aamir Saeed; Kamel, Nidal; Chooi, Weng-Tink; Hussain, Muhammad
2015-09-23
Educational psychology research has linked fluid intelligence with learning and memory abilities and neuroimaging studies have specifically associated fluid intelligence with event related potentials (ERPs). The objective of this study is to find the relationship of ERPs with learning and memory recall and predict the memory recall score using P300 (P3) component. A sample of thirty-four healthy subjects between twenty and thirty years of age was selected to perform three tasks: (1) Raven's Advanced Progressive Matrices (RAPM) test to assess fluid intelligence; (2) learning and memory task to assess learning ability and memory recall; and (3) the visual oddball task to assess brain-evoked potentials. These subjects were divided into High Ability (HA) and Low Ability (LA) groups based on their RAPM scores. A multiple regression analysis was used to predict the learning & memory recall and fluid intelligence using P3 amplitude and latency. Behavioral results demonstrated that the HA group learned and recalled 10.89 % more information than did the LA group. ERP results clearly showed that the P3 amplitude of the HA group was relatively larger than that observed in the LA group for both the central and parietal regions of the cerebrum; particularly during the 300-400 ms time window. In addition, a shorter latency for the P3 component was observed at Pz site for the HA group compared to the LA group. These findings agree with previous educational psychology and neuroimaging studies which reported an association between ERPs and fluid intelligence as well as learning performance. These results also suggest that the P3 component is associated with individual differences in learning and memory recall and further indicate that P3 amplitude might be used as a supporting factor in standard psychometric tests to assess an individual's learning & memory recall ability; particularly in educational institutions to aid in the predictability of academic skills.
Social Representations of Intelligence
Directory of Open Access Journals (Sweden)
Elena Zubieta
2016-02-01
Full Text Available The article stresses the relationship between Explicit and Implicit theories of Intelligence. Following the line of common sense epistemology and the theory of Social Representations, a study was carried out in order to analyze naive’s explanations about Intelligence Definitions. Based on Mugny & Carugati (1989 research, a self-administered questionnaire was designed and filled in by 286 subjects. Results are congruent with the main hyphotesis postulated: A general overlap between explicit and implicit theories showed up. According to the results Intelligence appears as both, a social attribute related to social adaptation and as a concept defined in relation with contextual variables similar to expert’s current discourses. Nevertheless, conceptions based on “gifted ideology” still are present stressing the main axes of Intelligence debate: biological and sociological determinism. In the same sense, unfamiliarity and social identity are reaffirmed as organizing principles of social representation. The distance with the object -measured as the belief in intelligence differences as a solve/non solve problem- and the level of implication with the topic -teachers/no teachers- appear as discriminating elements at the moment of supporting specific dimensions.
International Nuclear Information System (INIS)
Perret-Galix, D.
1992-01-01
A vivid example of the growing need for frontier physics experiments to make use of frontier technology is in the field of artificial intelligence and related themes. This was reflected in the second international workshop on 'Software Engineering, Artificial Intelligence and Expert Systems in High Energy and Nuclear Physics' which took place from 13-18 January at France Telecom's Agelonde site at La Londe des Maures, Provence. It was the second in a series, the first having been held at Lyon in 1990
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-01-16
Executive Order 12333, {open_quotes}United States Intelligence Activities,{close_quotes} (1) designates the Department`s intelligence element as a member of the Intelligence Community, and (2) states that no agency within the Intelligence community shall sponsor, contract for or conduct research on human subjects except in accordance with guidelines issued by the Department of Health and Human Services. The Federal policy for the Protection of Human Subjects, which was based on Department of Health and Human Services regulations, was promulgated in Title 10 Code of Federal Regulations Part 745 by the Department of Energy. The purpose of this inspection was to review the internal control procedures used by the Office of Nonproliferation and National Security to manage selected intelligence and intelligence-related projects that involve human subject research.
Li, Tianrui
2012-01-01
Proceedings of The Sixth International Conference on Intelligent System and Knowledge Engineering presents selected papers from the conference ISKE 2011, held December 15-17 in Shanghai, China. This proceedings doesn’t only examine original research and approaches in the broad areas of intelligent systems and knowledge engineering, but also present new methodologies and practices in intelligent computing paradigms. The book introduces the current scientific and technical advances in the fields of artificial intelligence, machine learning, pattern recognition, data mining, information retrieval, knowledge-based systems, knowledge representation and reasoning, multi-agent systems, natural-language processing, etc. Furthermore, new computing methodologies are presented, including cloud computing, service computing and pervasive computing with traditional intelligent methods. The proceedings will be beneficial for both researchers and practitioners who want to utilize intelligent methods in their specific res...
Quo vadis, Intelligent Machine?
Directory of Open Access Journals (Sweden)
Rosemarie Velik
2010-09-01
Full Text Available Artificial Intelligence (AI is a branch of computer science concerned with making computers behave like humans. At least this was the original idea. However, it turned out that this is no task easy to be solved. This article aims to give a comprehensible review on the last 60 years of artificial intelligence taking a philosophical viewpoint. It is outlined what happened so far in AI, what is currently going on in this research area, and what can be expected in future. The goal is to mediate an understanding for the developments and changes in thinking in course of time about how to achieve machine intelligence. The clear message is that AI has to join forces with neuroscience and other brain disciplines in order to make a step towards the development of truly intelligent machines.
Becker, Lee A.
1987-01-01
Presents and develops a general model of the nature of a learning system and a classification for learning systems. Highlights include the relationship between artificial intelligence and cognitive psychology; computer-based instructional systems; intelligent instructional systems; and the role of the learner's knowledge base in an intelligent…
Orak, Roohangiz Jamshidi; Farahani, Mansoureh Ashghali; Kelishami, Fatemeh Ghofrani; Seyedfatemi, Naima; Banihashemi, Sara; Havaei, Farinaz
2016-09-01
Nursing students, particularly at the time of entering clinical education, experience a great deal of stress and emotion typically related to their educational and clinical competence. Emotional intelligence is known to be one of the required skills to effectively cope with such feelings. The aim of this study was to investigate the effect of training on first-year nursing students' levels of emotional intelligence. This was a quasi-experiment study in which 69 first-year nursing students affiliated with Tehran University of Medical Sciences were assigned to either the control or the experimental groups. The study intervention included of an emotional intelligence educational program offered in eight two-hour sessions for eight subsequent weeks. In total, 66 students completed the study. The study groups did not differ significantly in terms of emotional intelligence scores before and after educational program. Although the educational program did not have an effect on students' emotional intelligence scores, this study finding can be explained. Limited time for exercising the acquired knowledge and skills may explain the non-significant findings. Moreover, our participants were exclusively first-year students who had no clinical experience and hence, might have felt no real need to learn emotional intelligence skills. Copyright © 2016 Elsevier Ltd. All rights reserved.
Li, Tianrui; Li, Hongbo
2014-01-01
These proceedings present technical papers selected from the 2012 International Conference on Intelligent Systems and Knowledge Engineering (ISKE 2012), held on December 15-17 in Beijing. The aim of this conference is to bring together experts from different fields of expertise to discuss the state-of-the-art in Intelligent Systems and Knowledge Engineering, and to present new findings and perspectives on future developments. The proceedings introduce current scientific and technical advances in the fields of artificial intelligence, machine learning, pattern recognition, data mining, knowledge engineering, information retrieval, information theory, knowledge-based systems, knowledge representation and reasoning, multi-agent systems, and natural-language processing, etc. Furthermore they include papers on new intelligent computing paradigms, which combine new computing methodologies, e.g., cloud computing, service computing and pervasive computing with traditional intelligent methods. By presenting new method...
Intelligent distributed computing
Thampi, Sabu
2015-01-01
This book contains a selection of refereed and revised papers of the Intelligent Distributed Computing Track originally presented at the third International Symposium on Intelligent Informatics (ISI-2014), September 24-27, 2014, Delhi, India. The papers selected for this Track cover several Distributed Computing and related topics including Peer-to-Peer Networks, Cloud Computing, Mobile Clouds, Wireless Sensor Networks, and their applications.
Model Pembelajaran Berbasis Penstimulasian Multiple Intelligences Siswa
Directory of Open Access Journals (Sweden)
Edy Legowo
2017-03-01
Full Text Available Tulisan ini membahas mengenai penerapan teori multiple intelligences dalam pembelajaran di sekolah. Pembahasan diawali dengan menguraikan perkembangan konsep inteligensi dan multiple intelligences. Diikuti dengan menjelaskan dampak teori multiple intelligences dalam bidang pendidikan dan pembelajaran di sekolah. Bagian selanjutnya menguraikan tentang implementasi teori multiple intelligences dalam praktik pembelajaran di kelas yaitu bagaimana pemberian pengalaman belajar siswa yang difasilitasi guru dapat menstimulasi multiple intelligences siswa. Evaluasi hasil belajar siswa dari pandangan penerapan teori multiple intelligences seharusnya dilakukan menggunakan authentic assessment dan portofolio yang lebih memfasilitasi para siswa mengungkapkan atau mengaktualisasikan hasil belajarnya melalui berbagai cara sesuai dengan kekuatan jenis inteligensinya.
ECONOMIC INTELLIGENCE - THEORETICAL AND PRACTICAL ASPECTS
Directory of Open Access Journals (Sweden)
VIRGIL - ION POPOVICI
2014-12-01
Full Text Available Economic Intelligence (EI may be a solution in knowledge management as involves collecting, evaluating, processing, analysis and dissemination of economic data within organizations. The ultimate goal of economic intelligence (EI is to take advantage of this opportunity to develop and improve methods for identifying relevant information sources, analysis of information collected and manipulation, to give the user all the necessary decisions. Scope of the Economic Intelligence focused on information available outside the organization, covering wide areas from technology to market or legal issues. Economic Intelligence (EI is closely related to other approaches to information management, and knowledge management and business intelligence, excelling in the use of software tools.
Intelligibility of clear speech: effect of instruction.
Lam, Jennifer; Tjaden, Kris
2013-10-01
The authors investigated how clear speech instructions influence sentence intelligibility. Twelve speakers produced sentences in habitual, clear, hearing impaired, and overenunciate conditions. Stimuli were amplitude normalized and mixed with multitalker babble for orthographic transcription by 40 listeners. The main analysis investigated percentage-correct intelligibility scores as a function of the 4 conditions and speaker sex. Additional analyses included listener response variability, individual speaker trends, and an alternate intelligibility measure: proportion of content words correct. Relative to the habitual condition, the overenunciate condition was associated with the greatest intelligibility benefit, followed by the hearing impaired and clear conditions. Ten speakers followed this trend. The results indicated different patterns of clear speech benefit for male and female speakers. Greater listener variability was observed for speakers with inherently low habitual intelligibility compared to speakers with inherently high habitual intelligibility. Stable proportions of content words were observed across conditions. Clear speech instructions affected the magnitude of the intelligibility benefit. The instruction to overenunciate may be most effective in clear speech training programs. The findings may help explain the range of clear speech intelligibility benefit previously reported. Listener variability analyses suggested the importance of obtaining multiple listener judgments of intelligibility, especially for speakers with inherently low habitual intelligibility.
Emotional Intelligence in medical practice
Directory of Open Access Journals (Sweden)
Abu Hasan Sarkar
2016-08-01
Full Text Available Emotional Intelligence is the ability to perceive, express, understand and regulate one’s inner emotions and the emotions of others. It is considered to be a ‘must have’ competence in the workplace. Several scientific studies have proven that the application of emotional intelligence is effective in improving the teaching-learning process and that it leads to organizational growth; however, only limited work has been carried out to assess its effectiveness in the practice of medicine, especially in India. Various scales have been developed to measure emotional intelligence but they are not universally applicable because emotional intelligence depends upon culture and personal background among other factors. In recent years in India, conflicts between patients and doctors have had serious, sometimes fatal, consequences for the physician. Behavior, when faced with a potential conflict-like situation, depends to a great extent on the emotional intelligence of the physician. Emotional intelligence of medical students and medical professionals can be honed through exposure to the medical humanities which are known to promote patient-centered care. Building better physician-patient relationships might help in averting doctor-patient conflict.
Fire auto alarm system intelligent trend
International Nuclear Information System (INIS)
Du Chengbao
1997-01-01
The author gives the course and trend of the fire alarm system going to more computerized and more intelligent. It is described that only the system applied artificial intelligent and confusion control is the true intelligent fire alarm system. The author gives the detailed analysis on the signal treatment of artificial intelligent applied to analogue fire alarm system as well as the alarm system controlled by confusion technology and artificial nervous net
Economic intelligence of the modern state
Levytskyi, Valentyn
2001-01-01
The goal of the thesis is to explore economic intelligence. The work includes the analysis of open sources. Tile approach to the issue of economic intelligence is based on the analysis of the state's economic security. The research presents the views of politicians, intelligence professionals, and scientists. It proposes possible objectives and missions of economic intelligence. Additionally, the research investigates the usefulness and reliability of open sources of economic analysis. The se...
Batey, Mark; Chamorro-Premuzic, Tomas; Furnham, Adrian
2009-01-01
Two studies examined the relationships between measures of intelligence, personality and divergent thinking (DT) in student samples. Study one investigated the incremental validity of measures of IQ and fluid intelligence with the Big Five Personality Inventory with regards to DT. Significant relationships of DT to fluid intelligence, Extraversion…
Affective Computing and Intelligent Interaction
2012-01-01
2012 International Conference on Affective Computing and Intelligent Interaction (ICACII 2012) was the most comprehensive conference focused on the various aspects of advances in Affective Computing and Intelligent Interaction. The conference provided a rare opportunity to bring together worldwide academic researchers and practitioners for exchanging the latest developments and applications in this field such as Intelligent Computing, Affective Computing, Machine Learning, Business Intelligence and HCI. This volume is a collection of 119 papers selected from 410 submissions from universities and industries all over the world, based on their quality and relevancy to the conference. All of the papers have been peer-reviewed by selected experts.
Artificial Intelligence in Civil Engineering
Lu, Pengzhen; Chen, Shengyong; Zheng, Yujun
2012-01-01
Artificial intelligence is a branch of computer science, involved in the research, design, and application of intelligent computer. Traditional methods for modeling and optimizing complex structure systems require huge amounts of computing resources, and artificial-intelligence-based solutions can often provide valuable alternatives for efficiently solving problems in the civil engineering. This paper summarizes recently developed methods and theories in the developing direction for applicati...
Krech, M; Probst, P
1998-10-01
The paper is concerned with personal theories of health care professionals about deficiencies in social intelligence of autistic persons. In the component-model of social intelligence means the ability of individuals or groups, to interact with each other in social situations. This contains social perception, social behavior as well as social conceptions and refers to emotional, cognitive and normative aspects. 33 interviewees, working as psychologists or teachers in kindergartens, schools or therapy institutions, are questioned by a half-standardized single interview concerning their beliefs about nonverbal social abilities, social perspective taking, and construction of a theory of mind in autistic persons. The major finding is: The impairments can be found in all aspects of social intelligence. Especially emotional handicaps, which are quoted by more than 80% of the interviewees, and low cognitive preconditions of mastering social stimuli, which are quoted by nearly all interviewees, are relevant. The subjective theories of the interviewees are in accordance to the models of parents as well as the models of the leading experts. The professional relationship to autistic persons and the practical experiences of the health care professionals lead to their specific personal theories of deficiencies in social intelligence of autistic people with wide consequences in respect to the professional contact with the autistic children and young adults.
Irwin, J David
2011-01-01
Technology has now progressed to the point that intelligent systems are replacing humans in the decision making processes as well as aiding in the solution of very complex problems. In many cases intelligent systems are already outperforming human activities. Artificial neural networks are not only capable of learning how to classify patterns, such images or sequence of events, but they can also effectively model complex nonlinear systems. Their ability to classify sequences of events is probably more popular in industrial applications where there is an inherent need to model nonlinear system
Energy Technology Data Exchange (ETDEWEB)
Hoyle, F
1983-01-01
The subject is covered in chapters, entitled: chance and the universe (synthesis of proteins; the primordial soup); the gospel according to Darwin (discussion of Darwin theory of evolution); life did not originate on earth (fossils from space; life in space); the interstellar connection (living dust between the stars; bacteria in space falling to the earth; interplanetary dust); evolution by cosmic control (microorganisms; genetics); why aren't the others here (a cosmic origin of life); after the big bang (big bang and steady state); the information rich universe; what is intelligence up to; the intelligent universe.
Directory of Open Access Journals (Sweden)
Eija Kaasinen
2012-12-01
Full Text Available Our everyday environments are gradually becoming intelligent, facilitated both by technological development and user activities. Although large-scale intelligent environments are still rare in actual everyday use, they have been studied for quite a long time, and several user studies have been carried out. In this paper, we present a user-centric view of intelligent environments based on published research results and our own experiences from user studies with concepts and prototypes. We analyze user acceptance and users’ expectations that affect users’ willingness to start using intelligent environments and to continue using them. We discuss user experience of interacting with intelligent environments where physical and virtual elements are intertwined. Finally, we touch on the role of users in shaping their own intelligent environments instead of just using ready-made environments. People are not merely “using” the intelligent environments but they live in them, and they experience the environments via embedded services and new interaction tools as well as the physical and social environment. Intelligent environments should provide emotional as well as instrumental value to the people who live in them, and the environments should be trustworthy and controllable both by regular users and occasional visitors. Understanding user expectations and user experience in intelligent environments, and providing users with tools to influence the environments can help to shape the vision of intelligent environments into meaningful, acceptable and appealing service entities for all those who live and act in them.
Extraordinary intelligence and the care of infants
Piantadosi, Steven T.; Kidd, Celeste
2016-01-01
We present evidence that pressures for early childcare may have been one of the driving factors of human evolution. We show through an evolutionary model that runaway selection for high intelligence may occur when (i) altricial neonates require intelligent parents, (ii) intelligent parents must have large brains, and (iii) large brains necessitate having even more altricial offspring. We test a prediction of this account by showing across primate genera that the helplessness of infants is a particularly strong predictor of the adults’ intelligence. We discuss related implications, including this account’s ability to explain why human-level intelligence evolved specifically in mammals. This theory complements prior hypotheses that link human intelligence to social reasoning and reproductive pressures and explains how human intelligence may have become so distinctive compared with our closest evolutionary relatives. PMID:27217560
Selvi, Sezgin; Demir, Selçuk Besir
2017-01-01
This qualitative study was conducted to compare the perceptions of students with gifted intelligence and students with those of normal intelligence about social science and social scientists. The data obtained from 23 gifted intelligent and 23 normal participants within the same age group was analysed using content analysis and results were…
Reliability and validity of the new Tanaka B Intelligence Scale scores: a group intelligence test.
Uno, Yota; Mizukami, Hitomi; Ando, Masahiko; Yukihiro, Ryoji; Iwasaki, Yoko; Ozaki, Norio
2014-01-01
The present study evaluated the reliability and concurrent validity of the new Tanaka B Intelligence Scale, which is an intelligence test that can be administered on groups within a short period of time. The new Tanaka B Intelligence Scale and Wechsler Intelligence Scale for Children-Third Edition were administered to 81 subjects (mean age ± SD 15.2 ± 0.7 years) residing in a juvenile detention home; reliability was assessed using Cronbach's alpha coefficient, and concurrent validity was assessed using the one-way analysis of variance intraclass correlation coefficient. Moreover, receiver operating characteristic analysis for screening for individuals who have a deficit in intellectual function (an FIQIntelligence Scale IQ (BIQ) was 0.86, and the intraclass correlation coefficient with FIQ was 0.83. Receiver operating characteristic analysis demonstrated an area under the curve of 0.89 (95% CI: 0.85-0.96). In addition, the stratum-specific likelihood ratio for the BIQ≤65 stratum was 13.8 (95% CI: 3.9-48.9), and the stratum-specific likelihood ratio for the BIQ≥76 stratum was 0.1 (95% CI: 0.03-0.4). Thus, intellectual disability could be ruled out or determined. The present results demonstrated that the new Tanaka B Intelligence Scale score had high reliability and concurrent validity with the Wechsler Intelligence Scale for Children-Third Edition score. Moreover, the post-test probability for the BIQ could be calculated when screening for individuals who have a deficit in intellectual function. The new Tanaka B Intelligence Test is convenient and can be administered within a variety of settings. This enables evaluation of intellectual development even in settings where performing intelligence tests have previously been difficult.
Multiple Intelligences in Action.
Campbell, Bruce
1992-01-01
Describes the investigation of the effects of a four-step model program used with third through fifth grade students to implement Gardener's concepts of seven human intelligences--linguistic, logical/mathematical, visual/spatial, musical, kinesthetic, intrapersonal, and interpersonal intelligence--into daily learning. (BB)
Intelligence and treaty ratification
International Nuclear Information System (INIS)
Cahn, A.H.
1990-01-01
This paper reports that there are two sets of questions applicable to the ratification phase: what is the role of intelligence in the ratification process? What effect did intelligence have on that process. The author attempts to answer these and other questions
MacCann, Carolyn; Joseph, Dana L; Newman, Daniel A; Roberts, Richard D
2014-04-01
This article examines the status of emotional intelligence (EI) within the structure of human cognitive abilities. To evaluate whether EI is a 2nd-stratum factor of intelligence, data were fit to a series of structural models involving 3 indicators each for fluid intelligence, crystallized intelligence, quantitative reasoning, visual processing, and broad retrieval ability, as well as 2 indicators each for emotion perception, emotion understanding, and emotion management. Unidimensional, multidimensional, hierarchical, and bifactor solutions were estimated in a sample of 688 college and community college students. Results suggest adequate fit for 2 models: (a) an oblique 8-factor model (with 5 traditional cognitive ability factors and 3 EI factors) and (b) a hierarchical solution (with cognitive g at the highest level and EI representing a 2nd-stratum factor that loads onto g at λ = .80). The acceptable relative fit of the hierarchical model confirms the notion that EI is a group factor of cognitive ability, marking the expression of intelligence in the emotion domain. The discussion proposes a possible expansion of Cattell-Horn-Carroll theory to include EI as a 2nd-stratum factor of similar standing to factors such as fluid intelligence and visual processing.
The Role of Intelligence in Social Learning.
Vostroknutov, Alexander; Polonio, Luca; Coricelli, Giorgio
2018-05-02
Studies in cultural evolution have uncovered many types of social learning strategies that are adaptive in certain environments. The efficiency of these strategies also depends on the individual characteristics of both the observer and the demonstrator. We investigate the relationship between intelligence and the ways social and individual information is utilised to make decisions in an uncertain environment. We measure fluid intelligence and study experimentally how individuals learn from observing the choices of a demonstrator in a 2-armed bandit problem with changing probabilities of a reward. Participants observe a demonstrator with high or low fluid intelligence. In some treatments they are aware of the intelligence score of the demonstrator and in others they are not. Low fluid intelligence individuals imitate the demonstrator more when her fluid intelligence is known than when it is not. Conversely, individuals with high fluid intelligence adjust their use of social information, as the observed behaviour changes, independently of the knowledge of the intelligence of the demonstrator. We provide evidence that intelligence determines how social and individual information is integrated in order to make choices in a changing uncertain environment.
Understanding US National Intelligence
DEFF Research Database (Denmark)
Leander, Anna
2014-01-01
In July 2010, the Washington Post (WP) published the results of a project on “Top Secret America” on which twenty investigative journalists had been working for two years. The project drew attention to the change and growth in National Intelligence following 9/11 (Washington Post 2010a......). The initial idea had been to work on intelligence generally, but given that this proved overwhelming, the team narrowed down to focus only on intelligence qualified as “top secret.” Even so, the growth in this intelligence activity is remarkable. This public is returning, or in this case expanding...... at an impressive speed confirming the general contention of this volume. Between 2001 and 2010 the budget had increased by 250 percent, reaching $75 billion (the GDP of the Czech Republic). Thirty-three building complexes for top secret work had been or were under construction in the Washington area; 1...
Handbook of Intelligent Vehicles
2012-01-01
The Handbook of Intelligent Vehicles provides a complete coverage of the fundamentals, new technologies, and sub-areas essential to the development of intelligent vehicles; it also includes advances made to date, challenges, and future trends. Significant strides in the field have been made to date; however, so far there has been no single book or volume which captures these advances in a comprehensive format, addressing all essential components and subspecialties of intelligent vehicles, as this book does. Since the intended users are engineering practitioners, as well as researchers and graduate students, the book chapters do not only cover fundamentals, methods, and algorithms but also include how software/hardware are implemented, and demonstrate the advances along with their present challenges. Research at both component and systems levels are required to advance the functionality of intelligent vehicles. This volume covers both of these aspects in addition to the fundamentals listed above.
Education for All: Gardner's Multiple Intelligences Theory
Directory of Open Access Journals (Sweden)
Gisela Emst-Slavit
2001-12-01
Full Text Available In the last years the Theory of the Multiple Intelligences developed by Howard Gardner has had a tremendous impact in elementary and secondary classrooms in the United States. Gardner(1983 defines intelligence as the ability to solve a problem or fashion a product that is valued in one or more cultural settings. His definition expands our understanding of "intelligence" beyond the familiar linguistic and Logical-mathematical intelligences, to include the spatial, musical,bodily-kinesthetic, naturalist. interpersonal, and intrapersonal intelligences. This new wayof conceptualizing human intelligence has profound implications for educators whose task needs to include the identification and nourishment of the different talents brought by al students.
Intelligent Systems For Aerospace Engineering: An Overview
KrishnaKumar, K.
2003-01-01
Intelligent systems are nature-inspired, mathematically sound, computationally intensive problem solving tools and methodologies that have become extremely important for advancing the current trends in information technology. Artificially intelligent systems currently utilize computers to emulate various faculties of human intelligence and biological metaphors. They use a combination of symbolic and sub-symbolic systems capable of evolving human cognitive skills and intelligence, not just systems capable of doing things humans do not do well. Intelligent systems are ideally suited for tasks such as search and optimization, pattern recognition and matching, planning, uncertainty management, control, and adaptation. In this paper, the intelligent system technologies and their application potential are highlighted via several examples.
Identifying the Multiple Intelligences of Your Students
McClellan, Joyce A.; Conti, Gary J.
2008-01-01
One way of addressing individual differences among adult learners is to identify the Multiple Intelligences of the learner. Multiple Intelligences refers to the concept developed by Howard Gardner that challenges the traditional view of intelligence and explains the presence of nine different Multiple Intelligences. The purpose of this study was…
Intelligent type sodium instrumentations for LMFR
International Nuclear Information System (INIS)
Daolong Chen
1996-01-01
The constructions and their performances of a lot of newly developed intelligent type sodium instrumentations that consist of the intelligent type sodium flowmeter, the intelligent type immersed sodium flowmeter, the intelligent type sodium manometer and the intelligent type sodium level gauge are described. The graduation characteristic equations for corresponding transducer using the medium temperature as the parameter are given. Because the operating temperature limit of measured medium (sodium) is wide, so the on-line compensation of the temperature effect of their graduation characteristics much be considered. The tests show that these intelligent type sodium instrumentations possess of good linearity. The accurate sodium process parameter (flowrate, pressure and level) measurement data can be obtained by means of their on-line compensation function of the temperature effect. Moreover, these intelligent type sodium instrumentations possess of the self-inspection, the electric shutoff protection, the setting of full-scale, the setting of alarm limits (two upper limits and two lower limits alarms), the thermocouple breaking alarm, each other isolative the 0-10V direct-current analogue output and CENTRONICS standard digital output, and the alarm relay contact output. These intelligent type sodium instrumentations are suitable particularly for the instrument, control and protective systems of LMFR by means of these excellent functions based on microprocessor. The basic error of the intelligent type sodium flowmeter, immersed sodium flowmeter, sodium manometer and sodium level gauge is respectively ±2%, ±2.3%, ±0.3% and ±1.9% of measuring range. (author). 4 refs, 9 figs
Classification of Children Intelligence with Fuzzy Logic Method
Syahminan; ika Hidayati, Permata
2018-04-01
Intelligence of children s An Important Thing To Know The Parents Early on. Typing Can be done With a Child’s intelligence Grouping Dominant Characteristics Of each Type of Intelligence. To Make it easier for Parents in Determining The type of Children’s intelligence And How to Overcome them, for It Created A Classification System Intelligence Grouping Children By Using Fuzzy logic method For determination Of a Child’s degree of intelligence type. From the analysis We concluded that The presence of Intelligence Classification systems Pendulum Children With Fuzzy Logic Method Of determining The type of The Child’s intelligence Can be Done in a way That is easier And The results More accurate Conclusions Than Manual tests.
Kombineret dagslys og intelligent LED belysning - få dagslys ind i bygningerne
DEFF Research Database (Denmark)
Dam-Hansen, Carsten; Corell, Dennis Dan; Thorseth, Anders
This report contains a description of the work carried out and the results of the research and development project ”Combined daylight and Intelligent LED lighting ‐ getting the daylight into the buildings” and form the final report for this project. The project is carried out in cooperation between...... the following partners: DTU Fotonik, Statens Byggeforsknings‐institut, Rambøll Danmark, Energirådgiveren and Philips Lighting Denmark. The project has been led by DTU Fotonik, Senior scientist, Ph.d. Carsten Dam‐Hansen The project was financed by the Danish Energy Association through Elforsk’s PSO program...... of the project, the work and results together with future perspectives of the results of the project. The report contains an overview of dynamic lighting systems and a description of the development of a new intelligent dynamic lighting system based on color mixing LED technology. The system, which has been...
Design and Optimization of Intelligent Service Robot Suspension System Using Dynamic Model
International Nuclear Information System (INIS)
Choi, Seong Hoon; Park, Tae Won; Lee, Soo Ho; Jung, Sung Pil; Jun, Kab Jin; Yoon, J. W.
2010-01-01
Recently, an intelligent service robot is being developed for use in guiding and providing information to visitors about the building at public institutions. The intelligent robot has a sensor at the bottom to recognize its location. Four wheels, which are arranged in the form of a lozenge, support the robot. This robot cannot be operated on uneven ground because its driving parts are attached to its main body that contains the important internal components. Continuous impact with the ground can change the precise positions of the components and weaken the connection between each structural part. In this paper, the design of the suspension system for such a robot is described. The dynamic model of the robot is created, and the driving characteristics of the robot with the designed suspension system are simulated. Additionally, the suspension system is optimized to reduce the impact for the robot components
Indirect Self-Destructiveness and Emotional Intelligence.
Tsirigotis, Konstantinos
2016-06-01
While emotional intelligence may have a favourable influence on the life and psychological and social functioning of the individual, indirect self-destructiveness exerts a rather negative influence. The aim of this study has been to explore possible relations between indirect self-destructiveness and emotional intelligence. A population of 260 individuals (130 females and 130 males) aged 20-30 (mean age of 24.5) was studied by using the Polish version of the chronic self-destructiveness scale and INTE, i.e., the Polish version of the assessing emotions scale. Indirect self-destructiveness has significant correlations with all variables of INTE (overall score, factor I, factor II), and these correlations are negative. The intensity of indirect self-destructiveness differentiates significantly the height of the emotional intelligence and vice versa: the height of the emotional intelligence differentiates significantly the intensity of indirect self-destructiveness. Indirect self-destructiveness has negative correlations with emotional intelligence as well as its components: the ability to recognize emotions and the ability to utilize emotions. The height of emotional intelligence differentiates the intensity of indirect self-destructiveness, and vice versa: the intensity of indirect self-destructiveness differentiates the height of emotional intelligence. It seems advisable to use emotional intelligence in the prophylactic and therapeutic work with persons with various types of disorders, especially with the syndrome of indirect self-destructiveness.
Intelligence as Trait—and State?
Directory of Open Access Journals (Sweden)
Robert J. Sternberg
2014-02-01
Full Text Available We tend to think of intelligence as trait-like. However, with increasing use of psychoactive drugs that enhance performance on psychometric tests of intelligence, investigators need to think of intelligence also as having state-like properties. Questions of the ethics of such drug use will need to be faced in the field of high-stakes psychometric testing as they now are being faced in professional athletics.
Nap sleep spindle correlates of intelligence.
Ujma, Péter P; Bódizs, Róbert; Gombos, Ferenc; Stintzing, Johannes; Konrad, Boris N; Genzel, Lisa; Steiger, Axel; Dresler, Martin
2015-11-26
Sleep spindles are thalamocortical oscillations in non-rapid eye movement (NREM) sleep, that play an important role in sleep-related neuroplasticity and offline information processing. Several studies with full-night sleep recordings have reported a positive association between sleep spindles and fluid intelligence scores, however more recently it has been shown that only few sleep spindle measures correlate with intelligence in females, and none in males. Sleep spindle regulation underlies a circadian rhythm, however the association between spindles and intelligence has not been investigated in daytime nap sleep so far. In a sample of 86 healthy male human subjects, we investigated the correlation between fluid intelligence and sleep spindle parameters in an afternoon nap of 100 minutes. Mean sleep spindle length, amplitude and density were computed for each subject and for each derivation for both slow and fast spindles. A positive association was found between intelligence and slow spindle duration, but not any other sleep spindle parameter. As a positive correlation between intelligence and slow sleep spindle duration in full-night polysomnography has only been reported in females but not males, our results suggest that the association between intelligence and sleep spindles is more complex than previously assumed.
Intelligence and Nuclear Proliferation: Lessons Learned
International Nuclear Information System (INIS)
Hansen, Keith A.
2011-09-01
Intelligence agencies play a fundamental role in the prevention of nuclear proliferation, as they help to understand other countries' intentions and assess their technical capabilities and the nature of their nuclear activities. The challenges in this area remain, however, formidable. Past experiences and the discoveries of Iraq's WMD programs, of North Korean nuclear weapon program, and of Iranian activities, have put into question the ability of intelligence to monitor small, clandestine proliferation activities from either states or non-state entities. This Proliferation Paper analyzes the complex challenges intelligence faces and the various roles it plays in supporting national and international nuclear non-proliferation efforts, and reviews its track record. In an effort to shed light on the role and contribution of intelligence in national and international efforts to halt, if not prevent, further nuclear weapon proliferation, this paper first analyzes the challenges intelligence faces in monitoring small, clandestine proliferation activities and the role it plays in supporting non-proliferation efforts. It then reviews the intelligence track record in monitoring proliferation including the lessons learned from Iraq. Finally, it addresses whether it is possible for intelligence to accurately monitor future clandestine proliferation efforts. (author)
Students’ thinking level based on intrapersonal intelligence
Sholikhati, Rahadian; Mardiyana; Retno Sari Saputro, Dewi
2017-12-01
This research aims to determine the students’ thinking level based on bloom taxonomy guidance and reviewed from students' Intrapersonal Intelligence. Taxonomy bloom is a taxonomy that classifies the students' thinking level into six, ie the remembering, understanding, applying, analyzing, creating, and evaluating levels. Students' Intrapersonal Intelligence is the intelligence associated with awareness and knowledge of oneself. The type of this research is descriptive research with qualitative approach. The research subject were taken by one student in each Intrapersonal Intelligence category (high, moderate, and low) which then given the problem solving test and the result was triangulated by interview. From this research, it is found that high Intrapersonal Intelligence students can achieve analyzing thinking level, subject with moderate Intrapersonal Intelligence being able to reach the level of applying thinking, and subject with low Intrapersonal Intelligence able to reach understanding level.
Benedek, Mathias; Jauk, Emanuel; Sommer, Markus; Arendasy, Martin; Neubauer, Aljoscha C.
2014-01-01
Intelligence and creativity are known to be correlated constructs suggesting that they share a common cognitive basis. The present study assessed three specific executive abilities – updating, shifting, and inhibition – and examined their common and differential relations to fluid intelligence and creativity (i.e., divergent thinking ability) within a latent variable model approach. Additionally, it was tested whether the correlation of fluid intelligence and creativity can be explained by a common executive involvement. As expected, fluid intelligence was strongly predicted by updating, but not by shifting or inhibition. Creativity was predicted by updating and inhibition, but not by shifting. Moreover, updating (and the personality factor openness) was found to explain a relevant part of the shared variance between intelligence and creativity. The findings provide direct support for the executive involvement in creative thought and shed further light on the functional relationship between intelligence and creativity. PMID:25278640
Emotional intelligence as an aspect of general intelligence: what would David Wechsler say?
Kaufman, A S; Kaufman, J C
2001-09-01
R. D. Roberts, M. Zeidner, and G. Matthews (2001) have carefully examined the controversial issue of whether emotional intelligence (EI) should be classified as an intelligence and whether EI's constructs meet the same psychometric standards as general intelligence's constructs. This article casts their efforts into the framework of both historical and modern IQ-testing theory and research. It details David Wechsler's attempts to integrate EI into his tests and how his conception of a good clinician would be that of an emotionally intelligent clinician. Current theories and research on IQ also have a role in EI beyond what Roberts et al. described, including J. L. Horn's (1989) expanded model and A. R. Luria's (1966) neuropsychological research, and better criteria than the Armed Services Vocational Aptitude Battery should be used in future EI studies. The authors look forward to more research being conducted on EI, particularly in future performance-based assessments.
Are Prospective English Teachers Linguistically Intelligent?
Tezel, Kadir Vefa
2017-01-01
Language is normally associated with linguistic capabilities of individuals. In the theory of multiple intelligences, language is considered to be related primarily to linguistic intelligence. Using the theory of Multiple Intelligences as its starting point, this descriptive survey study investigated to what extent prospective English teachers'…
32 CFR 637.17 - Police Intelligence.
2010-07-01
... 32 National Defense 4 2010-07-01 2010-07-01 true Police Intelligence. 637.17 Section 637.17... CRIMINAL INVESTIGATIONS MILITARY POLICE INVESTIGATION Investigations § 637.17 Police Intelligence. (a) The purpose of gathering police intelligence is to identify individuals or groups of individuals in an effort...
The importance of business intelligence in the bank strategic marketing
Directory of Open Access Journals (Sweden)
Đorđević Bojan
2006-01-01
Full Text Available Marketing philosophy today is inevitable for many financial institutions which are dealing with big competition in the market. Banking institutions while transforming from traditional to modern banks, must put in a first place acceptance of marketing principals, i.e. they must focus on consumers (users of bank's products & services. Implementing new technologies in business, banking market competitors are facing many innovations in products/services and processes, and a wide range of offers in banking and non-banking financial organizations. That invokes the need for modern technological solutions in gathering and processing a lot of market information and individual tracking of every client's activities (one-to-one. In those circumstances, there's great necessity to implement business intelligence system in banks, that can significantly help in finding and realization of adequate marketing strategies in banking business.
Genes, evolution and intelligence.
Bouchard, Thomas J
2014-11-01
I argue that the g factor meets the fundamental criteria of a scientific construct more fully than any other conception of intelligence. I briefly discuss the evidence regarding the relationship of brain size to intelligence. A review of a large body of evidence demonstrates that there is a g factor in a wide range of species and that, in the species studied, it relates to brain size and is heritable. These findings suggest that many species have evolved a general-purpose mechanism (a general biological intelligence) for dealing with the environments in which they evolved. In spite of numerous studies with considerable statistical power, we know of very few genes that influence g and the effects are very small. Nevertheless, g appears to be highly polygenic. Given the complexity of the human brain, it is not surprising that that one of its primary faculties-intelligence-is best explained by the near infinitesimal model of quantitative genetics.
Tarter, Jill
The search for extraterrestrial intelligence (SETI) could succeed tomorrow, decades from now, or never. The nature of this scientific exploration is such that we cannot predict success on any timescale; we only know that if we do not search, we cannot succeed. Having spent my scientific career in this field, I know perhaps better than anyone that the researchers of tomorrow may hold the key. Thus I have an enormous and vested interest in trying to educate the next generation of scientists. Because SETI excites such enthusiasm in young and old alike, I have an excellent opportunity to capture hearts and minds and leverage this interest into science education at many levels. Astrobiology is the new banner for inter- and cross-disciplinary investigations aimed at answering the big question "Are we alone?" The story of cosmic evolution is one that scientists at the SETI Institute have been telling for decades. We have used it as the framework for developing supplementary materials for elementary and middle schools called Life In The Universe. Currently we are tackling a year-long curriculum called Voyages Through Time for ninth grade students. This curriculum is delivered on CD-ROM and supported by the web. It focuses on evolution as a theme and stresses the contributions made from all the traditionally isolated branches of science --- and by the way, it's fun! I am a product of the post-Sputnik era and the American emphasis on science and engineering education. In the New York City bedroom community where I grew up, every school bond issue passed at every election. So I am appalled at the difficulties, the impecuniousness, and bureaucratic nonsense our pilot and field test teachers encounter on a daily basis. I am also overjoyed that even under such unreasonable conditions, I meet enthusiastic teachers who care about their students and are dedicated to helping them achieve the best possible education. Not all students will become scientists, nor should they. However
A measurement model of multiple intelligence profiles of management graduates
Krishnan, Heamalatha; Awang, Siti Rahmah
2017-05-01
In this study, developing a fit measurement model and identifying the best fitting items to represent Howard Gardner's nine intelligences namely, musical intelligence, bodily-kinaesthetic intelligence, mathematical/logical intelligence, visual/spatial intelligence, verbal/linguistic intelligence, interpersonal intelligence, intrapersonal intelligence, naturalist intelligence and spiritual intelligence are the main interest in order to enhance the opportunities of the management graduates for employability. In order to develop a fit measurement model, Structural Equation Modeling (SEM) was applied. A psychometric test which is the Ability Test in Employment (ATIEm) was used as the instrument to measure the existence of nine types of intelligence of 137 University Teknikal Malaysia Melaka (UTeM) management graduates for job placement purposes. The initial measurement model contains nine unobserved variables and each unobserved variable is measured by ten observed variables. Finally, the modified measurement model deemed to improve the Normed chi-square (NC) = 1.331; Incremental Fit Index (IFI) = 0.940 and Root Mean Square of Approximation (RMSEA) = 0.049 was developed. The findings showed that the UTeM management graduates possessed all nine intelligences either high or low. Musical intelligence, mathematical/logical intelligence, naturalist intelligence and spiritual intelligence contributed highest loadings on certain items. However, most of the intelligences such as bodily kinaesthetic intelligence, visual/spatial intelligence, verbal/linguistic intelligence interpersonal intelligence and intrapersonal intelligence possessed by UTeM management graduates are just at the borderline.
Model Pembelajaran Berbasis Penstimulasian Multiple Intelligences Siswa
Edy Legowo
2017-01-01
Tulisan ini membahas mengenai penerapan teori multiple intelligences dalam pembelajaran di sekolah. Pembahasan diawali dengan menguraikan perkembangan konsep inteligensi dan multiple intelligences. Diikuti dengan menjelaskan dampak teori multiple intelligences dalam bidang pendidikan dan pembelajaran di sekolah. Bagian selanjutnya menguraikan tentang implementasi teori multiple intelligences dalam praktik pembelajaran di kelas yaitu bagaimana pemberian pengalaman belajar siswa yang difasilita...
Artificial Intelligence and Its Importance in Education.
Tilmann, Martha J.
Artificial intelligence, or the study of ideas that enable computers to be intelligent, is discussed in terms of what it is, what it has done, what it can do, and how it may affect the teaching of tomorrow. An extensive overview of artificial intelligence examines its goals and applications and types of artificial intelligence including (1) expert…
The evolution of intelligence in mammalian carnivores.
Holekamp, Kay E; Benson-Amram, Sarah
2017-06-06
Although intelligence should theoretically evolve to help animals solve specific types of problems posed by the environment, it is unclear which environmental challenges favour enhanced cognition, or how general intelligence evolves along with domain-specific cognitive abilities. The social intelligence hypothesis posits that big brains and great intelligence have evolved to cope with the labile behaviour of group mates. We have exploited the remarkable convergence in social complexity between cercopithecine primates and spotted hyaenas to test predictions of the social intelligence hypothesis in regard to both cognition and brain size. Behavioural data indicate that there has been considerable convergence between primates and hyaenas with respect to their social cognitive abilities. Moreover, compared with other hyaena species, spotted hyaenas have larger brains and expanded frontal cortex, as predicted by the social intelligence hypothesis. However, broader comparative study suggests that domain-general intelligence in carnivores probably did not evolve in response to selection pressures imposed specifically in the social domain. The cognitive buffer hypothesis, which suggests that general intelligence evolves to help animals cope with novel or changing environments, appears to offer a more robust explanation for general intelligence in carnivores than any hypothesis invoking selection pressures imposed strictly by sociality or foraging demands.
Emotional intelligence of mental health nurses
Jan Derksen; prof Berno van Meijel; Loes van Dusseldorp
2011-01-01
Aims. The aim of this study is to gain insight into the level of emotional intelligence of mental health nurses in the Netherlands. Background. The focus in research on emotional intelligence to date has been on a variety of professionals. However, little is known about emotional intelligence in
2015 Chinese Intelligent Automation Conference
Li, Hongbo
2015-01-01
Proceedings of the 2015 Chinese Intelligent Automation Conference presents selected research papers from the CIAC’15, held in Fuzhou, China. The topics include adaptive control, fuzzy control, neural network based control, knowledge based control, hybrid intelligent control, learning control, evolutionary mechanism based control, multi-sensor integration, failure diagnosis, reconfigurable control, etc. Engineers and researchers from academia, industry and the government can gain valuable insights into interdisciplinary solutions in the field of intelligent automation.
Artificial intelligence in robot control systems
Korikov, A.
2018-05-01
This paper analyzes modern concepts of artificial intelligence and known definitions of the term "level of intelligence". In robotics artificial intelligence system is defined as a system that works intelligently and optimally. The author proposes to use optimization methods for the design of intelligent robot control systems. The article provides the formalization of problems of robotic control system design, as a class of extremum problems with constraints. Solving these problems is rather complicated due to the high dimensionality, polymodality and a priori uncertainty. Decomposition of the extremum problems according to the method, suggested by the author, allows reducing them into a sequence of simpler problems, that can be successfully solved by modern computing technology. Several possible approaches to solving such problems are considered in the article.
The role of soft computing in intelligent machines.
de Silva, Clarence W
2003-08-15
An intelligent machine relies on computational intelligence in generating its intelligent behaviour. This requires a knowledge system in which representation and processing of knowledge are central functions. Approximation is a 'soft' concept, and the capability to approximate for the purposes of comparison, pattern recognition, reasoning, and decision making is a manifestation of intelligence. This paper examines the use of soft computing in intelligent machines. Soft computing is an important branch of computational intelligence, where fuzzy logic, probability theory, neural networks, and genetic algorithms are synergistically used to mimic the reasoning and decision making of a human. This paper explores several important characteristics and capabilities of machines that exhibit intelligent behaviour. Approaches that are useful in the development of an intelligent machine are introduced. The paper presents a general structure for an intelligent machine, giving particular emphasis to its primary components, such as sensors, actuators, controllers, and the communication backbone, and their interaction. The role of soft computing within the overall system is discussed. Common techniques and approaches that will be useful in the development of an intelligent machine are introduced, and the main steps in the development of an intelligent machine for practical use are given. An industrial machine, which employs the concepts of soft computing in its operation, is presented, and one aspect of intelligent tuning, which is incorporated into the machine, is illustrated.
Prakash, Om; Sharma, Neelu; Singh, Amool R.; Sengar, K. S.; Chaudhury, Suprakash; Ranjan, Jay Kumar
2015-01-01
Aim: To assess personality disorder (PD), emotional intelligence (EI), and locus of control of alcohol dependent (AD) patients and its comparison with normal controls. Materials and Methods: Based on purposive sampling technique, 33 AD patients were selected from the De-Addiction Ward of Ranchi Institute of Neuro-Psychiatry and Allied Sciences (RINPAS) and 33 matched normal subjects were selected from Ranchi and nearby places. Both the groups were matched on various sociodemographic parameter...
Intelligent design som videnskab?
DEFF Research Database (Denmark)
Klausen, Søren Harnow
2007-01-01
Diskuterer hvorvidt intelligent design kan betegnes som videnskab; argumenterer for at dette grundet fraværet af klare demarkationskriterier næppe kan afvises.......Diskuterer hvorvidt intelligent design kan betegnes som videnskab; argumenterer for at dette grundet fraværet af klare demarkationskriterier næppe kan afvises....
The Reproduction of Intelligence
Meisenberg, Gerhard
2010-01-01
Although a negative relationship between fertility and education has been described consistently in most countries of the world, less is known about the relationship between intelligence and reproductive outcomes. Also the paths through which intelligence influences reproductive outcomes are uncertain. The present study uses the NLSY79 to analyze…
Pro SharePoint 2010 Business Intelligence Solutions
Malik, Sahil; Wright, Steve
2010-01-01
What differentiates good organizations from bad? The good ones are those that take advantage of the data they already have and use the feedback that business intelligence gives them to improve their processes. SharePoint is now the delivery platform of choice for Microsoft's business intelligence products, and in this book we reveal how to get the most from developing business intelligence solutions on SharePoint 2010. To understand the various business intelligence offerings in SharePoint 2010, you need to understand the core SQL Server business intelligence concepts, and the first part of th
Schooling Built on the Multiple Intelligences
Kunkel, Christine D.
2009-01-01
This article features a school built on multiple intelligences. As the first multiple intelligences school in the world, the Key Learning Community shapes its students' days to include significant time in the musical, spatial and bodily-kinesthetic intelligences, as well as the more traditional areas of logical-mathematical and linguistics. In…
Machine intelligence and signal processing
Vatsa, Mayank; Majumdar, Angshul; Kumar, Ajay
2016-01-01
This book comprises chapters on key problems in machine learning and signal processing arenas. The contents of the book are a result of a 2014 Workshop on Machine Intelligence and Signal Processing held at the Indraprastha Institute of Information Technology. Traditionally, signal processing and machine learning were considered to be separate areas of research. However in recent times the two communities are getting closer. In a very abstract fashion, signal processing is the study of operator design. The contributions of signal processing had been to device operators for restoration, compression, etc. Applied Mathematicians were more interested in operator analysis. Nowadays signal processing research is gravitating towards operator learning – instead of designing operators based on heuristics (for example wavelets), the trend is to learn these operators (for example dictionary learning). And thus, the gap between signal processing and machine learning is fast converging. The 2014 Workshop on Machine Intel...
Intelligent Processing Equipment Research and Development Programs of the Department of Commerce
Simpson, J. A.
1992-01-01
The intelligence processing equipment (IPE) research and development (R&D) programs of the Department of Commerce are carried out within the National Institute of Standards and Technology (NIST). This institute has had work in support of industrial productivity as part of its mission since its founding in 1901. With the advent of factory automation these efforts have increasingly turned to R&D in IPE. The Manufacturing Engineering Laboratory (MEL) of NIST devotes a major fraction of its efforts to this end while other elements within the organization, notably the Material Science and Engineering Laboratory, have smaller but significant programs. An inventory of all such programs at NIST and a representative selection of projects that at least demonstrate the scope of the efforts are presented.
Energy Technology Data Exchange (ETDEWEB)
Thorseth, A.; Corell, D.; Hansen, Soeren S.; Dam-Hansen, C.; Petersen, Paul Michael
2013-01-15
The project has resulted in a prototype of a new intelligent lighting control system. The control system enables the end user to control his or her own local lighting environment (lighting zone) according to individual preferences and needs. The report provides a description of how the developed intelligent lighting system is composed and functions. The system is designed as a work lamp that enables dynamic change of the light color scheme according to a number of light control algorithms. It is specifically designed in relation to user tests of the intelligent lighting system, which is carried out in the final part of the project. An intelligent and advanced control of LED lighting was developed, which enables optimization of the user's light conditions in a given situation. Based on a number of known parameters, the system can control lighting so that at any time optimal light conditions are created, using a minimum of electric power. (LN)
Snowden, Austyn; Watson, Roger; Stenhouse, Rosie; Hale, Claire
2015-12-01
To examine the construct validity of the Trait Emotional Intelligence Questionnaire Short form. Emotional intelligence involves the identification and regulation of our own emotions and the emotions of others. It is therefore a potentially useful construct in the investigation of recruitment and retention in nursing and many questionnaires have been constructed to measure it. Secondary analysis of existing dataset of responses to Trait Emotional Intelligence Questionnaire Short form using concurrent application of Rasch analysis and confirmatory factor analysis. First year undergraduate nursing and computing students completed Trait Emotional Intelligence Questionnaire-Short Form in September 2013. Responses were analysed by synthesising results of Rasch analysis and confirmatory factor analysis. Participants (N = 938) completed Trait Emotional Intelligence Questionnaire Short form. Rasch analysis showed the majority of the Trait Emotional Intelligence Questionnaire-Short Form items made a unique contribution to the latent trait of emotional intelligence. Five items did not fit the model and differential item functioning (gender) accounted for this misfit. Confirmatory factor analysis revealed a four-factor structure consisting of: self-confidence, empathy, uncertainty and social connection. All five misfitting items from the Rasch analysis belonged to the 'social connection' factor. The concurrent use of Rasch and factor analysis allowed for novel interpretation of Trait Emotional Intelligence Questionnaire Short form. Much of the response variation in Trait Emotional Intelligence Questionnaire Short form can be accounted for by the social connection factor. Implications for practice are discussed. © 2015 John Wiley & Sons Ltd.
2016-11-01
into its acquisitions; and (3) efforts to develop tools to integrate intelligence into its acquisitions. GAO compared certification and training to...conduct their business , and that the centers currently were not prioritizing, verifying, or balancing the work related to producing intelligence mission...Force, and we observed briefings from the task force to the Acquisition Intelligence Requirements Executive Steering Group. We also compared the
Low molecular weight squash trypsin inhibitors from Sechium edule seeds.
Laure, Hélen J; Faça, Vítor M; Izumi, Clarice; Padovan, Júlio C; Greene, Lewis J
2006-02-01
Nine chromatographic components containing trypsin inhibitor activity were isolated from Sechium edule seeds by acetone fractionation, gel filtration, affinity chromatography and RP-HPLC in an overall yield of 46% of activity and 0.05% of protein. The components obtained with highest yield of total activity and highest specific activity were sequenced by Edman degradation and their molecular masses determined by mass spectrometry. The inhibitors contained 31, 32 and 27 residues per molecule and their sequences were: SETI-IIa, EDRKCPKILMRCKRDSDCLAKCTCQESGYCG; SETI-IIb, EEDRKCPKILMRCKRDSDCLAKCTCQESGYCG and SETI-V, CPRILMKCKLDTDCFPTCTCRPSGFCG. SETI-IIa and SETI-IIb, which differed by an amino-terminal E in the IIb form, were not separable under the conditions employed. The sequences are consistent with consensus sequences obtained from 37 other inhibitors: CPriI1meCk_DSDCla_C_C_G_CG, where capital letters are invariant amino acid residues and lower case letters are the most preserved in this position. SETI-II and SETI-V form complexes with trypsin with a 1:1 stoichiometry and have dissociation constants of 5.4x10(-11)M and 1.1x10(-9)M, respectively.
The handbook of artificial intelligence
Barr, Avron
1982-01-01
The Handbook of Artificial Intelligence, Volume II focuses on the improvements in artificial intelligence (AI) and its increasing applications, including programming languages, intelligent CAI systems, and the employment of AI in medicine, science, and education. The book first elaborates on programming languages for AI research and applications-oriented AI research. Discussions cover scientific applications, teiresias, applications in chemistry, dependencies and assumptions, AI programming-language features, and LISP. The manuscript then examines applications-oriented AI research in medicine
The Professionalization of Intelligence Cooperation
DEFF Research Database (Denmark)
Svendsen, Adam David Morgan
"Providing an in-depth insight into the subject of intelligence cooperation (officially known as liason), this book explores the complexities of this process. Towards facilitating a general understanding of the professionalization of intelligence cooperation, Svendsen's analysis includes risk...... management and encourages the realisation of greater resilience. Svendsen discusses the controversial, mixed and uneven characterisations of the process of the professionalization of intelligence cooperation and argues for a degree of 'fashioning method out of mayhem' through greater operational...
FOREWORD: Structural Health Monitoring and Intelligent Infrastructure
Wu, Zhishen; Fujino, Yozo
2005-06-01
quality standards as for any paper in a regular issue. The papers cover a wide spectrum of topics including smart and effective sensing technologies, reliable approaches to signal processing, rational data gathering and interpretation methods, advanced damage characterization, modeling feature selection and diagnosis methods, and system integration technologies, etc. This special issue contains the most up-to-date achievements in SHM and intelligent technologies and provides information pertaining to their current and potential applications in infrastructure. It is our hope that this special issue makes a significant contribution in advancing awareness and acceptance of SHM and intelligent technologies for the maintenance and construction of different kinds of infrastructure. We would like to express our sincere thanks to Professor Varadan (Editor-in-Chief), Professor Matsuzaki (Regional Editor), the Editorial Assistants and the staff at Institute of Physics Publishing for their great support and advice in publishing this special issue. Special thanks are due to all the reviewers for their willingness to share their time and expertise. Final but important thanks go to Ms Suzhen Li (Doctorate Candidate at Ibaraki University) for her assistance in editing this special issue.
Multivariate Associations of Fluid Intelligence and NAA.
Nikolaidis, Aki; Baniqued, Pauline L; Kranz, Michael B; Scavuzzo, Claire J; Barbey, Aron K; Kramer, Arthur F; Larsen, Ryan J
2017-04-01
Understanding the neural and metabolic correlates of fluid intelligence not only aids scientists in characterizing cognitive processes involved in intelligence, but it also offers insight into intervention methods to improve fluid intelligence. Here we use magnetic resonance spectroscopic imaging (MRSI) to measure N-acetyl aspartate (NAA), a biochemical marker of neural energy production and efficiency. We use principal components analysis (PCA) to examine how the distribution of NAA in the frontal and parietal lobes relates to fluid intelligence. We find that a left lateralized frontal-parietal component predicts fluid intelligence, and it does so independently of brain size, another significant predictor of fluid intelligence. These results suggest that the left motor regions play a key role in the visualization and planning necessary for spatial cognition and reasoning, and we discuss these findings in the context of the Parieto-Frontal Integration Theory of intelligence. © The Author 2016. Published by Oxford University Press. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.
Intelligence and Physical Attractiveness
Kanazawa, Satoshi
2011-01-01
This brief research note aims to estimate the magnitude of the association between general intelligence and physical attractiveness with large nationally representative samples from two nations. In the United Kingdom, attractive children are more intelligent by 12.4 IQ points (r=0.381), whereas in the United States, the correlation between…
Next generation Emotional Intelligence
J. Saveland
2012-01-01
Emotional Intelligence has been a hot topic in leadership training since Dan Goleman published his book on the subject in 1995. Emotional intelligence competencies are typically focused on recognition and regulation of emotions in one's self and social situations, yielding four categories: self-awareness, self-management, social awareness and relationship...
2009-07-01
success of the quintessential espionage genre with his teen spy thriller Storm- breaker. Like any good thriller , the book begins with a hook: “When the...Valerie P. Rogue’s March 19 James M. Burridge INTELLIGENCE IN BOOK AND FILM The Hunt for Red October: The Techno-espionage Prototype? 23 Bill Hadley The...Kite Runner 27 Elizabeth Darcy INTELLIGENCE IN FILM AND TELEVISION One Day in September and Munich: Enduring Questions, Indelible Images 31 Dr. Daniel
Menna, Tamene Yoseph
2017-01-01
The purpose of this study was to examine the relationship between cultural intelligence, transformational leadership, and team performance in one private Christian higher education institution in Southern California. The study further conducted initial exploration of how student leaders' Christian worldview (humility) influences their cultural…
Khan, Samee; Burczy´nski, Tadeusz
2012-01-01
One of the most challenging issues in today’s large-scale computational modeling and design is to effectively manage the complex distributed environments, such as computational clouds, grids, ad hoc, and P2P networks operating under various types of users with evolving relationships fraught with uncertainties. In this context, the IT resources and services usually belong to different owners (institutions, enterprises, or individuals) and are managed by different administrators. Moreover, uncertainties are presented to the system at hand in various forms of information that are incomplete, imprecise, fragmentary, or overloading, which hinders in the full and precise resolve of the evaluation criteria, subsequencing and selection, and the assignment scores. Intelligent scalable systems enable the flexible routing and charging, advanced user interactions and the aggregation and sharing of geographically-distributed resources in modern large-scale systems. This book presents new ideas, theories, models...
9th International Symposium on Intelligent Distributed Computing
Camacho, David; Analide, Cesar; Seghrouchni, Amal; Badica, Costin
2016-01-01
This book represents the combined peer-reviewed proceedings of the ninth International Symposium on Intelligent Distributed Computing – IDC’2015, of the Workshop on Cyber Security and Resilience of Large-Scale Systems – WSRL’2015, and of the International Workshop on Future Internet and Smart Networks – FI&SN’2015. All the events were held in Guimarães, Portugal during October 7th-9th, 2015. The 46 contributions published in this book address many topics related to theory and applications of intelligent distributed computing, including: Intelligent Distributed Agent-Based Systems, Ambient Intelligence and Social Networks, Computational Sustainability, Intelligent Distributed Knowledge Representation and Processing, Smart Networks, Networked Intelligence and Intelligent Distributed Applications, amongst others.
Key Success Factors in Business Intelligence
Directory of Open Access Journals (Sweden)
Szymon Adamala
2011-12-01
Full Text Available Business Intelligence can bring critical capabilities to an organization, but the implementation of such capabilities is often plagued with problems. Why is it that certain projects fail, while others succeed? The aim of this article is to identify the factors that are present in successful Business Intelligence projects and to organize them into a framework of critical success factors. A survey was conducted during the spring of 2011 to collect primary data on Business Intelligence projects. Findings confirm that Business Intelligence projects are wrestling with both technological and non-technological problems, but the non-technological problems are found to be harder to solve as well as more time consuming than their counterparts. The study also shows that critical success factors for Business Intelligence projects are different from success factors for Information Systems projects in general. Business Intelligences projects have critical success factors that are unique to the subject matter. Major differences can be found primarily among non-technological factors, such as the presence of a specific business need and a clear vision to guide the project. Success depends on types of project funding, the business value provided by each iteration in the project and the alignment of the project to a strategic vision for Business Intelligence at large. Furthermore, the study provides a framework for critical success factors that, explains sixty-one percent of variability of success for projects. Areas which should be given special attention include making sure that the Business Intelligence solution is built with the end users in mind, that the Business Intelligence solution is closely tied to the company’s strategic vision and that the project is properly scoped and prioritized to concentrate on the best opportunities first.
Directory of Open Access Journals (Sweden)
O. V. Kotomina
2017-01-01
intelligence and academic achievement of students. However, contrary to the hypothesis, that interrelation turned out to be negative. With reference to the established facts, it has been suggested that students with the high level of emotional intelligence treat their academic grades more calmly, building full-fledged balance between studies, work and private life.Practical significance. The present findings of the research and results of the first stage of a longitudinal panel investigation of opportunities of psychology and pedagogical influence on development of university students’ emotional intelligence can be used by academic teaching staff of higher education institutions for further work with students.
Intelligence Community Programs, Management, and Enduring Issues
2016-11-08
books, journal papers, conference presentations, working papers, and other electronic and print publications. Intelligence Community Programs... Intelligence Community Programs, Management, and Enduring Issues Anne Daugherty Miles Analyst in Intelligence and National Security Policy...
Brain anatomical network and intelligence.
Directory of Open Access Journals (Sweden)
Yonghui Li
2009-05-01
Full Text Available Intuitively, higher intelligence might be assumed to correspond to more efficient information transfer in the brain, but no direct evidence has been reported from the perspective of brain networks. In this study, we performed extensive analyses to test the hypothesis that individual differences in intelligence are associated with brain structural organization, and in particular that higher scores on intelligence tests are related to greater global efficiency of the brain anatomical network. We constructed binary and weighted brain anatomical networks in each of 79 healthy young adults utilizing diffusion tensor tractography and calculated topological properties of the networks using a graph theoretical method. Based on their IQ test scores, all subjects were divided into general and high intelligence groups and significantly higher global efficiencies were found in the networks of the latter group. Moreover, we showed significant correlations between IQ scores and network properties across all subjects while controlling for age and gender. Specifically, higher intelligence scores corresponded to a shorter characteristic path length and a higher global efficiency of the networks, indicating a more efficient parallel information transfer in the brain. The results were consistently observed not only in the binary but also in the weighted networks, which together provide convergent evidence for our hypothesis. Our findings suggest that the efficiency of brain structural organization may be an important biological basis for intelligence.
Laughlin, Kevin; Foley, Andi
2012-01-01
The "Intelligences That Plants Can Pass On" is an activity that involves several of Gardner's Multiple Intelligences and was designed for demonstrating the practical use of Multiple Intelligences in delivering education programs to all ages of learners. Instructions are provided for how to implement this activity, and the activity is linked to…
Distributed intelligence in CAMAC
International Nuclear Information System (INIS)
Kunz, P.F.
1977-01-01
A simple extension of the CAMAC standard is described which allows distributed intelligence at the crate level. By distributed intelligence is meant that there is more than one source of control in a system. This standard is just now emerging from the NIM Dataway Working Group and its European counterpart. 1 figure
Rattan, Aneeta; Savani, Krishna; Naidu, N V R; Dweck, Carol S
2012-11-01
We identify a novel dimension of people's beliefs about intelligence: beliefs about the potential to become highly intelligent. Studies 1-3 found that in U.S. American contexts, people tend to believe that only some people have the potential to become highly intelligent. In contrast, in South Asian Indian contexts, people tend to believe that most people have the potential to become highly intelligent. To examine the implications of these beliefs, Studies 4-6 measured and manipulated Americans' beliefs about the potential for intelligence and found that the belief that everyone can become highly intelligent predicted increased support for policies that distribute resources more equally across advantaged and disadvantaged social groups. These findings suggest that the belief that only some people have the potential to become highly intelligent is a culturally shaped belief, and one that can lead people to oppose policies aimed at redressing social inequality. (c) 2012 APA, all rights reserved.
Intelligent Integrated System Health Management
Figueroa, Fernando
2012-01-01
Intelligent Integrated System Health Management (ISHM) is the management of data, information, and knowledge (DIaK) with the purposeful objective of determining the health of a system (Management: storage, distribution, sharing, maintenance, processing, reasoning, and presentation). Presentation discusses: (1) ISHM Capability Development. (1a) ISHM Knowledge Model. (1b) Standards for ISHM Implementation. (1c) ISHM Domain Models (ISHM-DM's). (1d) Intelligent Sensors and Components. (2) ISHM in Systems Design, Engineering, and Integration. (3) Intelligent Control for ISHM-Enabled Systems
Computational Intelligence for Engineering Systems
Madureira, A; Vale, Zita
2011-01-01
"Computational Intelligence for Engineering Systems" provides an overview and original analysis of new developments and advances in several areas of computational intelligence. Computational Intelligence have become the road-map for engineers to develop and analyze novel techniques to solve problems in basic sciences (such as physics, chemistry and biology) and engineering, environmental, life and social sciences. The contributions are written by international experts, who provide up-to-date aspects of the topics discussed and present recent, original insights into their own experien
A cloaking device for transiting planets
Kipping, David M.; Teachey, Alex
2016-06-01
The transit method is presently the most successful planet discovery and characterization tool at our disposal. Other advanced civilizations would surely be aware of this technique and appreciate that their home planet's existence and habitability is essentially broadcast to all stars lying along their ecliptic plane. We suggest that advanced civilizations could cloak their presence, or deliberately broadcast it, through controlled laser emission. Such emission could distort the apparent shape of their transit light curves with relatively little energy, due to the collimated beam and relatively infrequent nature of transits. We estimate that humanity could cloak the Earth from Kepler-like broad-band surveys using an optical monochromatic laser array emitting a peak power of ˜30 MW for ˜10 hours per year. A chromatic cloak, effective at all wavelengths, is more challenging requiring a large array of tunable lasers with a total power of ˜250 MW. Alternatively, a civilization could cloak only the atmospheric signatures associated with biological activity on their world, such as oxygen, which is achievable with a peak laser power of just ˜160 kW per transit. Finally, we suggest that the time of transit for optical Search for Extraterrestrial Intelligence (SETI) is analogous to the water-hole in radio SETI, providing a clear window in which observers may expect to communicate. Accordingly, we propose that a civilization may deliberately broadcast their technological capabilities by distorting their transit to an artificial shape, which serves as both a SETI beacon and a medium for data transmission. Such signatures could be readily searched in the archival data of transit surveys.
Directory of Open Access Journals (Sweden)
Masoomeh Arabshahi
2013-11-01
Full Text Available Universities and institutions of higher education with a professional, special, educational and cultural environment play important roles in the direction towards the effective management of knowledge and space provision for the sharing of knowledge. Faculty members are known as the main elements of the university and they are the mental and intellectual investment banks who share their knowledge under certain conditions. In addition, their knowledge sharing behaviors lead to the success and improvement of individual and organizational operations. Moreover, organizational intelligence is the capacity of the organization to create knowledge and to use it in a strategic way to coordinate and to conform itself to its surroundings. This study examines the impact of organizational intelligence on faculty members' knowledge sharing behaviors. Data collection for qualitative research includes interviews with experts and quantitative research is performed using a questionnaire. The research results show that there was a significant relationship between organizational intelligence and faculty members' knowledge sharing behaviors. Among these dimensions, “knowledge application” influenced other dimensions. On the other hand, “common outcome” had a significant relationship with the “behavioral” dimension and “special and professional activities”.
The Literature of Competitive Intelligence.
Walker, Thomas D.
1994-01-01
Describes competitive intelligence (CI) literature in terms of its location, quantity, authorship, length, and problems of bibliographic access. Highlights include subject access; competitive intelligence research; espionage and security; monographs; and journals. (21 references) (LRW)