Dielectric enhancement of PbZr{sub 0.3}Ti{sub 0.7}O{sub 3}/LaNiO{sub 3} multilayer thick film

Energy Technology Data Exchange (ETDEWEB)

Fan, Yasong; Chen, Xiaoyang; Habibul, Arzigul; Zhang, Danyang; Yu, Ping [College of Materials Science and Engineering, Sichuan University, Chengdu, 610064 (China)

2016-08-15

Multilayer thick films (∝4 μm) with compositional PbZr{sub 0.3}Ti{sub 0.7}O{sub 3}/LaNiO{sub 3} layers and one-layer PZT thick films were prepared on the silicon substrate by radio-frequency magnetron sputtering. PbZr{sub 0.3}Ti{sub 0.7}O{sub 3}/LaNiO{sub 3} multilayer thick film are characterized by highly preferential (100)-oriented growth and columnar microstructure due to alternately introducing LaNiO{sub 3} seeding layers. The effects of LaNiO{sub 3} layers on microstructure and electrical properties of PbZr{sub 0.3}Ti{sub 0.7}O{sub 3} thick films were investigated in detail. The results show that both PZT and PbZr{sub 0.3}Ti{sub 0.7}O{sub 3}/LaNiO{sub 3} multilayer thick film were pure perovskite crystalline phase. The PbZr{sub 0.3}Ti{sub 0.7}O{sub 3} film texture was dense and well adhered on the LaNiO{sub 3} layer. PbZr{sub 0.3}Ti{sub 0.7}O{sub 3}/LaNiO{sub 3} multilayer thick film possessed obvious enhanced dielectric properties compared with PZT thick film: ε{sub r} ∝2450 (10 kHz) and tanδ ∝0.02 (10 kHz). Rayleigh law was used to analysis the behavior of the enhanced dielectric properties and the pinched-shaped polarization-electric field hysteresis loops. The larger Rayleigh parameter, α ∝51.1408 cm kV{sup -1} (1 kHz) indicates the larger extrinsic contribution to permittivity and strong domain-wall-defect charge interaction. The leakage current behaviors of the multilayer thick film were also investigated in detail. (copyright 2016 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

Project Plan 7930 Cell G PaR Remote Handling System Replacement

International Nuclear Information System (INIS)

Kinney, Kathryn A.

2009-01-01

For over 40 years the US Department of Energy (DOE) and its predecessors have made Californium-252 ( 252 Cf) available for a wide range of industries including medical, nuclear fuels, mining, military and national security. The Radiochemical Engineering Development Center (REDC) located within the Oak Ridge National Laboratory (ORNL) processes irradiated production targets from the High Flux Isotope Reactor (HFIR). Operations in Building 7930, Cell G provide over 70% of the world's demand for 252 Cf. Building 7930 was constructed and equipped in the mid-1960s. Current operations for 252 Cf processing in Building 7930, Cell G require use of through-the-wall manipulators and the PaR Remote Handling System. Maintenance and repairs for the manipulators is readily accomplished by removal of the manipulator and relocation to a repair shop where hands-on work can be performed in glove boxes. Contamination inside cell G does not currently allow manned entry and no provisions were created for a maintenance area inside the cell. There has been no maintenance of the PaR system or upgrades, leaving operations vulnerable should the system have a catastrophic failure. The Cell G PaR system is currently being operated in a run to failure mode. As the manipulator is now 40+ years old there is significant risk in this method of operation. In 2006 an assessment was completed that resulted in recommendations for replacing the manipulator operator control and power centers which are used to control and power the PaR manipulator in Cell G. In mid-2008 the chain for the bridge drive failed and subsequent examinations indicated several damaged links (see Figure 1). To continue operations the PaR manipulator arm is being used to push and pull the bridge as a workaround. A retrieval tool was fabricated, tested and staged inside Cell G that will allow positioning of the bridge and manipulator arm for removal from the cell should the PaR system completely fail. A fully functioning and

Choriocarcinome gestationnel révélé par une métastase rénale

African Journals Online (AJOL)

B. Sadiki

d'une néphrectomie d'hémostase en cas d'hématurie persistante. La néphrectomie peut être remplacée par une embolisation sélective. [10]. Conclusion. Les métastases rénales du CG sont rares. Cette éventualité doit être évoquée par l'urologue en présence d'un syndrome tumoral rénal chez les patientes en âge de ...

Breakdown of the lattice polaron picture in La0.7Ca0.3MnO3 single crystals

International Nuclear Information System (INIS)

Chun, S. H.; Salamon, M. B.; Tomioka, Y.; Tokura, Y.

2000-01-01

When heated through the magnetic transition at T C , La 0.7 Ca 0.3 MnO 3 changes from a band metal to a polaronic insulator. The Hall constant R H , through its activated behavior and sign anomaly, provides key evidence for polaronic behavior. We use R H and the Hall mobility to demonstrate the breakdown of the polaron phase. Above 1.4T C , the polaron picture holds in detail, while below, the activation energies of both R H and the mobility deviate strongly from their polaronic values. These changes reflect the presence of metallic, ferromagnetic fluctuations, in the volume of which the Hall effect develops additional contributions tied to quantal phases. (c) 2000 The American Physical Society

A polarised neutron scattering study of the excitations in the CMR manganite La0.7Ca0.3MnO3

International Nuclear Information System (INIS)

Hagen, M.; Dai, P.

2002-01-01

Full text: The magnetic excitations in the colossal magnetoresistance (CMR) materials A 1-x B x MnO 3 (A = La, Pr, Nd, B = Ca, Sr) near the optimum doping x = 1/3 show some remarkable features. In a recent unpolarised inelastic neutron scattering experiment on La 0.7 Ca 0.3 MnO 3 Dai et al. discovered that the magnetic excitations (spin waves) appeared to show considerable softening on approaching the Brillouin zone boundary. This softening appeared to occur when the spin wave dispersion relation crossed a number of flat optic phonon branches, and the possibility exists for interaction/hybridisation with the phonons. In order to separate the magnetic spin waves from the lattice dynamical phonons we have carried out an inelastic polarised neutron scattering study using the IN20 triple axis spectrometer at the Institut Laue Langevin, Grenoble, France. Because La 0.7 Ca 0.3 MnO 3 is a ferromagnet and our principle aim is to separate magnetic from lattice dynamical excitations we have been able to use a novel 'half-polarised' configuration for the spectrometer, originally developed by Holden and Stirling, which boosts the signal by a factor of ∼ 10x. The technique used and the results for La 0.7 Ca 0.3 MnO 3 will be described

Hierarchical La0.7Ce0.3FeO3/halloysite nanocomposite for photocatalytic degradation of antibiotics

Science.gov (United States)

Li, Xiazhang; Zhu, Wei; Yan, Xiangyu; Lu, Xiaowang; Yao, Chao; Ni, Chaoying

2016-08-01

The hierarchical La0.7Ce0.3FeO3/halloysite nanotubes (HNTs) composites have been successfully prepared via sol-gel method. XRD and TEM characterizations indicated that the sheet-like La0.7Ce0.3FeO3 coupled with the co-precipitated CeO2 were evenly deposited onto the surface of halloysite. The photocatalytic degradation of chlortetracycline under visible light irradiation using La0.7Ce0.3FeO3/HNTs as catalyst was evaluated by high-performance liquid chromatography, which exhibited remarkable photocatalytic activity with the removal rate up to 99 % in 90 min, due to the formation of "solid solution/co-precipitation" heterostructure as well as the excellent adsorptive capability of halloysite for antibiotics.

Hierarchical La0.7Ce0.3FeO3/halloysite nanocomposite for photocatalytic degradation of antibiotics

International Nuclear Information System (INIS)

Li, Xiazhang; Yao, Chao; Zhu, Wei; Yan, Xiangyu; Lu, Xiaowang; Ni, Chaoying

2016-01-01

The hierarchical La 0.7 Ce 0.3 FeO 3 /halloysite nanotubes (HNTs) composites have been successfully prepared via sol-gel method. XRD and TEM characterizations indicated that the sheet-like La 0.7 Ce 0.3 FeO 3 coupled with the co-precipitated CeO 2 were evenly deposited onto the surface of halloysite. The photocatalytic degradation of chlortetracycline under visible light irradiation using La 0.7 Ce 0.3 FeO 3 /HNTs as catalyst was evaluated by high-performance liquid chromatography, which exhibited remarkable photocatalytic activity with the removal rate up to 99 % in 90 min, due to the formation of ''solid solution/co-precipitation'' heterostructure as well as the excellent adsorptive capability of halloysite for antibiotics. (orig.)

Isothermal Kinetics of Diesel Soot Oxidation over La0.7K0.3ZnOy Catalysts

Directory of Open Access Journals (Sweden)

Ram Prasad

2014-10-01

Full Text Available This paper describes the kinetics of catalytic oxidation of diesel soot with air under isothermal conditions (320-350 oC. Isothermal kinetics data were collected in a mini-semi-batch reactor. Experiments were performed over the best selected catalyst composition La0.7K0.3ZnOy prepared by sol-gel method. Characterization of the catalyst by XRD and FTIR confirmed that La1-xKxZnOy did not exhibit perovskite phase but formed mixed metal oxides. 110 mg of the catalyst-soot mixture in tight contact (10:1 ratio was taken in order to determine the kinetic model, activation energy and Arrhenius constant of the oxidation reaction under the high air flow rate assuming pseudo first order reaction. The activation energy and Arrhenius constant were found to be 138 kJ/mol and 6.46x1010 min-1, respectively. © 2014 BCREC UNDIP. All rights reservedReceived: 26th April 2014; Revised: 27th May 2014; Accepted: 28th June 2014How to Cite: Prasad, R., Kumar, A., Mishra, A. (2014. Isothermal Kinetics of Diesel Soot Oxidation over La0.7K0.3ZnOy Catalysts. Bulletin of Chemical Reaction Engineering & Catalysis, 9(3: 192-200. (doi: 10.9767/bcrec.9.3.6773.192-200Permalink/DOI: http://dx.doi.org/10.9767/bcrec.9.3.6773.192-200

Laponite Na+0.7[(Si8Mg5.5Li0.3)O20(OH)4]–0.7

Indian Academy of Sciences (India)

Si8Mg5.5Li0.3)O20(OH)4]–0.7. Negative charges are counterbalanced by Na+ ions present in the interlayer. Electrostatic screening length at pH 10 ≈30 nm. Effective maximum volume increases by a factor of 60. Thus, for less than 1 volume ...

L'analyse par activation de neutrons de réacteur

Science.gov (United States)

Meyer, G.

2003-02-01

Quand les neutrons traversent la matière, certains sont transmis sans interaction, les autres interagissent avec le milieu traversé par diffusion et par absorption. Ce phénomène d'absorption est utilisé pour se protéger des neutrons, mais aussi pour les détecter; il peut également être utilisé pour identifier les noyaux “absorbants" et ainsi analyser le milieu traversé. En effet par différentes réactions nucléaires (n,γ), (n,p), (n,α), (n,fission), on obtient des noyaux résiduels qui sont souvent radioactifs; on dit que l'échantillon est “activé". Si l'on connaît le rendement d'activation et donc le pourcentage de noyaux ainsi “transmutés", les mesures de radioactivité induite vont permettre de déterminer la composition de l'échantillon irradié. Cette méthode dite d'analyse par activation neutronique est pratiquée depuis la découverte du neutron. Elle a permis grâce à sa sélectivité et à sa sensibilité d'avoir accès au domaine des traces et des ultra-traces dans des champs d'application très divers comme la métallurgie, l'archéologie, la biologie, la géochimie etc...

Synthesis and performance of LiMn0.7Fe0.3PO4 cathode material for lithium ion batteries

International Nuclear Information System (INIS)

Chang Xiaoyan; Wang Zhixing; Li Xinhai; Zhang Long; Guo Huajun; Peng Wenjie

2005-01-01

Pure and carbon-containing olivine LiMn 0.7 Fe 0.3 O 4 were synthesized at 600 deg. C by the method of solid-state reaction. Structure, surface morphology and charge/discharge performance of LiMn 0.7 Fe 0.3 O 4 were characterized by X-ray diffraction, scanning electron microscopy, and electrochemical measurement, respectively. The prepared materials with and without carbon both show the single olivine structure. The morphologies of primary particles are greatly affected by the addition of carbon. Large particles (500-1000 nm) and densely sintered blocks were observed in pure LiMn 0.7 Fe 0.3 PO 4 , which made the insertion and extraction of lithium ions difficult. Battery made from this sample can not charge and discharge effectively. The carbon-containing LiMn 0.7 Fe 0.3 PO 4 has a small particle size (100-200 nm) and a regular appearance. This material demonstrates high reversible capacity of about 120 mAh g -1 , perfect cycling performance, and excellent rate capability. It is obvious that the addition of carbon plays an important role in restricting the particle size of the material, which helps to prepare LiMn 0.7 Fe 0.3 PO 4 with excellent electrochemical performance. The electrochemical reaction resistance is much lower in the partly discharged state than in the fully charged or fully discharged state by the measurement of ac impedance for carbon-containing LiMn 0.7 Fe 0.3 PO 4 . It is indicated that the mixed-valence of Fe 3+ /Fe 2+ or Mn 3+ /Mn 2+ is beneficial to the transfer of electron which happens between the interface

Hydrogen storage and microstructure investigations of La0.7-xMg0.3PrxAl0.3Mn0.4Co0.5Ni3.8 alloys

International Nuclear Information System (INIS)

Galdino, G.S.; Casini, J.C.S.; Ferreira, E.A.; Faria, R.N.; Takiishi, H.

2010-01-01

The effects of substitution of Pr for La in the hydrogen storage capacity and microstructures of La 0.7-x Pr x Mg 0.3 Al 0.3 Mn 0.4 Co 0.5 Ni 3.8 (x=0, 0.1, 0.3, 0.5, 0.7) alloys electrodes have been studied. X-ray diffraction (XRD), scanning electron microscopy, energy dispersive spectrometry (EDS) and electrical tests were carried out in a the alloys and electrodes. Cycles of charge and discharge have also been carried out in the Ni/MH (Metal hydride) batteries based on the alloys negative electrodes. (author)

Chemical, profile and laboratory analysis oceanographic data collected aboard the Ferrel in the Gulf of Mexico from 2010-07-03 to 2010-07-07 in response to the Deepwater Horizon Oil Spill event (NODC Accession 0074854)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Chemical, profile and laboratory analysis oceanographic data were collected aboard the Ferrel in the Gulf of Mexico from 2010-07-03 to 2010-07-07 in response to the...

40 CFR 417.122 - Effluent limitations guidelines representing the degree of effluent reduction attainable by the...

Science.gov (United States)

2010-07-01

... COD 4.05 1.35 TSS 0.09 .03 Surfactants 0.90 .30 Oil and grease 0.15 .05 pH (1) (1) English units (pounds per 1,000 lb of anhydrous product) BOD5 0.90 0.30 COD 4.05 1.35 TSS 0.09 .03 Surfactants 0.90 .30... technology currently available. 417.122 Section 417.122 Protection of Environment ENVIRONMENTAL PROTECTION...

40 CFR 417.132 - Effluent limitations guidelines representing the degree of effluent reduction attainable by the...

Science.gov (United States)

2010-07-01

...) BOD5 0.90 0.30 COD 4.05 1.35 TSS 0.09 .03 Surfactants 0.90 .30 Oil and grease 0.15 .05 pH (1) (1) English units (pounds per 1,000 lb of anhydrous product) BOD5 0.90 0.30 COD 4.05 1.35 TSS 0.09 .03... technology currently available. 417.132 Section 417.132 Protection of Environment ENVIRONMENTAL PROTECTION...

40 CFR 417.102 - Effluent limitations guidelines representing the degree of effluent reduction attainable by the...

Science.gov (United States)

2010-07-01

...) BOD5 0.90 0.30 COD 4.05 1.35 TSS 0.09 .03 Surfactants 0.90 .30 Oil and grease 0.15 .05 pH (1) (1) English units (pounds per 1,000 lb of anhydrous product) BOD5 0.90 0.30 COD 4.05 1.35 TSS 0.09 .03... technology currently available. 417.102 Section 417.102 Protection of Environment ENVIRONMENTAL PROTECTION...

37 CFR 1.417 - Submission of translation of international publication.

Science.gov (United States)

2010-07-01

... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Submission of translation of... Provisions General Information § 1.417 Submission of translation of international publication. The submission of an English language translation of the publication of an international application pursuant to 35...

Unigene BLAST: CBRC-DMEL-03-0071 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-03-0071 gnl|UG|Dm#S40593121 DMG1C.2_1.G07.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.3.082.a, mRNA sequence /clone=DMG1-chr3R.3.082.a /gb=EW713160 /gi=156142114 /ug=Dm.27906 /len=1533 3e-07 47% ...

Symmetry breaking and electrical conductivity of La0.7Sr0.3Cr0.4Mn0.6O3-δ perovskite as SOFC anode material

International Nuclear Information System (INIS)

Reyes-Rojas, A.; Alvarado-Flores, J.; Esparza-Ponce, H.; Esneider-Alcala, M.; Espitia-Cabrera, I.; Torres-Moye, E.

2011-01-01

Research highlights: → Perovskite-type La 0.7 Sr 0.3 Cr 0.4 Mn 0.6 O 3-δ -NiO nucleation kinetics. Symmetry-breaking by introducing Ni 2+ cations at 1050 deg. C. Phase transition from high temperature aristotype R3-bar c to hettotype I4/mmm. At low Ni concentration ρ resistivity decreases when increasing the temperature. For Ni concentration higher than 25% ρ resistivity increases. - Abstract: This work is focused on nanocrystalline solid oxide fuel cell synthesis and characterization (SOFC) anodes of La 0.7 Sr 0.3 Cr 0.4 Mn 0.6 O 3-δ (perovskite-type) with Nickel. Perovskite-type oxide chemical reactivity, nucleation kinetics and phase composition related with La 0.7 Sr 0.3 Cr 0.4 Mn 0.6 O 3-δ -NiO to La 0.7 Sr 0.3 Cr 0.4 Mn 0.6 O 3-δ -Ni transformation have been analyzed. SOFC anode powders were obtained by sol-gel synthesis, using polyvinyl alcohol as an organic precursor to get a porous cermet electrode after sintering at 1365 deg. C and oxide reduction by hydrogen at 800 deg. C/1050 deg. C for 8 h in a horizontal tubular reactor furnace under 10% H 2 /N 2 atmosphere. Composite powders were compressed into 10-mm diameter discs with 25-75 wt% Ni. Electrical and structural characterization by four-point probe method for conductivity, scanning electron microscopy (SEM), X-ray energy dispersive spectroscopy (EDS), X-ray diffraction (XRD), and Rietveld method were carried out. Symmetry-breaking by phase transition from high temperature aristotype R3-bar c to hettotype I4/mmm has been identified and confirmed by XRD and Rietveld method which can be produced by introducing Ni 2+ cations in the perovskite solid solution. Rietveld analysis suggests that Ni contents are directly proportional to La 0.7 Sr 0.3 Cr 0.4 Mn 0.6 NiO 3.95 tetragonal structure cell volume and inversely proportional to Ni cubic structure cell volume after reduction at 1050 deg. C. Kinetic analysis indicated that the Johnson-Mehl-Avrami equation is able to provide a good fit to phase

Tuning the magnetocaloric properties of La0.7Ca0.3MnO3 manganites through Ni-doping

Science.gov (United States)

Gómez, A.; Chavarriaga, E.; Supelano, I.; Parra, C. A.; Morán, O.

2018-04-01

The effect of Ni2+ doping on the magnetic and magnetocaloric properties of La0.7Ca0.3MnO3 manganites synthesized via the auto-combustion method is reported. The aim of studying Ni2+-substituted La0.7Ca0.3Mn1 - xNixO3 (x = 0 , 0.02 , 0.07, and 0.1) manganites was to explore the possibility of increasing the operating temperature range for the magnetocaloric effect through tuning of the magnetic transition temperature. X-ray diffraction analysis confirmed the phase purity of the synthesized samples. The substitution of Mn3+ ions by Ni2+ ions in the La0.7Ca0.3MnO3 lattice was also corroborated through this technique. The dependence of the magnetization on the temperature reveals that all the compositions exhibit a well-defined ferromagnetic to paramagnetic transition near the Curie temperature. A systematic decrease in the values of the Curie temperature is clearly observed upon Ni2+ doping. Probably the replacement of Mn3+ by Ni2+ ions in the La0.7Ca0.3MnO3 lattice weakens the Mn3+-O-Mn4+ double exchange interaction, which leads to a decrease in the transition temperature and the magnetic moment in the samples. By using Arrott plots, it was found that the phase transition from ferromagnetic to paramagnetic is second order. The maximum magnetic entropy changes observed for the x = 0 , 0.02 , 0.07, and 0.1 composites was 0.85, 0.77, 0.63, and 0.59 J/kg K, respectively, under a magnetic field of 1.5 T. In general, it was verified that the magnetic entropy change achieved for La0.7Ca0.3Mn1 - xNixO3 manganites synthesized via the auto-combustion method is higher than those reported for other manganites with comparable Ni2+-doping levels synthesized via standard solid state reaction. The addition of Ni2+ increases the value of the relative cooling power as compared to that of the parent compound. The highest value of this parameter (∼60 J/kg) is found for a Ni-doping level of 2% around 230 K in a field of 1.5 T.

Synthesis, characterization and formaldehyde gas sensitivity of La{sub 0.7}Sr{sub 0.3}FeO{sub 3} nanoparticles assembled nanowires

Energy Technology Data Exchange (ETDEWEB)

Yao Pengjun [School of Electronic Science and Technology, Dalian University of Technology, Dalian 116023 (China); School of Educational Technology, Shenyang Normal University, Shenyang 110034 (China); Wang Jing, E-mail: wangjing@dlut.edu.cn [School of Electronic Science and Technology, Dalian University of Technology, Dalian 116023 (China); Du Haiying [School of Electronic Science and Technology, Dalian University of Technology, Dalian 116023 (China); Department of Electromechanical Engineering and Information, Dalian Nationalities University, Dalian 116600 (China); Qi Jinqing [School of Electronic Science and Technology, Dalian University of Technology, Dalian 116023 (China)

2012-05-15

Highlights: Black-Right-Pointing-Pointer High aspect ratio La{sub 0.7}Sr{sub 0.3}FeO{sub 3} nanoparticles assembled nanowires were synthesized by a CTAB assisted hydrothermal method. Black-Right-Pointing-Pointer Formaldehyde with low concentration (0.1-100 ppm) was used for gas sensing study. Black-Right-Pointing-Pointer The growth mechanism of La{sub 0.7}Sr{sub 0.3}FeO{sub 3} nanowires was reported. - Abstract: La{sub 0.7}Sr{sub 0.3}FeO{sub 3} nanoparticles assembled nanowires were synthesized by a hydrothermal method assisted with cetyltrimethylammonium bromide (CTAB). The hydrothermal temperature was 180 Degree-Sign C and the annealed temperature was 700 Degree-Sign C. Scanning electron microscopy (SEM), transmission electron microscopy (TEM), X-ray diffraction (XRD) and X-ray photoelectron spectroscopy (XPS) were used to characterize the morphology, composition and structural properties of the materials. The results showed that the La{sub 0.7}Sr{sub 0.3}FeO{sub 3} nanoparticles assembled nanowires had a high aspect ratio (the largest aspect ratio >100); the size of the nanoparticles was about 20 nm and the diameter of the nanowires was about 100-150 nm. The growth mechanism of La{sub 0.7}Sr{sub 0.3}FeO{sub 3} nanowires was discussed. Gas sensors were fabricated by using La{sub 0.7}Sr{sub 0.3}FeO{sub 3} nanowires. Formaldehyde gas sensing properties were carried out in the concentration range of 0.1-100 ppm at the optimum operating temperature of 280 Degree-Sign C. The response and recovery times to 20 ppm formaldehyde of the sensor were 110 s and 50 s, respectively. The gas sensing mechanism of La{sub 0.7}Sr{sub 0.3}FeO{sub 3} nanowires was investigated.

L'urétroplastie par résection anastomose terminoterminale pour ...

African Journals Online (AJOL)

K.H. Sikpa

Résumé. Objectif : évaluer l'uretroplastie par résection anastomose terminoterminale (URAT) au CHU Sylvanus. Olympio de Lomé au Togo. Patients et méthodes : étude descriptive, rétrospective sur 30 mois, portant sur 34 patients qui ont subi une. URAT. Résultats : L'âge moyen des patients était de 44,79+/-15 ans.

Magnetic-entropy change in Mn1.1Fe0.9P0.7As0.3-xGe x

International Nuclear Information System (INIS)

Tegus, O.; Fuquan, B.; Dagula, W.; Zhang, L.; Brueck, E.; Si, P.Z.; Boer, F.R. de; Buschow, K.H.J.

2005-01-01

We have studied the magnetic properties and magnetic-entropy changes of Mn 1.1 Fe 0.9 P 0.7 As 0.3-x Ge x compounds with x = 0, 0.05, 0.1, 0.15 and 0.3. X-ray diffraction (XRD) study shows all the compounds crystallize in the Fe 2 P-type structure. Magnetic measurements show that the Curie temperature increases from 150 K for Mn 1.1 Fe 0.9 P 0.7 As 0.3 to 380 K for Mn 1.1 Fe 0.9 P 0.7 Ge 0.3 . A field-induced first-order magnetic phase transition is observed above the Curie temperature for the compounds with x up to 0.15. There exists an optimal composition in which the first-order phase transition is the sharpest. The optimal composition for this system is x = 0.1. The maximal magnetic-entropy change derived from the magnetization data is about 40 J/(kg K) for a field change from 0 to 3 T

Magnetic and magnetocaloric properties in Ba-doped La0.7Ca0.3MnO3 nanoparticles

International Nuclear Information System (INIS)

Thanh, Tran Dang; Linh, Dinh Chi; Uyen Tuyen, Ngo Thi; Phan, The-Long; Yu, Seong-Cho

2015-01-01

La 0.7 Ca 0.3−x Ba x MnO 3 nanoparticles with the crystalline size d = 38 and 39 nm for x = 0.025, and 0.05, respectively, were synthesized by utilizing the solid-state reaction and mechanical ball milling methods. We have used the Banerjee's criteria, the mean-field, and the thermodynamic theories, and isothermal magnetization, M(H), data around Curie temperature (T C ) to investigate the magnetic phase transformation and the temperature (T) and magnetic field (H) dependences of magnetic entropy change, ΔS m (T, H), for nanoparticles. These exhibit the samples undergoing a second-order magnetic phase transition with an existence of the short-range ferromagnetic order in the samples. Under an applied magnetic field change ΔH = 30 kOe, the maximum value of ΔS m (denoted as |ΔS max |) are obtained about 4.4 J kg −1 K −1 corresponding to a relative cooling power (RCP) value about 140 J kg −1 . Field dependences of |ΔS max | and RCP can be expressed by the power laws, |ΔS max | = a × H n and RCP = b × H N , where a and b are coefficients, n and N are the field exponents, respectively. Interestingly, all the ΔS m (T, H) curves measured at different applied fields are collapsed onto a universal curve, ΔS m (T, H)/ΔS max versus θ = (T − T C )/(T r − T C ), where T r is the reference temperature. - Highlights: • An existence of the short-range FM order in the La 0.7 Ca 0.3−x Ba x MnO 3 nanoparticles. • High magnetic entropy change, wide operative temperature range, and high RCP value. • Field dependences of |ΔS max | and RCP can be expressed by the power laws. • All the ΔS m (T, H) data are followed a universal master curve

Alloying behavior, microstructure and mechanical properties in a FeNiCrCo0.3Al0.7 high entropy alloy

International Nuclear Information System (INIS)

Chen, Weiping; Fu, Zhiqiang; Fang, Sicong; Xiao, Huaqiang; Zhu, Dezhi

2013-01-01

Highlights: • FeNiCrCo 0.3 Al 0.7 high entropy alloy is prepared via MA and SPS. • Two BCC phases and one FCC phase were obtained after SPS. • The two BCC phases are enriched in Fe–Cr (A2 structure) and enriched in Ni–Al (B2 structure). • Bulk FeNiCrCo 0.3 Al 0.7 HEA exhibits excellent mechanical properties. - Abstract: The present paper reports the synthesis of FeNiCrCo 0.3 Al 0.7 high entropy alloy (HEA) by mechanical alloying (MA) and spark plasma sintering (SPS) process. Alloying behavior, microstructure, mechanical properties and detailed phases of the alloy were investigated systematically. During MA, the formation of a supersaturated solid solution with body-centered cubic (BCC) structure occurred. However, partial BCC structure phase transformed into a face-center cubic (FCC) structure phase during SPS. Two BCC phases with nearly the same lattice parameter of 3.01 Å and one FCC phase with the lattice parameter of 3.72 Å were characterized in the transmission electron microscope (TEM) images. The two BCC phases which are evidently deviated from the definition of high entropy alloys (HEAs) are enriched in Fe–Cr and enriched in Ni–Al, respectively. Moreover, the FCC phase agrees well with the definition of HEAs. Bulk FeNiCrCo 0.3 Al 0.7 alloy with little porosity exhibits much better mechanical properties except compression ratio compared with other typical HEAs of FeNiCrCoAl HEA system. The yield strength, compressive strength, compression ratio and Vickers hardness of FeNiCrCo 0.3 Al 0.7 alloy are 2033 ± 41 MPa, 2635 ± 55 MPa, 8.12 ± 0.51% and 624 ± 26H v , respectively. The fracture mechanism of bulk FeNiCrCo 0.3 Al 0.7 alloy is dominated by intercrystalline fracture and quasi-cleavage fracture

Colossal magnetoresistance of bulk Ag-doped Nd{sub 0.7}Sr{sub 0.3}MnO{sub 3} two-phase composites

Energy Technology Data Exchange (ETDEWEB)

Cui Xugao [National Laboratory of Solid State Microstructures, Department of Physics, Nanjing University, Nanjing 210093 (China); Hu Xiukun [National Laboratory of Solid State Microstructures, Department of Physics, Nanjing University, Nanjing 210093 (China); Xia Hongxu [National Laboratory of Solid State Microstructures, Department of Physics, Nanjing University, Nanjing 210093 (China); Yu Jiangying [National Laboratory of Solid State Microstructures, Department of Physics, Nanjing University, Nanjing 210093 (China); Zhang Shiyuan [National Laboratory of Solid State Microstructures, Department of Physics, Nanjing University, Nanjing 210093 (China)]. E-mail: zsy@netra.nju.edu.cn

2005-05-17

We have prepared a series of bulk polycrystalline manganites with the nominal compositions, Nd{sub 0.7}Sr{sub 0.3}MnO{sub 3}-Ag {sub x} (x is the molar fraction) with x = 0.1, 0.2, 0.3, 0.4, 0.5 by conventional solid-state reaction. The X-ray diffraction patterns show that the sample Nd{sub 0.7}Sr{sub 0.3}MnO{sub 3} (x = 0) is a single-phase compound with the pseudocubic perovskite structure, while the Ag-doped samples are two-phase composites consisting of a ferromagnetic perovskite phase and a nonmagnetic Ag metal phase. For all the samples, the Curie temperature, T {sub C}, remains nearly the same (228 {+-} 2 K), but the maximum magnetoresistance in a magnetic field of 1 T at 222 K is enhanced strongly due to the addition of Ag, namely, from 45% for the Nd{sub 0.7}Sr{sub 0.3}MnO{sub 3} sample to 188, 277, 142, 158 and 151% for the Nd{sub 0.7}Sr{sub 0.3}MnO{sub 3}-Ag {sub x} samples with x = 0.1, 0.2, 0.3, 0.4, and 0.5, respectively. This magnetoresistance-enhancement phenomenon can be attributed to the spin-dependent scattering of the spin-polarized electrons at the interfaces between the perovskite grains and the Ag granules.

Tunneling Evidence of Half-Metallic Ferromagnetism in La(0.7)Ca(0.3)MnO(3)

Science.gov (United States)

Wei, J. Y. T.; Yeh, N. C.; Vasquez, R. P.

1997-01-01

Direct experimental evidence of half-metallic density of states (DOS) is observed by scanning tunneling spectroscopy on ferromagnetic La(0.7)Ca(0.3)MnO(3) which exhibits colossal magnetoresistance (SMR).

Properties measurements of (U{sub 0.7}Pu{sub 0.3})O{sub 2-x} in PO{sub 2}-controlled atmosphere

Energy Technology Data Exchange (ETDEWEB)

Kato, M.; Murakami, T.; Sunaoshi, T. [Advanced Nuclear System Research and Development Directorate, Japan Atomic Energy Agency, Muramatsu Tokai-mura Ibaraki, 319-1194 (Japan); Nelson, A.T.; McClellan, K.J. [Los Alamos National Laboratory, Los Alamos, New Mexico 87545 (United States)

2013-07-01

The investigation of physical properties of uranium and plutonium mixed oxide (MOX) fuels is important for the development of fast reactor fuels. It is well known that MOX is a nonstoichiometric oxide, and the physical properties change drastically with the Oxygen-to-Metal (O/M) ratio. A control technique for O/M ratio was established for measurements of high temperature properties of uranium and plutonium mixed oxide fuels. Sintering behavior, thermal expansion and O/M change of (U{sub 0.7}Pu{sub 0.3})O{sub 2.00} and (U{sub 0.7}Pu{sub 0.3})O{sub 1.99} were investigated in PO{sub 2}-controlled atmosphere which was controlled by H{sub 2}/H{sub 2}O gas system. Sintering behavior changed drastically with O/M ratio, and shrinkage of (U{sub 0.7}Pu{sub 0.3})O{sub 2.00} was faster and more advanced at lower temperatures as compared with (U{sub 0.7}Pu{sub 0.3})O{sub 1.99}. Thermal expansion was observed to be slightly increased with decreasing O/M ratio. (authors)

Effects of magnesium substitution on the magnetic properties of Nd0.7Sr0.3MnO3

International Nuclear Information System (INIS)

Tseggai, M.; Mathieu, R.; Nordblad, P.; Tellgren, R.; Bau, L.V.; Nam, D.N.H.; Phuc, N.X.; Khiem, N.V.; Andre, G.; Bouree, F.

2005-01-01

Effects of magnesium substitution on the magnetic properties of Nd 0.7 Sr 0.3 MnO 3 have been investigated by neutron powder diffraction and magnetization measurements on polycrystalline samples of composition Nd 0.7 Sr 0.3 MnO 3 , Nd 0.6 Mg 0.1 Sr 0.3 MnO 3 , Nd 0.6 Mg 0.1 Sr 0.3 Mn 0.9 Mg 0.1 O 3 , and Nd 0.6 Mg 0.1 Sr 0.3 Mn 0.8 Mg 0.2 O 3 . The pristine compound Nd 0.7 Sr 0.3 MnO 3 is ferromagnetic with a transition temperature occurring at about 210K. Increasing the Mg-substitution causes weakened ferromagnetic interaction and a great reduction in the magnetic moment of Mn. The Rietveld analyses of the neutron powder diffraction (NPD) data at 1.5K for the samples with Mg concentration, y=0.0 and 0.1, show ferromagnetic Mn moments of 3.44(4) and 3.14(4)μ B , respectively, which order along the [001] direction. Below 20K the Mn moments of these samples become canted giving an antiferromagnetic component along the [010] direction of about 0.4μ B at 1.5K. The analyses also show ferromagnetic polarization along [001] of the Nd moments below 50K, with a magnitude of almost 1μ B at 1.5K for both samples. In the samples with Mg substitution of 0.2 and 0.3 only short range magnetic order occurs and the magnitude of the ferromagnetic Mn moments is about 1.6μ B at 1.5K for both samples. Furthermore, the low-temperature NPD patterns show an additional very broad and diffuse feature resulting from short range antiferromagnetic ordering of the Nd moments

Odlévání turbínových kol turbodmychadel ze slitin TiAl technologií přesného lití

Czech Academy of Sciences Publication Activity Database

Zemčík, L.; Dlouhý, Antonín; Umshaus, J.

2008-01-01

Roč. 56, č. 9-10 (2008), s. 417-421 ISSN 0037-6825 R&D Projects: GA ČR GA106/07/0762 Institutional research plan: CEZ:AV0Z20410507 Keywords : TiAl alloys * investment casting * turbocharger Subject RIV: JG - Metallurgy

Electrical and magnetic behavior of La0.7Ca0.3MnO3/La0.7Sr0.2Ca0.1MnO3 composites

International Nuclear Information System (INIS)

Phong, P.T.; Dai, N.V.; Manh, D.H.; Thanh, T.D.; Khiem, N.V.; Hong, L.V.; Phuc, N.X.

2010-01-01

The electrical transport properties and the magnetoresistance of La 0.7 Ca 0.3 MnO 3 /La 0.7 Sr 0.2 Ca 0.1 MnO 3 composites are investigated as a function of sintering temperature. On the basis of an analysis by X-ray powder diffraction and scanning electron microscopy we suggest that raising the sintering temperature enhanced the interfacial reaction and creates interfacial phases at the boundaries of the La 0.7 Ca 0.3 MnO 3 and La 0.7 Sr 0.2 Ca 0.1 MnO 3 . Results also show that in 3 kOe, and at the Curie temperature, the magnetoresistance value of 14% was observed for the composite sintered at 1300 o C. Based on the phenomenological equation for conductivity under a percolation approach, which depends on the phase segregation of ferromagnetic metallic clusters and paramagnetic insulating regions, we fitted the experimental resistivity-temperature data from 50-300 K and find that the activation barrier decreases as temperature is increased.

Crystalline and lattice matched Ba0.7Si0.3O layers on plane and vicinal Si(001) surfaces

International Nuclear Information System (INIS)

Zachariae, J.

2006-01-01

In this work the low temperature growth conditions of epitaxial and lattice-matched Ba 0.7 Sr 0.3 O layers on Si(100) were investigated using the combination of low energy electron diffraction (LEED), x-ray photoemission (XPS) and electron energy loss spectroscopy (EELS). With these methods crystallinity, stoichiometry and electronic structure of both occupied and unoccupied levels were studied as a function of layer thickness. Oxide layers were generated by evaporating the metals in oxygen ambient pressure with the sample at room temperature. Perfect crystallinity and lattice matching was only obtained starting with a preadsorbed monolayer (ML) of Sr or Ba at a concentration close to one monolayer. The XPS analysis shows that Ba 0.7 Sr 0.3 O as a high-K gate dielectric offers an adequate band gap, an appropriate band alignment and a atomically sharp interface to the Si(001) substrate. No silicide and silicate species, or SiO 2 formation at the interface after oxidation were found. To show that Ba 0.7 Sr 0.3 O is really appropriate to replace SiO 2 as a gate dielectric, first C-V and I-V curves of MOS-diodes with SrO, BaO and Ba 0.7 Sr 0.3 O as gateoxide were measured under ambient conditions. Besides other results, it turns out that the measured dielectric constant of Ba 0.7 Sr 0.3 O conforms with the expected value of ε ∼ 25 - 30. Exploring ways for self-organized structuring of insulating films, the possibility to produce replicas of step trains, given by a vicinal Si(001)-4 [110] surface, in layers of crystalline and perfectly lattice matched Ba 0.7 Sr 0.3 O were investigated. For this purpose high-resolution spot profile analyses in low-energy electron diffraction (SPA-LEED) both on flat Si(001) and on vicinal Si(001)-4 [110] were carried out. The G(S) analysis of these mixed oxide layers reveals a strong influence of local compositional fluctuations of Sr and Ba ions and their respective scattering phases, which appears as an unphysically large variation

Hierarchical La{sub 0.7}Ce{sub 0.3}FeO{sub 3}/halloysite nanocomposite for photocatalytic degradation of antibiotics

Energy Technology Data Exchange (ETDEWEB)

Li, Xiazhang; Yao, Chao [Changzhou University, Jiangsu Key Laboratory of Advanced Catalytic Materials and Technology, School of Petrochemical Engineering, Changzhou (China); Chinese Academy of Science, R and D Center of Xuyi Attapulgite Applied Technology, Xuyi (China); Zhu, Wei; Yan, Xiangyu [Changzhou University, Jiangsu Key Laboratory of Advanced Catalytic Materials and Technology, School of Petrochemical Engineering, Changzhou (China); Lu, Xiaowang [Chinese Academy of Science, R and D Center of Xuyi Attapulgite Applied Technology, Xuyi (China); Ni, Chaoying [University of Delaware, Center for Advanced Microscopy and Microanalysis, Newark, DE (United States)

2016-08-15

The hierarchical La{sub 0.7}Ce{sub 0.3}FeO{sub 3}/halloysite nanotubes (HNTs) composites have been successfully prepared via sol-gel method. XRD and TEM characterizations indicated that the sheet-like La{sub 0.7}Ce{sub 0.3}FeO{sub 3} coupled with the co-precipitated CeO{sub 2} were evenly deposited onto the surface of halloysite. The photocatalytic degradation of chlortetracycline under visible light irradiation using La{sub 0.7}Ce{sub 0.3}FeO{sub 3}/HNTs as catalyst was evaluated by high-performance liquid chromatography, which exhibited remarkable photocatalytic activity with the removal rate up to 99 % in 90 min, due to the formation of ''solid solution/co-precipitation'' heterostructure as well as the excellent adsorptive capability of halloysite for antibiotics. (orig.)

An experimental assessment of the upper elevational limit of flowering plants in the western Himalaya

Czech Academy of Sciences Publication Activity Database

Klimeš, Leoš; Doležal, Jiří

2010-01-01

Roč. 33, č. 3 (2010), s. 590-596 ISSN 0906-7590 R&D Projects: GA AV ČR IAA600050802; GA ČR GA206/03/1219 Institutional research plan: CEZ:AV0Z60050516 Keywords : species richness * vascular plants * species limits Subject RIV: EF - Botanics Impact factor: 4.417, year: 2010

The analysis of strain of giant magnetoresistive Pr0.7Sr0.3MnO3/La0.5Ca0.5MnO3/Pr0.7Sr0.3MnO-3 trilayers

International Nuclear Information System (INIS)

Wang Haiou; Liu Hao; Dai Ping; Tan Weishi; Wu Xiaoshan; Jia Quanjie; Li Xiaolong

2012-01-01

Pr 0.7 Sr 0.3 MnO 3 /La 0.5 Ca 0.5 MnO 3 /Pr 0.7 Sr 0.3 MnO 3 (PSMO/LCMO/PSMO) trilayers were deposited on (001)-oriented single crystal MgO by pulsed laser deposition. The thickness of both PSMO layers was 36 nm while the thickness of LCMO layer was 6, 12, 18, 24, 30 and 36 nm, respectively. Out-of-plane and in-plane lattice parameters of trilayers were obtained by using symmetric scanning and asymmetric scanning mode of high resolution X-ray diffraction. Strain states of trilayers have been studied. The results showed that strain relaxation states of trilayers were decided by bulk strain and Jahn-Teller (JT) strain together: The mechanism for strain relaxation in trilayers is different from that for tetragonal distortion. The competition between bulk strain and Jahn-Teller (JT) strain played an important role in the magnetotransport and magnetic properties of trilayers. (authors)

Pushing nanoparticles of La0.7Sr0.3MnO3

International Nuclear Information System (INIS)

Ma, Y.-R.; Liou Yung; Yao, Y.-D.

2004-01-01

Pushing nanoparticles of La 0.7 Sr 0.3 MnO 3 (LSMO) on a native SiO 2 surface using atomic force microscopy (AFM) in the tapping mode is presented. The pushing is accompanied by a repulsive tip-sample interaction between the AFM tip and the LSMO nanoparticles and the physisorption of the LSMO on the SiO 2 surface. The AFM images show scratch artifacts on the surface, indicating that artificial scratches are strongly related to the pushing of the LSMO nanoparticles. A possible approach to pushing nanoparticles is proposed

Residual and Progressive Aortic Regurgitation After Valve-Sparing Root Replacement: A Propensity-Matched Multi-Institutional Analysis in 764 Patients.

Science.gov (United States)

Kari, Fabian A; Doll, Kai-Nicolas; Hemmer, Wolfgang; Liebrich, Markus; Sievers, Hans-Hinrich; Richardt, Doreen; Reichenspurner, Hermann; Detter, Christian; Siepe, Matthias; Czerny, Martin; Beyersdorf, Friedhelm

2016-04-01

Residual/progressive aortic regurgitation (rAR, pAR) after valve-sparing aortic root replacement (V-SARR) can lead to reoperations. We sought to characterize risk factors of mild rAR and pAR after V-SARR in a multicenter cohort. The effect of additional cusp repair on valve function was analyzed using propensity matching. A total of 1,015 patients after V-SARR were identified with (n = 288, 28%) or without additional cusp/commissure repair (n = 727, 72%) at four cardiac units in Germany. A total of 764 patients fulfilling transthoracic echocardiography follow-up-criteria comprised the study cohort. Logistic regression was used for risk factor analysis with endpoints rAR, new onset AR, and pAR. t tests and analyses of variance were used for between-group differences. The effects of additional cusp repair on valve function were studied comparing propensity-matched quintiles. The incidence of rAR was 29%, with influencing factors aneurysm size (p = 0.07) and preoperative aortic valve function (p = 0.08). It was found more often among nonsyndromic patients (34% vs. 14%; OR, 0.4; p < 0.001). Progression of rAR was detectable in 30% after a mean of 4.3 years. The progression rate of rAR ∼ 0.3 grades per patient-year within the first 5 years. When quintiles identified by propensity score were compared, additional cusp repair was linked to new onset AR (p = 0.016) while it was not linked to rAR (p = 0.14) or pAR (p = 0.5). The incidences of rAR and pAR are considerable after V-SARR. Patients should be operated on before large aneurysms are present. New onset AR after an initially good functional result is more likely after an additional cusp repair, while rAR and pAR are not influenced by cusp repair. Copyright © 2016 The Society of Thoracic Surgeons. Published by Elsevier Inc. All rights reserved.

High field induced magnetic transitions in the Y0.7E r0.3F e2D4.2 deuteride

Science.gov (United States)

Paul-Boncour, V.; Guillot, M.; Isnard, O.; Hoser, A.

2017-09-01

The influence of the partial Er for Y substitution on the crystal structure and magnetic properties of YF e2D4.2 has been investigated by high field magnetization and neutron diffraction experiments. Y0.7E r0.3F e2D4.2 compound crystallizes in the same monoclinic structure as YF e2D4.2 described in P c (P1c1) space group with D atoms located in 18 different tetrahedral interstitial sites. A cell volume contraction of 0.6% is observed upon Er substitution, inducing large modification of the magnetic properties. Electronic effect of D insertion as well as lowering of crystal symmetry are important factors determining the magnetic properties of Fe sublattice, which evolves towards more delocalized behavior and modifying the Er-Fe exchange interactions. In the ground state, the Er and Fe moments are arranged ferrimagnetically within the plane perpendicular to the monoclinic b axis and with average moments mEr=6.4 (3 ) μBEr-1 and mFe=2.0 (1 ) μBFe-1 at 10 K. Upon heating, mEr decreases progressively until TEr=55 K . Between 55 K and 75 K, the Fe sublattice undergoes a first-order ferromagnetic-antiferromagnetic (FM-AFM) transition with a cell volume contraction due to the itinerant metamagnetic behavior of one Fe site. In the AFM structure, mFe decreases until the Néel temperature TN=125 K . At high field, two different types of field induced transitions are observed. The Er moments become parallel to the Fe one and saturates to the E r3 + free ion value, leading to an unusual field induced FM arrangement at a transition field BTrans of only 78 kG below 30 K. Then above TM0=66 K , an AFM-FM transition of the Fe sublattice, accompanied by a cell volume increase is observed. BTrans increases linearly versus temperature and with a larger d BTrans/d T slope than for YF e2D4.2 . This has been explained by the additional contribution of Er induced moments above BTrans.

Nanocrystalline composites of transition metal molybdate (Ni1-xCoxMoO4; x = 0, 0.3, 0.5, 0.7, 1) synthesized by a co-precipitation method as humidity sensors and their photoluminescence properties

Science.gov (United States)

Jeseentharani, V.; Dayalan, A.; Nagaraja, K. S.

2018-04-01

In this study, nanocrystalline transition metal nickel-cobalt molybdate (Ni1-xCoxMoO4, NiCM; x = 0, 0.3, 0.5, 0.7, 1) composites were prepared using a simple co-precipitation method. The composites were characterized by thermogravimetric/differential thermal analysis, Fourier transform-infrared spectroscopy, X-ray diffraction, scanning electron microscopy, and transmission electron microscopy. The NiCM composites were studied to determine their possible use as humidity sensors, and photoluminescence (PL) measurements were obtained. The sensing study was performed in environments with different relative humidity levels (5-98%). The maximum sensitivity of 18624 ± 168 was observed with the Ni0.7Co0.3MoO4 composite where the humidity could be calculated according to the relationship: Sf = R5%/R98%, where R5% and R98% are the dc resistances at 5 and 98% RH, respectively. The photoluminescence measurements acquired at room temperature for the NiCMs included green and red emission peaks when excited at a wavelength (λex) of 520 nm.

Isotope exchange of molecular oxygen with oxygen of La0,7Sr0,3CoO3-δ

International Nuclear Information System (INIS)

Vdovin, G.K.; Kuzin, B.L.; Kurumchin, Eh.Kh.

1991-01-01

The exchange rate of the oxygen in La 0,7 Sr 0,3 CoO 3-δ has been measured by an isotopic exchange method at temperatures 620-1250 K and pressures 1.6-10 torr. The activation energy and the dependence of the exchange rate on pressures in gas have been defined. It is suggested that the knees on the temperature dependences of the exchange rate are attributed to the appearance of Co 2+ ions on the surface of the sample at elevated temperature as new centres of the exchange reaction. The activation energies of the adsorption and desorption processes on the La 0,7 Sr 0,3 CoO 3-δ surface have been estimated

40 CFR 417.10 - Applicability; description of the soap manufacturing by batch kettle subcategory.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 28 2010-07-01 2010-07-01 true Applicability; description of the soap... PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Soap Manufacturing by Batch Kettle Subcategory § 417.10 Applicability; description of the soap...

Electroresistive and magnetoresistive effects in electron doped manganite La0.7Ce0.3MnO3 thin films

International Nuclear Information System (INIS)

Bajaj, Kavita; Jesudasan, John; Bagwe, Vivas; Raychaudhuri, Pratap

2007-01-01

Full text: The influence of electric current and magnetic field separately and in conjugation on the transport behavior of patterned La 0.7 Ce 0.3 MnO 3 thin films on (001) LaAlO 3 substrate is studied. Measurements were carried out in the regime of low current densities, for dc currents. In absence of magnetic field significant reduction in peak resistance (R p ) was found with increasing bias current. This effect is also present when a magnetic field is applied though the magnitude of the electroresistance (ER=(R(I=0.05μA)-R(I=50μA))/R(I=50μA)) decreases. The metal-insulator transition temperature (T p ) increases both with increasing current and with magnetic field. The current-voltage characteristics at various temperatures above and below T p show nonlinearity for small currents due to electroresistance and large currents due to Joule heating. The behavior of resistance with current is similar at various temperatures decreasing initially with increasing current and then nearly leveling off. We observe an interesting correlation between effect of electric current and magnetic field. The magnetoresistance (MR (R H=0 -R H=1T )/R H=0 ) decreases with increasing bias current, while ER decreases with increasing magnetic field. Both ER and MR show a maximum near T p . This interesting correlation between these two effects suggests that both these effects suggests that both these effects arise from the same origin

Anisotropic and excellent magnetocaloric properties of La0.7Ca0.3MnO3 single crystal with anomalous magnetization

International Nuclear Information System (INIS)

Debnath, J.C.; Zeng, R.; Kim, J.H.; Chen, D.P.; Dou, S.X.

2012-01-01

Highlights: ► ΔS M shows a very large reversibility value at low field. ► The single crystal exhibits anisotropy in the MCE. ► La 0.7 Ca 0.3 MnO 3 is weakly itinerant ferromagnetic. ► No hysteresis loss is observed. - Abstract: Magnetic properties and the magnetocaloric effect (MCE) have been investigated in La 0.7 Ca 0.3 MnO 3 single crystal with applied field along both the ab-plane and the c-direction. Due to the magnetocrystalline anisotropy, the crystal exhibits anisotropy in the MCE. Upon application of a 5 T field, the magnetic entropy changes (ΔS M ), reaching values of 7.668 J/(kg K) and 6.412 J/(kg K) for both the ab-plane and the c-direction, respectively. A magnetic entropy change of 3.3 J/(kg K) was achieved for a magnetic field change of 1.5 T at the Curie temperature, T C = 245 K. Due to the absence of grains in the single crystal, the ΔS M distribution here is much more uniform than for gadolinium (Gd) and other polycrystalline manganites, which is desirable for an Ericsson-cycle magnetic refrigerator. For a field change of 5 T, the relative cooling power, RCP, reached 358.17 J/kg, while the maximum adiabatic temperature change of 5.33 K and a magnetoresistance (MR) ratio of 507.88% at T C were observed. We analysed the magnetization of La 0.7 Ca 0.3 MnO 3 single crystal at T C and estimated several parameters of spin fluctuation on the basis of a self-consistent renormalization theory of spin fluctuations, with reciprocal susceptibility above T C . We found that the magnetic property of La 0.7 Ca 0.3 MnO 3 is weakly itinerant ferromagnetic. A large reversible MCE and no hysteresis loss with a considerable value of refrigerant capacity indicate that La 0.7 Ca 0.3 MnO 3 single crystal is a potential candidate as a magnetic refrigerant.

Surface and bulk electronic structures of unintentionally and Mg-doped In0.7Ga0.3N epilayer by hard X-ray photoelectron spectroscopy

Science.gov (United States)

Imura, Masataka; Tsuda, Shunsuke; Takeda, Hiroyuki; Nagata, Takahiro; Banal, Ryan G.; Yoshikawa, Hideki; Yang, AnLi; Yamashita, Yoshiyuki; Kobayashi, Keisuke; Koide, Yasuo; Yamaguchi, Tomohiro; Kaneko, Masamitsu; Uematsu, Nao; Wang, Ke; Araki, Tsutomu; Nanishi, Yasushi

2018-03-01

The surface and bulk electronic structures of In0.7Ga0.3N epilayers are investigated by angle-resolved hard X-ray photoelectron spectroscopy (HX-PES) combined with soft X-PES. The unintentionally and Mg-doped In0.7Ga0.3N (u-In0.7Ga0.3N and In0.7Ga0.3N:Mg, respectively) epilayers are grown by radio-frequency plasma-assisted molecular beam epitaxy. Here three samples with different Mg concentrations ([Mg] = 0, 7 × 1019, and 4 × 1020 cm-3) are chosen for comparison. It is found that a large downward energy band bending exists in all samples due to the formation of a surface electron accumulation (SEA) layer. For u-In0.7Ga0.3N epilayer, band bending as large as 0.8 ± 0.05 eV occurs from bulk to surface. Judged from the valence band spectral edge and numerical analysis of energy band with a surface quantum well, the valence band maximum (VBM) with respect to Fermi energy (EF) level in the bulk is determined to be 1.22 ± 0.05 eV. In contrast, for In0.7Ga0.3N:Mg epilayers, the band bending increases and the VBM only in the bulk tends to shift toward the EF level owing to the Mg acceptor doping. Hence, the energy band is considered to exhibit a downward bending structure due to the coexistence of the n+ SEA layer and Mg-doped p layer formed in the bulk. When [Mg] changes from 7 × 1019 to 4 × 1020 cm-3, the peak split occurs in HX-PES spectra under the bulk sensitive condition. This result indicates that the energy band forms an anomalous downward bending structure with a singular point due to the generation of a thin depleted region at the n+ p interface. For In0.7Ga0.3N:Mg epilayers, the VBM in the bulk is assumed to be slightly lower than EF level within 0.1 eV.

Impedance and magnetoelectric characteristics of (1 - x)BaTiO3- xLa0.7Sr0.3MnO3 ( x = 0.1 and 0.3) nano-composites

Science.gov (United States)

Nayek, C.; Murugavel, P.; Dinesh Kumar, S.; Subramanian, V.

2015-08-01

We have synthesized the phase-pure (1 - x)BaTiO3- xLa0.7Sr0.3MnO3 ( x = 0.1 and 0.3) magnetoelectric composites without interdiffusion among the existing phases. The magnetic measurements revealed an anomaly at the ferroelectric Curie temperature (393 K) of BaTiO3, and the dielectric data revealed an anomaly at the ferromagnetic transition temperature (360 K) of La0.7Sr0.3MnO3 ascertaining the magnetoelectric coupling in the composite. Impedance analysis indicated dipolar polarization contributions to the dielectric spectrum with two non-Debye-type relaxations. Both the grain and grain boundary contributions were present in the system with dominant grain boundary effect in all the composites. The composites show semiconducting behavior with the barrier hopping-type conducting mechanism. To avoid the free charge carrier and the space charge contributions, the magnetoelectric response was measured at high frequency range. The maximum values of magnetoelectric voltage coefficient measured at 100 kHz were 221 and 219 mV/Oe-cm for x = 0.1 and 0.3 samples, respectively.

40 CFR 417.30 - Applicability; description of the soap manufacturing by fatty acid neutralization subcategory.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 28 2010-07-01 2010-07-01 true Applicability; description of the soap... ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Soap Manufacturing by Fatty Acid Neutralization Subcategory § 417.30 Applicability...

Effect of calcination temperature on microstructure, dielectric, magnetic and optical properties of Ba0.7La0.3Fe11.7Co0.3O19 hexaferrites

International Nuclear Information System (INIS)

Kaur, Talwinder; Kaur, Barjinder; Bhat, Bilal H.; Kumar, Sachin; Srivastava, A.K.

2015-01-01

M-type barium hexaferrite Ba 0.7 La 0.3 Fe 11.7 Co 0.3 O 19 (BaLCM) powder, synthesized using sol gel auto combustion method, heat treated at 700, 900, 1100 and 1200 °C. X ray diffraction (XRD) powder patterns of heat treated samples show the formation of pure phase of M-type hexaferrite after 700 °C. Thermo gravimetric analysis (TGA) reveals that the weight loss of BaLCM becomes constant after 680 °C. The presence of two prominent peaks, at 432 cm −1 and 586 cm −1 in Fourier Transform Infrared Spectroscopy (FT-IR) spectra, gives the idea of formation of M-type hexaferrites. The M–H curve obtained from Vibrating Sample Magnetometer (VSM) were used to calculate saturation magnetization (M S ), retentivity (M r ), squareness ration (SR) and coercivity (H c ). The maximum value of coercivity (5602 Oe) is found at 900 °C. The band gap dependency on temperature was studied using UV–vis NIR spectroscopy. The dielectric constant has been found to be high at low frequency but it decreases with increase in frequency. Such kind of dielectric behavior is explained on the basis of Koop's phenomenological theory and Maxwell Wagner theory

MCSA Windows Server 2012 R2 complete study guide exams 70-410, 70-411, 70-412, and 70-417

CERN Document Server

Panek, William

2014-01-01

Prepare for the MCSA Windows Server 2012 R2 Exams Microsoft's new version of the MCSA certification for WindowsServer 2012 R2 requires passing three exams (or one Upgrade exam ifyou have your MCSA or MCITP in Windows Server 2008). Thisvalue-priced study guide includes more than 1,000 pages of qualityexam-prep content, covering 100% of the objective domains of allthree exams (as well as the Upgrade exam, 70-417). In addition, you get access to an interactive practice testenvironment with more than 500 questions, electronic flashcards,and videos showing how to perform the more difficult tasks.

Temperature dependence of colossal electro-resistance of Pr0.7Ca0.3MnO3 thin films

International Nuclear Information System (INIS)

Odagawa, A.; Kanno, T.; Adachi, H.; Sato, H.; Inoue, I.H.; Akoh, H.; Kawasaki, M.; Tokura, Y.

2005-01-01

The electronic conduction through a Pr 0.7 Ca 0.3 MnO 3 thin film is investigated by measurements using dc and pulsed bias. Pr 0.7 Ca 0.3 MnO 3 films sandwiched by electrodes exhibit two stable resistance states by means of applying voltage pulses. Both of the states show semiconducting behavior. The ratio of the two resistance states induces a colossal electro-resistance (CER) effect greater than 1000%. The CER behavior is seen in the temperature range of 300 K down to 150 K. The observed conduction characteristics exhibit the space-charge-limited-current effect, and the switching behavior can be ascribed to a carrier trapping/detrapping of the trap sites in the perovskite manganite

Structural features and high-temperature transport in SrFe0.7Mo0.3O3-δ

Science.gov (United States)

Merkulov, O. V.; Markov, A. A.; Patrakeev, M. V.; Leonidov, I. A.; Shalaeva, E. V.; Tyutyunnik, A. P.; Kozhevnikov, V. L.

2018-02-01

The complex oxide SrFe0.7Mo0.3O3-δ was obtained by combustion of the organometallic precursor in air followed by annealing in an argon flow at 1350 °C, and characterized with the help of X-ray and electron diffraction methods. Oxygen nonstoichiometry and electrical conductivity data were collected in the oxygen partial pressure range from 10-19 to 0.5 atm at temperatures 750-950 °C. The as-prepared single phase oxide SrFe0.7Mo0.3O3-δ with the cubic double perovskite structure (SG Fm3m) is shown to undergo a structural transition to the tetragonal double perovskite phase (SG I4mmm) in the result of reducing treatment at pO2 = 10-12 atm and 950 °C. The ordered phases are characterized by a strong anti-site disordering of iron and molybdenum and nearly zero long-range ordering parameter. The maximal concentration of n-type carriers is about four times larger than of p-type carriers in the studied limits of oxygen pressure and temperature. The mobility of p-type carriers is found to vary within 0.02-0.03 cm2 V-1 s-1 with the migration energy of about 0.4 eV, while the n-type mobility being approximately twice higher does not practically depend on temperature. Such features as good electrical conductivity, which can rise up to 40 S cm-1 in reducing conditions and a considerable amount of oxygen vacancies favorable for fast oxygen ion transport are beneficial for application of SrFe0.7Mo0.3O3-δ as anode material in SOFCs and oxygen membrane for hydrogen generation by a water splitting.

Unigene BLAST: CBRC-DMEL-03-0012 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-03-0012 gnl|UG|Dm#S40593121 DMG1C.2_1.G07.C1 MODENCODE_DM_A Drosophila melanogaster cDNA clone DMG...1-chr3R.3.082.a, mRNA sequence /clone=DMG1-chr3R.3.082.a /gb=EW713160 /gi=156142114 /ug=Dm.27906 /len=1533 0.64 34% ...

22 Sanou_F 03.pmd

African Journals Online (AJOL)

hond

comment le masque peut être analysé comme une institution. Passé le .... de la littérature moderne », il retient trois auteurs dont les œuvres théoriques vont jeter les ... mation ». L'édition est une activité à cheval entre le culturel et le commercial et ..... ment elle est réalisée, le processus par lequel l'artiste la crée. • Etape 3 ...

Magnetic resonances spectroscopy of nanosize particles La0.7Sr0.3MnO3

International Nuclear Information System (INIS)

Krivoruchko, Vladimir; Konstantinova, Tat'yana; Mazur, Anton; Prokhorov, Andrey; Varyukhin, Victor

2006-01-01

Using a co-precipitation method, perovskite-type manganese oxide La 0.7 Sr 0.3 MnO 3 nanoparticles (NPs) with particle size 12 nm were prepared. Detailed studies of both 55 Mn nuclear magnetic resonance and superparamagnetic resonance spectrum, completed by magnetic measurements, have been performed to obtain microscopic information on the local magnetic structure of the NP. Our results on nuclear dynamics provide direct evidence of formation of a magnetically dead layer, of the thickness ∼2 nm, at the particle surface. Temperature dependences of the magnetic resonance spectra have been measured to obtain information about complex magnetic properties of La 0.7 Sr 0.3 MnO 3 fine-particle ensembles. In particular, electron paramagnetic resonance spectrum at 300 K shows a relatively narrow sharp line, but as the temperature decreases to 5 K, the apparent resonance field decreases and the line width considerably increases. The low-temperature blocking of the NPs magnetic moments has been clearly observed in the electron paramagnetic resonances. The blocking temperature depends on the measuring frequency and for the ensemble of 12 nm NPs at 9.244 GHz has been evaluated as 110 K

Éviter la reprise des conflits par des règlements politiques inclusifs ...

International Development Research Centre (IDRC) Digital Library (Canada)

Les États ayant réussi à s'extraire de la violence et à s'engager dans un processus de développement ont souvent commencé par conclure de bons règlements politiques, ou des pactes entre élites. Ceux-ci prennent parfois la forme d'accords de paix ou de coalitions électorales, voire simplement d'ententes non officielles ...

Neural Network Classifier Based on Growing Hyperspheres

Czech Academy of Sciences Publication Activity Database

Jiřina Jr., Marcel; Jiřina, Marcel

2000-01-01

Roč. 10, č. 3 (2000), s. 417-428 ISSN 1210-0552. [Neural Network World 2000. Prague, 09.07.2000-12.07.2000] Grant - others:MŠMT ČR(CZ) VS96047; MPO(CZ) RP-4210 Institutional research plan: AV0Z1030915 Keywords : neural network * classifier * hyperspheres * big -dimensional data Subject RIV: BA - General Mathematics

Effect of the annealing temperature of thin Hf0.3Zr0.7O2 films on their energy storage behavior

International Nuclear Information System (INIS)

Park, Min Hyuk; Kim, Han Joon; Kim, Yu Jin; Moon, Taehwan; Kim, Keum Do; Hwang, Cheol Seong

2014-01-01

With increasing annealing temperature (T anneal ), the magnitude of the electric fields for the antiferroelectric-to-ferro-electric (E AF ) and ferroelectric-to-antiferroelectric (E FA ) transition of a 9.2 nm thick Hf 0.3 Zr 0.7 O 2 film decreased. The energy storage densities of the Hf 0.3 Zr 0.7 O 2 films crystallized at 400 C, 500 C, and 600 C were as large as 42.2 J/cm 3 , 40.4 J/cm 3 , and 28.3 J/cm 3 , respectively, at the electric field of 4.35 MV/cm. The maximum dielectric constant of the Hf 0.3 Zr 0.7 O 2 film crystallized at 600 C was the largest (∝46) as it had the smallest E AF and E FA , whereas the leakage current density of the film crystallized at 400 C was the smallest. The 400 C of T anneal was the optimum condition for energy storage application. (copyright 2014 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

Nano-desorption electrospray and kinetic method in chiral analysis of clinical samples

Czech Academy of Sciences Publication Activity Database

Ranc, V.; Havlíček, Vladimír; Bednář, P.; Lemr, Karel

2008-01-01

Roč. 14, č. 6 (2008), s. 411-417 ISSN 1469-0667 R&D Projects: GA MŠk LC545; GA ČR GA203/07/0765 Institutional research plan: CEZ:AV0Z50200510 Keywords : nano-desorption electrospray * mass spectrometry * kinetic method Subject RIV: EE - Microbiology, Virology Impact factor: 1.167, year: 2008

Répercussions de la migration causée par les réformes agraires sur ...

International Development Research Centre (IDRC) Digital Library (Canada)

De récentes réformes agraires ont entraîné un phénomène unique de migration entre régions rurales dans le district de Chimanimani, au Zimbabwe. Les chercheurs vérifieront l'hypothèse selon laquelle les migrants sont fortement attirés par les ressources forestières dans les régions où ils s'établissent et verront s'il est ...

Interfacial magnetic coupling in ultrathin all-manganite La0.7Sr0.3MnO3-TbMnO3 superlattices

KAUST Repository

Tian, Y. F.

2014-04-14

We report the growth and magnetic properties of all-manganite superlattices composed of ultrathin double-exchange ferromagnetic La0.7Sr0.3MnO3 and noncollinear multiferroic TbMnO3 layers. Spontaneous magnetization and hysteresis loops are observed in such superlattices with individual La0.7Sr0.3MnO3 layers as thin as two unit cells, which are accompanied by pronounced exchange bias and enhanced coercivity. Our results indicate substantial interfacial magnetic coupling between spin sublattices in such superlattices, providing a powerful approach towards tailoring the properties of artificial magnetic heterostructures.

Interfacial magnetic coupling in ultrathin all-manganite La0.7Sr0.3MnO3-TbMnO3 superlattices

KAUST Repository

Tian, Y. F.; Lebedev, O. I.; Roddatis, V. V.; Lin, W. N.; Ding, J. F.; Hu, S. J.; Yan, S. S.; Wu, Tao

2014-01-01

We report the growth and magnetic properties of all-manganite superlattices composed of ultrathin double-exchange ferromagnetic La0.7Sr0.3MnO3 and noncollinear multiferroic TbMnO3 layers. Spontaneous magnetization and hysteresis loops are observed in such superlattices with individual La0.7Sr0.3MnO3 layers as thin as two unit cells, which are accompanied by pronounced exchange bias and enhanced coercivity. Our results indicate substantial interfacial magnetic coupling between spin sublattices in such superlattices, providing a powerful approach towards tailoring the properties of artificial magnetic heterostructures.

Hydrogen storage and microstructure investigations of La{sub 0.7-x}Mg{sub 0.3}Pr{sub x}Al{sub 0.3}Mn{sub 0.4}Co{sub 0.5}Ni{sub 3.8} alloys

Energy Technology Data Exchange (ETDEWEB)

Galdino, G.S.; Casini, J.C.S.; Ferreira, E.A.; Faria, R.N.; Takiishi, H., E-mail: agsgaldino@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (DM/IPEN-CNEN/SP), Sao Paulo, SP (Brazil). Dept. de Metalurgia

2010-07-01

The effects of substitution of Pr for La in the hydrogen storage capacity and microstructures of La{sub 0.7-x}Pr{sub x}Mg{sub 0.3}Al{sub 0.3}Mn{sub 0.4}Co{sub 0.5}Ni{sub 3.8} (x=0, 0.1, 0.3, 0.5, 0.7) alloys electrodes have been studied. X-ray diffraction (XRD), scanning electron microscopy, energy dispersive spectrometry (EDS) and electrical tests were carried out in a the alloys and electrodes. Cycles of charge and discharge have also been carried out in the Ni/MH (Metal hydride) batteries based on the alloys negative electrodes. (author)

Structural phase transition at the percolation threshold in epitaxial (La0.7Ca0.3MnO3)1-x:(MgO)x nanocomposite films.

Science.gov (United States)

Moshnyaga, V; Damaschke, B; Shapoval, O; Belenchuk, A; Faupel, J; Lebedev, O I; Verbeeck, J; van Tendeloo, G; Mücksch, M; Tsurkan, V; Tidecks, R; Samwer, K

2003-04-01

'Colossal magnetoresistance' in perovskite manganites such as La0.7Ca0.3MnO3 (LCMO), is caused by the interplay of ferro-paramagnetic, metal-insulator and structural phase transitions. Moreover, different electronic phases can coexist on a very fine scale resulting in percolative electron transport. Here we report on (LCMO)1-x:(MgO)x (0 strain. The largest colossal magnetoresistance of 10(5)% was observed at the percolation threshold in the conductivity at xc 0.3, which is coupled to a structural phase transition from orthorhombic (0 < x < or 0.1) to rhombohedral R3c structure (0.33 < or = x < or = 0.8). An increase of the Curie temperature for the Rc phase was observed. These results may provide a general method for controlling the magnetotransport properties of manganite-based composite films by appropriate choice of the second phase.

2018-03-29T07:13:34Z https://www.ajol.info/index.php/all/oai oai:ojs ...

African Journals Online (AJOL)

article/95913 2018-03-29T07:13:34Z rj:ART HIV/AIDS Management and The Mobile Workforce: A Case ... The HIV /AIDS pandemic has a peculiarity with persons employed in the security forces, health care delivery chain and students in hostels.

Histiocytose langerhansienne pulmonaire révélée par un pneumothorax: à propos d’un cas

Science.gov (United States)

Sajiai, Hafsa; Rachidi, Mariam; Serhane, Hind; Aitbatahar, Salma; Amro, Lamyae

2016-01-01

L’histiocytose langerhansienne est une affection rare d’étiologie inconnue caractérisée par une infiltration d’un ou plusieurs organes, par des cellules de type Langerhans. Elle a une présentation clinique polymorphe. Nous rapportons le cas de Mr R.Y, âgé de 22 ans, tabagique à 8 PA, admis pour pneumothorax total spontané droit. Un drainage thoracique a été réalisé avec bonne évolution. La TDM thoracique de contrôle a objectivé de multiples formations kystiques diffuses prédominant aux lobes supérieurs. Un bilan a été réalisé à la recherche d’une histiocytose systémique mais s’est révélé négatif. L’évolution était marquée par la récidive du pneumothorax, le recours à une pleurodèse et la réalisation d’une biopsie pulmonaire qui a confirmé le diagnostic. Le diagnostic de l’HistiocytoseLangerhansienne doit être évoqué devant un pneumothorax sur poumon kystique. Le diagnostic est aisé devant un tableau clinique et radiologique évocateur. Néanmoins, les possibilités thérapeutiques restent limitées et la récidive du pneumothorax est fréquente. PMID:28154724

Magnetically tunable alternating current electrical properties of x La0.7Sr0.3MnO3–(1 − x) ErMnO3 (x = 0.1, 0.3, and 0.5) multiferroic nanocomposite

International Nuclear Information System (INIS)

Debnath, Rajesh; Dey, P.; Singh, Swati; Roy, J. N.; Mandal, S. K.; Nath, T. K.

2015-01-01

Detailed magnetically tunable ac electrical properties of x La 0.7 Sr 0.3 MnO 3 (LSMO)–(1 − x) ErMnO 3 (EMO) (x = 0.1, 0.3, and 0.5) multiferroic nanocomposites have been studied at 300 K in presence of varying magnetic field (H appl ), applied both in parallel and perpendicular configuration with respect to the measuring electric field. AC electrical properties have exhibited significant variation with H appl for all composites, whereas for parallel configuration of H appl such effect is very feeble for x = 0.3 composite. We have attributed this anisotropic behavior to the demagnetization effect in the sample. In contrast, for x = 0.1 and 0.5 composites, no such anisotropy effect is experimentally evidenced. Impedance and real part of impedance have been found to decrease with H appl at low frequency (f) region. We attribute this observation to the depinning of the magnetic domain walls from the grain boundaries pinning centers and thereby enhancing the spin dependent transport in the composite. For x = 0.3 composite, Nyquist plots have been fitted considering dominant contributions of LSMO and EMO grain boundaries and the interface region between them. However, for x = 0.1 composite, it corresponds to EMO grain boundaries and grain boundary interface region. The relaxation frequency (f R ) is observed to shift at higher/lower f region in perpendicular/parallel configuration of H appl for x = 0.3 composite. This opposite variation of f R s with H appl for perpendicular and parallel configurations has been attributed to two competing factors of H appl induced enhancement of inductive part and H appl enhanced spin dependent transport causing fast relaxation processes in the sample. For x = 0.1 composite, in both configurations of H appl , f R s is shifting towards high f region, which has been discussed in terms of dominant role of spin dependent transport

Structural and magnetic properties of La0.7Sr0.3MnO3 ferromagnetic thin film grown on PMN-PT by sol–gel method

Directory of Open Access Journals (Sweden)

Jing Zhang

2017-08-01

Full Text Available We report the preparation of epitaxial La0.7Sr0.3MnO3 thin films grown on (001-oriented 0.72Pb(Mg1∕3Nb2∕3O3-0.28PbTiO3 substrates by the sol–gel technique. The phase structure, magnetic properties and magnetoresistance of the samples are investigated by using high solution X-ray diffraction, atomic force microscopy, physical property measurement system, respectively. The La0.7Sr0.3MnO3 thin films display a well-defined hysteresis loop and typical ferromagnetism behavior at lower temperature. High magnetoresistance at 5T of 42% appears at 227K for La0.7Sr0.3MnO3 thin film.

Dual Role of Host Par2 in a Murine Model of Spontaneous Metastatic B16 Melanoma

Czech Academy of Sciences Publication Activity Database

Olejár, Tomáš; Větvička, D.; Zadinová, M.; Poučková, P.; Kukal, J.; Ježek, Petr; Matěj, R.

2014-01-01

Roč. 34, č. 7 (2014), s. 3511-3515 ISSN 0250-7005 R&D Projects: GA ČR(CZ) GAP302/10/0346 Institutional support: RVO:67985823 Keywords : PAR2 * melanoma * metastasis * murine model Subject RIV: EA - Cell Biology Impact factor: 1.826, year: 2014

Douleurs induites par les soins: la réalité au Centre Hospitalier Universitaire de Befelatanana Antananarivo, Madagascar

Science.gov (United States)

Mahavivola, Ernestho-Ghoud Indretsy; Olivah, Razanaparany Miarisoa Mireille; Mihary, Dodo; Hendriniaina, Rakotoharivelo; Lalao, Randriamboavonjy Rado; Henintsoa, Rakotonirainy Oliva; Fahafahantsoa, Rapelanoro Rabenja

2014-01-01

La douleur induite par les soins correspond à la douleur survenant lors des actes à visé diagnostique et/ou thérapeutique. A notre connaissance, nous n'avons pas encore des données disponibles pour les douleurs induites par les soins à l'Hôpital de Befelatanana. Nos objectifs étaient de décrire le profil épidémiologique de la douleur induite par les soins, d'identifier les principaux facteurs influençant sur l'intensité de la douleur et leurs retentissements chez les patients. Il s'agissait d'une étude rétrospective, transversale type un jour donné menée dans les douze services de Médecines au Centre Hospitalier Universitaire de Befelatanana en Novembre 2013. Cent deux patients ont été retenus dans l’étude et trois cent vingt trois actes douloureux étaient enregistrés. La fréquence de la douleur induite par les soins était de 69,86%. Le genre féminin prédominait dans 52% des cas (n = 53) avec un sex-ratio à 0,92. L’âge moyen était de 46 ans. Les ponctions vasculaires étaient l'acte prédominant dans 49,54% (n = 109) des cas. Les infirmiers réalisaient les soins dans 47,05% (n = 48) des cas. L'information verbale était la mesure préventive utilisée dans 57,84% des cas (n = 59). Le transport par marche à pied et au dos représentait 16,67% des cas (n = 17). Les patients naïfs des gestes étaient plus anxieux. Ces patients gardaient de mauvais souvenir dans 64,71% des cas (n = 66). La fréquence de douleur induite par les soins était trop élevée. Un effort important est nécessaire pour réduire la douleur induite par les soins PMID:25932071

The adipokinetic hormones of Heteroptera: a comparative study

Czech Academy of Sciences Publication Activity Database

Kodrík, Dalibor; Marco, H. G.; Šimek, Petr; Socha, Radomír; Štys, P.; Gäde, G.

2010-01-01

Roč. 35, č. 2 (2010), s. 117-127 ISSN 0307-6962 R&D Projects: GA ČR GA522/07/0788 Grant - others:National Research Foundation(ZA) FA20070213000002; National Research Foundation(ZA) IFR2008071500048 Institutional research plan: CEZ:AV0Z50070508 Keywords : adipokinetic peptide * Heteroptera * mass spectrometry Subject RIV: ED - Physiology Impact factor: 1.417, year: 2010

14 CFR 417.109 - Ground safety.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Ground safety. 417.109 Section 417.109... TRANSPORTATION LICENSING LAUNCH SAFETY Launch Safety Responsibilities § 417.109 Ground safety. (a) Ground safety... 417.115(c), and subpart E of this part provide launch operator ground safety requirements. ...

CERN Technical Training 2003: Learning for the LHC ! MAGNE-03 : MAGNETISME POUR L'ELECTROTECHNIQUE - French version only

CERN Multimedia

Monique Duval

2003-01-01

Phénomènes magnétiques, matériaux et applications MAGNE-03 est un cours dans le cadre du programme de l'Enseignement technique 2003 qui s'adresse aux personnes souhaitant découvrir, améliorer ou remettre à niveau leurs connaissances en magnétisme. Le cours est donné au CERN par la société CEDRAT Technologies basée à Meylan (France). La participation est ouverte à l'ensemble du personnel technique et scientifique nécessitant une formation en magnétisme dans le cadre de leurs activités professionnelles, courantes ou futures. En ayant organisé des sessions au CERN, une importante économie par participant est réalisée par rapport aux frais nécessaires pour suivre la même formation sur leur site en Isère. MAGNE-03 s'intéresse, entre autres, au développement de la compr&am...

Magnetic and magnetocaloric properties in Ba-doped La{sub 0.7}Ca{sub 0.3}MnO{sub 3} nanoparticles

Energy Technology Data Exchange (ETDEWEB)

Thanh, Tran Dang, E-mail: thanhxraylab@yahoo.com [Institute of Materials Science, Vietnam Academy of Science and Technology, 18-Hoang Quoc Viet, Hanoi (Viet Nam); Linh, Dinh Chi [Institute of Materials Science, Vietnam Academy of Science and Technology, 18-Hoang Quoc Viet, Hanoi (Viet Nam); Uyen Tuyen, Ngo Thi [Department of Natural Science, Nha Trang Pedagogic College, Khanh Hoa (Viet Nam); Phan, The-Long [Department of Physics and Oxide Research Center, Hankuk University of Foreign Studies, Yongin 449-791 (Korea, Republic of); Yu, Seong-Cho, E-mail: scyu@chungbuk.ac.kr [Department of Physics, Chungbuk National University, Cheongju 361-763 (Korea, Republic of)

2015-11-15

La{sub 0.7}Ca{sub 0.3−x}Ba{sub x}MnO{sub 3} nanoparticles with the crystalline size d = 38 and 39 nm for x = 0.025, and 0.05, respectively, were synthesized by utilizing the solid-state reaction and mechanical ball milling methods. We have used the Banerjee's criteria, the mean-field, and the thermodynamic theories, and isothermal magnetization, M(H), data around Curie temperature (T{sub C}) to investigate the magnetic phase transformation and the temperature (T) and magnetic field (H) dependences of magnetic entropy change, ΔS{sub m}(T, H), for nanoparticles. These exhibit the samples undergoing a second-order magnetic phase transition with an existence of the short-range ferromagnetic order in the samples. Under an applied magnetic field change ΔH = 30 kOe, the maximum value of ΔS{sub m} (denoted as |ΔS{sub max}|) are obtained about 4.4 J kg{sup −1} K{sup −1} corresponding to a relative cooling power (RCP) value about 140 J kg{sup −1}. Field dependences of |ΔS{sub max}| and RCP can be expressed by the power laws, |ΔS{sub max}| = a × H{sup n} and RCP = b × H{sup N}, where a and b are coefficients, n and N are the field exponents, respectively. Interestingly, all the ΔS{sub m}(T, H) curves measured at different applied fields are collapsed onto a universal curve, ΔS{sub m}(T, H)/ΔS{sub max} versus θ = (T − T{sub C})/(T{sub r} − T{sub C}), where T{sub r} is the reference temperature. - Highlights: • An existence of the short-range FM order in the La{sub 0.7}Ca{sub 0.3−x}Ba{sub x}MnO{sub 3} nanoparticles. • High magnetic entropy change, wide operative temperature range, and high RCP value. • Field dependences of |ΔS{sub max}| and RCP can be expressed by the power laws. • All the ΔS{sub m}(T, H) data are followed a universal master curve.

Effect of In_xGa_1_−_xAs interlayer on the properties of In_0_._3Ga_0_._7As epitaxial films grown on Si (111) substrates by molecular beam epitaxy

International Nuclear Information System (INIS)

Gao, Fangliang; Wen, Lei; Zhang, Shuguang; Li, Jingling; Zhang, Xiaona; Li, Guoqiang; Liu, Ying

2015-01-01

High-quality In_0_._3Ga_0_._7As films have been epitaxially grown on Si (111) substrate by inserting an In_xGa_1_−_xAs interlayer with various In compositions by molecular beam epitaxy. The effect of In_xGa_1_−_xAs interlayer on the surface morphology and structural properties of In_0_._3Ga_0_._7As films is studied in detail. It reveals that In_0_._3Ga_0_._7As films grown at appropriate In composition in In_xGa_1_−_xAs interlayer exhibit smooth surface with a surface root-mean-square roughness of 1.7 nm; while In_0_._3Ga_0_._7As films grown at different In composition of In_xGa_1_−_xAs interlayer show poorer properties. This work demonstrates a simple but effective method to grow high-quality In_0_._3Ga_0_._7As epilayers on Si substrates, and brings up a broad prospect for the application of InGaAs-based optoelectronic devices on Si substrates. - Highlights: • We provide a simple approach to achieve high-quality In_0_._3Ga_0_._7As films on Si. • An In_0_._2_8Ga_0_._7_2As interlayer can release mismatch strain. • High-quality In_0_._3Ga_0_._7As film is grown on Si using 10-nm-thick interlayer. • Smooth surface In_0_._3Ga_0_._7As film is grown on Si using 10-nm-thick interlayer.

Magnetic, dielectric and magnetodielectric properties of PVDF-La0.7Sr0.3MnO3 polymer nanocomposite film

Directory of Open Access Journals (Sweden)

Ch. Thirmal

2013-11-01

Full Text Available We have investigated the structure, magnetic and dielectric properties of PVDF-La0.7Sr0.3MnO3 polymer nanocomposite thick film fabricated by dip coating technique along with the magnetodielectric effect. The structure and dielectric properties show the enhanced β phase in the composite compared to the PVDF film. The coupling between the ferroelectric and magnetic phases in the composite is revealed in the form of dielectric anomaly at the ferromagnetic Curie temperature. We observed 1.9% magnetodielectric effect at 300 K with the possibility of enhanced effect near the transition temperature. In addition, the analysis of the electric modulus indicates that the composite exhibits interfacial related relaxation and it follows Arrhenius Law. Our study suggests that the ac conductivity of the PVDF-La0.7Sr0.3MnO3 composite could be explained by correlated barrier hopping mechanism.

14 CFR 417.107 - Flight safety.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Flight safety. 417.107 Section 417.107... TRANSPORTATION LICENSING LAUNCH SAFETY Launch Safety Responsibilities § 417.107 Flight safety. (a) Flight safety... safety system that satisfies subpart D of this part as follows, unless § 417.125 applies. (1) In the...

Enhanced magnetization in morphologically and magnetically distinct BiFeO3 and La0.7Sr0.3MnO3 composites

Science.gov (United States)

Pillai, Shreeja; Reshi, Hilal Ahmad; Bagwaiya, Toshi; Banerjee, Alok; Shelke, Vilas

2017-09-01

Nanomaterials exhibit properties different from those of their bulk counterparts. The modified magnetic characteristics of manganite nanoparticles were exploited to improve magnetization in multiferroic BiFeO3 compound. We studied the composite of two morphologically and magnetically distinct compounds BiFeO3 (BFO) and La0.7Sr0.3MnO3 (LSMO). The microcrystalline BiFeO3 sample was prepared by solid state reaction method and the nanocrystalline La0.7Sr0.3MnO3 by sol-gel method. Composites with nominal compositions (1-x)BiFeO3-(x)La0.7Sr0.3MnO3 were prepared by modified solid state reaction method. The phase purity and crystal structures were checked by using X-ray diffraction. The formation of composites with phase separated BFO and LSMO was confirmed using Raman and Fourier Transform Infrared spectroscopy studies. The composite samples showed relatively high value of magnetization with finite coercivity. This improvement in magnetic behavior is ascribed to the coexistence of multiple magnetic orderings in composite samples. We scrutinized the possibility of oxygen vacancy or Fe mixed valency formation in the samples using X-ray photoelectron spectroscopy technique.

Binary Channel SAW Mustard Gas Sensor Based on PdPc0.3PANI0.7 hybrid Sensitive Film

International Nuclear Information System (INIS)

Shi, Y B; Xiang, J J; Feng, Q H; Hu, Z P; Zhang, H Q; Guo, J Y

2006-01-01

This paper discussed the working principle of binary channel surface acoustic wave (SAW) lithium niobate piezoelectric chip detecting mustard, established the mathematic model of beat frequency output Δf and the mustard gas density δ. The MEMS craft solved the parameters of the binary channel SAW chip such as its interdigital electrode number was 15∼25 couple, width and spacing were both 25μm, degree of overlapping was 2mm, fundamental frequency was 10∼35MHz, frequency-domain width was 5∼20Hz, and its back pt hot film's. According to TG-DSC thermal analysis, vacuum coating craft was adopted to solve the hybrid sensitive film forming craft parameter of PdPc 0.3 PANI 0.7 (phthalocyanine palladium 0.3 Poiyaniline 0.7 ). The micro-appearance of sensitive film was analyzed through SEM. The sensor's sensitivity and response characteristic were tested and analyzed: appear linear change, its response time is less than 5min while its recovery time is less than 8min

40 CFR 192.03 - Monitoring.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Monitoring. 192.03 Section 192.03... of Residual Radioactive Materials from Inactive Uranium Processing Sites § 192.03 Monitoring. A groundwater monitoring plan shall be implemented, to be carried out over a period of time commencing upon...

C9.A/14 steelwork joints de poutres par plaque frontale : assemblages par gousset

CERN Document Server

2015-01-01

Les Tables de résistances ultimes des assemblages boulonnés par plaque frontale et par gousset, complétées par une description des modèles de calcul et des exemples d’application, ont pour but de faciliter la tâche de l'ingénieur et du constructeur. Cette première partie C9.A/14 contient les chapitres suivants: - Joints de poutres par plaque frontale en acier S235 et S355 - Assemblages par gousset en acier S235 et S355 Les Tables contiennent des données relatives à la géométrie ainsi que les valeurs de calcul correspondantes des résistances ultimes des assemblages ; elles remplacent le chapitre « Assemblages par plaques frontales et boulons HR » des anciennes Tables C9.1 de 1983 / 2002. Le calcul de ces assemblages par plaque frontale est basé sur les hypothèses du modèle de la méthode des composants décrite dans la norme SN EN 1993-1-8. Les vérifications sont effectuées selon la norme SIA 263:2013. Les assemblages par gousset remplacent les assemblages par double cornière, (telle...

Magnetoelastic effects in La{sub 0.7}Sr{sub 0.3−x}Ca{sub x}MnO{sub 3} nanocrystalline perovskites

Energy Technology Data Exchange (ETDEWEB)

Tabatabai Yazdi, Sh., E-mail: sh_tabatabai3@yahoo.com [Department of Physics, Faculty of Sciences, Ferdowsi University of Mashhad, Mashhad 91755-1436 (Iran, Islamic Republic of); Iranmanesh, P. [Department of Physics, Vali-e-Asr University of Rafsanjan, 77139-36417 Rafsanjan (Iran, Islamic Republic of)

2014-09-01

La{sub 0.7}Sr{sub 0.3−x}Ca{sub x}MnO{sub 3} (x=0, 0.1, 0.2 and 0.3) nanoparticles, prepared by sol–gel method, were studied by means of X-ray diffraction, transmission electron microscopy, thermal expansion and magnetostriction measurements. It was revealed that samples of low Ca concentration (x≤0.1) crystallize in rhombohedral perovskite structure with R-3c space group, and by increasing x, smaller Ca radius causes the lattice to convert to orthorhombic structure (space group of Pbnm). The results exhibit an anomalous behavior in the thermal expansion behavior of all samples, as well as temperature dependence of their volume magnetostriction being related to the presence of a conductive magnetic two-phase state at temperatures higher than T{sub C}. Moreover, the magnitude of this magnetovolume effect increases with x due to smaller Ca size, which softens the crystal lattice. The results show that Ca substitution results in weakening the double-exchange interaction and consequently reducing T{sub C}, as well as decreasing the magnetic anisotropy. Furthermore, our nanocrystalline samples have a relatively lower T{sub C}, compared with the reported values for similar compounds with larger particle size. Among them, the sample with x=0.2 possess T{sub C} value of about room temperature; to say by partial substitution of Ca for Sr we succeeded in adjusting the transition temperature of this series of manganites which was a main motivation for this research. - Highlights: • Magnetoelastic properties of La{sub 0.7}Sr{sub 0.3−x}Ca{sub x}MnO{sub 3} nanocrystalline samples are investigated. • Substitution of Sr by Ca causes structure to convert from rhombohedral to orthorhombic perovskite. • Considerable magnetovolume anomalies are revealed due to presence of conductive MTPS above T{sub C}. • Ca softens the crystal lattice and intensifies the magnetovolume effects. • Ca reduces T{sub C} and magnetic anisotropy of compounds by weakening DE interactions.

Effect of Ca-Doping on the Structure and Morphology of Polycrystalline La0.7(Ba1-xCax)0.3MnO3 (x = 0; 0.03; and 0.05)

International Nuclear Information System (INIS)

Winarsih, S; Kurniawan, B; Manaf, A; Saptari, S A; Nanto, D

2016-01-01

In this paper, we report structure and morphology of polycrystalline La 0.7 (Ba 1-x Ca x ) 0.3 MnO 3 (x = 0; 0.03; 0.05). Basically, these materials are perovskite manganites type with the general structure AMnO 3 (A= trivalent rare earth with divalent ion-doped) which have been extensively studied due to their interesting physical properties. It was known that the electron transport in this material influenced by ion doped at A site. Doping with different divalent ions should cause the lattice distortion. Hence, double exchange interaction is enhanced. In this study, we prepared our sample through the sol-gel method. It is show that the method has resulted in powder materials with ultra-fine particle size. The effect of Ca +2 and Ba +2 doping on the structure did not make any phase changing, but the lattice parameter of La 0.7 (Ba 1-x Ca x ) 0.3 MnO 3 decreased below × = 0.03. Microstructure observed by scanning electron microscope to the sintered samples indicated that the microstructure is homogeneous with fine size of equiaxed grain morphology. Microanalysis by EDS confirmed there is no significant different between designated composition and measured one. It is concluded that effect of Ca+ 2 and Ba+ 2 doped in LaMnO 3 has resulted in microstructural and lattice parameter changes. The doped materials are remaining single phase. (paper)

Growth and properties of La{sub 0.7}Sr{sub 0.3}MnO{sub 3}/YBa{sub 2}Cu{sub 3}O{sub 7−δ}/La{sub 0.7}Sr{sub 0.3}MnO{sub 3} epitaxial trilayer films

Energy Technology Data Exchange (ETDEWEB)

Sharma, Minaxi, E-mail: meenanith@gmail.com; Kumar, Arvind; Sharma, K. K. [Department of Physics, National Institute of Technology, Hamirpur -177005 (India); Kumar, Ravi [Centre for Materials Science and Engineering, National Institute of Technology, Hamirpur -177005 (India); Beant College of Engineering and Technology, Gurdaspur Punjab-143521 (India); Choudhary, R. J. [UGC-DAE-Consortium for Scientific Research, Khandwa Road, Indore-452001 (India)

2015-08-28

We report the growth and properties of La{sub 0.7}Sr{sub 0.3}MnO{sub 3}/YBa{sub 2}Cu{sub 3}O{sub 7−δ}/La{sub 0.7}Sr{sub 0.3}MnO{sub 3} LSMO/YBCO/LSMO epitaxial trilayer films, fabricated on SrTiO{sub 3} substrate using pulsed laser deposition technique. From x-ray diffraction and high resolution x-ray diffraction measurements, it is confirmed that the grown trilayered films are single phase and epitaxial in nature. Magneto-transport and magnetic properties are found to be dependent on the thickness of YBCO spacer layer. We infer that for fixed thickness of top and bottom LSMO layers, superconductivity is completely suppressed. At 100 K, the hysteresis loops reveal the ferromagnetic signature of trilayered film. At room temperature, we obtain a butterfly type scenario, signifies the co-existence of ferromagnetic and antiferromagnetic interaction. In addition, at room temperature, the YBCO spacer layer allowing the top and bottom LSMO layers to interact antiferromagnetically.

33 CFR 64.03 - Scope.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Scope. 64.03 Section 64.03... STRUCTURES, SUNKEN VESSELS AND OTHER OBSTRUCTIONS General § 64.03 Scope. (a) Except as provided in paragraph... jurisdiction of the United States and, on the high seas, structures owned or operated by persons subject to the...

Magnetically tunable alternating current electrical properties of x La{sub 0.7}Sr{sub 0.3}MnO{sub 3}–(1 − x) ErMnO{sub 3} (x = 0.1, 0.3, and 0.5) multiferroic nanocomposite

Energy Technology Data Exchange (ETDEWEB)

Debnath, Rajesh; Dey, P.; Singh, Swati; Roy, J. N.; Mandal, S. K., E-mail: saniitkgp2007@gmail.com [Department of Physics, National Institute of Technology Agartala, Tripura 799046 (India); Nath, T. K. [Department of Physics and Meteorology, Indian Institute of Technology Kharagpur, Kharagpur 721302, West Bengal (India)

2015-07-28

Detailed magnetically tunable ac electrical properties of x La{sub 0.7}Sr{sub 0.3}MnO{sub 3} (LSMO)–(1 − x) ErMnO{sub 3} (EMO) (x = 0.1, 0.3, and 0.5) multiferroic nanocomposites have been studied at 300 K in presence of varying magnetic field (H{sub appl}), applied both in parallel and perpendicular configuration with respect to the measuring electric field. AC electrical properties have exhibited significant variation with H{sub appl} for all composites, whereas for parallel configuration of H{sub appl} such effect is very feeble for x = 0.3 composite. We have attributed this anisotropic behavior to the demagnetization effect in the sample. In contrast, for x = 0.1 and 0.5 composites, no such anisotropy effect is experimentally evidenced. Impedance and real part of impedance have been found to decrease with H{sub appl} at low frequency (f) region. We attribute this observation to the depinning of the magnetic domain walls from the grain boundaries pinning centers and thereby enhancing the spin dependent transport in the composite. For x = 0.3 composite, Nyquist plots have been fitted considering dominant contributions of LSMO and EMO grain boundaries and the interface region between them. However, for x = 0.1 composite, it corresponds to EMO grain boundaries and grain boundary interface region. The relaxation frequency (f{sub R}) is observed to shift at higher/lower f region in perpendicular/parallel configuration of H{sub appl} for x = 0.3 composite. This opposite variation of f{sub R}s with H{sub appl} for perpendicular and parallel configurations has been attributed to two competing factors of H{sub appl} induced enhancement of inductive part and H{sub appl} enhanced spin dependent transport causing fast relaxation processes in the sample. For x = 0.1 composite, in both configurations of H{sub appl}, f{sub R}s is shifting towards high f region, which has been discussed in terms of dominant role of spin dependent transport.

42 CFR 417.838 - Organization determinations.

Science.gov (United States)

2010-10-01

... 42 Public Health 3 2010-10-01 2010-10-01 false Organization determinations. 417.838 Section 417... (CONTINUED) MEDICARE PROGRAM HEALTH MAINTENANCE ORGANIZATIONS, COMPETITIVE MEDICAL PLANS, AND HEALTH CARE PREPAYMENT PLANS Health Care Prepayment Plans § 417.838 Organization determinations. (a) Actions that are...

Electrical and magnetic behavior of La{sub 0.7}Ca{sub 0.3}MnO{sub 3}/La{sub 0.7}Sr{sub 0.2}Ca{sub 0.1}MnO{sub 3} composites

Energy Technology Data Exchange (ETDEWEB)

Phong, P.T., E-mail: ptphong.nh@khanhhoa.edu.v [Nhatrang Pedagogic College, Khanhhoa (Viet Nam); Institute of Material Science, Vietnamese Academy of Science and Technology, Hanoi (Viet Nam); Dai, N.V.; Manh, D.H.; Thanh, T.D. [Institute of Material Science, Vietnamese Academy of Science and Technology, Hanoi (Viet Nam); Khiem, N.V. [Department of Natural Sciences, Hongduc University, Thanhhoa (Viet Nam); Hong, L.V.; Phuc, N.X. [Institute of Material Science, Vietnamese Academy of Science and Technology, Hanoi (Viet Nam)

2010-09-15

The electrical transport properties and the magnetoresistance of La{sub 0.7}Ca{sub 0.3}MnO{sub 3}/La{sub 0.7}Sr{sub 0.2}Ca{sub 0.1}MnO{sub 3} composites are investigated as a function of sintering temperature. On the basis of an analysis by X-ray powder diffraction and scanning electron microscopy we suggest that raising the sintering temperature enhanced the interfacial reaction and creates interfacial phases at the boundaries of the La{sub 0.7}Ca{sub 0.3}MnO{sub 3} and La{sub 0.7}Sr{sub 0.2}Ca{sub 0.1}MnO{sub 3}. Results also show that in 3 kOe, and at the Curie temperature, the magnetoresistance value of 14% was observed for the composite sintered at 1300 {sup o}C. Based on the phenomenological equation for conductivity under a percolation approach, which depends on the phase segregation of ferromagnetic metallic clusters and paramagnetic insulating regions, we fitted the experimental resistivity-temperature data from 50-300 K and find that the activation barrier decreases as temperature is increased.

The effect of Nb and Zr addition on the microstructural features and magnetic properties of Tb0.3Dy0.7Fe1.95

International Nuclear Information System (INIS)

Palit, Mithun; Arout Chelvane, J.; Basumatary, Himalay; Pandian, S.; Chandrasekaran, V.

2009-01-01

Alloys of Tb 0.3 Dy 0.7 Fe 1.95-x Nb x and Tb 0.3 Dy 0.7 Fe 1.95-x Zr x , with x = 0-0.075, were prepared by conventional melting and casting under vacuum. The magnetostriction improved remarkably with the individual addition of Nb and Zr. It is seen from the microstructural features that Nb addition results in the formation of NbFe 2 as the primary phase while Zr addition results in the depletion of (Tb,Dy)Fe 3 phase owing to the substitution of Zr for rare earths in the main phase

42 CFR 417.542 - Reinsurance costs.

Science.gov (United States)

2010-10-01

... 42 Public Health 3 2010-10-01 2010-10-01 false Reinsurance costs. 417.542 Section 417.542 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... PLANS Medicare Payment: Cost Basis § 417.542 Reinsurance costs. Reinsurance costs are not allowable. ...

Closure Report for Corrective Action Unit 417: Central Nevada Test Area Surface, Nevada; TOPICAL

International Nuclear Information System (INIS)

K. B. Campbell

2001-01-01

The following site closure activities were performed at the 34 Corrective Action Sites (CASs) comprising Corrective Action Unit (CAU) 417 and are documented in this report: (1) No closure action was taken at 13 CASs (17 sites): 58-05-01,58-07-01,58-05-04, 58-09-05 (Mud Pits C and D only), 58-35-01,58-05-02,58-09-06 (Mud Pits A, B, C, and D), 58-10-06,58-19-01,58-35-02,58-44-04,58-05-04, and 58-09-03 (Mud Pit E only). (2) Housekeeping activities, collecting scrap materials, and transporting to approved landfill sites at the NTS were used to close seven CASs: 58-44-01,58-44-02,58-44-05, 58-98-03,58-98-01,58-98-02, and 58-98-04. (3) Two CASs (58-05-03 and 58-99-01) were closed by excavation and removal of USTs. (4) Two septic tanks (CASs 58-05-05 and 58-05-06) were closed by backfilling with clean fill. (5) Site posting with above-grade monuments and attached warning signs and land-use restrictions were used to close seven CASs (nine sites): 58-09-02,58-09-05 (Mud Pit E only), 58-09-06 (Mud Pit E only), 58-10-01,58-25-01,58-09-03 (Mud Pits A, B, and D), and 58-10-05. (6) Clean closure by excavation soil with TPH levels greater than the NDEP action level of 100 mg/kg and limited regrading was used to close five CASs: 58-10-03,58-44-06, 58-44-03,58-10-02, and 58-10-04. (7) Construction of engineered covers was used to close in place two CASs: 58-09-01 and 58-09-03 (Mud Pit C only). Following construction, a fence was constructed around each cover to prevent damage to the cover or intrusion by wildlife

42 CFR 417.540 - Enrollment costs.

Science.gov (United States)

2010-10-01

... 42 Public Health 3 2010-10-01 2010-10-01 false Enrollment costs. 417.540 Section 417.540 Public... PLANS Medicare Payment: Cost Basis § 417.540 Enrollment costs. (a) Principle. Enrollment costs are... of costs included. Enrollment costs include, but are not limited to, reasonable costs incurred in...

9 CFR 417.3 - Corrective actions.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Corrective actions. 417.3 Section 417.3 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... ANALYSIS AND CRITICAL CONTROL POINT (HACCP) SYSTEMS § 417.3 Corrective actions. (a) The written HACCP plan...

Unusual Critical Behavior of the Diluted Uniaxial Dipolar Ferromagnet LiTb0.3Y0.7F4

DEFF Research Database (Denmark)

Seiden, P.; Seiden, J.; Laursen, Ib

1980-01-01

The experimental critical behavior of the susceptibility of LiTb0.3Y0.7F4 is described by the power law χ=Γ[(T-Tc) / Tc]-γ with Tc=0.520±0.003 K and γ=1.80±0.04. This behavior is dramatically different from that previously observed in LiTbF4 and is evidence of a departure from marginal...

Crystal structure of (110) oriented La0.7Sr0.3MnO3 grown on (001) silicon

International Nuclear Information System (INIS)

Sinha, Umesh Kumar; Sahoo, Antarjami; Padhan, Prahallad

2016-01-01

The mixed valance perovskite manganites have attracted a considerable attention due to their colossal magnetoresistance behavior. In particular, La 0.7 Sr 0.3 MnO 3 (LSMO) show half metallicity and possess Curie temperature (T C ) above room temperature, which makes this material an attractive candidate for spintronic device application. Thin films of LSMO were grown on (001) oriented Silicon (Si) using sputtering technique

THERMOELECTRIC PROPERTIES OF HOT-PRESSED p-TYPE Mg2Si0.3Sn0.7 SOLID SOLUTION

Directory of Open Access Journals (Sweden)

G. N. Isachenko

2014-05-01

Full Text Available It is shown that thermoelectric energy conversion which gives the possibility for utilizing a low potential heat is one of the ways for adoption of energy-saving technologies; and semiconductor materials with p-type and n-type conductivities having high thermoelectric figure of merit are necessary for operation of thermoelectric generators. The paper deals with possibility of usage of the p-Mg2Si0.3Sn0.7 solid solution (with a nanostructured modification as a couple for the well studied thermoelectric material based on n-Mg2Si-Mg2Sn. A technological scheme for fabrication of heavily doped Mg2Si0.3Sn0.7 solid solution of p-type by hot pressing from nanopowder is developed. The given technology has made it possible to reduce duration of a homogeneous material fabrication and has improved its physical and chemical properties. The samples were made by three ways: direct fusion for polycrystals fabrication; hot pressing from microparticles; nanostructuring, i.e. hot pressing from nanoparticles. By X-ray diffraction it is shown that sizes of structural elements in the fabricated samples are about 40 nm. The probe technique is used for measurement of electric conductivity and Seebeck coefficient. The stationary absolute method is used for measurement of thermal conductivity. Thermoelectric figure of merit is defined by measured values of kinetic coefficients in the temperatures range of 77 – 800 K. It was demonstrated, that electric conductivity, Seebeck coefficient and the power factor do not depend practically on a way of solid solution preparation. Thermal conductivity of samples pressed from nanoparticles has appeared to be higher, than of samples, obtained by direct fusion; i.e. in this case nanostructuring has not led to increase of thermoelectric figure of merit. The conclusion is drawn, that polycrystalline semiconductor Mg2Si0.3Sn0.7 can be used as a p-branch for a thermoelectric generator though nanostructuring has not led to the figure of

Passivity Based Stabilization of Non-minimum Phase Nonlinear Systems

Czech Academy of Sciences Publication Activity Database

Travieso-Torres, J.C.; Duarte-Mermoud, M.A.; Zagalak, Petr

2009-01-01

Roč. 45, č. 3 (2009), s. 417-426 ISSN 0023-5954 R&D Projects: GA ČR(CZ) GA102/07/1596 Institutional research plan: CEZ:AV0Z10750506 Keywords : nonlinear systems * stabilisation * passivity * state feedback Subject RIV: BC - Control Systems Theory Impact factor: 0.445, year: 2009 http://library.utia.cas.cz/separaty/2009/AS/zagalak-passivity based stabilization of non-minimum phase nonlinear systems.pdf

La réforme foncière au Vietnam : Analyse des jeux d'acteurs et du processus de transformation des institutions aux échelons central et provincial

OpenAIRE

Mellac , Marie; Fortunel , Frederic; Dan Tran , Dac

2010-01-01

rapport scientifique; Une des particularités du foncier vietnamien réside dans l'existence d'un « état zéro » des institutions foncières, que l'on peut dater approximativement au début des années 1980, à partir duquel l'ensemble des institutions a été mis en place. Cet « état zéro » des institutions ne signifie bien entendu pas l'absence d'héritages : les institutions qui émergent aujourd'hui portent la trace de chacune des périodes passées. C'est le cas par exemple de la multiplicité des ins...

42 CFR 417.802 - Allowable costs.

Science.gov (United States)

2010-10-01

... 42 Public Health 3 2010-10-01 2010-10-01 false Allowable costs. 417.802 Section 417.802 Public... PLANS Health Care Prepayment Plans § 417.802 Allowable costs. (a) General rule. The costs that are considered allowable for HCPP reimbursement are the same as those for reasonable cost HMOs and CMPs specified...

14 CFR 417.307 - Support systems.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Support systems. 417.307 Section 417.307... TRANSPORTATION LICENSING LAUNCH SAFETY Flight Safety System § 417.307 Support systems. (a) General. (1) A flight safety system must include the systems required by this section to support the functions of the flight...

42 CFR 417.934 - Reserve requirement.

Science.gov (United States)

2010-10-01

... 42 Public Health 3 2010-10-01 2010-10-01 false Reserve requirement. 417.934 Section 417.934 Public... PLANS Administration of Outstanding Loans and Loan Guarantees § 417.934 Reserve requirement. (a) Timing... section 1305 of the PHS Act was required to establish a restricted reserve account on the earlier of the...

Enhanced electrical and magnetic properties in La0.7Sr0.3MnO3 thin films deposited on CaTiO3-buffered silicon substrates

Directory of Open Access Journals (Sweden)

C. Adamo

2015-06-01

Full Text Available We investigate the suitability of an epitaxial CaTiO3 buffer layer deposited onto (100 Si by reactive molecular-beam epitaxy (MBE for the epitaxial integration of the colossal magnetoresistive material La0.7Sr0.3MnO3 with silicon. The magnetic and electrical properties of La0.7Sr0.3MnO3 films deposited by MBE on CaTiO3-buffered silicon (CaTiO3/Si are compared with those deposited on SrTiO3-buffered silicon (SrTiO3/Si. In addition to possessing a higher Curie temperature and a higher metal-to-insulator transition temperature, the electrical resistivity and 1/f noise level at 300 K are reduced by a factor of two in the heterostructure with the CaTiO3 buffer layer. These results are relevant to device applications of La0.7Sr0.3MnO3 thin films on silicon substrates.

Localisation d'une source sonore par un réseau de microphones

OpenAIRE

Thaljaoui , Adel; Brulin , Damien; Val , Thierry; Nasri , Nejah

2014-01-01

National audience; L'assistance à domicile d'une personne âgée, notamment la connaissance de sa position géographique en tout instant, est devenue actuellement l'une des problématiques les plus urgentes. L'exploitation de l'information audio captée par un réseau de capteurs munis de microphones constitue un axe de recherche prometteur qui pourrait contribuer à une meilleure localisation dans le cadre des maisons intelligentes. Nous introduisons, dans cet article, nos premiers travaux sur la l...

42 CFR 417.534 - Allowable costs.

Science.gov (United States)

2010-10-01

... typical “provider” costs, and costs (such as marketing, enrollment, membership, and operation of the HMO... principles applicable to provider costs, as set forth in § 417.536. (2) The allowability of other costs is determined in accordance with principles set forth in §§ 417.538 through 417.550. (3) Costs for covered...

Dissolved inorganic carbon, alkalinity, temperature, salinity and other variables collected from discrete sample and profile observations using Alkalinity titrator, CTD and other instruments from HEALY in the Bering Sea from 2008-07-03 to 2008-07-31 (NCEI Accession 0144981)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0144981 includes discrete sample and profile data collected from HEALY in the Bering Sea from 2008-07-03 to 2008-07-31. These data include AMMONIUM...

Low-temperature transport properties of chemical solution deposited polycrystalline La0.7Sr0.3MnO3 ferromagnetic films under a magnetic field

International Nuclear Information System (INIS)

Zhu, Junyu; Chen, Ying; Xu, Wenfei; Yang, Jing; Bai, Wei; Wang, Genshui; Duan, Chungang; Tang, Zheng; Tang, Xiaodong

2011-01-01

Polycrystalline La 0.7 Sr 0.3 MnO 3 (LSMO) films were prepared on SiO 2 /Si (001) substrates by chemical solution deposition technique. Electrical and magnetic properties of LSMO were investigated. A minimum phenomenon in resistivity is found at the low temperature ( 0.7 Sr 0.3 MnO 3 films were grown by a modified chemical solution deposition route. → High quality LSMO thin films were prepared directly onto SiO 2 /Si substrates. → Abnormality in resistivity of LSMO films at low temperatures was studied in detail. → The abnormality was mainly attributed to Kondo-like spin dependent scattering.

Structure par RMN d'un complexe AlcR(1-60)-ADN: Reconnaissance du petit sillon par la partie N-terminale

Science.gov (United States)

Cahuzac, B.; Félenbok, B.; Guittet, E.

1999-10-01

Aspergillus nidulans is a filamentous fungus able to use ethanol as sole energy source. The activation of the ethanol regulon genes expression is mediated by the AlcR protein. Its DNA-binding domain is located in the N-terminus (residues 1 to 60), and its NMR solution structure shows a global zinc binuclear cluster fold, with two helices in addition to the basic binuclear motif. A small number of crystallographic structures of DNA complexes of binuclear cluster proteins is yet known, and points out the major groove and the first helix as the principal sites of interaction on the DNA and the protein respectively. In this article we show evidences that the N-terminus of the protein is involved in binding to the minor groove. Aspergillus nidulans est un champignon filamenteux capable d'utiliser l'éthanol comme source unique d'énergie. La protéine AlcR est responsable de l'activation de l'expression des gènes du régulon éthanol. Le domaine de liaison à l'ADN est situé dans la partie N-terminale de la protéine (a.a. 1 à 60), et sa structure déterminée par RMN en solution montre un repliement global en bouquet binucléaire à zinc, avec deux hélices supplémentaires par rapport au motif de base. Alors que les structures déjà connues de complexes ADN - bouquets binucléaires permettent de situer dans le grand sillon la quasi-totalité des interactions, nous montrons dans la présente étude l'implication du début de la séquence dans la reconnaissance du petit sillon de l'ADN (a.a. 5 et 6).

Hydronéphrose géante sur rein ectopique pelvien révélée par un ...

African Journals Online (AJOL)

Les auteurs rapportent un cas d'hydronéphrose majeure sur un rein gauche ectopique en position pelvienne, chez un patient de 17 ans, révélé par une occlusion intestinale aigüe. Un drainage premier par néphrostomie per-cutanée écho-guidée a permis de soulager la patient. Le traitement définitif a consisté en une ...

Effect of calcination temperature on microstructure, dielectric, magnetic and optical properties of Ba{sub 0.7}La{sub 0.3}Fe{sub 11.7}Co{sub 0.3}O{sub 19} hexaferrites

Energy Technology Data Exchange (ETDEWEB)

Kaur, Talwinder [Department of Physics, Lovely Professional University, Phagwara, Punjab 144411 (India); Kaur, Barjinder [Department of Physics, National Institute of Technology, Jalandhar 144011 (India); Bhat, Bilal H. [Department of Physics, University of Kashmir, 190006 (India); Kumar, Sachin [Department of Chemistry, Guru Nanak Dev University, Amritsar 143005 (India); Srivastava, A.K., E-mail: srivastava_phy@yahoo.co.in [Department of Physics, Lovely Professional University, Phagwara, Punjab 144411 (India)

2015-01-01

M-type barium hexaferrite Ba{sub 0.7}La{sub 0.3}Fe{sub 11.7}Co{sub 0.3}O{sub 19} (BaLCM) powder, synthesized using sol gel auto combustion method, heat treated at 700, 900, 1100 and 1200 °C. X ray diffraction (XRD) powder patterns of heat treated samples show the formation of pure phase of M-type hexaferrite after 700 °C. Thermo gravimetric analysis (TGA) reveals that the weight loss of BaLCM becomes constant after 680 °C. The presence of two prominent peaks, at 432 cm{sup −1} and 586 cm{sup −1} in Fourier Transform Infrared Spectroscopy (FT-IR) spectra, gives the idea of formation of M-type hexaferrites. The M–H curve obtained from Vibrating Sample Magnetometer (VSM) were used to calculate saturation magnetization (M{sub S}), retentivity (M{sub r}), squareness ration (SR) and coercivity (H{sub c}). The maximum value of coercivity (5602 Oe) is found at 900 °C. The band gap dependency on temperature was studied using UV–vis NIR spectroscopy. The dielectric constant has been found to be high at low frequency but it decreases with increase in frequency. Such kind of dielectric behavior is explained on the basis of Koop's phenomenological theory and Maxwell Wagner theory.

Effect of temperature on structural, morphological and magnetic properties of Cd{sub 0.7}Co{sub 0.3}Fe{sub 2}O{sub 4} nanoparticles

Energy Technology Data Exchange (ETDEWEB)

Prabhakar Vattikuti, S.V., E-mail: vsvprabu@gmail.com [School of Mechanical Engineering, Yeungnam University, Gyeongsan, Gyeongsangbuk-do 712-749, Republic of Korea, (Korea, Republic of); Byon, Chan [School of Mechanical Engineering, Yeungnam University, Gyeongsan, Gyeongsangbuk-do 712-749, Republic of Korea, (Korea, Republic of); Shim, Jaesool, E-mail: jshim@ynu.ac.kr [School of Mechanical Engineering, Yeungnam University, Gyeongsan, Gyeongsangbuk-do 712-749, Republic of Korea, (Korea, Republic of); Reddy, Ch. Venkata, E-mail: cvrphy@gmail.com [School of Mechanical Engineering, Yeungnam University, Gyeongsan, Gyeongsangbuk-do 712-749, Republic of Korea, (Korea, Republic of)

2015-11-01

Cadmium-substituted cobalt ferrite (Cd{sub 0.7}Co{sub 0.3}Fe{sub 2}O{sub 4}) nanoparticles were synthesized using a chemical synthesis method and synthesized particles were calcinated at 300 °C and 600 °C respectively. The samples were characterized in order to understand the temperature effect on structural, morphological, thermal, and magnetic properties. X-ray diffraction data confirm the formation of single-phase cubic structure and the average grain sizes were evaluated. The microstructural features were examined by scanning electron microscopy (SEM) and transmission electron microscopy (TEM), and compositional analysis carried out by energy dispersive spectroscopy (EDS). A vibrating sample magnetometer (VSM) was used to investigate the magnetic properties. The hysteresis curves of Cd{sub 0.7}Co{sub 0.3}Fe{sub 2}O{sub 4} nanoparticles show enhancement of the coercivity with the increasing calcinated temperature. This enhancement is attributed to the transition from a multi-domain to a single-domain nature. The high and low frequency absorption bands of Cd{sub 0.7}Co{sub 0.3}Fe{sub 2}O{sub 4} were investigated using FT-IR analysis. - Highlights: • Cd{sub 0.7}Co{sub 0.3}Fe{sub 2}O{sub 4} nano particles are prepared by the chemical synthesis method. • X-ray diffraction data confirms the single phase cubic spinel structure. • The estimated particle sizes from the XRD are approximately 25 and 35 nm. • The coercivity and magnetization values increase with increasing the particle size. • FT-IR spectra indicate the fundamental vibrations of host lattices.

The tunneling spectra and superconducting gaps observed by using scanning tunneling microscope near the grain-boundary of FeSe0.3Te0.7 films

OpenAIRE

Lin, K. C.; Li, Y. S.; Shen, Y. T.; Wu, M. K.; Chi, C. C.

2013-01-01

We used STM to study the tunneling spectra of FeSe0.3Te0.7 films with two orientations of ab-planes and the connection ramp between them. We have discovered that, using pulse laser deposition (PLD) method, the a- and b-axis of the FeSe0.3Te0.7 film deposited on Ar-ion-milled Magnesium Oxide (MgO) substrate are rotated 45 degree with respect to those of MgO, while the a- and b-axis of the film grown on pristine MgO substrate are parallel to those of MgO. With photolithography and this techniqu...

Crystal growth of Sm0.3Tb0.7FeO3 and spin reorientation transition in Sm1−xTbxFeO3 orthoferrite

International Nuclear Information System (INIS)

Wu, Anhua; Wang, Bo; Zhao, Xiangyang; Xie, Tao; Man, Peiwen; Su, Liangbi; Kalashnikova, A.M.; Pisarev, R.V.

2017-01-01

In this work, Sm 0.3 Tb 0.7 FeO 3 single crystal was successfully grown by optical floating zone method. Sm 0.3 Tb 0.7 FeO 3 samples with a-, b-, and c-orientation were manufactured by means of Laue photograph. Magnetic properties of Sm 0.3 Tb 0.7 FeO 3 single crystals are studied over a wide temperature range from 2 to 400 K. Spin reorientation transition from Γ 2 to Γ 4 are observed by means of the temperature dependence of magnetization It indicated the reorientation transition temperature of Sm 1−x Tb x FeO 3 single crystals is lowered with the contents of Tb contents rising based on this work and our previous works, thus the spin reorientation transition temperature can be adjusted through changing the compound in orthoferrites materials, which means that we can get orthoferrites single crystals with high magnetism property in various temperature through material design. - Highlights: • Sm 0.3 Tb 0.7 FeO 3 single crystals with various compounds were successfully grown by optical floating zone method. • The relation between SRT temperature and composition in Sm 1−x Tb x FeO 3 orthoferrite was indicated. • The spin reorientation transition temperature of Sm 1−x Tb x FeO 3 single crystals can be adjusted through changing the compound in orthoferrites materials.

Unsaturated magnetoconductance of epitaxial La0.7Sr0.3MnO3 thin films in pulsed magnetic fields up to 60 T

Directory of Open Access Journals (Sweden)

Wei Niu

2017-05-01

Full Text Available We report on the temperature and field dependence of resistance of La0.7Sr0.3MnO3 thin films over a wide temperature range and in pulsed magnetic fields up to 60 T. The epitaxial La0.7Sr0.3MnO3 thin films were deposited by laser molecular beam epitaxy. High magnetic field magnetoresistance curves were fitted by the Brillouin function, which indicated the existence of magnetically polarized regions and the underlying hopping mechanism. The unsaturated magnetoconductance was the most striking finding observed in pulsed magnetic fields up to 60 T. These observations can deepen the fundamental understanding of the colossal magnetoresistance in manganites with strong correlation of transport properties and magnetic ordering.

Financiarisation et lien social : une analyse de l’exclusion bancaire à partir de l’institutionnalisme de J.R. Commons Financialisation and social inclusion: an analysis of financial exclusion based on the institutionalism of J. R. Commons

Directory of Open Access Journals (Sweden)

Georges Gloukoviezoff

2010-12-01

Full Text Available La financiarisation de l’économie affecte les entreprises mais aussi largement les ménages. Les règles et normes d’accès et d’usage bancaires se traduisent notamment par des difficultés pouvant faire basculer les personnes vers l’exclusion sociale. La mobilisation des concepts empruntés à l’un des fondateurs de l’institutionnalisme américain, J.R. Commons (institution, futurité, going concern, capitalisme raisonnable permet d’envisager la mise en cohérence du rôle social des produits bancaires et de la prestation bancaire avec les contraintes de la régulation marchande des établissements bancaires.Financialisation impacts firms but also households. Banking norms and rules of access and use involve difficulties wich could lead people to poverty and social exclusion. A framework based on concepts elaborated by one of the pioneer of American Institutionalism, J.R. Commons (institution, futurity, going concern, reasonable capitalism help to think how to articulate the social role of financial products and services and financial firms with the constraint of the free market regulation of financial firms.

Enhancement of Thermoelectric Performances in a Topological Crystal Insulator Pb0.7Sn0.3Se via Weak Perturbation of the Topological State and Chemical Potential Tuning by Chlorine Doping.

Science.gov (United States)

Lin, Chan-Chieh; Kim, Gareoung; Ginting, Dianta; Ahn, Kyunghan; Rhyee, Jong-Soo

2018-04-04

Topological insulators generally share commonalities with good thermoelectric (TE) materials because of their narrow band gaps and heavy constituent elements. Here, we propose that a topological crystalline insulator (TCI) could exhibit a high TE performance by breaking its crystalline symmetry and tuning the chemical potential by elemental doping. As a candidate material, we investigate the TE properties of the Cl-doped TCI Pb 0.7 Sn 0.3 Se. The infrared absorption spectra reveal that the band gap is increased from 0.055 eV for Pb 0.7 Sn 0.3 Se to 0.075 eV for Pb 0.7 Sn 0.3 Se 0.99 Cl 0.01 , confirming that the Cl doping can break the crystalline mirror symmetry of a TCI Pb 0.7 Sn 0.3 Se and thereby enlarge its bulk electronic band gap. The topological band inversion is confirmed by the extended X-ray absorption fine structure spectroscopy, which shows that the TCI state is weakened in a chlorine x = 0.05-doped compound. The small gap opening and partial linear band dispersion with massless and massive bands may have a high power factor (PF) for high electrical conductivity with an enhancement of the Seebeck coefficient. As a result, Pb 0.7 Sn 0.3 Se 0.99 Cl 0.01 shows a considerably enhanced ZT of 0.64 at 823 K, which is about 1200% enhancement in ZT compared with that of the undoped Pb 0.7 Sn 0.3 Se. This work demonstrates that the optimal n-type Cl doping tunes the chemical potential together with breaking the state of the TCI, suppresses the bipolar conduction at high temperatures, and thereby enables the Seebeck coefficient to increase up to 823 K, resulting in a significantly enhanced PF at high temperatures. In addition, the bipolar contribution to thermal conductivity is effectively suppressed for the Cl-doped samples of Pb 0.7 Sn 0.3 Se 1- x Cl x ( x ≥ 0.01). We propose that breaking the crystalline mirror symmetry in TCIs could be a new research direction for exploring high-performance TE materials.

Polycyclic aromatic hydrocarbons stimulate cell proliferation of human breast cancer MCF-7 cells

Czech Academy of Sciences Publication Activity Database

Vondráček, Jan; Plíšková, M.; Vojtěšek, B.; Kozubík, Alois; Machala, M.

2003-01-01

Roč. 270, Suppl. 1 (2003), s. 127 ISSN 0014-2956. [FEBS Special Meeting 2003 on Signal Transduction. 03.07.2003-08.07.2003, Brussels] R&D Projects: GA ČR GP525/01/D076; GA ČR GA525/03/1527 Institutional research plan: CEZ:AV0Z5004920 Keywords : cell proliferation * estrogen receptor * p53 Subject RIV: BO - Biophysics

Growth temperature dependence of Si doping efficiency and compensating deep level defect incorporation in Al0.7Ga0.3N

International Nuclear Information System (INIS)

Armstrong, Andrew M.; Moseley, Michael W.; Allerman, Andrew A.; Crawford, Mary H.; Wierer, Jonathan J.

2015-01-01

The growth temperature dependence of Si doping efficiency and deep level defect formation was investigated for n-type Al 0.7 Ga 0.3 N. It was observed that dopant compensation was greatly reduced with reduced growth temperature. Deep level optical spectroscopy and lighted capacitance-voltage were used to understand the role of acceptor-like deep level defects on doping efficiency. Deep level defects were observed at 2.34 eV, 3.56 eV, and 4.74 eV below the conduction band minimum. The latter two deep levels were identified as the major compensators because the reduction in their concentrations at reduced growth temperature correlated closely with the concomitant increase in free electron concentration. Possible mechanisms for the strong growth temperature dependence of deep level formation are considered, including thermodynamically driven compensating defect formation that can arise for a semiconductor with very large band gap energy, such as Al 0.7 Ga 0.3 N

Exciton luminescence in In0.3Ga0.7As/GaAs quantum well heterostructures

International Nuclear Information System (INIS)

Kapon, Eli; Mereuta, Alexandru; Dorogan, Andrei; Dragutan, Nicolae; Vieru, Tatiana; Syrbu, Nicolae

2011-01-01

Radiation maxima were observed in photoluminescence spectra of GaAs/ In 0.3 Ga 0.7 As/ GaAs in case of 632.8 nm and 532 nm He-Ne laser excitation conditioned by the recombination from ground (e1-hh1, e1-lh1) and excited (e2-hh2, e2-lh2) states of polarionic excitons in quantum wells. The doublet character of e1-hh1, e1-lh1 transitions can be explained by the interaction of excitons in quantum wells. Radiation maxima are revealed in the region of 1.5eV energy conditioned by recombination transitions E b -hh1, E b -lh1of the GaAs buffer layer.

Neutron diffraction and magnetic study of the Nd0.7Pb0.3Mn1-xFexO3 (0=

International Nuclear Information System (INIS)

Blanco, J.J.; Insausti, M.; Gil de Muro, I.; Lezama, L.; Rojo, T.

2006-01-01

The effect of Fe doping on the ferromagnetic Nd 0.7 Pb 0.3 Mn 1-x Fe x O 3 (x=0, 0.025, 0.05, 0.075, 0.1) phases has been studied in order to analyze the double-exchange interaction. The structural and magnetic study has been carried out by neutron powder diffraction and susceptibility measurements between 1.7 and 300K. The substitution of Fe at the Mn site results in reductions in both the Curie temperature T c and the magnetic moment per Mn ion without appreciable differences in the crystal structures. All the compounds crystallize in Pnma space group. The thermal evolution of the lattice parameters of the Nd 0.7 Pb 0.3 Mn 1-x Fe x O 3 (x=0.025, 0.05, 0.075) compounds shows discontinuities in volume and lattice parameters close to the magnetic transition temperature. Increasing amounts of Fe 3+ reduces the double exchange interactions and no magnetic contribution for x=0.1 is observed. The magnetic structures of Nd 0.7 Pb 0.3 Mn 1-x Fe x O 3 (x=0, 0.025, 0.05, 0.075) compounds show that the Nd and Mn ions are ferromagnetically ordered

40 CFR 191.03 - Standards.

Science.gov (United States)

2010-07-01

...) Management and storage of spent nuclear fuel or high-level or transuranic radioactive wastes at all... and storage of spent nuclear fuel or high-level or transuranic radioactive wastes at all facilities... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Standards. 191.03 Section 191.03...

Par and IR reflectance, transmittance, and absorptance of four crop canopies

International Nuclear Information System (INIS)

Wanjura, D.F.; Hatfield, J.L.

1986-01-01

Reflectance, transmittance and absorptance of electromagnetic radiation by cotton, soybeans, grain sorghum, and sunflower was measured at three growth stages in two wavebands (PAR: 0.4 to 0.7 pun and IR: 0.7 to 1.1 yim). As leaf area increased in each crop there were increases in IR reflectance and PAR absorptance and decreases in PAR reflectance and both PAR and IR transmittance. IR radiation was concentrated at the soil surface between rows by reflectance from the sides of canopies when crop cover was less than 80%. Across all crops one parameter, leaf overlap index, explained 81 and 71% of the PAR reflectance and another, crop cover, explained 86 and 94% of IR reflectance from rows and interrows, respectively. Attenuation of PAR radiation through the canopies of cotton and sunflower was similar (K = 0.62 and 0.67) but different from that of soybeans and grain sorghum (K = 0.46 and 0.43) which were the same

9 CFR 417.4 - Validation, Verification, Reassessment.

Science.gov (United States)

2010-01-01

.... 417.4 Section 417.4 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF... not have a HACCP plan because a hazard analysis has revealed no food safety hazards that are... ACT HAZARD ANALYSIS AND CRITICAL CONTROL POINT (HACCP) SYSTEMS § 417.4 Validation, Verification...

42 CFR 417.406 - Application and determination.

Science.gov (United States)

2010-10-01

... 42 Public Health 3 2010-10-01 2010-10-01 false Application and determination. 417.406 Section 417.406 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES... PREPAYMENT PLANS Qualifying Conditions for Medicare Contracts § 417.406 Application and determination. (a...

Evaluation of the magnetocaloric response of nano-sized La0.7Ca0.3Mn1-xNixO3 manganites synthesized by auto-combustion method

Science.gov (United States)

Gómez, Adrián; Chavarriaga, Edgar; Supelano, Iván; Parra, Carlos Arturo; Morán, Oswaldo

2018-05-01

A systematic study of the dependence of the magnetization on the magnetic field around the ferromagnetic-paramagnetic phase transition temperature is carried out on La0.7Ca0.3Mn1-xNixO3 (x=0, 0.02, 0.07, and 1) samples synthesized by auto-combustion method. The successful substitution of Mn3+ ions by Ni2+ ions in the La0.7Ca0.3MnO3 lattice is corroborated by X-ray diffraction technique. Banerjees criteria, Arrott plots, and the scaling hypothesis are used to analyze the experimental data. It is verified that the Ni-doping increases the operating temperature range for magnetocaloric effect through tuning of the magnetic transition temperature. Probably, the replacement of Mn3+ by Ni2+ ions in the La0.7Ca0.3MnO3 lattice weakens the Mn3+-O-Mn4+ double exchange interaction, which leads to a decrease in the transition temperature and magnetic moment in the samples. The Arrott plots suggest that the phase transition from ferromagnetic to paramagnetic in the nano-sized manganite is of second order. The analysis of the magnetization results show that the maximum magnetic entropy changes observed for x=0, 0.02, 0.07, and 0.1 compositions are 0.85, 0.77, 0.63, and 0.59 J/kg K, under a magnetic field of 1.5 T. These values indicate that the magnetic entropy change achieved for La0.7Ca0.3Mn1-xNixO3 manganites synthesized by auto-combustion method is higher than those reported for other manganites with comparable Ni-doping levels but synthesized by standard solid state reaction. It is also observed that the addition of Ni2+ increases the value of the relative cooling power as compared to that of the parent compound. The highest value of this parameter (˜60 J/kg) is found for a Ni-doping level of 2 % around 230 K in a field of 1.5 T.

Voies de recherche en matière de récupération assistée du pétrole par tensio-actifs Research Lines in Enhanced Oil Recovery by Surfactants

Directory of Open Access Journals (Sweden)

Baviere M.

2006-11-01

Full Text Available Quelle que soit la conjoncture économique, le procédé de récupération assistée du pétrole par injection d'agents tensio-actifs nécessite une mise en oeuvre très élaborée pour tirer le meilleur parti des produits et donc pour franchir le seuil de rentabilité. Il apparaît par ailleurs que son champ d'application doit être étendu aux conditions de réservoir couramment rencontrées, notamment les fortes salinités, par l'utilisation de structures chimiques adaptées. Pour réduire les pertes de tensio-actifs par adsorption sur la roche, et par suite, préserver l'efficacité du fluide micellaire, deux techniques sont étudiées à l'Institut Français du Pétrole. L'une d'entre elles consiste à réduire l'adsorption en augmentant le pH de la formation à l'aide d'agents alcalins. Dans l'autre méthode, les molécules adsorbées sont remises en solution par un agent désorbant ajouté à l'eau de chasse. L'extension du procédé aux gisements salés est illustrée avec une famille de tensio-actifs qui ont un comportement prometteur dans ces conditions, les sulfonates d'oléfines alpha. Il apparaît que l'efficacité interfaciale de ces produits ne doit pas être seule prise en compte, mais également la solubilité, la stabilité chimique, le comportement rhéologique et l'adsorption sur les surfaces minérales. No matter what the economic situation may be, the process of enhanced oil recovery (EOR by surfactant flooding requires very sophisticated implementation to take maximum advantage of the chemicals and hence to cross the threshold of economic feasibility. It seems, moreover, that the scope of application of this process must be enlarged to meet the reservoir conditions commonly encountered, particularly high salinity, by the use of suitable chemical structures. To reduce surfactant losses by adsorption on the rock and then to preserve the efficiency of the micellar fluid, two techniques are being investigated at the Institut

Synthesis and characterization of Ni0.7Zn0.3Fe2O4 ferrospinel: performance evaluation for methyl and ethyl esterification

International Nuclear Information System (INIS)

Mapossa, A.B.; Dantas, J.; Diniz, V.C.S.; Costa, A.C.F.M.; Silva, M.R.; Kiminami, R.H.G.A.

2017-01-01

Ni 0.7 Zn 0.3 Fe 2 O 4 ferrospinel was synthesized by combustion and its catalytic performance in methyl and ethyl esterification of the soybean oil was investigated. The samples were characterized by X-ray diffraction, Rietveld refinement analysis, energy dispersive X-ray fluorescence spectroscopy, Fourier transform infrared spectroscopy, textural analysis, scanning electron microscopy, density by picnometry, particle size analysis, thermogravimetric analysis, magnetic measurements, and catalytic tests. The synthesis was efficient resulting in a ferrospinel with single phase Ni 0.7 Zn 0.3 Fe 2 O 4 with crystallite size of 20 nm, high surface area (86 m 2 /g) and saturation magnetization of 18 emu/g. The ferrospinel had promising catalytic activity in both reaction conditions studied, being more active in the conversion of soybean oil to biodiesel in methyl esterification with an average conversion of 93.9±2.8%. (author)

9 CFR 417.6 - Inadequate HACCP Systems.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Inadequate HACCP Systems. 417.6 Section 417.6 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... ANALYSIS AND CRITICAL CONTROL POINT (HACCP) SYSTEMS § 417.6 Inadequate HACCP Systems. A HACCP system may be...

On-site study of HCFC-22 substitution for HFC non-azeotropic blends (R417A, R422D) on a water chiller of a centralized HVAC system

Energy Technology Data Exchange (ETDEWEB)

Torrella, E.; Larumbe, J.A. [Polytechnic University of Valencia, Dep. of Applied Thermodynamics, Camino de Vera 14, E-46022 Valencia (Spain); Cabello, R.; Sanchez, D.; Llopis, R. [Jaume I University, Dep. of Mechanical Engineering and Construction, Campus de Riu Sec s/n, E-12071 Castellon (Spain)

2010-09-15

The European Regulation no 2037/2000 has banned manufacturing HCFC refrigerants from January 1st 2010, although its use is allowed up to 2015 if the fluids come from a recycling process. This situation creates the need for developing new working fluids to replace the HCFC in the refrigeration plants now in operation. Among all the HCFCs the R22 is the most widely used in a wide range of applications, especially in air conditioning. This work presents an on-site experimental study of the R22 replacement by two possible substitutes, the HFC-417A and the HFC-422D, in a water chiller in which the energy performance was evaluated. This chiller is part of the centralized HVAC system of a lecture room building at the Jaume I University of Castellon, Spain. This communication compares and analyses main operation parameters of the chiller when operating with each refrigerant in real conditions. (author)

Hypersensitivity Induced by Activation of Spinal Cord PAR2 Receptors Is Partially Mediated by TRPV1 Receptors

Czech Academy of Sciences Publication Activity Database

Mrózková, Petra; Špicarová, Diana; Paleček, Jiří

2016-01-01

Roč. 11, č. 10 (2016), č. článku e0163991. E-ISSN 1932-6203 R&D Projects: GA ČR(CZ) GA15-11138S; GA MŠk(CZ) LH15279; GA ČR(CZ) GBP304/12/G069; GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:67985823 Keywords : PAR2 * TRP * neuropathy * spinal cord Subject RIV: FH - Neurology Impact factor: 2.806, year: 2016

Microstructure-lattice thermal conductivity correlation in nanostructured PbTe{sub 0.7}S{sub 0.3} thermoelectric materials

Energy Technology Data Exchange (ETDEWEB)

He, Jiaqing [Department of Materials Science and Engineering, Northwestern University Evanston, IL (United States); Department of Chemistry, Northwestern University Evanston, IL (United States); Girard, Steven N [Department of Chemistry, Northwestern University Evanston, IL (United States); Kanatzidis, Mercouri G [Department of Chemistry, Northwestern University Evanston, IL (United States); Materials Science Division Argonne, National Laboratory Argonne, IL (United States); Dravid, Vinayak P [Department of Materials Science and Engineering, Northwestern University Evanston, IL (United States)

2010-03-09

The reduction of thermal conductivity, and a comprehensive understanding of the microstructural constituents that cause this reduction, represent some of the important challenges for the further development of thermoelectric materials with improved figure of merit. Model PbTe-based thermoelectric materials that exhibit very low lattice thermal conductivity have been chosen for this microstructure-thermal conductivity correlation study. The nominal PbTe{sub 0.7}S{sub 0.3} composition spinodally decomposes into two phases: PbTe and PbS. Orderly misfit dislocations, incomplete relaxed strain, and structure-modulated contrast rather than composition-modulated contrast are observed at the boundaries between the two phases. Furthermore, the samples also contain regularly shaped nanometer-scale precipitates. The theoretical calculations of the lattice thermal conductivity of the PbTe{sub 0.7}S{sub 0.3} material, based on transmission electron microscopy observations, closely aligns with experimental measurements of the thermal conductivity of a very low value, {proportional_to}0.8 W m{sup -1} K{sup -1} at room temperature, approximately 35% and 30% of the value of the lattice thermal conductivity of either PbTe and PbS, respectively. It is shown that phase boundaries, interfacial dislocations, and nanometer-scale precipitates play an important role in enhancing phonon scattering and, therefore, in reducing the lattice thermal conductivity. (Abstract Copyright [2010], Wiley Periodicals, Inc.)

Effect of Fe substitution on magnetocaloric effect in La0.7Sr0.3Mn1-xFexO3 (0.05≤x≤0.20)

International Nuclear Information System (INIS)

Barik, S.K.; Krishnamoorthi, C.; Mahendiran, R.

2011-01-01

We have studied the effect of Fe substitution on magnetic and magnetocaloric properties in La 0.7 Sr 0.3 Mn 1-x Fe x O 3 (x=0.05, 0.07, 0.10, 0.15, and 0.20) over a wide temperature range (T=10-400 K). It is shown that substitution by Fe gradually decreases the ferromagnetic Curie temperature (T C ) and saturation magnetization up to x=0.15 but a dramatic change occurs for x=0.2. The x=0.2 sample can be considered as a phase separated compound in which both short-range ordered ferromagnetic and antiferromagnetic phases coexist. The magnetic entropy change (-ΔS m ) was estimated from isothermal magnetization curves and it decreases with increase of Fe content from 4.4 J kg -1 K -1 at 343 K (x=0.05) to 1.3 J kg -1 K -1 at 105 K (x=0.2), under ΔH=5 T. The La 0.7 Sr 0.3 Mn 0.93 Fe 0.07 O 3 sample shows negligible hysteresis loss, operating temperature range over 60 K around room temperature with refrigerant capacity of 225 J kg -1 , and magnetic entropy of 4 J kg -1 K -1 which will be an interesting compound for application in room temperature refrigeration. - Research highlights: → We report magnetocaloric effect in La 0.7 Sr 0.3 Mn 1-x Fe x O 3 (x=0-0.2). → Magnetic entropy change (ΔS m ) decreases with increasing x. → A large ΔS m and refrigeration capacity are found around 300 K in x=0.07.

42 CFR 417.536 - Cost payment principles.

Science.gov (United States)

2010-10-01

... 42 Public Health 3 2010-10-01 2010-10-01 false Cost payment principles. 417.536 Section 417.536... PREPAYMENT PLANS Medicare Payment: Cost Basis § 417.536 Cost payment principles. (a) Applicability. Unless otherwise specified in this subpart, the principles set forth in parts 412 and 413 of this chapter are...

9 CFR 417.7 - Training.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Training. 417.7 Section 417.7 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE REGULATORY REQUIREMENTS UNDER THE FEDERAL MEAT INSPECTION ACT AND THE POULTRY PRODUCTS INSPECTION ACT HAZARD ANALYSIS AND...

Accurate measurement of heteronuclear dipolar couplings by phase-alternating R-symmetry (PARS) sequences in magic angle spinning NMR spectroscopy

Energy Technology Data Exchange (ETDEWEB)

Hou, Guangjin, E-mail: hou@udel.edu, E-mail: tpolenov@udel.edu; Lu, Xingyu, E-mail: luxingyu@udel.edu, E-mail: lexvega@comcast.net; Vega, Alexander J., E-mail: luxingyu@udel.edu, E-mail: lexvega@comcast.net; Polenova, Tatyana, E-mail: hou@udel.edu, E-mail: tpolenov@udel.edu [Department of Chemistry and Biochemistry, University of Delaware, Newark, Delaware 19716, USA and Pittsburgh Center for HIV Protein Interactions, University of Pittsburgh School of Medicine, 1051 Biomedical Science Tower 3, 3501 Fifth Ave., Pittsburgh, Pennsylvania 15261 (United States)

2014-09-14

We report a Phase-Alternating R-Symmetry (PARS) dipolar recoupling scheme for accurate measurement of heteronuclear {sup 1}H-X (X = {sup 13}C, {sup 15}N, {sup 31}P, etc.) dipolar couplings in MAS NMR experiments. It is an improvement of conventional C- and R-symmetry type DIPSHIFT experiments where, in addition to the dipolar interaction, the {sup 1}H CSA interaction persists and thereby introduces considerable errors in the dipolar measurements. In PARS, phase-shifted RN symmetry pulse blocks applied on the {sup 1}H spins combined with π pulses applied on the X spins at the end of each RN block efficiently suppress the effect from {sup 1}H chemical shift anisotropy, while keeping the {sup 1}H-X dipolar couplings intact. Another advantage over conventional DIPSHIFT experiments, which require the signal to be detected in the form of a reduced-intensity Hahn echo, is that the series of π pulses refocuses the X chemical shift and avoids the necessity of echo formation. PARS permits determination of accurate dipolar couplings in a single experiment; it is suitable for a wide range of MAS conditions including both slow and fast MAS frequencies; and it assures dipolar truncation from the remote protons. The performance of PARS is tested on two model systems, [{sup 15}N]-N-acetyl-valine and [U-{sup 13}C,{sup 15}N]-N-formyl-Met-Leu-Phe tripeptide. The application of PARS for site-resolved measurement of accurate {sup 1}H-{sup 15}N dipolar couplings in the context of 3D experiments is presented on U-{sup 13}C,{sup 15}N-enriched dynein light chain protein LC8.

Role of grain size on the magnetic properties of La{sub 0.7}Sr{sub 0.3}MnO{sub 3}

Energy Technology Data Exchange (ETDEWEB)

Yadav, P.A. [Center for Advanced Studies in Materials Science and Condensed Matter Physics, Department of Physics, University of Pune, Pune 411007 (India); Deshmukh, A.V. [Department of Physics, Fergusson College, Pune 411004 (India); Adhi, K.P. [Center for Advanced Studies in Materials Science and Condensed Matter Physics, Department of Physics, University of Pune, Pune 411007 (India); Kale, B.B. [Centre for Materials for Electronics Technology, Pune 411008 (India); Basavaih, N. [Indian Institute of Geomagnetism, New Mumbai 410218 (India); Patil, S.I., E-mail: patil@physics.unipune.ac.in [Center for Advanced Studies in Materials Science and Condensed Matter Physics, Department of Physics, University of Pune, Pune 411007 (India)

2013-02-15

Nanophasic La{sub 0.7}Sr{sub 0.3}MnO{sub 3} samples were synthesized using the citrate-gel method. The samples were annealed at different temperatures ranging from 600 to 1200 Degree-Sign C. Grain size was observed to increase with the increase in annealing temperature. Furthermore, the magnetization data of these samples show well defined hysteresis. Saturation magnetization was observed to increase with increase in particle size. This gives evidence of formation of a magnetically dead layer at the surface. The thickness of the dead layer has also been calculated. The coercivity of nanoparticles follows the same trend as predicted theoretically and particles below 22 nm are found to be single domain. The ferromagnetic to paramagnetic transition temperature also increases with increase in particle size. - Highlights: Black-Right-Pointing-Pointer Synthesis of nanocrystalline La{sub 0.7}Sr{sub 0.3}MnO{sub 3} by the citrate-gel method. Black-Right-Pointing-Pointer Saturation magnetization increases with increase in particle size. Black-Right-Pointing-Pointer Formation of dead magnetic layer.

Getting to know Malaysian R and D institutions

International Nuclear Information System (INIS)

1994-01-01

There are 27 institutions in Malaysia involved in research and development (R and D). They are categorised into three different groups; the universities, Government's research institutes and statutory body research institutions. The universities are governed by the University and University College Acts and are placed under the jurisdiction of the Ministry of Education. The statutory body research institutions exist under their respective Acts while Government research institutes are placed under various government departments

Resonant photoemission study on La0.7Ca0.3MnO3 using Indus-1 synchrotron source

International Nuclear Information System (INIS)

Sagdeo, P.R.; Choudhary, R.J.; Phase, D.M.

2008-01-01

The electronic valance band structure of pulsed laser deposited La 0.7 Ca 0.3 MnO 3 thin film has been investigated by resonant photoelectron spectroscopy using CSR beamline (BL-2) on Indus-1 synchrotron radiation source. The valance band spectra were measured at room temperature with the photon energy ranging from 40 eV to 60 eV. The contribution of Mn-3d to the valance band was determined using resonant photo-electron intensity near Mn3p-3d threshold. (author)

40 CFR 413.03 - Monitoring requirements.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 28 2010-07-01 2010-07-01 true Monitoring requirements. 413.03 Section 413.03 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND... for total toxic organics (TTO), I certify that, to the best of my knowledge and belief, no dumping of...

Magnetic properties of La0.7Ca0.3MnO3 nanoparticles prepared by reactive milling

International Nuclear Information System (INIS)

Do Hung Manh; Nguyen Chi Thuan; Pham Thanh Phong; Le Van Hong; Nguyen Xuan Phuc

2009-01-01

La 0.7 Ca 0.3 MnO 3 (LCMO) nanoparticles were synthesized by reactive milling in ambient conditions. Magnetic properties of LCMO single-phase nanocrystalline particles were studied. LCMO nanoparticles exhibit superparamagnetism with blocking temperature that decreases in the logarithmic function as increasing applied magnetic field. Besides, the blocking temperature decreases as increasing milling time from 8 h to 16 h. The temperature dependence of the saturation magnetization shows a strong collective excitation due to the spin wave that depends on temperature in form T α with α = 1.7, which slightly deviates from the Bloch law.

Enhancement of Magnetocaloric Effect in ({ {La}}_{0.67}{ {Ca}}_{0.33}{ {MnO}}_{3})/({ {La}}_{0.7}{ {Ba}}_{0.3}{ {MnO}}_{3}) ( La 0.67 Ca 0.33 MnO 3 ) / ( La 0.7 Ba 0.3 MnO 3 ) Composite

Science.gov (United States)

Khelifi, J.; Dhahri, E.; Hlil, E. K.

2018-03-01

The composite (La_{0.67}Ca_{0.33}MnO3)/La_{0.7}Ba_{0.3}MnO3) sample was prepared using the conventional solid-state reaction method, and their crystallographic structure was achieved by X-ray diffraction pattern analysis. The magnetic and magnetocaloric effect has been studied by magnetization measurements. Based on the relation: χ ^{-1}(T)∝ (T-T_C^Rand )^{1-λ }, the inverse of susceptibility shows a downturn before T_C indicating the existence of Griffiths phase for the temperature range T_C^Randphase has been obtained from detailed magnetization studies. Furthermore, a large magnetic entropy change is observed in (La_{0.67}Ca_{0.33}MnO3)/(La_{0.7}Ba_{0.3}MnO3) composite which possesses a large MCE characterized by two Δ S_M(T) peaks. It has revealed that the combination of manganite materials with different Curie temperatures is a possible method for enhancement of magnetocaloric effect. To determine the field dependence of the experimental Δ S_M(T), a local exponent n( T, H) can be calculated from the logarithmic derivative of the magnetic entropy change versus field; it is shown that for a multiphase system n evolves with field both at the Curie temperature of the system and at the Curie temperatures of the constituent phases.

Fractional-flux Little-Parks resistance oscillations in disordered superconducting Au0.7In0.3 cylinders

International Nuclear Information System (INIS)

Zadorozhny, Yu.; Liu, Y.

2001-01-01

The resistance of disordered superconducting Au 0.7 In 0.3 cylindrical films was measured as a function of applied magnetic field. In the high-temperature part of the superconducting transition regime, the resistance oscillated with a period of h/2e in units of the enclosed magnetic flux. However, at lower temperatures, the resistance peaks split. We argue that this splitting is due to the emergence of an oscillation with a period of h/4e, half of the flux quantum for paired electrons. The possible physical origin of the h/4e resistance oscillation is discussed in the context of new minima in the free energy of a disordered superconducting cylinder. (orig.)

Chemical disorder influence on magnetic state of optimally-doped La0.7Ca0.3MnO3

Science.gov (United States)

Rozenberg, E.; Auslender, M.; Shames, A. I.; Jung, G.; Felner, I.; Tsindlekht, M. I.; Mogilyansky, D.; Sominski, E.; Gedanken, A.; Mukovskii, Ya. M.; Gorodetsky, G.

2011-10-01

X-band electron magnetic resonance and dc/ac magnetic measurements have been employed to study the effects of chemical disorder on magnetic ordering in bulk and nanometer-sized single crystals and bulk ceramics of optimally-doped La0.7Ca0.3MnO3 manganite. The magnetic ground state of bulk samples appeared to be ferromagnetic with the lower Curie temperature and higher magnetic homogeneity in the vicinity of the ferromagnetic-paramagnetic phase transition in the crystal, as compared with those characteristics in the ceramics. The influence of technological driven "macroscopic" fluctuations of Ca-dopant level in crystal and "mesoscopic" disorder within grain boundary regions in ceramics was proposed to be responsible for these effects. Surface spin disorder together with pronounced inter-particle interactions within agglomerated nano-sample results in well defined core/shell spin configuration in La0.7Ca0.3MnO3 nano-crystals. The analysis of the electron paramagnetic resonance data enlightened the reasons for the observed difference in the magnetic order. Lattice effects dominate the first-order nature of magnetic phase transition in bulk samples. However, mesoscale chemical disorder seems to be responsible for the appearance of small ferromagnetic polarons in the paramagnetic state of bulk ceramics. The experimental results and their analysis indicate that a chemical/magnetic disorder has a strong impact on the magnetic state even in the case of mostly stable optimally hole-doped manganites.

14 CFR 417.121 - Safety critical preflight operations.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Safety critical preflight operations. 417.121 Section 417.121 Aeronautics and Space COMMERCIAL SPACE TRANSPORTATION, FEDERAL AVIATION... surveillance. A launch operator must implement its hazard area surveillance and clearance plan, of § 417.111(j...

48 CFR 9904.417-50 - Techniques for application.

Science.gov (United States)

2010-10-01

... capitalized, such as the method used for financial accounting and reporting, may be used, provided the.... 9904.417-50 Section 9904.417-50 Federal Acquisition Regulations System COST ACCOUNTING STANDARDS BOARD... ACCOUNTING STANDARDS COST ACCOUNTING STANDARDS 9904.417-50 Techniques for application. (a) The cost of money...

Histoire d’une institution au cœur de la Francophonie

OpenAIRE

Gendreau-Massaloux, Michèle

2010-01-01

L’histoire de l’AUF, institution universitaire et francophone, est marquée à la fois par l’évolution de la Francophonie institutionnelle et par sa dimension proprement universitaire. C’est au début des années 1960 qu’est fondée l’association des universités partiellement ou entièrement de langue française, l’AUPELF, réseau mis en place par quelques universitaires de divers pays soucieux d’échanges et de coopération. Le caractère associatif de cette instance, qui regroupe rapidement une quaran...

Keratometric alterations following the 25-gauge transconjunctival sutureless pars plana vitrectomy versus the conventional pars plana vitrectomy.

Science.gov (United States)

Citirik, Mehmet; Batman, Cosar; Bicer, Tolga; Zilelioglu, Orhan

2009-09-01

To assess the alterations in keratometric astigmatism following the 25-gauge transconjunctival sutureless pars plana vitrectomy versus the conventional pars plana vitrectomy. Sixteen consecutive patients were enrolled into the study. Conventional vitrectomy was applied to eight of the cases and 25-gauge transconjunctival sutureless vitrectomy was performed in eight patients. Keratometry was performed before and after the surgery. In the 25-gauge transconjunctival sutureless pars plana vitrectomy group, statistically significant changes were not observed in the corneal curvature in any post-operative follow-up measurement (p > 0.05); whereas in the conventional pars plana vitrectomy group, statistically significant changes were observed in the first postoperative day (p = 0.01) and first postoperative month (p = 0.03). We noted that these changes returned to baseline in three months (p = 0.26). Both 25-gauge transconjunctival sutureless and conventional pars plana vitrectomy are effective surgical modalities for selected diseases of the posterior segment. Surgical procedures are critical for the visual rehabilitation of the patients. The post-operative corneal astigmatism of the vitrectomised eyes can be accurately determined at least two months post-operatively.

Electric-field control of electronic transport properties and enhanced magnetoresistance in La0.7Sr0.3MnO3/0.5BaZr0.2Ti0.8O3-0.5Ba0.7Ca0.3TiO3 lead-free multiferroic structures

Science.gov (United States)

Yan, Jian-Min; Gao, Guan-Yin; Liu, Yu-Kuai; Wang, Fei-Fei; Zheng, Ren-Kui

2017-10-01

We report the fabrication of lead-free multiferroic structures by depositing ferromagnetic La0.7Sr0.3MnO3 (LSMO) polycrystalline films on polished 0.5BaZr0.2Ti0.8O3-0.5Ba0.7Ca0.3TiO3 (BZT-BCT) piezoelectric ceramic substrates. By applying electric fields to the BZT-BCT along the thickness direction, the resistivity of LSMO films can be effectively manipulated via the piezoelectric strain of the BZT-BCT. Moreover, the LSMO polycrystalline films exhibit almost temperature independent and significantly enhanced magnetoresistance (MR) below TC. At T = 2 K and H = 8 T, the MR of polycrystalline films is approximately two orders of magnitude higher than that of LSMO epitaxial films grown on (LaAlO3)0.3(SrAl1/2Ta1/2O3)0.7 single-crystal substrates. The enhanced MR mainly results from the spin-polarized tunneling of charge carriers across grain boundaries. The LSMO/BZT-BCT structures with electric-field controllable modulation of resistivity and enhanced MR effect may have potential applications in low-energy consumption and environmentally friendly electronic devices.

The effect of Se/Te ratio on transient absorption behavior and nonlinear absorption properties of CuIn0.7Ga0.3(Se1-xTex)2 (0 ≤ x ≤ 1) amorphous semiconductor thin films

Science.gov (United States)

Karatay, Ahmet; Küçüköz, Betül; Çankaya, Güven; Ates, Aytunc; Elmali, Ayhan

2017-11-01

The characterization of the CuInSe2 (CIS), CuInGaSe (CIGS) and CuGaSe2 (CGS) based semiconductor thin films are very important role for solar cell and various nonlinear optical applications. In this paper, the amorphous CuIn0.7Ga0.3(Se1-xTex)2 semiconductor thin films (0 ≤ x ≤ 1) were prepared with 60 nm thicknesses by using vacuum evaporation technique. The nonlinear absorption properties and ultrafast transient characteristics were investigated by using open aperture Z-scan and ultrafast pump-probe techniques. The energy bandgap values were calculated by using linear absorption spectra. The bandgap values are found to be varying from 0.67 eV to 1.25 eV for CuIn0.7Ga0.3Te2, CuIn0.7Ga0.3Se1.6Te0.4, CuIn0.7Ga0.3Se0.4Te1.6 and CuIn0.7Ga0.3Se2 thin films. The energy bandgap values decrease with increasing telluride (Te) doping ratio in mixed CuIn0.7Ga0.3(Se1-xTex)2 films. This affects nonlinear characteristics and ultrafast dynamics of amorphous thin films. Ultrafast pump-probe experiments indicated that decreasing of bandgap values with increasing the Te amount switches from the excited state absorption signals to ultrafast bleaching signals. Open aperture Z-scan experiments show that nonlinear absorption properties enhance with decreasing bandgaps values for 65 ps pulse duration at 1064 nm. Highest nonlinear absorption coefficient was found for CuIn0.7Ga0.3Te2 thin film due to having the smallest energy bandgap.

42 CFR 417.538 - Enrollment and marketing costs.

Science.gov (United States)

2010-10-01

... PREPAYMENT PLANS Medicare Payment: Cost Basis § 417.538 Enrollment and marketing costs. (a) Principle. Costs incurred by an HMO or CMP in performing the enrollment and marketing activities described in subpart k of... 42 Public Health 3 2010-10-01 2010-10-01 false Enrollment and marketing costs. 417.538 Section 417...

Controlling morphology and crystallite size of Cu(In0.7Ga0.3)Se2 nano-crystals synthesized using a heating-up method

International Nuclear Information System (INIS)

Hsu, Wei-Hsiang; Hsiang, Hsing-I; Chia, Chih-Ta; Yen, Fu-Su

2013-01-01

CuIn 0.7 Ga 0.3 Se 2 (CIGS) nano-crystals were successfully synthesized via a heating-up process. The non-coordinating solvent (1-octadecene) and selenium/cations ratio effects on the crystalline phase and crystallite size of CIGS nano-crystallites were investigated. It was observed that the CIGS nano-crystallite morphology changed from sheet into spherical shape as the amount of 1-octadecene addition was increased. CIGS nano-crystals were obtained in 9–20 nm sizes as the selenium/cations ratio increased. These results suggest that the monomer reactivity in the solution can be adjusted by changing the solvent type and selenium/cations ratio, hence affecting the crystallite size and distribution. - Graphical abstract: CuIn 0.7 Ga 0.3 Se 2 (CIGS) nano-crystals were successfully synthesized via a heating-up process in this study. The super-saturation in the solution can be adjusted by changing the OLA/ODE ratio and selenium/cation ratio.

Local profile dependence of coercivity in (MM0.3Nd0.7)-Fe-B sintered magnets

Science.gov (United States)

Yu, Xiaoqiang; Zhu, Minggang; Liu, Weiqiang; Li, Wei; Sun, Yachao; Shi, Xiaoning; Yue, Ming

2018-03-01

Two magnets with the same nominal composition of (MM0.3Nd0.7)-Fe-B (Marked as A) and [(La0.27Ce0.53Pr0.03Nd0.17)0.3Nd0.7]-Fe-B (Marked as B) were prepared using traditional powder metallurgical process, respectively. In order to point out the difference between two magnets, the magnetic properties, microstructure and magnetic domain of both magnets were investigated. Both magnets have the same elements, but different raw materials of misch-metal (MM) and La/Ce/Pr/Nd pure metal, which induces different magnetic properties. The magnet A with Br of 13.1 kGs, Hcj of 7.6 kOe, (BH)max of 37.8 MGOe and magnet B with Br of 13.4 kGs, Hcj of 5.8 kOe, (BH)max of 34.5 MGOe are obtained. Although both magnets have the similar Br, magnet A has higher coercivity than that of magnet B. According to refined results of characteristic X-ray diffraction peaks, there is a hard magnetic main phase with higher magnetic anisotropy field (HA) in magnet A and opposite case happens on magnet B. SEM images demonstrate that magnet A has more continuous RE-rich phase and smaller grain size compared to that of magnet B, which contributes to enhancing the coercivity. In addition, two main phases of [Nd0.82(La, Ce)0.18]-Fe-B and [Nd0.75(La, Ce)0.25]-Fe-B were detected by the EDX calculation, and the two main phases in both magnets were observed by magnetic domains again. Compared to magnet B, 2:14:1 main phases in magnet A contain more [Nd0.82(La, Ce)0.18]-Fe-B main phases and less [Nd0.75(La, Ce)0.25]-Fe-B main phases, which also leads to higher coercivity due to the different HA among Nd2Fe14B, La2Fe14B and Ce2Fe14B phases. Therefore, it is concluded that MM substitution could exhibit better magnetic properties than (La0.27Ce0.53Pr0.03Nd0.17)-metal substitution. Furthermore, applications of MM are beneficial to fabricate (MM, Nd)-Fe-B permanent magnets with lower cost.

Synthesis dependent characteristics of Sr1−xMnxTiO3 (x=0.03, 0.05, 0.07 and 0.09)

International Nuclear Information System (INIS)

Preethi Meher, K.R.S.; Bogicevic, Christine; Janolin, Pierre-Eymeric; Varma, K.B.R.

2012-01-01

Sr 1−x Mn x TiO 3 (where x=0.03, 0.05, 0.07 and 0.09) was synthesized via different routes that include solid-state, oxalate precipitation and freeze drying. In oxalate precipitation technique, compositions corresponding to 3 and 5 mol% doping of Mn were monophasic whereas the higher compositions revealed the presence of the secondary phases such as MnO, Mn 3 O 4 etc., as confirmed by high resolution X-ray diffraction (XRD) studies. The decomposition behavior of the precursors prepared using oxalate precipitation method corresponding to the above mentioned compositions was studied. Nanopowders of compositions pertaining to 5 to 9 mol% of Mn doping were obtained using freeze–drying technique. The average crystallite size of these nanopowders was found to be in the 35 to 65 nm range. The microstructural studies carried out on the sintered ceramics, fabricated using powders synthesized by different routes established the fine grained nature ( 1−x Mn x TiO 3 (x=0.03 and 0.05) obtained by oxalate precipitation technique along with that of the nanopowders for x=0.05, 0.07 and 0.09 obtained by freeze drying method, microstructural characterization and synthesis dependent dielectric behavior. Highlights: ► Monophasic samples obtained for compositions Sr 1−x Mn x TiO 3 with x=0.03 and 0.05. ► Nanopowders of Sr 1−x Mn x TiO 3 with x=0.05, 0.07 and 0.09 were synthesized by freeze–drying method. ► Phase purity of samples synthesized using freeze drying method were studied at different sintering temperatures. ► Analysis of Raman spectra for samples prepared by both oxalate precipitation and freeze–drying. ► Microstructure dependent dielectric characteristics have been illustrated.

Effect of Synthesis Temperature on Structure and Magnetic Properties of (La,Nd)0.7Sr0.3MnO3 Nanoparticles.

Science.gov (United States)

Shlapa, Yulia; Solopan, Sergii; Bodnaruk, Andrii; Kulyk, Mykola; Kalita, Viktor; Tykhonenko-Polishchuk, Yulia; Tovstolytkin, Alexandr; Belous, Anatolii

2017-12-01

Two sets of Nd-doped La 0.7 Sr 0.3 MnO 3 nanoparticles were synthesized via sol-gel method with further heat treatment at 1073 and 1573 K, respectively. Crystallographic and magnetic properties of obtained nanoparticles were studied, and the effect of synthesis conditions on these properties was investigated. According to X-ray data, all particles crystallized in the distorted perovskite structure. Magnetic parameters, such as saturation magnetization, coercivity, Curie temperature, and specific loss power, which is released on the exposure of an ensemble of nanoparticles to AC magnetic field, were determined for both sets of samples. The correlation between the values of Curie temperature and maximal heating temperature under AC magnetic field was found. It was revealed that for the samples synthesized at 1573 K, the dependences of crystallographic and magnetic parameters on Nd content were monotonous, while for the samples synthesized at 1073 K, they were non-monotonous. It was concluded that Nd-doped La 0.7 Sr 0.3 MnO 3 nanoparticles are promising materials for self-controlled magnetic hyperthermia applications, but the researchers should be aware of the unusual behavior of the particles synthesized at relatively low temperatures.

42 CFR 417.930 - Initial costs of operation.

Science.gov (United States)

2010-10-01

... 42 Public Health 3 2010-10-01 2010-10-01 false Initial costs of operation. 417.930 Section 417.930... PREPAYMENT PLANS Administration of Outstanding Loans and Loan Guarantees § 417.930 Initial costs of operation. Under section 1305 of the PHS, loans and loan guarantees were awarded for initial costs of operation of...

Differences in technology innovation R&D performance creation behavior between for-profit institutions and not-for-profit institutions.

Science.gov (United States)

Park, Sungmin

2016-01-01

The present study compares the performance creation behavior between for-profit institutions and not-for-profit institutions within a national technology innovation research and development (R&D) program. Based on the stepwise performance creation chain structure of typical R&D logic models, a series of successive binary logistic regression models is newly proposed. Using the models, a sample of n = 2076 completed government-sponsored R&D projects was analyzed. For each institution type, its distinctive behavior is diagnosed, and relevant implications are suggested for improving the R&D performance.

Plateforme régionale sur les ordinateurs personnels, déchets ...

International Development Research Centre (IDRC) Digital Library (Canada)

Institution. SUR Corporación de Estudios Sociales y Educación. Pays d' institution. Chili. Contenus connexes. Un numéro spécial de la revue met en lumière les conclusions d'une étude financée par le CRDI sur le travail rémunéré des femmes. Policy in Focus publie un numéro spécial présentant des données probantes ...

33 CFR 117.417 - Ohio River.

Science.gov (United States)

2010-07-01

....417 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Kentucky § 117.417 Ohio River. The draw of the Southern Railway railroad bridge, mile 607.4 at New Albany, Indiana, need not be opened for the passage of vessels. [CGD 82...

42 CFR 417.153 - Offer of HMO alternative.

Science.gov (United States)

2010-10-01

... 42 Public Health 3 2010-10-01 2010-10-01 false Offer of HMO alternative. 417.153 Section 417.153... § 417.153 Offer of HMO alternative. (a) Basic rule. An employing entity that is subject to this subpart and that elects to include one or more qualified HMOs must offer the HMO alternative in accordance...

RBS studies of the lattice damage caused by 1 MeV Si+ implantation into Al0.3Ga0.7As/GaAs superlattices at elevated temperature

International Nuclear Information System (INIS)

Xu Tianbing; Zhu Peiran; Zhou Junsi; Li Daiqing; Gong Baoan; Wan Ya; Mu Shanming; Zhao Qingtai; Wang Zhonglie

1994-01-01

The lattice damage accumulation in GaAs and Al 0.3 Ga 0.7 As/GaAs superlattices by 1 MeV Si + irradiation at room temperature and 350 C has been studied. For irradiations at 350 C, at lower doses the samples were almost defect-free after irradiation, while a large density of accumulated defects was induced at a higher dose. The critical dose above which the damage accumulation is more efficient is estimated to be 2 x 10 15 Si/cm 2 for GaAs, and is 5 x 10 15 Si/cm 2 for Al 0.8 Ga 0.7 As/GaAs superlattice for implantation with 1.0 MeV Si ions at 350 C. The damage accumulation rate for 1 MeV Si ion implantation in Al 0.3 Ga 0.7 As/GaAs superlattice is less than that in GaAs. (orig.)

Percolation on the institute-enterprise R

Directory of Open Access Journals (Sweden)

Li Chenguang

2015-01-01

Full Text Available Realistic network-like systems are usually composed of multiple networks with interacting relations such as school-enterprise research and development (R&D collaboration networks. Here, we study the percolation properties of a special class of R&D collaboration network, namely institute-enterprise R&D collaboration networks (IERDCNs. We introduce two actual IERDCNs to show their structural properties, and we present a mathematical framework based on generating functions for analyzing an interacting network with any connection probability. Then,we illustrate the percolation threshold and structural parameter arithmetic in the sub-critical and supercritical regimes.We compare the predictions of our mathematical framework and arithmetic to data for two real R&D collaboration networks and a number of simulations. We find that our predictions are in remarkable agreement with the data. We show applications of the framework to electronics R&D collaboration networks

42 CFR 417.158 - Payroll deductions.

Science.gov (United States)

2010-10-01

... 42 Public Health 3 2010-10-01 2010-10-01 false Payroll deductions. 417.158 Section 417.158 Public....158 Payroll deductions. Each employing entity that provides payroll deductions as a means of paying... employee's contribution, if any, to be paid through payroll deductions. [59 FR 49841, Sept. 30, 1994] ...

14 CFR 417.23 - Compliance monitoring.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Compliance monitoring. 417.23 Section 417... Compliance monitoring. (a) A launch operator must allow access by, and cooperate with, Federal officers or... launch operator must provide the FAA with a console for monitoring the progress of the countdown and...

14 CFR 417.103 - Safety organization.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Safety organization. 417.103 Section 417... organization. (a) A launch operator must maintain and document a safety organization. A launch operator must... within the launch operator's organization and between the launch operator and any federal launch range or...

Plantes médicinales utilisées par les populations Bassa de la région ...

African Journals Online (AJOL)

Une enquête ethnobotanique portant sur un échantillon de 90 ménages a été conduite en juin 2010 dans trois villages de la région de Douala, au Cameroun, afin de recenser les plantes médicinales utilisées par les populations rurales. Elle montre que 48 espèces relevant de 44 genres et de 26 familles sont utilisées dans ...

Distributivity of the algebra of regular open subsets of .beta. R / R

Czech Academy of Sciences Publication Activity Database

Balcar, Bohuslav; Hrušák, M.

2005-01-01

Roč. 149, č. 1 (2005), s. 1-7 ISSN 0166-8641 R&D Projects: GA ČR(CZ) GA201/03/0933; GA ČR(CZ) GA201/02/0857 Institutional research plan: CEZ:AV0Z10190503 Keywords : distributivity of Boolean algebras * cardinal invariants of the continuum * Čech-Stone compactification Subject RIV: BA - General Mathematics Impact factor: 0.297, year: 2005

Synthesis and characterization of Ni{sub 0.7}Zn{sub 0.3}Fe{sub 2}O{sub 4} ferrospinel: performance evaluation for methyl and ethyl esterification; Sintese e caracterizacao do ferroespinelio Ni{sub 0,7}Zn{sub 0,3}Fe{sub 2}O{sub 4}: avaliacao de desempenho na esterificacao metilica e etilica

Energy Technology Data Exchange (ETDEWEB)

Mapossa, A.B., E-mail: mapossabenjox@gmail.com [Curso de Quimica, Dept. de Ciencias Naturais, Universidade Pedagogica de Mocambique, Delegacao de Manica, Chimoio (Mozambique); Dantas, J.; Diniz, V.C.S.; Costa, A.C.F.M. [Universidade Federal de Campina Grande (UFCG), PB (Brazil). Programa de Pos-Graduacao em Ciencia e Engenharia de Materiais; Silva, M.R. [Universidade Federal de Itajuba (UNIFEI), MG (Brazil). Dept. de Fisica; Kiminami, R.H.G.A. [Universidade Federal de Sao Carlos (UFSCar), SP (Brazil). Departamento de Engenharia de Materiais

2017-04-15

Ni{sub 0.7}Zn{sub 0.3}Fe{sub 2}O{sub 4} ferrospinel was synthesized by combustion and its catalytic performance in methyl and ethyl esterification of the soybean oil was investigated. The samples were characterized by X-ray diffraction, Rietveld refinement analysis, energy dispersive X-ray fluorescence spectroscopy, Fourier transform infrared spectroscopy, textural analysis, scanning electron microscopy, density by picnometry, particle size analysis, thermogravimetric analysis, magnetic measurements, and catalytic tests. The synthesis was efficient resulting in a ferrospinel with single phase Ni{sub 0.7}Zn{sub 0.3}Fe{sub 2}O{sub 4} with crystallite size of 20 nm, high surface area (86 m{sup 2}/g) and saturation magnetization of 18 emu/g. The ferrospinel had promising catalytic activity in both reaction conditions studied, being more active in the conversion of soybean oil to biodiesel in methyl esterification with an average conversion of 93.9±2.8%. (author)

Role of grain size on magnetic properties of La0.7Sr0.3MnO3

International Nuclear Information System (INIS)

Yadav, Priyanka A.; Adhi, K.P.; Patil, S.I.; Deshmukh, Alka V.

2012-01-01

The perovskite compound has the form ABO 3 , where A site is rare earth element and B site is occupied by Mn ions. Undoped perovskite Manganites like LaMnO 3 is antiferromagnetic insulator. While divalent doped Manganites of the form R (1-x) A x MnO 3 (where R: Trivalent rare earth ion, A: divalent alkali ion) exhibit properties like insulator to metal and paramagnetic to ferromagnetic transitions, colossal magnetoresistance, charge ordered behaviour, phase separation etc. Divalent doping (e.g. Ca, Sr, Ba) causes Mn 3+ to change in Mn 4+ state far charge compensation, depending on the doping concentration. During last decade, lot of work has been carried out on single crystal and polycrystalline perovskite Manganites. But very few reports have been found on nanoparticles of hole doped Manganites. Hence to study the effect of particle size on the properties of perovskite Manganites, we have synthesized the nanosized powder of La 0.7 Sr 0.3 MnO 3 (LSMO) by using citrate-gel method. The samples are sintered from 600-1200 ° C by the step of 50° C for four hours. The size of particles was determined using X-ray diffraction and Field Emission Scanning Electron Microscopy technique. The average particle size is in the range 17-20 nm for sample prepared at 600° C. It was found that size of nanoparticles increased with increasing sintering temperature. Magnetization measurements of the sample were carried out with the help of Vibrating Sample Magnetometer (VSM) at room temperature. Saturation magnetization was found to be increased with increasing particle size giving evidence of formation of dead magnetic layer on the surface. The coercivity of nanoparticles follows the same trend as explained by Cullity. A.C. susceptibility measurements for these samples show systematic increase in magnetic transition temperature and approach the bulk value with increase in the particle size. (author)

Institutional Influences on R&D Collaboration in China

DEFF Research Database (Denmark)

Søberg, Peder Veng

2014-01-01

that simultaneously builds trust in the sequence of affect-based trust followed by cognition-based trust. Thereby, good results can be created in collaboration with Chinese universities. The paper illustrates institutional influences on R&D collaboration between foreign invested R&D and local universities in China...

Impedance spectroscopic and dielectric analysis of Ba0.7Sr0.3TiO3 thin films

International Nuclear Information System (INIS)

Rouahi, A.; Kahouli, A.; Sylvestre, A.; Defaÿ, E.; Yangui, B.

2012-01-01

Highlights: ► The material exhibits the contribution of both grain and grain boundaries in the electric response of Ba 0.7 Sr 0.3 TiO 3 . ► The plot of normalized complex dielectric modulus and impedance as a function of frequency exhibits both short and long-range conduction in the film. ► The frequency dependence of ac conductivity exhibits a polaron hopping mechanism with activation energy of 0.38 eV. ► The complex dielectric modulus analysis confirmed the presence of a non-Debye type of conductivity relaxation deduced from the KWW function. - Abstract: Polycrystalline Ba 0.7 Sr 0.3 TiO 3 thin film with Pt/BST/Pt/TiO 2 /SiO 2 structure was prepared by ion beam sputtering. The film was post annealed at 700 °C. The dielectric and electric modulus properties were studied by impedance spectroscopy over a wide frequency range [0.1–10 5 Hz] at different temperatures [175–350 °C]. The Nyquist plots (Z″ vs . Z′) show the contribution of both grain and grain boundaries at higher temperature on the electric response of BST thin films. Moreover, the resistance of grains decreases with the rise in temperature and the material exhibits a negative temperature coefficient of resistance. The electric modulus plot indicates the non-Debye type of dielectric relaxation. The values of the activation energy computed from both plots of Z″ and M″ are 0.86 eV and 0.81 eV respectively, which reveals that the species responsible for conduction are the same. The scaling behavior of M ″ /M ″ max shows the temperature independent nature of relaxation time. The plot of normalized complex dielectric modulus and impedance as a function of frequency exhibits both short and long-range conduction in the film.

Critical behavior of Y-doped Nd0.7Sr0.3MnO3 manganites exhibiting the tricritical point and large magnetocaloric effect

International Nuclear Information System (INIS)

Phan, The-Long; Ho, T.A.; Thang, P.D.; Tran, Q.T.; Thanh, T.D.; Phuc, N.X.; Phan, M.H.; Huy, B.T.; Yu, S.C.

2014-01-01

Highlights: • Tricritical point in Y-doped Nd 0.7 Sr 0.3 MnO 3 manganites. • A large magnetic-entropy change. • Magnetic inhomogeneity and phase separation. - Abstract: We have determined the values of critical exponents of two polycrystalline samples (Nd 1−x Y x ) 0.7 Sr 0.3 MnO 3 (x = 0 and 0.07) from the magnetization data versus temperature and magnetic field, M(H, T), to learn about their magnetic and magnetocaloric (MC) properties. The results reveal the samples exhibiting the crossover of first-order and second-order phase transitions, where the exponent values β = 0.271 and γ = 0.922 for x = 0, and β = 0.234–0.236 and γ = 1.044–1.063 for x = 0.07 determined by using modified Arrott plots and static-scaling hypothesis are close to those expected for the tricritical mean-field theory (β = 0.25 and γ = 1.0). Particularly, the T C of x = 0 and 0.07 can be any value in the temperature ranges of 240–255 K and 170–278 K, respectively, depending on the magnitude of applied magnetic field and determination techniques. Around the T C , studying the MC effect of the samples has revealed a large magnetic-entropy change (ΔS m ) up to ∼8 J/kg K for the applied field interval ΔH = 50 kOe, corresponding to refrigerant capacity values of 200–245 J/kg. These phenomena are related to the crossover nature and the persisting of FM/anti-FM interactions even above the T C , as further confirmed by electron-spin-resonance data, Curie–Weiss law-based analyses, and an exponential parameter characteristic of magnetic order n = dLn|ΔS m |/dLnH

Single Crystal Growth and Superconducting Properties of Antimony-Substituted NdO0.7F0.3BiS2

Directory of Open Access Journals (Sweden)

Satoshi Demura

2017-12-01

Full Text Available Antimony (Sb substitution of less than 8% was examined on a single crystal of a layered superconductor NdO0.7F0.3BiS2. The superconducting transition temperature of the substituted samples decreased as Sb concentration increased. A lattice constant along the c-axis showed a large decrease compared with that along the a-axis. Since in-plane chemical pressure monotonically decreased as Sb concentration increased, the suppression of the superconductivity is attributed to the decrease in the in-plane chemical pressure.

TMS suppression of right pars triangularis, but not pars opercularis, improves naming in aphasia

Science.gov (United States)

Naeser, Margaret A.; Martin, Paula I.; Theoret, Hugo; Kobayashi, Masahito; Fregni, Felipe; Nicholas, Marjorie; Tormos, Jose M.; Steven, Megan S.; Baker, Errol H.; Pascual-Leone, Alvaro

2011-01-01

This study sought to discover if an optimum 1 cm2 area in the non-damaged right hemisphere (RH) was present, which could temporarily improve naming in chronic, nonfluent aphasia patients when suppressed with repetitive transcranial magnetic stimulation (rTMS). Ten minutes of slow, 1 Hz rTMS was applied to suppress different RH ROIs in eight aphasia cases. Picture naming and response time (RT) were examined before, and immediately after rTMS. In aphasia patients, suppression of right pars triangularis (PTr) led to significant increase in pictures named, and significant decrease in RT. Suppression of right pars opercularis (POp), however, led to significant increase in RT, but no change in number of pictures named. Eight normals named all pictures correctly; similar to aphasia patients, RT significantly decreased following rTMS to suppress right PTr, versus right POp. Differential effects following suppression of right PTr versus right POp suggest different functional roles for these regions. PMID:21864891

Renforcer la résilience dans les collectivités touchées par le tsunami ...

International Development Research Centre (IDRC) Digital Library (Canada)

Lors du tsunami qui a frappé l'Asie du Sud en décembre 2004, des études ont indiqué qu'une épaisse végétation côtière, telles les mangroves, avait permis de sauver des vies et de réduire les pertes matérielles en servant de barrières naturelles. Par ailleurs, des villageois, comme ceux de Nallavadu dans le territoire de ...

Activité antérieure – Un pionnier de la réhydratation par voie orale ...

International Development Research Centre (IDRC) Digital Library (Canada)

15 avr. 2016 ... Renommé pour son travail avant-gardiste visant l'élaboration du processus de réhydratation par voie orale, le Dr Cash figurait parmi les lauréats du Prix Prince Mahidol de la santé publique, remis en Thaïlande en 2006. En 2011, il a reçu le prix Fries pour l'amélioration de la santé en raison de son travail ...

Synthesis of carbon nitride powder by selective etching of TiC0.3N0.7 in chlorine-containing atmosphere at moderate temperature

International Nuclear Information System (INIS)

Sui Jian; Lu Jinjun

2010-01-01

We reported the synthesis of carbon nitride powder by extracting titanium from single inorganic precursor TiC 0.3 N 0.7 in chlorine-containing atmosphere at ambient pressure and temperature not exceeding 500 deg. C. The TiC 0.3 N 0.7 crystalline structure acted as a template, supplying active carbon and nitrogen atoms for carbon nitride when it was destroyed in chlorination. X-ray diffraction data showed that the obtained carbon nitride powders were amorphous, which was in good agreement with transmission electron microscope analysis. The composition and structure of carbon nitride powders were analyzed by employing Fourier transform infrared spectroscopy, Raman spectroscopy, and X-ray photoelectron spectroscopy. Results indicated that disorder structure was most likely for the carbon nitride powders and the N content depended greatly on the chlorination temperature. Thermal analysis in flowing N 2 indicated that the mass loss started from 300 deg. C and the complete decomposition occurred at around 650 deg. C, confirming the low thermal stability of the carbon nitride material.

Surface morphology of Al0.3Ga0.7N/Al2O3-high electron mobility transistor structure.

Science.gov (United States)

Cörekçi, S; Usanmaz, D; Tekeli, Z; Cakmak, M; Ozçelik, S; Ozbay, E

2008-02-01

We present surface properties of buffer films (AIN and GaN) and Al0.3Gao.zN/Al2O3-High Electron Mobility Transistor (HEMT) structures with/without AIN interlayer grown on High Temperature (HT)-AIN buffer/Al2O3 substrate and Al2O3 substrate. We have found that the GaN surface morphology is step-flow in character and the density of dislocations was about 10(8)-10(9) cm(-2). The AFM measurements also exhibited that the presence of atomic steps with large lateral step dimension and the surface of samples was smooth. The lateral step sizes are in the range of 100-250 nm. The typical rms values of HEMT structures were found as 0.27, 0.30, and 0.70 nm. HT-AIN buffer layer can have a significant impact on the surface morphology of Al0.3Ga0.7N/Al2O3-HEMT structures.

Voies de recherche en matière de récupération assistée du pétrole par tensio-actifs Research Lines in Enhanced Oil Recovery by Surfactants

OpenAIRE

Baviere M.; Defives D.; Labrid J.; Minssieux L.

2006-01-01

Quelle que soit la conjoncture économique, le procédé de récupération assistée du pétrole par injection d'agents tensio-actifs nécessite une mise en oeuvre très élaborée pour tirer le meilleur parti des produits et donc pour franchir le seuil de rentabilité. Il apparaît par ailleurs que son champ d'application doit être étendu aux conditions de réservoir couramment rencontrées, notamment les fortes salinités, par l'utilisation de structures chimiques adaptées. Pour réduire les pertes de tensi...

Magnetic and electrical response of Co-doped La{sub 0.7}Ca{sub 0.3}MnO{sub 3} manganites/insulator system

Energy Technology Data Exchange (ETDEWEB)

Debnath, J.C., E-mail: Jyotish.debnath@deakin.edu.au [Institute for Frontier Materials, Deakin University, Geelong, VIC 3216 (Australia); Wang, Jianli, E-mail: jcd341@uowmail.edu.au [Institute for Superconductivity and Electronic Materials, University of Wollongong, Wollongong, NSW 2522 (Australia)

2017-01-01

We present a systematic study of the structural, magnetic and electrical properties of La{sub 0.7}Ca{sub 0.3}MnO{sub 3} (LCMO) and La{sub 0.7}Ca{sub 0.3}Mn{sub 0.95}Co{sub 0.05}O{sub 3} (LCMCO0 perovskite manganites. Most of the work is devoted to the electrical properties with a thorough discussion about different models for both the metallic and insulator states. With a view to understand the conduction mechanism in these materials, the resistivity of both materials was measured over a temperature range 5–300 K and in a magnetic field up to 1 T and the data were analysed by using several theoretical models. It has been observed that the metallic part of the temperature dependent resistivity (ρ) curve fits well with ρ=ρ{sub 0} +ρ{sub 2,5}Τ{sup 2,5}, indicating the electron–magnon scattering processes in the conduction of these materials. On the other hand, in the high temperature paramagnetic insulating regime, the adiabatic small polaron and VRH models fit well, thereby indicating that polaron hopping might be responsible for the conduction mechanism.

47 CFR 0.417 - The Annual Reports.

Science.gov (United States)

2010-10-01

... 47 Telecommunication 1 2010-10-01 2010-10-01 false The Annual Reports. 0.417 Section 0.417 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL COMMISSION ORGANIZATION General Information Printed... of developments during the year, and selected industry statistics. [32 FR 10571, July 19, 1967] ...

Transport-entropy correlations in La0.7Ca0.3MnO3 manganite

International Nuclear Information System (INIS)

Debnath, J.C.; Strydom, A.M.

2014-01-01

An investigation of the magnetic entropy change ΔS M and resistivity ρ, and the relation between them, for La 0.7 Ca 0.3 MnO 3 (LCMO) material has been presented. By using an equation of the form ΔS M =−α∫ 0 H [(δln(ρ))/(δT) ] H dH (α=9.98 emu/g), which relates magnetic order to transport behavior of the compounds, we measure the magnetic entropy change ΔS M from the resistivity measurement, where the resistivity results agree quite well with the fitting parameter α=9.98 emu/g in the intermediate temperature range. This result reveals the predominant role of magnetic polarons on the magnetoresistive property of manganites. It is obvious that magnetic disorder, characterized by ΔS M , affects the magnetic polarons, while the magnetic polarons influence the electronic transport properties, which may be the underlying reason for a salient ΔS M −ρ relation. It also provides an alternative method to determine magnetic entropy change on the basis of resistive measurements

33 CFR 86.03 - Limits of fundamental frequencies.

Science.gov (United States)

2010-07-01

... of fundamental frequencies. To ensure a wide variety of whistle characteristics, the fundamental... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Limits of fundamental frequencies. 86.03 Section 86.03 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY...

Magnetic and magnetocaloric properties of La{sub 0.7}Ca{sub 0.3}Mn{sub 1−x}Zn{sub x}O{sub 3}

Energy Technology Data Exchange (ETDEWEB)

Ho, T.A. [Department of Materials Science and Engineering, Korea University, Seoul 02841 (Korea, Republic of); Lim, S.H., E-mail: sangholim@korea.ac.kr [Department of Materials Science and Engineering, Korea University, Seoul 02841 (Korea, Republic of); Tho, P.T.; Phan, T.L. [Department of Physics and Oxide Research Center, Hankuk University of Foreign Studies, Yongin 17035 (Korea, Republic of); Yu, S.C. [Department of Physics, Chungbuk National University, Cheongju 28644 (Korea, Republic of)

2017-03-15

The magnetic Mn{sup 3+} ions in La{sub 0.7}Ca{sub 0.3}MnO{sub 3} are partially replaced by nonmagnetic Zn{sup 2+} ions to form La{sub 0.7}Ca{sub 0.3}Mn{sub 1−x}Zn{sub x}O{sub 3} compounds (x=0.0, 0.06, 0.08, and 0.1), and their magnetic and magnetocaloric properties are investigated. The Curie temperature decreases drastically from 245 to 70 K as x increases from 0 to 0.1. An analysis using the Banerjee's criterion of the experimental results for magnetization as a function of temperature and magnetic field indicates that the first-to-second order magnetic phase transformation occurs at a threshold composition of x=0.06, which is further supported by the universal curves of the normalized entropy change versus reduced temperature. The maximum magnetic entropy change measured at a magnetic field span of 50 kOe, which occurs near the Curie temperature, decreases from 10.30 to 2.15 J/kg K with the increase of x from 0.0 to 0.1. However, the relative cooling power, an important parameter for practical applications, shows a maximum value of 404 J/kg at x=0.08, which is 1.5 times greater than that observed for the undoped sample. - Highlights: • Magnetic and MCE of La{sub 0.7}Ca{sub 0.3}Mn{sub 1−x}Zn{sub x}O{sub 3} are investigated. • Order of magnetic phase transition is dependent on the Zn doping concentration. • Although the |∆S{sub max}| decreases with increasing x, RCP increase remarkably.

Photoinduced effect on carrier transport properties in La0.7Sr0.3MnO3/Si heterostructure

International Nuclear Information System (INIS)

Jin, K X; Tan, X Y; Chen, C L; Zhao, S G

2008-01-01

The photoinduced effect on carrier transport properties has been investigated in the La 0.7 Sr 0.3 MnO 3 /Si heterostructure prepared by the pulsed laser deposition method. A giant photoinduced relative change in the resistance of about 6783% in the current-perpendicular-to-plane (CPP) geometry of the heterostructure has been observed when it is irradiated by a 532 nm laser at T = 270 K. The rising time of about 100 μs in the CPP geometry of the heterostructure under modulated laser irradiation of 200 μs duration seems to be independent of temperature. This provides an innovation for potential application in functional optical and electrical devices

Self-injection length in La0.7Ca0.3MnO3–YBa2Cu3 O7−δ ...

Indian Academy of Sciences (India)

Critical current, Ic, was measured at 77 K on both the control side as well as the LCMO side for different YBCO film thickness. It was observed that while the control ... devices which are essentially a heterostructure consisting of a layer of YBa2Cu3O7−δ (YBCO), grown over La0.7Ca0.3MnO3 (LCMO). The critical current of.

Investigations towards the use of Gd0.7Ca0.3CoOx as membrane in an exhaust gas sensor for NOx

NARCIS (Netherlands)

Romer, E.W.J.; Nigge, Ulrich; Schulte, Thomas; Wiemhöfer, Hans-Dieter; Bouwmeester, Henricus J.M.

2001-01-01

Application of a material with the nominal composition Gd0.7Ca0.3CoOx is considered for use as membrane material in an exhaust gas sensor for NOx. SEM–EDX and XRD measurements revealed that after sintering at 1200°C in air, three co-existing phases are present: (Gd0.6Ca0.4)2CoOx (60 vol.%), GdCoO3

42 CFR 417.124 - Administration and management.

Science.gov (United States)

2010-10-01

... program, administrative and management aspects of the HMO. (3) At a minimum, management by an executive... Administration and management. (a) General requirements. Each HMO must have administrative and managerial... 42 Public Health 3 2010-10-01 2010-10-01 false Administration and management. 417.124 Section 417...

29 CFR 1209.03 - Conduct of National Mediation Board business.

Science.gov (United States)

2010-07-01

... 29 Labor 4 2010-07-01 2010-07-01 false Conduct of National Mediation Board business. 1209.03 Section 1209.03 Labor Regulations Relating to Labor (Continued) NATIONAL MEDIATION BOARD PUBLIC OBSERVATION OF NATIONAL MEDIATION BOARD MEETINGS § 1209.03 Conduct of National Mediation Board business...

Giant Magneto-Resistance in Epitaxial (La_0.7Sr_0.3MnO₃)_0.5: (ZnO)_0.5 Nanocomposites

Energy Technology Data Exchange (ETDEWEB)

Pan, Wei [Sandia National Lab. (SNL-CA), Livermore, CA (United States); Jiang, Y. X. [Georgia Inst. of Technology, Atlanta, GA (United States); Ihlefeld, Jon [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Lu, Ping [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Lee, Stephen R. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

2015-12-01

A great deal of research has been carried out in oxide material systems. Among them, ZnO and La_0.7Sr_0.3MnO₃ (LSMO) are of particular interest due to their superb optical properties and colossal magneto-resistive effect. Here, we report our recent results of magneto-transport studies in self-assembled, epitaxial (ZnO)0.5:(La_0.7Sr_0.3MnO₃)_0.5 nanocomposite films.

Complexation de l'aluminium par des hétéropolyanions lacunaires ...

African Journals Online (AJOL)

L'objectif visé par cette étude est la dépollution des eaux à partir de la complexation d'un métal toxique, l'aluminium en solution, par des hétéropolyanions lacunaires (HPA) de type Dawson. Les complexes formés sont récupérés par membrane liquide émulsionnée (MEL).Les résultats de la complex1ation de l'aluminium ...

Fe-doping induced Griffiths-like phase in La0.7Ba0.3CoO3

International Nuclear Information System (INIS)

Wan-Guo, Huang; Xiang-Qun, Zhang; Guo-Ke, Li; Young, Sun; Qing-An, Li; Zhao-Hua, Cheng

2009-01-01

The effect of Fe-doping on the magnetic properties of the ABO 3 -type perovskite cobaltites La 0.7 Ba 0.3 Co 1–y Fe y O 3 (0 ≤ y ≤ 0.80) is reported. With no apparent structural change in any doped sample, the Curie temperature (T C ) and the magnetization (M) are greatly suppressed for y ≤ 0.30 samples, while a distinct increase in T C for the y = 0.40 sample is observed. With the further increase of Fe concentration, T C increases monotonically. Griffiths-like phases in 0.40 ≤ y ≤ 0.60 samples are confirmed. The formation of the Griffiths-like phase is ascribed to B-site disordering induced isolation of ferromagnetic (FM) clusters above T C . (condensed matter: electronic structure, electrical, magnetic, and optical properties)

Structures of actin-like ParM filaments show architecture of plasmid-segregating spindles.

Science.gov (United States)

Bharat, Tanmay A M; Murshudov, Garib N; Sachse, Carsten; Löwe, Jan

2015-07-02

Active segregation of Escherichia coli low-copy-number plasmid R1 involves formation of a bipolar spindle made of left-handed double-helical actin-like ParM filaments. ParR links the filaments with centromeric parC plasmid DNA, while facilitating the addition of subunits to ParM filaments. Growing ParMRC spindles push sister plasmids to the cell poles. Here, using modern electron cryomicroscopy methods, we investigate the structures and arrangements of ParM filaments in vitro and in cells, revealing at near-atomic resolution how subunits and filaments come together to produce the simplest known mitotic machinery. To understand the mechanism of dynamic instability, we determine structures of ParM filaments in different nucleotide states. The structure of filaments bound to the ATP analogue AMPPNP is determined at 4.3 Å resolution and refined. The ParM filament structure shows strong longitudinal interfaces and weaker lateral interactions. Also using electron cryomicroscopy, we reconstruct ParM doublets forming antiparallel spindles. Finally, with whole-cell electron cryotomography, we show that doublets are abundant in bacterial cells containing low-copy-number plasmids with the ParMRC locus, leading to an asynchronous model of R1 plasmid segregation.

Effect of strontium deficiency on the transport and magnetic properties of Pr{sub 0.7}Sr{sub 0.3}MnO{sub 3}

Energy Technology Data Exchange (ETDEWEB)

Abou-Ras, D.; Boujelben, W.; Cheikh-Rouhou, A.; Pierre, J.; Renard, J.-P. E-mail: jean-pierre.renard@ief.u-psud.fr; Reversat, L.; Shimizu, K

2001-08-01

Ceramic samples of Pr{sub 0.7}Sr{sub 0.3-x}{open_square}{sub x}MnO{sub 3} with x{<=}0.2 have been investigated by various techniques including {sup 55}Mn nuclear magnetic resonance, SQUID magnetometry, resistivity and magnetoresistance measurements. On increasing x, the samples remain ferromagnetic at a low temperature with a decreasing Curie temperature, but a metal-insulator transition is observed. Besides, a positive magnetoresistance (MR) at very low temperatures with respect to a negative colossal MR at high temperatures is observed in the Pr{sub 0.7}Sr{sub 0.2}{open_square}{sub 0.1}MnO{sub 3} sample.

(110) oriented GaAs/Al0.3Ga0.7As quantum wells for optimized T-shaped quantum wires

DEFF Research Database (Denmark)

Gislason, Hannes; Sørensen, Claus Birger; Hvam, Jørn Märcher

1996-01-01

High control of (110) oriented GaAs/Al0.3Ga0.7As quantum wells is very important for the growth of optimized T-shaped GaAs/AlGaAs quantum wires, We investigate theoretically and experimentally 20-200 Angstrom wide (110) oriented GaAs quantum wells grown on (110) oriented substrates and cleaved...... edges. Photoluminescence transition energies are found to be in good agreement with theory for all well widths. The mean well width is controllable to 1 monolayer accuracy and an effective well width fluctuation of 3.7 Angstrom is derived from the photoluminescence linewidths. The growth rate...

Evolution of rDNA in Nicotiana allopolyploids: A potential link between rDNa homogenization and epigenetics

Czech Academy of Sciences Publication Activity Database

Kovařík, Aleš; Nešpor Dadejová, Martina; Lim, Y.K.; Chase, M.W.; Clarkson, J.J.; Knapp, S.; Leitch, A.R.

2008-01-01

Roč. 101, č. 6 (2008), s. 815-823 ISSN 0305-7364 R&D Projects: GA ČR(CZ) GA521/07/0116 Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : rDNA * allopolyploidy * evolution-Nicotiana Subject RIV: BO - Biophysics Impact factor: 2.755, year: 2008

Synthesis and magnetic characterization of Zn{sub 0.7}Ni{sub 0.3}Fe{sub 2}O{sub 4} nanoparticles via microwave-assisted combustion route

Energy Technology Data Exchange (ETDEWEB)

Sertkol, M. [Department of Physics, Fatih University, 34500 Buyukcekmece, Istanbul (Turkey); Koeseoglu, Y., E-mail: yukselk@fatih.edu.t [Department of Physics, Fatih University, 34500 Buyukcekmece, Istanbul (Turkey); Baykal, A. [Department of Chemistry, Fatih University, 34500 Buyukcekmece, Istanbul (Turkey); Kavas, H. [Department of Physics, Fatih University, 34500 Buyukcekmece, Istanbul (Turkey); Toprak, M.S. [Division of Functional Materials, Royal Institute of Technology (KTH), SE-16440 Stockholm (Sweden)

2010-04-15

We report on the synthesis of Zn{sub 0.7}Ni{sub 0.3}Fe{sub 2}O{sub 4} nanoparticles via microwave assisted combustion route by using urea as fuel. XRD and FT-IR analyses confirm the composition and structure as spinel ferrite. The crystallite size estimated from XRD (16.4 nm) and the magnetic core size (15.04 nm) estimated from VSM agree well, while a slightly smaller magnetic diameter reflects a very thin magnetically dead layer on the surface of the nanoparticles. Morphological investigation of the products was done by TEM which revealed the existence of irregular shapes such spherical, spherodial and polygon. Magnetization measurements performed on Zn{sub 0.7}Ni{sub 0.3}Fe{sub 2}O{sub 4} nanoparticles showed that saturation was not attained at even in the high magnetic field. The sample shows superparamagnetic behavior at around the room temperature and ferromagnetic behavior below the blocking temperature which is measured as 284 K.

Calculs de doses générées par les rayonnements ionisants principes physiques et codes de calcul

CERN Document Server

Vivier, Alain

2016-01-01

Cet ouvrage et les codes associés s’adressent aux utilisateurs de sources de rayonnements ionisants : techniciens, ingénieurs de sécurité, personnes compétentes en radioprotection, mais aussi médecins, chercheurs, concepteurs, décideurs… Les contraintes croissantes liées à la radioprotection rendent indispensables l’utilisation de codes de calcul permettant d’évaluer les débits de doses générées par ces sources et la façon dont on peut s’en protéger au mieux. De nombreux codes existent, dont certains restent des références incontournables, mais ils sont relativement complexes à mettre en oeuvre et restent en général réservés aux bureaux d’études. En outre, ces codes sont souvent des « boîtes noires » qui ne permettent pas de comprendre la physique sous-jacente. L’objectif de cet ouvrage est double : - Exposer les principes physiques permettant de comprendre les phénomènes à l’oeuvre lorsque la matière est irradiée par des rayonnements ionisants. Il devient al...

Aging characteristics of 0.7Pb(Mg{sub 1/3}Nb{sub 2/3})O{sub 3}-0.3PbTiO{sub 3} single crystals with different crystal orientations

Energy Technology Data Exchange (ETDEWEB)

Liu, Xing [Changzhou University, School of Materials Science and Engineering, Jiangsu Collaborative Innovation Center of Photovoltaic Science and Engineering, Changzhou (China); Chinese Academy of Sciences, Key Laboratory of Inorganic Function Material and Device, Shanghai (China); Wu, Dun; Fang, Bijun [Changzhou University, School of Materials Science and Engineering, Jiangsu Collaborative Innovation Center of Photovoltaic Science and Engineering, Changzhou (China); Ding, Jianning [Changzhou University, School of Materials Science and Engineering, Jiangsu Collaborative Innovation Center of Photovoltaic Science and Engineering, Changzhou (China); Jiangsu University, School of Material Science and Engineering, Zhenjiang (China); Li, Xiaobing; Zhao, Xiangyong; Luo, Haosu [Chinese Academy of Sciences, Key Laboratory of Inorganic Function Material and Device, Shanghai (China); Ko, Jae-Hyeon [Hallym University, Department of Physics, Chuncheon (Korea, Republic of); Ahn, Chang Won [University of Ulsan, Department of Physics and EHSRC, Ulsan (Korea, Republic of)

2015-06-15

In this work, the time and temperature dependence of the piezoelectric and ferroelectric properties of the 0.7Pb(Mg{sub 1/3}Nb{sub 2/3})O{sub 3}-0.3PbTiO{sub 3} (0.7PMN-0.3PT) single crystals were investigated in order to search for an effective method to improve their properties further. The piezoelectric properties of the [001]-, [110]- and [111]-oriented 0.7PMN-0.3PT single crystals exhibit excellent time stability during the 2-month room-temperature aging process. The re-poling process leads to the improvement of piezoelectric constant d{sub 33} for the [001]-, [110]- and [111]-oriented 0.7PMN-0.3PT single crystals, while the values of electromechanical coupling coefficient k{sub t} change little. During the thermal aging, the values of the measured d{sub 33}, calculated converse piezoelectric constant d{sub 33}{sup *}, maximum strain S{sub max}% and longitudinal electrostrictive coefficient Q of the [001]-, [110]- and [111]-oriented crystal plates increase gradually before the ferroelectric phase transition temperatures (T{sub FPT}, T{sub R-M}, T{sub R-O} and T{sub R-T}) and then decline continuously. The increase in these values before the T{sub FPT} is a result of the phase instability. In general, the [001]- and [110]-oriented 0.7PMN-0.3PT single crystals exhibit large piezoelectricity, excellent time stability and relatively high thermal stability between 20 and 80 C, which is favorable to the piezoelectric applications. (orig.)

Coexistence of large positive and negative magnetoresistance in La0.7Ca0.3MnO3 films with microcracks

International Nuclear Information System (INIS)

Zhu Shaojiang; Zhang Fuchang; Yuan Jie; Zhu Beiyi; Xu Bo; Cao Lixin; Qiu Xianggang; Zhao Bairu

2007-01-01

The coexistence of large positive and negative low-field magnetoresistance (LFMR) in the ferromagnetic La 0.7 Ca 0.3 MnO 3 thin films with ordered microcrack (MC) distributions is reported. For the films with the highest linear density of MC, the negative LFMR can be up to -60% and rapidly changes to the positive value of 25% at 200 Oe field with the increase of temperature. We discuss the effect based on the spin-polarized tunneling and inhomogeneous magnetic state induced by the natural formations of MC in the films

40 CFR 425.03 - Sulfide analytical methods and applicability.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Sulfide analytical methods and applicability. 425.03 Section 425.03 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS LEATHER TANNING AND FINISHING POINT SOURCE CATEGORY General Provisions...

40 CFR 721.10083 - Copper, [29H, 31H-phthalocyaninato (2-)-N29, N30, N31, N32]-, 4-[(17-substituted-3,6,9,12,15...

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Copper, [29H, 31H-phthalocyaninato (2... Significant New Uses for Specific Chemical Substances § 721.10083 Copper, [29H, 31H-phthalocyaninato (2-)-N29... substance identified generically as copper, [29H, 31H-phthalocyaninato (2-)-N29, N30, N31, N32]-, 4-[(17...

Particle size effect on magnetic and transport properties of La/sub 0.7/Ca/sub 0.3/MnO/sub 3/ nanoparticles

International Nuclear Information System (INIS)

Qaseem, S.; Mumtaz, A.; Hasanain, S.K.; Maaz, K.

2010-01-01

La/sub 0.7/Ca/sub 0.3/MnO/sub 3/ nanoparticles have been synthesized by modified citrate route with particle sizes of 20, 26 and 32 +- 3 nm respectively. The structural characterization has been performed by XRD and TEM analyses while magnetic characterization has been performed by vibrating sample magnetometer (VSM). This work presents the study of size effects on magnetic and electrical properties of Ca-doped CMR nanoparticles (La/sub 0.7/Ca/sub 0.3.MnO/sub 3/). Different particle sizes have been prepared by a wet chemical route. Magnetic characterization reveals that magnetization increases with the increase in the particle size and the magnetic transition temperature for larger particles is the same as in the bulk (258K). The ferromagnetic and resistive transitions are however broad compared to the case of bulk presumably due to the role of the surface. The metal-insulator transition temperature is found to be at 158K while the resistivity shows anomalous low temperature behavior with an upturn at low temperatures presu due to coulomb blockade effects. Furthermore, the field dependence of the resistivity displays nonmonotonic behavior and is explained in terms of the field assisted tunneling between grains. (author)

Exchange bias coupling in La{sub 0.7}Sr{sub 0.3}MnO{sub 3}/BiFeO{sub 3} heterostructures

Energy Technology Data Exchange (ETDEWEB)

Huijben, Mark; Chu, Ying-Hao; Martin, Lane W.; Seidel, Jan; Balke, Nina; Gajek, Martin; Yang, Chan-Ho; Yu, Pu; Holcomb, Micky; Ramesh, Ramamoorthy [Department of Physics and Department of Materials Science and Engineering, University of California, Berkeley (United States)

2008-07-01

Heterostructures based on perovskite transition-metal oxides have attracted much attention because of the possibility of tuning the magnetic and electronic properties of thin films through interface effects such as exchange interactions, charge transfer, and epitaxial strain. The development and understanding of multiferroic materials such as BiFeO{sub 3}, have piqued the interest with the promise of coupling between order parameters such as ferroelectricity and antiferromagnetism. In this study we investigate the magnetic properties in ferromagnetic-antiferromagnetic multiferroic heterostructures by using atomic scale controlled growth through laser-MBE in combination with real-time RHEED monitoring. We will show the controlled coupling at the interfaces in La{sub 0.7}Sr{sub 0.3}MnO{sub 3}/BiFeO{sub 3} heterostructures. This coupling behavior is investigated by structural measurements, such as X-ray reciprocal space mapping to clarify strained states, and magnetic measurements to gain a deeper fundamental understanding of the interactions at these interfaces. The interface coupling displays a strong enhancement in the coercivity of the La{sub 0.7}Sr{sub 0.3}MnO{sub 3} layer and a large shift in the magnetization hysteresis loops, indicating the existence of exchange bias coupling.

El Acuerdo de París. Predominio del soft law en el régimen climático

OpenAIRE

Nava Escudero, César

2016-01-01

Resumen Es práctica común entre los Estados, adoptar dentro del régimen internacional de protección al ambiente, al que pertenece el régimen climático, acuerdos vinculantes con un alto contenido de normas que carecen de obligatoriedad; esto es, normas de soft law. El Acuerdo de París de 2015 es precisamente un ejemplo de lo anterior. A través de un breve análisis del contenido soft en los dos antecedentes convencionales más importantes (es decir, la Convención Marco de las Naciones Unidas sob...

Reproducible low-voltage resistive switching in a low-initial-resistance Pr0.7Ca0.3MnO3 junction

International Nuclear Information System (INIS)

Li Songlin; Gang Jianlei; Li Jie; Chu Haifeng; Zheng Dongning

2008-01-01

Current-voltage (I-V) characteristics are investigated in a low-initial-resistance Ag/Pr 0.7 Ca 0.3 MnO 3 /Pt sandwich structure. It is found that the junction can show stable low and high resistance states in ±0.3 V voltage sweeping cycles. The set and reset voltage values are, respectively, +0.1 V and -0.2 V, which are very low as compared with those reported previously. Furthermore, the I-V curves in both resistance states exhibit rather linear behaviour, without any signature of metal/insulator interface effects. This implies that the Schottky interface mechanism might not be an indispensable factor for the colossal electroresistance effect. The origin of low switching voltages is attributed to the reduced effective distance for electric field action due to the sufficient oxygen content of the PCMO layer. The underlying physics is discussed in terms of the filament network model together with the field-induced oxygen vacancy motion model

CERN Technical Training 2003: Learning for the LHC !
MAGNE-03 : MagnEtisme pour l'Electrotechnique
Phénomènes magnétiques, matériaux et applications - French version only

CERN Multimedia

2003-01-01

MAGNE-03 est un cours dans le cadre du programme de l'Enseignement technique 2003 qui s'adresse aux personnes souhaitant découvrir, améliorer ou remettre à niveau leurs connaissances en magnétisme. Le cours est donné au CERN par la société CEDRAT Technologies basée à Meylan (France). La participation est ouverte à l'ensemble du personnel technique et scientifique nécessitant une formation en magnétisme dans le cadre de leurs activités professionnelles, courantes ou futures. En ayant organisé des sessions au CERN, une importante économie par participant est réalisée par rapport aux frais nécessaires pour suivre la même formation sur leur site en Isère. MAGNE-03 s'intéresse, entre autres, au développement de la compréhension des phénomènes magnétiques et le «&...

Sol-Gel Synthesis, Electrochemical Characterization, and Stability Testing of Ti0.7W0.3O2 Nanoparticles for Catalyst Support Applications in Proton-Exchange Membrane Fuel Cells

Energy Technology Data Exchange (ETDEWEB)

Subban, Chinmayee V. [Cornell Univ., Ithaca, NY (United States); Zhou, Qin [Cornell Univ., Ithaca, NY (United States); Hu, Anthony [Cornell Univ., Ithaca, NY (United States); Moylan, Thomas E. [General Motors Research and Development, Warren, MI (United States); Wagner, Frederick T. [General Motors Research and Development, Warren, MI (United States); DiSalvo, Francis J. [Cornell Univ., Ithaca, NY (United States)

2010-11-19

The materials currently used in proton-exchange membrane fuel cells (PEMFCs) require complex control of operating conditions to make them sufficiently durable to permit commercial deployment. One of the major materials challenges to allow simplification of fuel cell operating strategies is the discovery of catalyst supports that are much more stable to oxidative decomposition than currently used carbon blacks. Here we report the synthesis and characterization of Ti_0.7W_0.3O₂ nanoparticles (approximately 50 nm diameter), a promising doped metal oxide that is a candidate for such a durable catalyst support. The synthesized nanoparticles were platinized, characterized by electrochemical testing, and evaluated for stability under PEMFC and other oxidizing acidic conditions. Ti_0.7W_0.3O₂ nanoparticles show no evidence of decomposition when heated in a Nafion solution for 3 weeks at 80 °C. In contrast, when heated in sulfuric, nitric, perchloric, or hydrochloric acid, the oxide reacts to form salts such as titanylsulfatehydrate from sulfuric acid. Electrochemical tests show that rates of hydrogen oxidation and oxygen reduction by platinum nanoparticles supported on Ti_0.7W_0.3O₂ are comparable to those of commercial Pt on carbon black.

Crystallization and preliminary X-ray crystallographic studies on the parD-encoded protein Kid from Escherichia coli plasmid R1

NARCIS (Netherlands)

Hargreaves, D.; Giraldo, R.; Santos-Sierra, S.; Boelens, R.; Rice, D.W.; Díaz Orejas, R.; Rafferty, J.B.

2002-01-01

DNA replication in Escherichia coli and therefore bacterial proliferation relies upon the efficient functioning of the DnaB helicase. The toxin protein Kid from the plasmid-stability system parD encoded on plasmid R1 of E. coli is thought to target and block DnaB-dependent DNA replication. The

Spectroscopie résolue en temps par continuum femtoseconde Applications en neurobiologie

Science.gov (United States)

Ramstein, S.; Mottin, S.

2003-06-01

La spectroscopie résolue en temps utilisant un laser blanc femtoseconde est appliquée à la mesure in vivo des principaux absorbeurs du cerveau. Après génération adéquate du continuum de lumière blanche femtoseconde (50mW/[580-756nm] à 1Hz), cette source se propage dans la calvaria, les méninges et le cortex chez le rat anesthésié. La transmission est étudiée sur 7mm de distance entre l'impact laser et la fibre optique de collection. Le signal transmis est analysé dans la fenêtre 580-760nm, par un spectromètre couplé à une caméra à balayage de fente permettant la décorrélation de l'absorption et de la diffusion.

A Qualitative approach to the criminal mobility of burglars: Questioning the "Near Home" hypothesis

Czech Academy of Sciences Publication Activity Database

Polišenská, Veronika

2008-01-01

Roč. 1, č. 1 (2008), s. 47-59 ISSN 1947-0428. [International Symposium on Evironmental Criminology. Izmir, 17.03.2008-19.03.2008] R&D Projects: GA ČR GA406/07/0261 Institutional research plan: CEZ:AV0Z70250504 Keywords : qualitative approach * burglars * criminal mobility Subject RIV: AN - Psychology

Crystal structure and dielectric measurements of mixed caesium-ammonium mercury chloride: Cs{sub 0.7}(NH{sub 4}){sub 0.3}HgCl{sub 3}

Energy Technology Data Exchange (ETDEWEB)

Kabadou, A.; Hassen, R.B.; Salah, A.B. [Fac. des Sci., Sfax (Tunisia). Lab. de l`Etat Solide; Jouini, T.

1998-08-01

The title compound crystallises in the space group P3{sub 2} and has the unit cell dimensions a = 13.295(11) A, c = 9.419(8) A, V = 1441.82(2), Z = 9, D{sub exp} = 4.17, D{sub calc} = 4.153. The structure at room temperature is considered as distorted perovskite tentatively with R = 0.057 and WR{sub 2} = 0.153 for 700 observed reflections. The dielectric permittivity measured in the frequency and temperatures ranges 10{sup 3} to 10{sup 6} Hz and 307 to 613 K, respectively, reveals a transition at T = 449 K. Transport properties in this material appear to be due to the high mobility of NH{sub 4}{sup +} in the tunnels. (orig.) 13 refs.

Induced Ti magnetization at La0.7Sr0.3MnO3 and BaTiO3 interfaces

Directory of Open Access Journals (Sweden)

Yaohua Liu

2016-04-01

Full Text Available In artificial multiferroics hybrids consisting of ferromagnetic La0.7Sr0.3MnO3 (LSMO and ferroelectric BaTiO3 epitaxial layers, net Ti moments are found from polarized resonant soft x-ray reflectivity and absorption. The Ti dichroic reflectivity follows the Mn signal during the magnetization reversal, indicating exchange coupling between the Ti and Mn ions. However, the Ti dichroic reflectivity shows stronger temperature dependence than the Mn dichroic signal. Besides a reduced ferromagnetic exchange coupling in the interfacial LSMO layer, this may also be attributed to a weak Ti-Mn exchange coupling that is insufficient to overcome the thermal energy at elevated temperatures.

La0.7Sr0.3MnO3 Thin Films for Magnetic and Temperature Sensors at Room Temperature

Directory of Open Access Journals (Sweden)

Sheng Wu

2012-03-01

Full Text Available In this paper, the potentialities of the manganese oxide La0.7Sr0.3MnO3 (LSMO for the realization of sensitive room temperature thermometers and magnetic sensors are discussed. LSMO exhibits both a large change of the resistance versus temperature at its metal-to-insulator transition (about 330 K and low field magnetoresistive effects at room temperature. The sensor performances are described in terms of signal-to-noise ratio in the 1 Hz - 100 kHz frequency range. It is shown that due to the very low 1/f noise level, LSMO based sensors can exhibit competitive performances at room temperature.

Novel role for proteinase-activated receptor 2 (PAR2) in membrane trafficking of proteinase-activated receptor 4 (PAR4).

Science.gov (United States)

Cunningham, Margaret R; McIntosh, Kathryn A; Pediani, John D; Robben, Joris; Cooke, Alexandra E; Nilsson, Mary; Gould, Gwyn W; Mundell, Stuart; Milligan, Graeme; Plevin, Robin

2012-05-11

Proteinase-activated receptors 4 (PAR(4)) is a class A G protein-coupled receptor (GPCR) recognized through the ability of serine proteases such as thrombin and trypsin to mediate receptor activation. Due to the irreversible nature of activation, a fresh supply of receptor is required to be mobilized to the cell surface for responsiveness to agonist to be sustained. Unlike other PAR subtypes, the mechanisms regulating receptor trafficking of PAR(4) remain unknown. Here, we report novel features of the intracellular trafficking of PAR(4) to the plasma membrane. PAR(4) was poorly expressed at the plasma membrane and largely retained in the endoplasmic reticulum (ER) in a complex with the COPI protein subunit β-COP1. Analysis of the PAR(4) protein sequence identified an arginine-based (RXR) ER retention sequence located within intracellular loop-2 (R(183)AR → A(183)AA), mutation of which allowed efficient membrane delivery of PAR(4). Interestingly, co-expression with PAR(2) facilitated plasma membrane delivery of PAR(4), an effect produced through disruption of β-COP1 binding and facilitation of interaction with the chaperone protein 14-3-3ζ. Intermolecular FRET studies confirmed heterodimerization between PAR(2) and PAR(4). PAR(2) also enhanced glycosylation of PAR(4) and activation of PAR(4) signaling. Our results identify a novel regulatory role for PAR(2) in the anterograde traffic of PAR(4). PAR(2) was shown to both facilitate and abrogate protein interactions with PAR(4), impacting upon receptor localization and cell signal transduction. This work is likely to impact markedly upon the understanding of the receptor pharmacology of PAR(4) in normal physiology and disease.

Regeneration de Pat Barker (1991 : la gestion des maux/mots de la Grande Guerre par l’institution psychiatrique

Directory of Open Access Journals (Sweden)

Isabelle Gérardin

2011-04-01

Full Text Available Cet article se propose d’étudier une œuvre publiée en 1991 par la romancière anglaise Pat Barker : Regeneration. Ce roman, qui a pour toile de fond la Grande Guerre, ne dépeint ni combats ni scènes de la vie des tranchées. Barker préfère représenter toute la dimension agonistique de ce conflit mondial à travers la question de la prise en charge des traumatismes de guerre des soldats par l’institution psychiatrique. Ces traumatismes, ayant diverses manifestations psychosomatiques, témoignent d’une forte tension entre une profonde aversion de l’individu pour l’extrême violence des affrontements et un appel à se conformer à une certaine culture de guerre collective fondée sur un idéal fort de virilité martiale et patriotique. Face à ces traumatismes, ainsi que Pat Barker le met en lumière, la psychiatrie de guerre se révèle souvent fort ambiguë. En effet, l’institution psychiatrique œuvre en continuité avec l’institution militaire, désirant imposer un contrôle sur les âmes autant que sur les corps. Regeneration nous invite donc à lire combien les maux/mots de la Grande Guerre ont eu grand peine à se faire entendre.This article deals with a novel, entitled Regeneration, published in 1991 by the English female author Pat Barker. This novel, although set against the backdrop of World War One, depicts neither battles nor scenes of everyday life in the trenches. Instead, the agonistic dimension of this world conflict is tackled by Pat Barker through the prism of the way the psychiatric institution dealt with war traumas endured by soldiers, traumas of the body and of the mind. These traumas, causing a variety of psychosomatic symptoms, reveal a powerful tension between a deep individual aversion to the extreme violence of combat and an appeal to conform to some collective culture of war rooted in a strong ideal of soldierly and patriotic manliness. Wartime psychiatry, as Barker highlights, often turns out to

Ideal tensile strength of Ni3Al and Fe3Al with D03 structure

Czech Academy of Sciences Publication Activity Database

Legut, Dominik; Šob, Mojmír

2008-01-01

Roč. 567-568, - (2008), s. 77-80 ISSN 0255-5476. [MSMF /5./. Brno, 27.06.2007-29.06.2007] R&D Projects: GA ČR GA106/07/1078; GA AV ČR IAA1041302 Institutional research plan: CEZ:AV0Z20410507 Keywords : ideal tensile strength * intermetallics * DO3 structure * magnetism Subject RIV: BM - Solid Matter Physics ; Magnetism

76 FR 30179 - National Institute on Deafness and Other Communication Disorders; Notice of Closed Meetings

Science.gov (United States)

2011-05-24

... Deafness and Other Communication Disorders; Notice of Closed Meetings Pursuant to section 10(d) of the... Deafness and Other Communication Disorders Special Emphasis Panel, R03-VSL. Date: June 1, 2011. Time: 11 a... Institute on Deafness and Other Communication Disorders Special Emphasis Panel, R03- Chemical Senses. Date...

External support to local institutions: providing political leverage to weaker groups, or sustaining traditional relations of power?

DEFF Research Database (Denmark)

Nygaard, Ivan

2008-01-01

. Le but de cette étude, qui comporte trois études de cas d'institutions appuyées par des bailleurs de fonds au Burkina Faso, est de comprendre pourquoi des parents proches de chefs traditionnels cherchent à prendre le contrôle de la municipalité alors qu'ils ne montrent qu'un intérêt limité pour...... obtenir le contrôle; des groupements villageois et de la coopérative d'électricité. L'article défend l'idée que bien que les acteurs locaux soient généralement attirés par les rentes de développement liées aux institutions appuyées par les bailleurs de fonds, les parents des chefs traditionnels semblent...

The effect of Bi substitution on the microstructure and magnetic properties of the Sr0.4Ba0.3La0.3Fe12−xBixO19 hexagonal ferrites

International Nuclear Information System (INIS)

Yang, Yujie; Wang, Fanhou; Liu, Xiansong; Shao, Juxiang; Feng, Shuangjiu; Huang, Duohui; Li, Mingling

2017-01-01

Bi 3+ ions doped M-type hexaferrites, Sr 0.4 Ba 0.3 La 0.3 Fe 12−x Bi x O 19 (0≤x≤0.7), were prepared by the ceramic process. The phase components of the magnetic powders were investigated by X-ray diffraction. The results show that a single magnetoplumbite phase is obtained for the magnetic powders with x from 0 to 0.2, and BiFeO 3 as a second phase appears when Bi content (x)≥0.3. The micrographs of the sintered magnets were observed by a field emission scanning electron microscopy. The sintered magnets are formed of hexagonal-shaped crystals. The magnetic properties of the sintered magnets were measured at room temperature by a permanent magnetic measuring system. The remanence (B r ) first increases with x from 0 to 0.2, and then decreases when Bi content (x)≥0.2. The intrinsic coercivity (H cj ) and magnetic induction coercivity (H cb ) firstly decrease quickly with x from 0 to 0.1, and then increase linearly when Bi content (x)≥0.1. The maximum energy product [(BH) max ] increases with x from 0 to 0.3, and then decreases when Bi content (x)≥0.3. The ratio H k /H cj ratio first increases with Bi content (x) from 0 to 0.4. And the H k /H cj ratio decreases when x≥0.4. - Highlights: • Sr 0.4 Ba 0.3 La 0.3 Fe 12−x Bi x O 19 (0≤x≤0.7) hexaferrites were prepared by the ceramic process. • A single magnetoplumbite phase is obtained for the magnetic powders with x from 0 to 0.2. • B r first increases with x from 0 to 0.2, and then decreases when x≥0.2. • H cj and H cb firstly decrease quickly with x from 0 to 0.1, and then increase linearly when x≥0.1.

Optical properties of amorphous Ba0.7Sr0.3TiO3 thin films obtained by metal organic decomposition technique

Science.gov (United States)

Qiu, Fei; Xu, Zhimou

2009-08-01

In this study, the amorphous Ba0.7Sr0.3TiO3 (BST0.7) thin films were grown onto fused quartz and silicon substrates at low temperature by using a metal organic decomposition (MOD)-spin-coating procedure. The optical transmittance spectrum of amorphous BST0.7 thin films on fused quartz substrates has been recorded in the wavelength range 190~900 nm. The films were highly transparent for wavelengths longer than 330 nm; the transmission drops rapidly at 330 nm, and the cutoff wavelength occurs at about 260 nm. In addition, we also report the amorphous BST0.7 thin film groove-buried type waveguides with 90° bent structure fabricated on Si substrates with 1.65 μm thick SiO2 thermal oxide layer. The design, fabrication and optical losses of amorphous BST0.7 optical waveguides were presented. The amorphous BST0.7 thin films were grown onto the SiO2/Si substrates by using a metal organic decomposition (MOD)-spin-coating procedure. The optical propagation losses were about 12.8 and 9.4 dB/cm respectively for the 5 and 10 μm wide waveguides at the wavelength of 632.8 nm. The 90° bent structures with a small curvature of micrometers were designed on the basis of a double corner mirror structure. The bend losses were about 1.2 and 0.9 dB respectively for 5 and 10 μm wide waveguides at the wavelength of 632.8 nm. It is expected for amorphous BST0.7 thin films to be used not only in the passive optical interconnection in monolithic OEICs but also in active waveguide devices on the Si chip.

Investigation of impact of neutron irradiation on properties of InSb-based hall plates

Czech Academy of Sciences Publication Activity Database

Ďuran, Ivan; Oszwaldowski, M.; Kovařík, Karel; Jankowski, J.; El-Ahmar, S.; Viererbl, L.; Lahodová, Z.

2011-01-01

Roč. 417, 1-3 (2011), s. 846-849 ISSN 0022-3115. [International Conference on Fusion Reactor Materials (ICFRM)/14./. Sapporo, 07.09.2009-12.09.2009] R&D Projects: GA MPO 2A-1TP1/101 Institutional research plan: CEZ:AV0Z20430508 Keywords : tokamak * Hall sensors * magnetic measurements * neutron irradiation Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 2.052, year: 2011 http://www.sciencedirect.com/science/article/pii/S0022311510009712

Synthesis, microstructure and magnetic properties of Fe{sub 3}Si{sub 0.7}Al{sub 0.3}@SiO{sub 2} core–shell particles and Fe{sub 3}Si/Al{sub 2}O{sub 3} soft magnetic composite core

Energy Technology Data Exchange (ETDEWEB)

Wang, Jian, E-mail: snove418562@163.com [The State Key Laboratory of Refractories and Metallurgy, Wuhan University of Science and Technology, Wuhan, Hubei 430081 (China); Key Laboratory for Ferrous Metallurgy and Resources Utilization of Ministry of Education, Wuhan University of Science and Technology, Wuhan, Hubei 430081 (China); Fan, Xi’an, E-mail: groupfxa@163.com [The State Key Laboratory of Refractories and Metallurgy, Wuhan University of Science and Technology, Wuhan, Hubei 430081 (China); Key Laboratory for Ferrous Metallurgy and Resources Utilization of Ministry of Education, Wuhan University of Science and Technology, Wuhan, Hubei 430081 (China); Wu, Zhaoyang, E-mail: wustwuzhaoyang@163.com [The State Key Laboratory of Refractories and Metallurgy, Wuhan University of Science and Technology, Wuhan, Hubei 430081 (China); Key Laboratory for Ferrous Metallurgy and Resources Utilization of Ministry of Education, Wuhan University of Science and Technology, Wuhan, Hubei 430081 (China); Li, Guangqiang [The State Key Laboratory of Refractories and Metallurgy, Wuhan University of Science and Technology, Wuhan, Hubei 430081 (China); Key Laboratory for Ferrous Metallurgy and Resources Utilization of Ministry of Education, Wuhan University of Science and Technology, Wuhan, Hubei 430081 (China)

2015-11-15

Fe{sub 3}Si{sub 0.7}Al{sub 0.3}@SiO{sub 2} core–shell particles and Fe{sub 3}Si/Al{sub 2}O{sub 3} soft magnetic composite core have been synthesized via a modified stöber method combined with following high temperature sintering process. Most of conductive Fe{sub 3}Si{sub 0.7}Al{sub 0.3} particles could be uniformly coated by insulating SiO{sub 2} using the modified stöber method. The Fe{sub 3}Si{sub 0.7}Al{sub 0.3}@SiO{sub 2} core–shell particles exhibited good soft magnetic properties with low coercivity and high saturation magnetization. The reaction 4Al+3SiO{sub 2}=2α-Al{sub 2}O{sub 3}+3Si took place during the sintering process. As a result the new Fe{sub 3}Si/Al{sub 2}O{sub 3} composite was formed. The Fe{sub 3}Si/Al{sub 2}O{sub 3} composite core displayed more excellent soft magnetic properties, better frequency stability at high frequencies, much higher electrical resistivity and lower core loss than the pure Fe{sub 3}Si{sub 0.7}Al{sub 0.3} core. The method of introducing insulating layers surrounding magnetic particles provides a promising route to develop new and high compact soft magnetic materials with good magnetic and electric properties. - Graphical abstract: In Fe{sub 3}Si/Al{sub 2}O{sub 3} composite, Fe{sub 3}Si phases are separated by Al{sub 2}O{sub 3} layers and the eddy currents are confined in Fe{sub 3}Si phases, thus increasing resistivity and reducing core loss. - Highlights: • Fe{sub 3}Si{sub 0.7}Al{sub 0.3}@SiO{sub 2} core–shell particles and Fe{sub 3}Si/Al{sub 2}O{sub 3} cores were prepared. • Fe{sub 3}Si{sub 0.7}Al{sub 0.3} particles could be uniformly coated by nano-sized SiO{sub 2} clusters. • Fe{sub 3}Si{sub 0.7}Al{sub 0.3}@SiO{sub 2} particles and Fe{sub 3}Si/Al{sub 2}O{sub 3} cores showed good soft magnetic properties. • Fe{sub 3}Si/Al{sub 2}O{sub 3} had lower core loss and better frequency stability than Fe{sub 3}Si{sub 0.7}Al{sub 0.3} cores.

Controlling morphology and crystallite size of Cu(In{sub 0.7}Ga{sub 0.3})Se{sub 2} nano-crystals synthesized using a heating-up method

Energy Technology Data Exchange (ETDEWEB)

Hsu, Wei-Hsiang [Department of Resources Engineering, Particulate Materials Research Center, National Cheng Kung University, Tainan, 70101 Taiwan (China); Hsiang, Hsing-I, E-mail: hsingi@mail.ncku.edu.tw [Department of Resources Engineering, Particulate Materials Research Center, National Cheng Kung University, Tainan, 70101 Taiwan (China); Chia, Chih-Ta [Department of Physics, National Taiwan Normal University, Taipei, 116 Taiwan (China); Yen, Fu-Su [Department of Resources Engineering, Particulate Materials Research Center, National Cheng Kung University, Tainan, 70101 Taiwan (China)

2013-12-15

CuIn{sub 0.7}Ga{sub 0.3}Se{sub 2}(CIGS) nano-crystals were successfully synthesized via a heating-up process. The non-coordinating solvent (1-octadecene) and selenium/cations ratio effects on the crystalline phase and crystallite size of CIGS nano-crystallites were investigated. It was observed that the CIGS nano-crystallite morphology changed from sheet into spherical shape as the amount of 1-octadecene addition was increased. CIGS nano-crystals were obtained in 9–20 nm sizes as the selenium/cations ratio increased. These results suggest that the monomer reactivity in the solution can be adjusted by changing the solvent type and selenium/cations ratio, hence affecting the crystallite size and distribution. - Graphical abstract: CuIn{sub 0.7}Ga{sub 0.3}Se{sub 2}(CIGS) nano-crystals were successfully synthesized via a heating-up process in this study. The super-saturation in the solution can be adjusted by changing the OLA/ODE ratio and selenium/cation ratio.

Hydronéphrose géante sur rein ectopique pelvien révélée par un ...

African Journals Online (AJOL)

R. Yassine

L'imagerie par résonnance magnétique (MRU magnetic resonance urography) est un excellent examen diagnostic, qui permet une évaluation précise tant morphologique que fonctionnelle [7]. Elle peut-être proposée en première intention; mais dans notre contexte, du fait de sa faible disponibilité, nous n'y recourons qu'en ...

Comparative thermodynamic analysis of the Pb-Au0.7Sn0.3 section in the Pb-Au-Sn ternary system

International Nuclear Information System (INIS)

Trumic, B.; Zivkovic, D.; Zivkovic, Z.; Manasijevic, D.

2005-01-01

The results of comparative thermodynamic analysis of Pb-Au 0.7 Sn 0.3 section in Pb-Au-Sn system are presented in this paper. Investigation was done comparatively by calorimetric measurements and thermodynamic calculation according to the general solution model. Thermodynamic parameters, such as partial and integral molar quantities, were determined at different temperatures. The comparison between experimental and calculated results showed mutual agreement. Demixing tendency of lead, presented in the positive deviation from ideal behavior, was confirmed through the study of concentration fluctuation in the long-wavelength limit. Also, chosen alloys in the investigated section were characterized using SEM-EDX analysis

Magnetic properties of La{sub 0.7}Ca{sub 0.3}MnO{sub 3} nanoparticles prepared by reactive milling

Energy Technology Data Exchange (ETDEWEB)

Do Hung Manh [Institute of Materials Science, Vietnamese Academy of Science and Technology, 18 Hoang Quoc Viet Road, Cau Giay Distr., Hanoi (Viet Nam)], E-mail: manhdh@ims.vast.ac.vn; Nguyen Chi Thuan [Institute of Materials Science, Vietnamese Academy of Science and Technology, 18 Hoang Quoc Viet Road, Cau Giay Distr., Hanoi (Viet Nam); Pham Thanh Phong [Nha Trang Pedagogic College, Khanh Hoa Province (Viet Nam); Le Van Hong; Nguyen Xuan Phuc [Institute of Materials Science, Vietnamese Academy of Science and Technology, 18 Hoang Quoc Viet Road, Cau Giay Distr., Hanoi (Viet Nam)

2009-06-24

La{sub 0.7}Ca{sub 0.3}MnO{sub 3} (LCMO) nanoparticles were synthesized by reactive milling in ambient conditions. Magnetic properties of LCMO single-phase nanocrystalline particles were studied. LCMO nanoparticles exhibit superparamagnetism with blocking temperature that decreases in the logarithmic function as increasing applied magnetic field. Besides, the blocking temperature decreases as increasing milling time from 8 h to 16 h. The temperature dependence of the saturation magnetization shows a strong collective excitation due to the spin wave that depends on temperature in form T{sup {alpha}} with {alpha} = 1.7, which slightly deviates from the Bloch law.

Réduction du risque d'infection par le VIH au Botswana - essais ...

International Development Research Centre (IDRC) Digital Library (Canada)

Au Botswana, ce sont les jeunes femmes qui sont le plus touchées par les nouvelles infections par le VIH. Le présent projet a pour but de réduire le nombre de nouveaux cas d'infection par le VIH, en particulier chez les femmes de 15 à 29 ans. Bien que l'on recense des cas de VIH/sida dans la plupart des régions du ...

Strain dependence of interfacial antiferromagnetic coupling in La0.7Sr0.3MnO3/SrRuO3 superlattices

Science.gov (United States)

Das, Sujit; Herklotz, Andreas; Pippel, Eckhard; Guo, Er-Jia; Rata, Diana; Dörr, Kathrin

2015-03-01

We have investigated the magnetic response of La0.7Sr0.3MnO3/SrRuO3 superlattices to biaxial in-plane strain applied in-situ. Superlattices grown on piezoelectric substrates of 0.72PbMg1/3Nb2/3O3-0.28PbTiO3(001) (PMN-PT) show strong antiferromagnetic coupling of the two ferromagnetic components. The coupling field of μ0HAF = 1.8 T is found to change by μ0 ΔHAF / Δɛ ~ -520 mT %-1 under reversible biaxial strain (Δɛ) at 80 K in a [La0.7Sr0.3MnO3(22 Å)/SrRuO3(55 Å)]15 superlattice. This reveals a significant strain effect on interfacial coupling. The applied in-plane compression enhances the ferromagnetic order in the manganite layers which are under as-grown tensile strain. It is thus difficult to disentangle the contributions from strain-dependent antiferromagnetic Mn-O-Ru interface coupling and Mn-O-Mn ferromagnetic double exchange near the interface, since the enhanced magnetic order of Mn spins leads to a larger net coupling of SrRuO3 layers at the interface. We discuss our experimental findings taken into account both the strain-dependent orbital occupation in a single-ion picture and the enhanced Mn order at the interface. This work was supported by the DFG within the Collaborative Research Center SFB 762 ``Functionality of Oxide Interfaces.''

Suppression of slow capacitance relaxation phenomenon in Pt/Ba0.3Sr0.7TiO3/Pt thin film ferroelectric structures by annealing in oxygen atmosphere

KAUST Repository

Altynnikov, A. G.; Gagarin, A. G.; Gaidukov, M. M.; Tumarkin, A. V.; Petrov, P. K.; Alford, N.; Kozyrev, A. B.

2014-01-01

The impact of oxygen annealing on the switching time of ferroelectric thin film capacitor structures Pt/Ba0.3Sr0.7TiO3/Pt was investigated. The response of their capacitance on pulsed control voltages before and after annealing was experimentally

Magnetorefractive effect in La0.7Ca0.3MnO3 in the infrared spectral range

International Nuclear Information System (INIS)

Sukhorukov, Yu. P.; Telegin, A. V.; Granovskii, A. B.; Gan'shina, E. A.; Naumov, S. V.; Kostromitina, N. V.; Elokhina, L. V.; Gonzalez, J.

2010-01-01

The reflection and magnetic reflection spectra, magnetic resistance, electrical properties, and equatorial Kerr effect in La 0.7 Ca 0.3 MnO 3 crystals have been complexly investigated. The measurements have been performed in wide temperature and spectral ranges in magnetic fields up to 3.5 kOe. It has been found that magnetic reflection is a high-frequency response in the infrared spectral range to the colossal magnetore-sistance near the Curie temperature. Correlation between the field and temperature dependences of the magnetic reflection and colossal magnetoresistance has been revealed. The previously developed theory of the magnetorefractive effect for metallic systems makes it possible to explain the experimental data at the qualitative level. Both demerits of the theory of the magnetorefractive effect in application to the magnets and possible additional mechanisms responsible for the magnetic reflection are discussed.

Giant magnetorefractive effect in La{sub 0.7}Ca{sub 0.3}MnO{sub 3} films

Energy Technology Data Exchange (ETDEWEB)

Granovskii, A. B., E-mail: granov@magn.ru [Moscow State University (Russian Federation); Sukhorukov, Yu. P., E-mail: suhorukov@imp.uran.ru; Telegin, A. V.; Bessonov, V. D. [Russian Academy of Sciences, Institute of Metal Physics, Ural Branch (Russian Federation); Gan' shina, E. A.; Kaul' , A. R.; Korsakov, I. E.; Gorbenko, O. Yu. [Moscow State University (Russian Federation); Gonzalez, J. [Universidad del Pais Vasco, Departamento Fisica de Materiales, Facultad de Quimica (Spain)

2011-01-15

Complex experimental investigations of the structural, optical, and magneto-optical properties (magnetotransmission, magnetoreflection, and transversal Kerr effect, as well as the magnetoresistance, of La{sub 0.7}Ca{sub 0.3}MnO{sub 3} epitaxial films indicate that magnetoreflection and magnetotransmission in manganite films can reach giant values and depend strongly on the magnetic and charge homogeneity of the films, their thickness, and spectral range under investigation. It has been shown that the optical enhancement of the magnetorefractive effect occurs in thin films as compared to manganite crystals. In the region of the minimum of the reflectance near the first phonon band, the resonance-like magnetorefractive effect has been observed, which is accompanied by change of the sign of the magnetoreflection. A model based on the theory of the magnetorefractive effect has been proposed to qualitatively explain this behavior.

Effect of Fe substitution on magnetocaloric effect in La{sub 0.7}Sr{sub 0.3}Mn{sub 1-x}Fe{sub x}O{sub 3} (0.05{<=}x{<=}0.20)

Energy Technology Data Exchange (ETDEWEB)

Barik, S K; Krishnamoorthi, C [Department of Physics and NUS Nanoscience and Nanotechnology Initiative, 2 Science Drive 3, National University of Singapore, Singapore 117542, Singapore. (Singapore); Mahendiran, R [Department of Physics and NUS Nanoscience and Nanotechnology Initiative, 2 Science Drive 3, National University of Singapore, Singapore 117542, Singapore. (Singapore)

2011-04-15

We have studied the effect of Fe substitution on magnetic and magnetocaloric properties in La{sub 0.7}Sr{sub 0.3}Mn{sub 1-x}Fe{sub x}O{sub 3} (x=0.05, 0.07, 0.10, 0.15, and 0.20) over a wide temperature range (T=10-400 K). It is shown that substitution by Fe gradually decreases the ferromagnetic Curie temperature (T{sub C}) and saturation magnetization up to x=0.15 but a dramatic change occurs for x=0.2. The x=0.2 sample can be considered as a phase separated compound in which both short-range ordered ferromagnetic and antiferromagnetic phases coexist. The magnetic entropy change (-{Delta}S{sub m}) was estimated from isothermal magnetization curves and it decreases with increase of Fe content from 4.4 J kg{sup -1} K{sup -1} at 343 K (x=0.05) to 1.3 J kg{sup -1} K{sup -1} at 105 K (x=0.2), under {Delta}H=5 T. The La{sub 0.7}Sr{sub 0.3}Mn{sub 0.93}Fe{sub 0.07}O{sub 3} sample shows negligible hysteresis loss, operating temperature range over 60 K around room temperature with refrigerant capacity of 225 J kg{sup -1}, and magnetic entropy of 4 J kg{sup -1} K{sup -1} which will be an interesting compound for application in room temperature refrigeration. - Research highlights: > We report magnetocaloric effect in La{sub 0.7}Sr{sub 0.3}Mn{sub 1-x}Fe{sub x}O{sub 3} (x=0-0.2). > Magnetic entropy change ({Delta}S{sub m}) decreases with increasing x. > A large {Delta}S{sub m} and refrigeration capacity are found around 300 K in x=0.07.

14 CFR 417.224 - Probability of failure analysis.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Probability of failure analysis. 417.224..., DEPARTMENT OF TRANSPORTATION LICENSING LAUNCH SAFETY Flight Safety Analysis § 417.224 Probability of failure..., must account for launch vehicle failure probability in a consistent manner. A launch vehicle failure...

Strain-Mediated Inverse Photoresistivity in SrRuO3/La0.7Sr0.3MnO3Superlattices

KAUST Repository

Liu, Heng-Jui

2015-12-09

© 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim. In the pursuit of novel functionalities by utilizing the lattice degree of freedom in complex oxide heterostructure, the control mechanism through direct strain manipulation across the interfaces is still under development, especially with various stimuli, such as electric field, magnetic field, light, etc. In this study, the superlattices consisting of colossal-magnetoresistive manganites La0.7Sr0.3MnO3 (LSMO) and photostrictive SrRuO3 (SRO) have been designed to investigate the light-dependent controllability of lattice order in the corresponding functionalities and rich interface physics. Two substrates, SrTiO3 (STO) and LaAlO3 (LAO), have been employed to provide the different strain environments to the superlattice system, in which the LSMO sublayers exhibit different orbital occupations. Subsequently, by introducing light, we can modulate the strain state and orbital preference of LSMO sublayers through light-induced expansion of SRO sublayers, leading to surprisingly opposite changes in photoresistivity. The observed photoresistivity decreases in the superlattice grown on STO substrate while increases in the superlattice grown on LAO substrate under light illumination. This work has presented a model system that demonstrates the manipulation of orbital-lattice coupling and the resultant functionalities in artificial oxide superlattices via light stimulus. A fascinating model system of optic-driven functionalities has been achieved by artificial superlattices consisting of manganite La0.7Sr0.3MnO3 (LSMO) and photostrictive SrRuO3 (SRO). With design of different initial strain and orbital states in superlattices, we can even control the photoresistivity of the superlattices in an opposite trend that cannot be achieved in pure single film.

The small laccase from Streptomyces coelicolor

Czech Academy of Sciences Publication Activity Database

Dohnálek, Jan; Skálová, Tereza; Ostergaard, L. H.; Ostergaard, P. R.; Hašek, Jindřich

2009-01-01

Roč. 16, 1a (2009), b4-b5 ISSN 1211-5894. [Discussions in Structural Molecular Biology /7./. 12.03.2009-14.03.2009, Nové Hrady] R&D Projects: GA ČR GA305/07/1073 Institutional research plan: CEZ:AV0Z40500505 Keywords : laccase * Streptomyces coelicolor * enzymer Subject RIV: CD - Macromolecular Chemistry

Ti atoms in Ru0.3Ti0.7O2 mixed oxides form active and selective sites for electrochemical chlorine evolution

DEFF Research Database (Denmark)

Karlsson, Rasmus K. B.; Hansen, Heine Anton; Bligaard, Thomas

2014-01-01

affected by the presence of small amounts of Ru dopant, whereas oxygen adsorption is relatively unaffected by Ti dopants in RuO2. The calculations also indicate that coordinatively unsaturated Ti sites on Ru-doped TiO2 and on Ru0.3Ti0.7O2 could form active and selective sites for Cl2 evolution....... These results suggest a reason for why DSA shows a higher chlorine selectivity than RuO2 and propose an experimental test of the hypothesis....

Surface glycoconjugates of Lyme borreliosis spirochetes

Czech Academy of Sciences Publication Activity Database

Vancová, Marie; Nebesářová, Jana; Grubhoffer, Libor

2003-01-01

Roč. 9, Supplement 03 (2003), s. 506-507 ISSN 1431-9276. [Microscopy Conference 2003, Conference of Deutsche Gesellschaft für Elektronenmikroskopie /31./. Dresden, 07.09.2003-12.09.2003] R&D Projects: GA ČR GA206/03/1323 Institutional research plan: CEZ:AV0Z6022909 Keywords : borreliosis * surface glycoconjugates * spirochete Subject RIV: EE - Microbiology, Virology Impact factor: 1.648, year: 2003

Magnetophonon resonance in photoluminescence excitation spectra of magnetoexcitons in GaAs/Al0.3Ga0.7As superlattice

DEFF Research Database (Denmark)

Dickmann, S.; Tartakovskii, A. I.; Timofeev, V. B.

2000-01-01

A strong increase in the intensity of the peaks of excited magnetoexciton (ME) states in the photoluminescence excitation (PLE) spectra recorded for the ground heavy-hole magnetoexcitons (of the 1sHH type) has been found in a GaAs/Al0.3Ga0.7As superlattice in strong magnetic field B applied normal...... to the sample layers. While varying B, the intensities of the PLE peaks have been measured as functions of energy separation Delta E between excited ME peaks and the ground state of the system. The resonance profiles have been found to have maxima at Delta E-max close to the energy of the GaAs LO phonon...

Possible origin of photoconductivity in La0.7Ca0.3MnO3

Science.gov (United States)

Sagdeo, P. R.; Choudhary, R. J.; Phase, D. M.

2010-01-01

The effect of photon energy on the density of states near Fermi level of pulsed laser deposited La0.7Ca0.3MnO3 thin film has been studied to investigate the possible origin of change in the conductivity of these manganites upon photon exposure. For this purpose the photoelectron spectroscopy measurements were carried out using CSR beamline (BL-2) on Indus-1 synchrotron radiation source. The valance band spectra were measured at room temperature with photon energy ranging from 40 to 60 eV. We could see huge change in the density of states near Fermi level and this change is observed to be highest at 56 eV which is due to the resonance between Mn 3p to Mn 3d level. Our results suggest that the probability of electron transfer from deep Mn 3p level to Mn 3d-eg level is higher than that of Mn 3d-t2g level. It appears that this transfer of electron from deep Mn level to Mn 3d-eg level not only modifies the density of state near Fermi level but also changes the mobility of electrons by modifying the electron lattice coupling due to presence of Mn+3 Jahn-Teller ion.

Facteurs de risque de l'infection par le VIH dans le district de santé de Meyomessala au Cameroun

Science.gov (United States)

Mbopi-Keou, Francois-Xavier; Nguefack-Tsague, Georges; Kalla, Ginette Claude Mireille; Abessolo, Stéphanie Abo'o; Angwafo, Fru; Muna, Walinjom

2014-01-01

Introduction L'objectif de ce travail était de déterminer les facteurs de risque de l'infection par le VIH dans le district de santé de Meyomessala (Région du Sud) au Cameroun. Méthodes Il s'agissait d'une étude transversale, descriptive et analytique qui s'est déroulée de Février à Mai 2011. Pour cette étude, nous avons obtenu une clairance éthique. Résultats L’échantillon était constitué de 315 participants dont 181 (57,46%) hommes et 134 (42,54%) femmes. L’âge moyen était de 24,5±8ans (extrême: 15-45ans). Quarante personnes (40) étaient séropositifs, soit une prévalence de l'infection par le VIH de 12,7%. Cette prévalence augmentait significativement (p = 0) avec le nombre de partenaires occasionnels au cours des douze derniers mois, allant de 2,7% chez ceux n'ayant eu aucun partenaire occasionnel à 21,25% chez ceux ayant plus de trois partenaires occasionnels (RC = 9,72; IC = 1,27-74,14; P = 0,03). le fait d’être âgé entre 20 et 24 ans (RC = 4,88; IC = 1,74-13,67; p = 0), avoir plus de trois partenaires sexuels au cours des douze derniers mois (RC = 9,72; IC = 1,27-74,14; p = 0,03), avoir les rapports sexuels avec les prostitués (RC = 2,86; IC = 1,42-5,76; p = 0), avoir eu le chlamydia (RC = 3,00; IC = 1,07-8,39; p = 0,04), avoir eu la syphilis (RC = 3,35; IC = 1,57-7,14; p = 0), avoir des avantages sociaux lors du premier rapport sexuel (RC = 2,57; IC = 1,03-6,43; p = 0,04) constituaient des potentiels facteurs de risque du VIH. Conclusion Il apparait urgent d'intensifier les campagnes de sensibilisation au risque d'infection par le VIH et les maladies sexuellement transmissibles dans le district de santé de Meyomessala PMID:25419299

14 CFR 417.215 - Straight-up time analysis.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Straight-up time analysis. 417.215 Section..., DEPARTMENT OF TRANSPORTATION LICENSING LAUNCH SAFETY Flight Safety Analysis § 417.215 Straight-up time analysis. A flight safety analysis must establish the straight-up time for a launch for use as a flight...

Jedenáctá mezinárodní konference o barokní hudbě, The Royal Northern College of Music, Manchester 14.–18. 7. 2004

Czech Academy of Sciences Publication Activity Database

Kapsa, Václav

2004-01-01

Roč. 41, 3-4 (2004), s. 399-402 ISSN 0018-7003. [Biennial International Conference on Baroque Music /11./. Manchester, 04.07.14-04.07.18] R&D Projects: GA ČR(CZ) GD408/03/H049 Institutional research plan: CEZ:AV0Z9058907 Keywords : baroque music * conference * report Subject RIV: AL - Art, Architecture, Cultural Heritage

Advanced probes for edge plasma diagnostics on the CASTOR tokamak

Czech Academy of Sciences Publication Activity Database

Stöckel, Jan; Adámek, Jiří; Balan, P.; Hronová-Bilyková, Olena; Brotánková, Jana; Dejarnac, Renaud; Devynck, P.; Ďuran, Ivan; Gunn, J. P.; Hron, Martin; Horáček, Jan; Ionita, C.; Kocan, M.; Martines, E.; Pánek, Radomír; Peleman, P.; Schrittwieser, R.; Van Oost, G.; Žáček, František

2006-01-01

Roč. 63, č. 0 (2006), 012001-012002 E-ISSN 1742-6596. [SECOND INTERNATIONAL WORKSHOP AND SUMMER SCHOOL ON PLASMA PHYSICS. Kiten, 03.07.2006-09.07.2006] R&D Projects: GA AV ČR KJB100430504 Institutional research plan: CEZ:AV0Z20430508 Keywords : plasma * tokamak * electric probes * diagnostics Subject RIV: BL - Plasma and Gas Discharge Physics

Critical behavior of Y-doped Nd{sub 0.7}Sr{sub 0.3}MnO{sub 3} manganites exhibiting the tricritical point and large magnetocaloric effect

Energy Technology Data Exchange (ETDEWEB)

Phan, The-Long; Ho, T.A. [Department of Physics, Chungbuk National University, Cheongju 361-763 (Korea, Republic of); Thang, P.D. [Faculty of Engineering Physics and Nanotechnology, VNU-University of Engineering and Technology, Xuan Thuy, Cau Giay, Hanoi (Viet Nam); Tran, Q.T. [Center for Science and Technology Communication, Ministry of Science and Technology, 113 Tran Duy Hung, Hanoi (Viet Nam); Thanh, T.D.; Phuc, N.X. [Institute of Materials Science, Vietnam Academy of Science and Technology, 18 Hoang Quoc Viet, Cau Giay, Hanoi (Viet Nam); Phan, M.H. [Department of Physics, University of South Florida, Tampa, FL 33620 (United States); Huy, B.T. [Department of Chemistry, Changwon National University, Changwon 641-773 (Korea, Republic of); Yu, S.C., E-mail: scyu@chungbuk.ac.kr [Department of Physics, Chungbuk National University, Cheongju 361-763 (Korea, Republic of)

2014-12-05

Highlights: • Tricritical point in Y-doped Nd{sub 0.7}Sr{sub 0.3}MnO{sub 3} manganites. • A large magnetic-entropy change. • Magnetic inhomogeneity and phase separation. - Abstract: We have determined the values of critical exponents of two polycrystalline samples (Nd{sub 1−x}Y{sub x}){sub 0.7}Sr{sub 0.3}MnO{sub 3} (x = 0 and 0.07) from the magnetization data versus temperature and magnetic field, M(H, T), to learn about their magnetic and magnetocaloric (MC) properties. The results reveal the samples exhibiting the crossover of first-order and second-order phase transitions, where the exponent values β = 0.271 and γ = 0.922 for x = 0, and β = 0.234–0.236 and γ = 1.044–1.063 for x = 0.07 determined by using modified Arrott plots and static-scaling hypothesis are close to those expected for the tricritical mean-field theory (β = 0.25 and γ = 1.0). Particularly, the T{sub C} of x = 0 and 0.07 can be any value in the temperature ranges of 240–255 K and 170–278 K, respectively, depending on the magnitude of applied magnetic field and determination techniques. Around the T{sub C}, studying the MC effect of the samples has revealed a large magnetic-entropy change (ΔS{sub m}) up to ∼8 J/kg K for the applied field interval ΔH = 50 kOe, corresponding to refrigerant capacity values of 200–245 J/kg. These phenomena are related to the crossover nature and the persisting of FM/anti-FM interactions even above the T{sub C}, as further confirmed by electron-spin-resonance data, Curie–Weiss law-based analyses, and an exponential parameter characteristic of magnetic order n = dLn|ΔS{sub m}|/dLnH.

Structure and properties of novel cobaltates Ln.sub.0.3./sub.CoO.sub.2./sub. (Ln = La, Pr, and Nd)

Czech Academy of Sciences Publication Activity Database

Knížek, Karel; Jirák, Zdeněk; Hejtmánek, Jiří; Maryško, Miroslav; Buršík, Josef

2012-01-01

Roč. 111, č. 7 (2012), "07D707-1"-"07D707-3" ISSN 0021-8979 R&D Projects: GA ČR GA203/09/1036; GA ČR GA202/09/0421 Institutional research plan: CEZ:AV0Z10100521; CEZ:AV0Z40320502 Keywords : thermoelectric and thermomagnetic effects * heat capacity * saturation moments and magnetic susceptibilities * nonmetals * Insulators * low-field transport Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.210, year: 2012

Effect of evodiamine and berberine on miR-429 as an oncogene in human colorectal cancer

Directory of Open Access Journals (Sweden)

Liu H

2016-07-01

Full Text Available Hong Liu, Chao Huang, Liyun Wu, Bin Wen Institute of Spleen and Stomach, Guangzhou University of Chinese Medicine, Guangzhou, Guangdong, People’s Republic of China Abstract: Loss of epithelial organization and deregulated microRNAs are hallmarks of malignant carcinomas, but the relationship between them has been poorly understood. This study was designed to investigate the changes in the expression of E-cadherin, Par3, and miR-429 during the development of human colorectal cancer (CRC. E-cadherin and Par3 levels were quantitatively detected by immunohistochemistry and Western blotting. An in vitro culture of colorectal tissue was established to analyze the effect of berberine (BER and evodiamine (EVO on the level of miR-429. Our results suggested that E-cadherin and Par3 were remarkably decreased in tumor tissues compared with those in normal tissues, and miR-429 was upregulated in tumor tissues. After treatment of BER and EVO, the level of miR-429 was lower in tumor tissues than in normal tissues. This study investigated the potential relationship between miR-429, E-cadherin, and Par3 in CRC. The data suggested that BER and EVO can be potential therapeutic agents for CRC, as they downregulated the expression level of miR-429. Keywords: microRNAs, tissue culture

Determination of flavanol and procyanidin (by degree of polymerization 1-10) content of chocolate, cocoa liquors, powder(s), and cocoa flavanol extracts by normal phase high-performance liquid chromatography: collaborative study.

Science.gov (United States)

Robbins, Rebecca J; Leonczak, Jadwiga; Li, Julia; Johnson, J Christopher; Collins, Tom; Kwik-Uribe, Catherine; Schmitz, Harold H

2012-01-01

An international collaborative study was conducted on an HPLC method with fluorescent detection (FLD) for the determination of flavanols and procyanidins in materials containing chocolate and cocoa. The sum of the oligomeric fractions with degree of polymerization 1-10 was the determined content value. Sample materials included dark and milk chocolates, cocoa powder, cocoa liquors, and cocoa extracts. The content ranged from approximately 2 to 500 mg/g (defatted basis). Thirteen laboratories representing commercial, industrial, and academic institutions in six countries participated in the study. Fourteen samples were sent as blind duplicates to the collaborators. Results from 12 laboratories yielded repeatability relative standard deviation (RSDr) values that were below 10% for all materials analyzed, ranging from 4.17 to 9.61%. The reproducibility relative standard deviation (RSD(R)) values ranged from 5.03 to 12.9% for samples containing 8.07 to 484.7 mg/g. In one sample containing a low content of flavanols and procyanidins (approximately 2 mg/g), the RSD(R) was 17.68%. Based on these results, the method is recommended for Official First Action for the determination of flavanols and procyanidins in chocolate, cocoa liquors, powder(s), and cocoa extracts.

Microscopie par rayons X dans la fenêtre de l'eau : faisabilité et intérêt pour la biologie d'un instrument de laboratoire

Science.gov (United States)

Adam, J. F.; Moy, J. P.

2005-06-01

La biologie étudie des structures ou des phénomènes sub-cellulaires. Pour cela la microscopie est la technique d'observation privilégiée. La résolution spatiale de la microscopie optique s'avère bien souvent insuffisante pour de telles observations. Les techniques plus résolvantes, comme la microscopie électronique par transmission sont souvent destructrices et d'une complexité peu adaptée aux besoins des biologistes. La microscopie par rayons X dans la fenêtre de l'eau permet l'imagerie rapide de cellules dans leur milieu naturel, nécessite peu de préparation et offre des résolutions de quelques dizaines de nanomètres. De plus, il existe un bon contraste naturel entre les structures carbonées (protéines, lipides) et l'eau. Actuellement cette technique est limitée aux centres de rayonnement synchrotron, ce qui impose une planification et des déplacements incompatibles avec les besoins de la biologie. Un tel microscope fonctionnant avec uns source de laboratoire serait d'une grande utilité. Ce document présente un état de l'art de la microscopie par rayons X dans la fenêtre de l'eau. Un cahier des charges détaillé pour un appareil de laboratoire ayant les performances optiques requises par les biologistes est présenté et confronté aux microscopes X de laboratoire déjà existants. Des solutions concernant la source et les optiques sont également discutées.

Dosage du mercure dans le gaz naturel par absorption atomique sans flammes Mercury Titration in Natural Gas by Flameless Atomic Absorption

Directory of Open Access Journals (Sweden)

La Villa F.

2006-11-01

Full Text Available Cet article présente la méthode mise au point par l'Institut Français du Pétrole pour déterminer par absorption atomique sans flamme, les traces de mercure métallique contenu dans un gaz naturel. La méthode d'analyse nécessite une extraction du mercure soit sous forme d'ion mercurique en faisant passer le gaz dans une solution oxydante, soit sous forme d'amalgame avec de l'or ou de l'argent. Le premier mode opératoire s'applique aux échantillons dont la concentration en mercure est supérieure à I ttg/Nm3, le second pour des concentrations inférieures à 5 pg/Nm3. Les seuils de détection sont respectivement 10 ng (en solution et 0,3 ng (en amalgame. La répétabilité pour 100 ng de mercure (en amalgame est de ± 7% pour une probabilité de.95 %. En conclusion, dans un échantillon de gaz naturel, compte tenu du volume des prélèvements effectués, il est possible de détecter des concentrations de l'ordre du nanogramme de mercure par mètre cube de gaz. This article describes the method developed by IFP using flameless atomic absorption to determine metallic mercury traces in a natural gas. The analyst method requires a mercury extraction either in the form of mercuric ions by making the gas pass through an oxidizing solution or in the form of an amalgam with gold or silver. The former operating method applies ta samples having a mercury concentration greater than I !ag/Nm3, and the latter for concentrations smaller than 5 (-Lg/Nm3. Detection thresholds are respectively 10 ng (in solution and 0.3 ng (in amalgam. The repeatability for 100 ng of mercury (in amalgam is ± 7 % with a probability of 95%. To conclude, in a sample of natural gas, considering the volume of the samples taken, it is possible ta detect concentrations in the vicinity of one nanogrom of mercury per cubic meter of gas.

Modifier le cadre participatif pour résoudre un problème client : exemples d’ajustement opéré par les professionnels dans les interactions en centre d’appels

Directory of Open Access Journals (Sweden)

Colón De Carvajal Isabel

2012-07-01

Full Text Available Si, dans les interactions de service en centre d’appels, la conversation principale est celle engagée entre l’appelant et l’appelé, une multitude d’autres interactions caractérise le travail des opérateurs. Cet article présente une étude linguistique sur les interactions entre les opérateurs du centre d’appels LocBike, qui propose l’accès à des vélos en libre service dans une grande ville française, et les clients, qui empruntent ces vélos et appellent le centre en cas de problèmes. Ces interactions ont la particularité d’être menées autour d’objets technologiques, afin d’interagir avec le client et traiter son dossier. L’accès à cet environnement d’interactions téléphoniques médiées par ordinateur permet d’analyser la résolution du problème client du point de vue de l’opérateur, et d’observer que ce travail se réalise parfois en collaboration avec son collègue co-présent dans son environnement immédiat. Les professionnels opèrent alors des ajustements par rapport au dispositif de communication, ou s’ajustent eux-mêmes à ce dispositif, pendant l’interaction principale avec le client, ce qui tend à modifier le cadre participatif. L’objectif de notre travail est d’analyser les pratiques des professionnels lors de modifications du cadre participatif, et ce, dans le but de résoudre un problème client. A travers des exemples de collaboration, nous étudierons les formes d’ajustement que les professionnels mettent en place par rapport au dispositif de communication, modifiant ainsi temporairement le cadre participatif.

Second order magnetic phase transition and scaling analysis in iron doped manganite La0.7Ca0.3Mn1−xFexO3 compounds

International Nuclear Information System (INIS)

Ginting, Dianta; Nanto, Dwi; Denny, Yus Rama; Tarigan, Kontan; Hadi, Syamsul; Ihsan, Mohammad; Rhyee, Jong-Soo

2015-01-01

We investigated magnetic properties of La 0.7 Ca 0.3 Mn 1−x Fe x O 3 (x=0.09 and 0.11) compounds in terms of isothermal magnetization analysis and scaling behavior with various critical exponents. From the Landau theory of magnetic phase transition, we found that the paramagnetic to ferromagnetic phase transition in La 0.7 Ca 0.3 Mn 1−x Fe x O 3 (x=0.09 and 0.11) compounds is the type of second order magnetic transition (SOMT), which contrary to the first order magnetic transition (FOMT) for low Fe-doped compounds (x<0.09) in previous reports. When we investigate the critical behavior of the compounds near T=T c by the modified Arrott plot, Kouvel–Fisher plots, and critical isothermal analysis, the estimated critical exponents β, γ, and δ are in between the theoretically predicted values for three-dimensional Heisenberg and mean-field interaction models. It is noteworthy that the scaling relations are obeyed in terms of renormalization magnetization m=ε −β M(H,ε) and renormalized field h=|ε| β+γ H. Temperature-dependent effective exponents β eff and γ eff correspond to the ones of disordered ferromagnets. It is shown that the magnetic state of the compounds is not fully described by the conventional localized-spin interaction model because the ferromagnetic interaction has itinerant character by increasing Fe-doping concentration. - Highlights: • The ferromagnetic phase transition is of second order in La 0.7 Ca 0.3 Mn 1−x Fe x O 3 . • The critical exponents are in between the 3D Heisenberg and mean-field models. • The ferromagnetic interaction becomes more itinerant by Fe-doping

Critical behavior of a La0,7Sr0,3MnO3 crystal in the vicinity of its transition to ferromagnetic state

International Nuclear Information System (INIS)

Kalita, V.M.; Lozenko, A.F.; Ryabchenko, S.M.; Trotsenko, P.O.; Tovstolitkyin, O.Yi.; Pogoryilij, A.M.

2009-01-01

Magnetostatic properties of a La 0,7 Sr 0,3 MnO 3 single crystal have been studied in the vicinity of its critical temperature T c . A nonlinear temperature dependence of the inverse magnetic susceptibility which is characteristic of the Griffiths phase, has been found in the minimal measuring magnetic field at temperatures slightly above the temperature of ferromagnetic (FM) ordering. A conclusion was made that such a nonlinearity arises owing to the formation of magnetic polarons

3D imaging of radiation damage in silicon sensor and spatial mapping of charge collection efficiency

Czech Academy of Sciences Publication Activity Database

Jakůbek, M.; Jakůbek, J.; Žemlička, J.; Platkevič, M.; Havránek, Vladimír; Semián, Vladimír

2013-01-01

Roč. 8, č. 3 (2013), C03023 ISSN 1748-0221. [14th International Workshop on Radiation Imaging Detectors. Figueira da Foz, Coimbra, 01.07.2012-05.07.2012] R&D Projects: GA TA ČR TA01010237; GA ČR(CZ) GA103/09/2101 Institutional support: RVO:61389005 ; RVO:68378297 Keywords : solid media * radiation damage * Pixelated detectors Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders; JL - Materials Fatigue, Friction Mechanics (UTAM-F) Impact factor: 1.526, year: 2013 http://iopscience.iop.org/1748-0221/8/03/C03023/pdf/1748-0221_8_03_C03023.pdf

Investigation of In0.7Ga0.3As/In0.7Al0.3As metamorphic HEMT- heterostructures by photoluminescence spectroscopy

International Nuclear Information System (INIS)

LETT', Prof. Popova 5, St. Petersburg 197376 (Russian Federation))" data-affiliation=" (Saint-Petersburg Electrotechnical University LETT', Prof. Popova 5, St. Petersburg 197376 (Russian Federation))" >Romanovskiy, D S; LETT', Prof. Popova 5, St. Petersburg 197376 (Russian Federation))" data-affiliation=" (Saint-Petersburg Electrotechnical University LETT', Prof. Popova 5, St. Petersburg 197376 (Russian Federation))" >Tarasov, S A; Galiev, G B; Pushkarev, S S

2014-01-01

Low-temperature photoluminescence and photoreflectance have been studied in several metamorphic HEMT- (MHEMT-) heterostructures with the same active regions and different buffer layer designs grown by solid-source molecular beam epitaxy. The indium mole fraction in InAlAs/InGaAs/InAlAs single quantum well (QW) is 0.7. It was found that structures with step-graded metamorphic buffer have better quality. Also it was shown that mismatched superlattices in metamorphic buffer can influence on the half-width of photoluminescence spectra. The possible attribution of photoluminescence and photoreflectance spectral lines and their thermal behaviour are critically discussed

Use of pulsating water jet technology for removal of concrete in repair of concrete structures

Czech Academy of Sciences Publication Activity Database

Sitek, Libor; Foldyna, Josef; Martinec, Petr; Ščučka, Jiří; Bodnárová, L.; Hela, R.

2011-01-01

Roč. 6, č. 4 (2011), s. 235-242 ISSN 1822-427X R&D Projects: GA ČR GA103/07/1662; GA ČR GP101/07/P512; GA AV ČR 1QS300860501; GA MŠk ED2.1.00/03.0082 Grant - others:GA MPO(CZ) FR-TI2/390 Program:FR Institutional research plan: CEZ:AV0Z30860518 Keywords : high-speed water jet technology * pulsating jet * rotating jets * removal of concrete layer Subject RIV: JQ - Machines ; Tools Impact factor: 1.610, year: 2011 http://www.bjrbe.vgtu.lt/volumes/en/volume6/number4/03.php

Nano-embossing technology on ferroelectric thin film Pb(Zr0.3,Ti0.7O3 for multi-bit storage application

Directory of Open Access Journals (Sweden)

Lu Qian

2011-01-01

Full Text Available Abstract In this work, we apply nano-embossing technique to form a stagger structure in ferroelectric lead zirconate titanate [Pb(Zr0.3, Ti0.7O3 (PZT] films and investigate the ferroelectric and electrical characterizations of the embossed and un-embossed regions, respectively, of the same films by using piezoresponse force microscopy (PFM and Radiant Technologies Precision Material Analyzer. Attributed to the different layer thickness of the patterned ferroelectric thin film, two distinctive coercive voltages have been obtained, thereby, allowing for a single ferroelectric memory cell to contain more than one bit of data.

Magnetoresistance in La0.7Ca0.3MnO3-YBa2Cu3O7 F/S/F trilayers

International Nuclear Information System (INIS)

Pena, V.; Visani, C.; Bruno, F.; Garcia-Barriocanal, J.; Arias, D.; Rivera, A.; Sefrioui, Z.; Leon, C.; Te Velthuis, S.G.E.; Hoffmann, A.; Nemes, N.; Garcia-Hernandez, M.; Martinez, J.L.; Santamaria, J.

2007-01-01

We report large magnetoresistance in ferromagnet/superconductor/ferromagnet structures made of La 0.7 Ca 0.3 MnO 3 and YBa 2 Cu 3 O 7 at temperatures along the resistive transition. We find that the magnetoresistance phenomenon is independent on the orientation of electric current versus field. Furthermore, the effect is also independent on the sweep rate of the magnetic field. This excludes interpretations in terms of spontaneous vortices or anisotropic magnetoresistance of the ferromagnetic layers and supports the view that the magnetoresistance phenomenon originates at the spin-dependent transport of quasiparticles transmitted from the ferromagnetic electrodes into the superconductor

Instability of the ferromagnetic ground state in Lu.sub.2./sub.Fe.sub.17-x./sub.Mn.sub.x./sub. [x = 0.5, 0.7

Czech Academy of Sciences Publication Activity Database

Arnold, Zdeněk; Kuchin, A.; Kamarád, Jiří

2012-01-01

Roč. 111, č. 7 (2012), "07E310-1"-"07E310-3" ISSN 0021-8979 R&D Projects: GA ČR GA202/09/1027 Institutional research plan: CEZ:AV0Z10100521 Keywords : ferromagnetic ground state, Magnetic moments * magnetic moments Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.210, year: 2012

Muscarinic antagonism impairs navigation in the active allothetic place avoidance task

Czech Academy of Sciences Publication Activity Database

Stuchlík, Aleš; Valeš, Karel

2005-01-01

Roč. 6, č. Suppl.1 (2005), s. 376-376 ISSN 1562-2975. [WFSBP Congress /8./. 28.06.2005-03.07.2005, Vienna] R&D Projects: GA MŠk(CZ) 1M0517; GA MŠk(CZ) LC554; GA ČR(CZ) GP309/03/P126 Institutional research plan: CEZ:AV0Z50110509 Keywords : AAPA Subject RIV: FH - Neurology

Effect of clozapine on Active Allothetic Place Avoidance in an animal model of schizophrenia

Czech Academy of Sciences Publication Activity Database

Valeš, Karel; Bubeníková, Věra; Stuchlík, Aleš

2005-01-01

Roč. 6, č. Suppl.1 (2005), s. 296-296 ISSN 1562-2975. [WFSBP Congress /8./. 28.06.2005-03.07.2005, Vienna] R&D Projects: GA ČR(CZ) GP309/03/P126; GA MŠk(CZ) 1M0517; GA MŠk(CZ) LC554 Institutional research plan: CEZ:AV0Z50110509 Keywords : AAPA Subject RIV: FH - Neurology

Optical response of oxygen deficient La{sub 0.7}Sr{sub 0.3}MnO{sub 3} thin films deposited by pulsed laser deposition

Energy Technology Data Exchange (ETDEWEB)

Cesaria, M., E-mail: maura.cesaria@le.infn.it [Department of Mathematics and Physics “Ennio De Giorgi”, University of Salento, Via Arnesano, 73100 Lecce (Italy); Caricato, A.P.; Leggieri, G.; Martino, M. [Department of Mathematics and Physics “Ennio De Giorgi”, University of Salento, Via Arnesano, 73100 Lecce (Italy); Maruccio, G. [Department of Mathematics and Physics “Ennio De Giorgi”, University of Salento, Via Arnesano, 73100 Lecce (Italy); National Nanotechnology Laboratory (NNL)-Nanoscience Institute-CNR, Via Arnesano, 73100 Lecce (Italy)

2013-10-31

The optical response of 200 nm thick La{sub 0.7}Sr{sub 0.3}MnO{sub (3−δ)} films, deposited by pulsed laser deposition on amorphous silica substrates heated at nearly 600 °C, under different oxygen pressures (0.1 Pa, 0.5 Pa, 1 Pa, 5 Pa and 10 Pa), is reported. The effects of the oxygen non-stoichiometry are investigated at room temperature dealing with the absorption coefficient and the Tauc's plot method rather than conventional optical conductivity. The absorption curves are evaluated by an algorithm able to realistically describe the behavior of thin films without exploiting numerical extrapolations or simplified theoretical models or ab-initio calculations. Optical features, tunable by the growth oxygen pressure, are discussed based on the known theoretical and experimental scenario. - Highlights: • Overview of the La{sub 0.7}Sr{sub 0.3}MnO{sub 3} basics to highlight basic questions to be assessed. • Optical analysis by the absorption coefficient rather than optical conductivity. • Realistic absorption response that avoids numerical refinements and simulations. • Analysis of the role of oxygen vacancies in tuning the electronic dispersion. • First investigation of direct and indirect transitions by the Tauc's plot.

Étude par spectroscopie Raman de résonance de composés modèles de la polyaniline

Science.gov (United States)

Boyer, M. I.; Quillard, S.; Louarn, G.; Lefrant, S.; Rebourt, E.; Monkman, A.

1998-06-01

In this paper, a vibrational study (Resonance Raman Scattering and valence- force-field calculations) of some model compounds of polyaniline is presented. Indeed, this model compound approach allows one to obtain some informations about the vibrational properties and consequently about the electronic configurations of the corresponding polymeric forms. By using valence-force- field calculations, three sets of force constants have been obtained, related to the reduced and oxidized units of the base forms of polyaniline and to the emeraldine salt form. Dans ce travail, nous présentons une étude vibrationnelle (diffusion Raman de résonance et calcul de champ de force de valence) de quelques composés modèles de la polyaniline. Cette approche par les composés modèles permet, en effet, d'obtenir des informations sur les propriétés vibrationnelles et à fortiori sur les configurations électroniques des formes polymères correspondantes. Ainsi, par un calcul de champ de force de valence, trois jeux de constantes ont été déterminés relatifs aux unités réduites et oxydées des différentes formes bases des polyanilines et à la forme éméraldine sel.

CERN Technical Training 2003: Learning for the LHC! MAGNE-03 : Magnétisme pour l'Electrotechnique Phénomènes magnétiques, matériaux et applications - French version only

CERN Multimedia

2003-01-01

MAGNE-03 est un nouveau cours dans le cadre du programme de l'Enseignement Technique 2003, qui s'adresse aux personnes souhaitant découvrir, améliorer ou remettre à niveau leurs connaissances en magnétisme. Recommandé par l'ancienne division LHC, le cours est donné au CERN par la société CEDRAT Technologies basée à Meylan (France, 38). La participation est ouverte à l'ensemble du personnel technique et scientifique nécessitant une formation en magnétisme dans le cadre de leurs activités professionnelles, courantes ou futures. En ayant organisé des sessions au CERN, une économie d'environ 800.- CHF par participant est réalisée par rapport aux frais nécessaires pour suivre la même formation sur leur site en Isère. MAGNE-03 s'intéresse, entre autres, au développement de la compréhension des phénomènes magnétiques et le "sens physique" appliqués à des produits industriels. Programme : Notions de base en électromagnétisme. Les aspects électrique et mécanique du magnétisme. Les ...

Several (un) known representational environments in geometry

Czech Academy of Sciences Publication Activity Database

Roubíček, Filip

2006-01-01

Roč. 14, 1 (2006), s. 40-43 ISSN 1214-4681. [Creativity in Mathematics Education and the Education of Gifted Students. České Budějovice, 05.07.2006-08.07.2006] R&D Projects: GA ČR(CZ) GP406/03/D052; GA ČR GA406/05/2444 Institutional research plan: CEZ:AV0Z10190503 Keywords : teaching of geometry * representation * construction Subject RIV: AM - Education

Local rhombohedral symmetry in Tb0.3Dy0.7Fe2 near the morphotropic phase boundary

International Nuclear Information System (INIS)

Ma, Tianyu; Liu, Xiaolian; Pan, Xingwen; Li, Xiang; Jiang, Yinzhu; Yan, Mi; Li, Huiying; Fang, Minxia; Ren, Xiaobing

2014-01-01

The recently reported morphotropic phase boundary (MPB) in a number of giant magnetostrictive materials (GMMs) has drawn considerable interest to the local symmetry/structure near MPB region of these materials. In this letter, by in-situ X-ray diffraction and AC magnetic susceptibility measurements, we show that Tb 0.3 Dy 0.7 Fe 2 , the typical composition of Terfenol-D GMMs, has coexistence of rhombohedral and tetragonal phases over a wide temperature range in the vicinity of MPB. High resolution transmission electron microscopy provides direct evidence for local rhombohedral symmetry of the ferromagnetic phase and reveals regular-shaped nanoscale domains below 10 nm. The nano-sized structural/magnetic domains are hierarchically inside a single micron-sized stripe-like domain with the same average magnetization direction. Such domain structures are consistent with the low magnetocrystalline anisotropy and easy magnetic/structural domain switching under magnetic field, thus generating large magnetostriction at low field

Magnetic and magnetocaloric properties in La{sub 0.7}Ca{sub 0.3−x}Na{sub x}MnO{sub 3} exhibiting first-order and second-order magnetic phase transitions

Energy Technology Data Exchange (ETDEWEB)

Ho, T.A. [Department of Materials Science and Engineering, Korea University, Seoul 136-713 (Korea, Republic of); Dang, N.T. [Institute of Research and Development, Duy Tan University, Da Nang (Viet Nam); Phan, The-Long [Department of Physics and Oxide Research Center, Hankuk University of Foreign Studies, Yongin 449-791 (Korea, Republic of); Yang, D.S. [Physics Division, School of Science Education, Chungbuk National University, Cheongju 361-763 (Korea, Republic of); Lee, B.W. [Department of Physics and Oxide Research Center, Hankuk University of Foreign Studies, Yongin 449-791 (Korea, Republic of); Yu, S.C., E-mail: scyu@chungbuk.ac.kr [Department of Physics, Chungbuk National University, Cheongju 361-763 (Korea, Republic of)

2016-08-15

Polycrystalline orthorhombic samples La{sub 0.7}Ca{sub 0.3−x}Na{sub x}MnO{sub 3} (x = 0–0.09) were prepared by solid-state reaction. The study of magnetic properties revealed that the ferromagnetic-paramagnetic (FM-PM) transition temperature (T{sub C}) increases from 255 to about 271 K with increasing Na-doping content (x) from 0 to 0.09, respectively. Around the T{sub C}, we have found the samples showing a large magnetocaloric (MC) effect with maximum values of magnetic entropy change (|ΔS{sub max}|) of 7–8 J kg{sup −1} K{sup −1} and relative cooling power RCP = 232–236 J/kg for the samples x = 0.03–0.09 in a magnetic-field interval ΔH = 40 kOe. Detailed analyses of isothermal magnetization data M(T, H) based on Banerjee's criteria indicated a first-to-second-order magnetic-phase transformation taking place at a threshold Na-doping concentration x{sub c} ≈ 0.06. This could also be observed clearly from the feature of entropy universal curves. An assessment of the magnetic-ordering exponent N = dLn|ΔS{sub m}|/dLnH demonstrates an existence of short-range magnetic order in the samples. We believe that the changes of the magnetic properties and MC effect in La{sub 0.7}Ca{sub 0.3−x}Na{sub x}MnO{sub 3} caused by Na doping are related to the changes in the structural parameters and Mn{sup 4+}/Mn{sup 3+} ratio, which are confirmed by the geometrical and electronic analyses based on X-ray diffraction and X-ray absorption fine structure. - Highlights: • Geometrical and electronic structures of La{sub 0.7}Ca{sub 0.3−x}Na{sub x}MnO{sub 3}. • Threshold of first-to-second-order phase transformation in La{sub 0.7}Ca{sub 0.3−x}Na{sub x}MnO{sub 3}. • Large magneto-caloric effect with |ΔS{sub max}| ≈ 7–8 J kg{sup −1} K{sup −1}, and RCP = 232–236 J/kg. • Universal curve of magnetic-entropy change.

Electrochemical and morphological properties of Ti/Ru0.3Pb(0.7-x)TixO2-coated electrodes

International Nuclear Information System (INIS)

Cestarolli, D.T.; Andrade, A.R. de

2003-01-01

In this work, a ternary coating with the nominal composition Ti/Ru 0.3 Pb (0.7-x) Ti x O 2 (0≤x≤0.7) deposited on Ti has been prepared through thermal decomposition of ruthenium, titanium and lead inorganic salts dissolved in isopropanol. To find out coatings with reasonable service life for application in electrolysis devices, changes in the firing temperature, heating time and supporting electrolyte have been investigated. Surface morphology and microstructure have been investigated by scanning electron microscopy (SEM) and energy-dispersive X-ray spectroscopy (EDS). SEM data show that the mud-crack structure is progressively lost with the substitution of titanium by lead oxides. EDS results suggest that lead segregates, forming islands with a high content of Pb. Changes in crystallinity have been obtained with an increase in the lead content. Electrochemical analyses have been carried out in acid medium (HClO 4 1.0 mol dm -3 and H 2 SO 4 0.5 mol dm -3 ). Cyclic voltammetric data and quasi-steady-state polarization curves have been recorded and accelerated life tests have been performed with an anodic current of 400 mA cm -2 . High coating stability has been obtained with the electrode fired at 550 deg. C. Replacing Ti with Pb extends the service life and improves the catalytic activity for oxygen evolution reaction (OER)

Dicty_cDB: VHJ417 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VH (Link to library) VHJ417 (Link to dictyBase) - G23450 DDB0202154 Contig-U12507-1...brary) Clone ID VHJ417 (Link to dictyBase) Atlas ID - NBRP ID G23450 dictyBase ID DDB0202154 Link to Contig ...Contig-U12507-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHJ4-...LLSAVSDSSVQSLSSSI--- ---IDEIKQSVFGATAIIGQSKYIMEGQLSLLKGVVASTKKDLFIYLFKDCIICTEINSN...QSKYIMEGQLSLLKGVVASTKKDLFIYLFKDCIICTEINSN YQKDGSNNNNNNNNNNSNNSNSNSSSNNSGSNNSSNNNSPNNLTPKKQTFKSLSTSSSTP NNLSQ

CERN Technical Training 2003: Learning for the LHC! MAGNE-03 : Magnétisme pour l'Electrotechnique
Phénomènes magnétiques, matériaux et applications. - French version only

CERN Multimedia

2003-01-01

MAGNE-03 est un nouveau cours dans le cadre du programme de l'Enseignement Technique 2003, qui s'adresse aux personnes souhaitant découvrir, améliorer ou remettre à niveau leurs connaissances en magnétisme. Recommandé par l'ancienne division LHC, le cours est donné au CERN par la société CEDRAT Technologies basée à Meylan (France, 38). La participation est ouverte à l'ensemble du personnel technique et scientifique nécessitant une formation en magnétisme dans le cadre de leurs activités professionnelles, courantes ou futures. En ayant organisé des sessions au CERN, une économie d'environ 800.- CHF par participant est réalisée par rapport aux frais nécessaires pour suivre la même formation sur leur site en Isère. MAGNE-03 s'intéresse, entre autres, au développement de la compréhension des phénomènes magnétiques et le "sens physique" appliqués à des produits industriels. Programme : Notions de base en électromagnétisme. Les aspects électrique et mécanique du magnétisme. Les ...

42 CFR 417.937 - Loan and loan guarantee provisions.

Science.gov (United States)

2010-10-01

... 42 Public Health 3 2010-10-01 2010-10-01 false Loan and loan guarantee provisions. 417.937 Section... HEALTH CARE PREPAYMENT PLANS Administration of Outstanding Loans and Loan Guarantees § 417.937 Loan and loan guarantee provisions. (a) Disbursement of loan proceeds. The principal amount of any loan made or...

Les réminiscences spartiates dans les discours et la politique de Robespierre de 1789 à Thermidor

OpenAIRE

Rosso, Maxime

2010-01-01

La Grèce antique est une des sources les plus riches de la pensée politique occidentale. Les réflexions de ses philosophes et les institutions de ses cités ont servi de modèles et appuyé les constructions intellectuelles, depuis la fin de cet ancien monde jusqu’au XXe siècle, où, il est vrai, la référence antique s’estompe un peu. Deux systèmes se détachent de l’ensemble et ont retenu l’attention de par leur importance historique et de par l’obstination des auteurs à opposer leurs lois et leu...

Role of Dependence in Chance-constrained and Robust Programming

Czech Academy of Sciences Publication Activity Database

Houda, Michal

2007-01-01

Roč. 15, č. 4 (2007), s. 111-120 ISSN 0572-3043 R&D Projects: GA ČR GD402/03/H057; GA ČR GA402/07/1113 Institutional research plan: CEZ:AV0Z10750506 Keywords : stochastic programming * robust programming * weak dependence Subject RIV: AH - Economics

Rectifying Behavior of Aligned ZnO Nano rods on Mg0.3Zn0.7O Thin Film Template

International Nuclear Information System (INIS)

Salina Muhamad; Suriani Abu Bakar; Mohamad Hafiz Mamat; Rafidah Ahmad; Mohamad Rusop

2011-01-01

Rectifying behavior more than 3 orders of aligned zinc oxide (ZnO) nano rods grown on Mg 0.3 Zn 0.7 O thin film template using chemical bath deposition method was observed, giving a barrier height of 0.75 eV, and the ideality factor achieved was almost 6, which was analyzed using thermionic emission theory. Field emission scanning electron microscope (FESEM) images revealed that the grown ZnO was in hexagonal shape, uniformly distributed and in vertically aligned form. The crystallinity of the sample being studied using X-ray diffraction (XRD), where the highest peak was found at (002) phase, confirming that high crystallinity of ZnO was attained. The effect of metal/semiconductor junction between metal and aligned ZnO nano rods was discussed in further details. (author)

Role of sperm surface proteins in reproduction

Czech Academy of Sciences Publication Activity Database

Jonáková, Věra; Maňásková, Pavla; Davidová, Nina; Tichá, M.; Pěknicová, Jana

2009-01-01

Roč. 30, Supplement (2009), s. 63-64 ISSN 0196-3635. [9th International Congress of Andrology. 07.03.2009-10.03.2009, Barcelona] R&D Projects: GA MŠk(CZ) 1M06011; GA ČR(CZ) GA523/08/H064; GA ČR(CZ) GA303/06/0895 Institutional research plan: CEZ:AV0Z50520701 Keywords : boar seminal plasma proteins * spermadhesins * proteinase inhibitor * DQH * boar spermatozoa Subject RIV: CE - Biochemistry

Atlas du réchauffement climatique 1971-2010. Publié par Physio-Géo - collection Ouvrages, 2012, 122 p.En ligne sur : http://www.physio-geo.fr (onglet "Ouvrages".

Directory of Open Access Journals (Sweden)

Jean-Claude Flageollet

2012-06-01

Full Text Available Cet atlas présente le réchauffement climatique récent, de 1971 à 2010, dans les terres émergées continentales et océaniques découpées en 39 régions dont, pour certaines d'entre elles, les limites sont proches des limites des régions climatiques du globe telles que définies et tracées par exemple par KÖPPEN et GEIGER. Les températures utilisées sont les moyennes annuelles empruntées à la base de données "Gistemp" de la NASA, complétées par calcul et par station. Dans chaque région, sont représentées graphiquement l'évolution des températures annuelles, selon l'environnement des stations, rural, urbain ou intermédiaire, ainsi que la valeur du réchauffement, par périodes pluri annuelles et décennales. En outre, les stations, classées en deux catégories en comparant leurs températures de 2009 et 2010, sont localisées sur des cartes à l'échelle de chaque continent. Quatre cartes régionales du réchauffement sont produites pour les périodes 1971-2010, 1981-2010, 1991-2010 et 2001­2010. Elles permettent de distinguer les régions en réchauffement et les régions en refroidissement, ces dernières concernant principalement les deux dernières décennies.This atlas presents the recent warming, from 1971 to 2010, in the continental and oceanic earth's land surface, divided into 39 regions which, for some of them, the limits are close to the earth's climatic regions defined and delineated by KÖPPEN and GEIGER. The temperatures used are annual averages taken from the "Gistemp" data base of the NASA, supplemented by calculation and by station. In each region, graphs and diagrams represent the evolution of annual temperatures as well as pluri-annual, decadal and multi decadal periods of warming, depending on the environment of stations: rural, urban or intermediate. In addition, the stations, divided into two categories by comparing their temperatures of 2009 and 2010, are located on each continent-scale maps. Four

Neuroactive steroid treatment in the model of focal cerebra ischemia in immature brain

Czech Academy of Sciences Publication Activity Database

Valeš, Karel; Uttl, L.; Vondráková, Kateřina; Druga, Rastislav; Kletečková, Lenka; Mikoška, M.; Syslová, K.; Kačer, P.; Stuchlík, Aleš; Vyklický ml., Ladislav; Kudová, Eva; Chodounská, Hana; Tsenov, Grygoriy

2016-01-01

Roč. 19, Suppl 1 (2016), s. 22-23 ISSN 1461-1457. [CINP World Congress of Neuropsychopharmacology /30./. 03.07.2016-05.07.2016, Seoul] R&D Projects: GA ČR(CZ) GBP304/12/G069; GA ČR(CZ) GA14-20613S; GA ČR(CZ) GAP303/12/1464; GA TA ČR(CZ) TE01020028 Institutional support: RVO:61388963 ; RVO:67985823 Keywords : neuroactive steroids * focal cerebral ischemia Subject RIV: CC - Organic Chemistry; FH - Neurology (FGU-C)

Institut čistých technologií

Czech Academy of Sciences Publication Activity Database

Šňupárek, Richard

2014-01-01

Roč. 2014, č. 6 (2014), s. 28-29 ISSN 1210-9525 R&D Projects: GA MŠk ED2.1.00/03.0082 Institutional support: RVO:68145535 Keywords : clean technologies * research project * energetical materials Subject RIV: JQ - Machines ; Tools http://abicko.avcr.cz/2014/06/09/index.html

40 CFR 417.160 - Applicability; description of the manufacture of liquid detergents subcategory.

Science.gov (United States)

2010-07-01

... manufacture of liquid detergents subcategory. 417.160 Section 417.160 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Liquid Detergents Subcategory § 417.160 Applicability; description of the...

Band Structure Analysis of La0.7Sr0.3MnO3 Perovskite Manganite Using a Synchrotron

Directory of Open Access Journals (Sweden)

Hong-Sub Lee

2015-01-01

Full Text Available Oxide semiconductors and their application in next-generation devices have received a great deal of attention due to their various optical, electric, and magnetic properties. For various applications, an understanding of these properties and their mechanisms is also very important. Various characteristics of these oxides originate from the band structure. In this study, we introduce a band structure analysis technique using a soft X-ray energy source to study a La0.7Sr0.3MnO3 (LSMO oxide semiconductor. The band structure is formed by a valence band, conduction band, band gap, work function, and electron affinity. These can be determined from secondary electron cut-off, valence band spectrum, O 1s core electron, and O K-edge measurements using synchrotron radiation. A detailed analysis of the band structure of the LSMO perovskite manganite oxide semiconductor thin film was established using these techniques.

Chemical deposition of La0.7Ca0.3MnO3±δ films on ceramic substrates

Directory of Open Access Journals (Sweden)

Cássio Morilla-Santos

2011-01-01

Full Text Available In this paper, it is reported the growth of La0.7Ca0.3MnO3±δ films using a chemical solution deposition method (CSD by the spin-coating technique. Such solution was prepared through a route based on modified polymeric precursor method. Spin-coating deposition on different ceramic substrates was performed and analyzed by X-ray diffraction (XRD, scanning electron microscopy (SEM and X-ray photoelectron spectroscopy (XPS. The magnetic response of the prepared specimens was studied using a SQUID magnetometer. The obtained results indicated uniform deposition on SrTiO3 and LaAlO3 substrates with similar characteristics. Furthermore, significant differences were detected in the Mn3+/Mn4+ valence ratio and a corresponding diverse magnetic response was observed. The sample prepared on SrTiO3 and LaAlO3 presented a critical temperature around 270 K as expected.

The IQ motif drives the nuclear translocation of nuclear myosin I

Czech Academy of Sciences Publication Activity Database

Dzijak, Rastislav; Yildirim, Sukriye; Kahle, Michal; Hozák, Pavel

2008-01-01

Roč. 275, č. 1 (2008), s. 67-67 E-ISSN 1742-4658. [FEBS Congress /33rd/, IUBMB conference /11th/. 28.06.2008-03.07.2008, Athens] R&D Projects: GA MŠk LC545; GA ČR(CZ) GA204/07/1592 Grant - others:GAČR(CZ) GD204/05/H023 Program:GD Institutional research plan: CEZ:AV0Z50520514 Keywords : nuclear myosin * nuclear transport Subject RIV: EB - Genetics ; Molecular Biology

Compression robuste du signal par la transformée avec les B ...

African Journals Online (AJOL)

Par contre, elle diminue de façon considérable pour les b-splincs et les paquets dbndelcttes de Haar. Du point de vue entropie, la compression par bfsplines est bonne que celle de la TCD. Nous donnons ci-dessous un tableau récapitulatif des résultats de quelques méthodes utilisées pour deux signaux EMG. Le facteur de ...

Post-Closure Inspection and Monitoring Report for Corrective Action Unit 417: Central Nevada Test Area Surface, Hot Creek Valley, Nevada For Calendar Year 2006

International Nuclear Information System (INIS)

2007-01-01

Corrective Action Unit (CAU) 417, Central Nevada Test Area - Surface, is located in Hot Creek Valley in northern Nye County, Nevada, and consists of three areas commonly referred to as UC-1, UC-3, and UC-4. CAU 417 consists of 34 Corrective Action Sites (CASs) which were closed in 2000 (U.S. Department of Energy, National Nuclear Security Administration Nevada Operations Office, 2001). Three CASs at UC-1 were closed in place with administrative controls. At CAS 58-09-01, Central Mud Pit (CMP), a vegetated soil cover was constructed over the mud pit. At the remaining two sites, CAS 58-09-02, Mud Pit, and CAS 58-09-05, Mud Pits (3), aboveground monuments and warning signs were installed to mark the CAS boundaries. Three CASs at UC-3 were closed in place with administrative controls. Aboveground monuments and warning signs were installed to mark the site boundaries at CAS 58-09-06, Mud Pits (5), CAS 58-25-01, Spill, and CAS 58-10-01, Shaker Pad Area. Two CASs that consist of five sites at UC-4 were closed in place with administrative controls. At CAS 58-09-03, Mud Pits (5), an engineered soil cover was constructed over Mud Pit C. At the remaining three sites in CAS 58-09-03 and at CAS 58-10-05, Shaker Pad Area, aboveground monuments and warning signs were installed to mark the site boundaries. The remaining 26 CASs at CAU 417 were either clean-closed or closed by taking no further action.

40 CFR 417.80 - Applicability; description of the manufacture of liquid soaps subcategory.

Science.gov (United States)

2010-07-01

... manufacture of liquid soaps subcategory. 417.80 Section 417.80 Protection of Environment ENVIRONMENTAL... CATEGORY Manufacture of Liquid Soaps Subcategory § 417.80 Applicability; description of the manufacture of liquid soaps subcategory. The provisions of this subpart are applicable to discharges resulting from the...

Investigation of structural and electrical properties of La0.7(Ba1-xCax)0.3MnO3 compounds by sol-gel method

International Nuclear Information System (INIS)

Winarsih, Suci; Kurniawan, Budhy; Manaf, Azwar; Nanto, Dwi; Imaduddin, Agung; Hendrik; Saptari, Sitti Ahmiatri

2016-01-01

In this paper, we explored structural and electrical properties of La 0.7 (Ba 1-x Ca x ) 0.3 MnO 3 (x = 0; 0.03; and 0.05) compounds. The general structure of perovskite manganites is AMnO 3 (A= trivalent rare earth with divalent ion-doped). Average A-site cation size, external pressure, and the variance of the cation size σ 2 are one of many factors that affected to magneto-transport properties of manganites as reported by others. In this work we focus only on the electrical properties in La 0.7 Ba 0.3 MnO 3 Ca-doped compound which may influence crystal structure resulting resistivity phenomena under magnetic field influence. All samples were synthesized by sol-gel method from which fine powders were obtained. The X-ray powder diffraction pattern of powder materials shows that all samples are fully crystalline with a rhombohedral structure. Rietveld refinement shows that the presence of calcium has changed some crystal structural parameters such lattice parameter, Mn–O bond length, and Mn–O–Mn angles. The electrical resistivity of all synthesized materials investigated by four point probe method using Cryogenic Magnet in the temperature range of 50-300 K under influence a magnetic field shows resistivity temperature dependent. In fact presence of calcium has reduced the resistivity. It might occure because it has made an enhancement in the mobility of hopping electrons. The magnetic external field causes the resistivity decreased for all samples because host spin align by delocalizing the charge carries so electron itinerant through the lattice suggested by other authors. Both calcium dopant concentration and the applied external magnetic field shows strong correlation in reduction of resistivity.

Hydrogen Production by Catalytic Partial Oxidation of Coke Oven Gas in BaCo0.7Fe0.3-xZrxO3-δ Ceramic Membrane Reactors

Directory of Open Access Journals (Sweden)

Yao Weilin

2016-01-01

Full Text Available The BaCo0.7Fe0.3-xZrxO3-δ (BCFZ, x = 0.04–0.12 mixed ionic–electronic conducting (MIEC membranes were synthesized with a sol–gel method and evaluated as potential membrane reactor materials for the partial oxidation of coke oven gas (COG. The effect of zirconium content on the phase structure, microstructure and performance of the BCFZ membrane under He or COG atmosphere were systemically investigated. The BaCo0.7Fe0.24Zr0.06O3-δ membrane exhibited the best oxygen permeability and good operation stability, which could be a potential candidate of the membrane materials for hydrogen production through the partial oxidation of COG.

Aspects épidémiologiques des accidents vasculaires cérébraux (AVC) aux urgences de l'institut de cardiologie d'Abidjan (ICA)

Science.gov (United States)

N'goran, Yves N'da Kouakou; Traore, Fatou; Tano, Micesse; Kramoh, Kouadio Euloge; Kakou, Jean-Baptiste Anzouan; Konin, Christophe; Kakou, Maurice Guikahue

2015-01-01

Introduction L'objectif de notre étude était de décrire les caractéristiques sociodémographiques et les Facteurs de Risque cardio-Vasculaires (FRV) des patients admis pour accidents vasculaires cérébraux (AVC) dans un service autre que celui de la neurologie. Méthodes Étude transversale rétrospective sur une période de 2 ans (janv. 2010 et déc. 2011), réalisée aux urgences de l'institut de cardiologie d'Abidjan. Résultats Il s'agissait de 176 adultes avec un âge moyen de 60 ans, une prédominance féminine. Les facteurs de risque majeurs retrouvés étaient l'hypertension artérielle dans 86,4% des cas, le diabète dans 11,4% des cas, le tabagisme dans 2,2% des cas. Les motifs de consultation étaient la perte de connaissance dans 36,4% des cas, l'hémiplégie dans 31,8% des cas, les céphalées dans 17,4% des cas, les vertiges dans 10,9% et les palpitations dans 2,2% des cas. La tension artérielle systolique moyenne était à 174 mmHg, la tension artérielle diastolique moyenne était à 105 mmHg et la pression pulsée moyenne était à 70 mmHg. Les AVC étaient associés à une arythmie complète par fibrillation auriculaire dans 11,4% des cas. Les AVC ischémiques représentaient 84,1%. L’évolution aux urgences a été marquée par un décès dans 17% (30) des cas. Conclusion Les AVC constituent un problème majeur de santé publique. Malgré sa prédominance féminine, ils (AVC) touchaient 44% des hommes dans notre étude lorsqu'on sait qu'en Afrique l'activité sociale repose sur les hommes. Ils restent une pathologie grave par la forte létalité. PMID:26327997

Anisotropic magnetoresistance and spin polarization of La0.7Sr0.3MnO3/SrTiO3 superlattices

International Nuclear Information System (INIS)

Wang, L.M.; Guo, C.-C.

2005-01-01

The crystalline structure, anisotropic magnetoresistance (AMR), and magnetization of La 0.7 Sr 0.3 MnO 3 /SrTiO 3 (LSMO/STO) superlattices grown by a rf sputtering system are systematically analyzed to study the spin polarization of manganite at interfaces. The presence of positive low-temperature AMR in LSMO/STO superlattices implies that two bands of majority and minority character contribute to the transport properties, leading to a reduced spin polarization. Furthermore, the magnetization of superlattices follows the T 3/2 law and decays more quickly as the thickness ratio d STO /d LSMO increases, corresponding to a reduced exchange coupling. The results clearly show that the spin polarization is strongly correlated with the influence of interface-induced strain on the structure

14 CFR 417.311 - Flight safety crew roles and qualifications.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Flight safety crew roles and qualifications. 417.311 Section 417.311 Aeronautics and Space COMMERCIAL SPACE TRANSPORTATION, FEDERAL AVIATION... vehicles in flight under the influence of aerodynamic forces; and (x) The application of flight termination...

The role of silicon on the microstructure and magnetic behaviour of nanostructured (Fe{sub 0.7}Co{sub 0.3}){sub 100−x}Si{sub x} powders

Energy Technology Data Exchange (ETDEWEB)

Hocine, M. [Département de Génie Mécanique, Faculté de Technologies, Université de M' sila, B.P 166 Ichbelia, M' sila (Algeria); UR-MPE, M' hamed Bougara University, Boumerdes, 35000 Algeria (Algeria); Guittoum, A., E-mail: aguittoum@gmail.com [Nuclear Research Centre of Algiers, 02Bd Frantz Fanon, BP 399, Alger-Gare, Algiers (Algeria); Hemmous, M. [Nuclear Research Centre of Algiers, 02Bd Frantz Fanon, BP 399, Alger-Gare, Algiers (Algeria); Martínez-Blanco, D. [SCTs, University of Oviedo, EPM, Mieres, 33600 Spain (Spain); Gorria, P. [Department of Physics, EPI, University of Oviedo, Gijón, 33203 Spain (Spain); Rahal, B. [Nuclear Research Centre of Algiers, 02Bd Frantz Fanon, BP 399, Alger-Gare, Algiers (Algeria); Blanco, J.A. [Department of Physics, University of Oviedo, CalvoSotelo St., Oviedo, 330 07 Spain (Spain); Sunol, J.J. [Departament de Fisica, Universitat de Girona, Campus de Montillivi, Girona, 17071 Spain (Spain); Laggoun, A. [UR-MPE, M' hamed Bougara University, Boumerdes, 35000 Algeria (Algeria)

2017-01-15

Single-phase(Fe{sub 0.7}Co{sub 0.3}){sub 100−x}Si{sub x} nanostructured powders (x=0,5, 10, 15 and 20) have been elaborated by mechanical alloying in order to investigate the effect of silicon on the microstructure and magnetic properties of these alloys. A disordered Fe(Co, Si) solid solution with body centred cubic (bcc) crystal structure is formed after 72 h of milling for all the compositions. The addition of Si gives rise to a progressive decrease of the lattice parameter, from about 2.865 Å for the binary Fe{sub 70}Co{sub 30} compound down to 2.841 Å for the powder with x=20. The sample with the uppermost Si content exhibits the lowest value for the mean grain size (≈10 nm) as well as the largest microstrain (above 1.1%). All the samples are ferromagnetic at room temperature, although the saturation magnetization value reduces almost linearly by adding Si to the composition. A similar trend is observed for the hyperfine magnetic field obtained from the analysis of the room temperature Mössbauer spectra. The hyperfine field distributions show a broad double-peak shape for x>0, which can be ascribed to multiple local environments for the Fe atoms inside a disordered solid solution. - Highlights: • Single-phase (Fe{sub 0.7}Co{sub 0.3}){sub 100−x}Si{sub x} nanostructured powders (x=0, 5, 10, 15 and 20) have been elaborated by mechanical alloying. • The sample with the uppermost Si content exhibits the lowest value for the mean grain size. • The magnetic and hyperfine parameters of (Fe{sub 0.7}Co{sub 0.3}){sub 100−x}Si{sub x} depended intimately on Si content.

Tuning the magnetic phase transition and the magnetocaloric properties of La0.7Ca0.3MnO3 compounds through Sm-doping

Science.gov (United States)

Thanh, Tran Dang; Dung, Nguyen Thi; Van Dang, Nguyen; Bau, Le Viet; Piao, Hong-Guang; Phan, The Long; Huyen Yen, Pham Duc; Hau, Kieu Xuan; Kim, Dong-Hyun; Yu, Seong-Cho

2018-05-01

In this work, we point out that the width and the nature of the magnetic phase transition, TC value, and as well as magnetocaloric effect in La0.7-xSmxCa0.3MnO3 compounds can be easily modified through Sm-doped into La-site. With an increasing Sm concentration, a systematic decrease in the magnetization, TC, and magnetic entropy change (ΔSm) are observed. The Arrott-plot proveds that the samples with x = 0 and 0.1 undergoing a first-order phase transition. Meanwhile, sample x = 0.2 undergoes a second-order phase transition, which exhibits a high value of the relative cooling power (81.5 J/kg at ΔH = 10 kOe). An analysis of the critical behavior based on the modified Arrott plots method has been done for sample x = 0.2. The results proved a coexistence of the long- and short-range interactions in La0.5Sm0.2Ca0.3MnO3 compound.

Using the Cambridge structure database of organic and organometalic compounds in structure biology

Czech Academy of Sciences Publication Activity Database

Hašek, Jindřich

2010-01-01

Roč. 17, 1a (2010), b24-b26 ISSN 1211-5894. [Discussions in Structural Molecular Biology /8./. Nové Hrady, 18.03.2010-20.03.2010] R&D Projects: GA AV ČR IAA500500701; GA ČR GA305/07/1073 Institutional research plan: CEZ:AV0Z40500505 Keywords : organic chemistry * Cambridge Structure Data base * molecular structure Subject RIV: CD - Macromolecular Chemistry http://xray.cz/ms/bul2010-1a/friday2.pdf

In situ study of the epoxy cure process using a fibre-optic sensor

Czech Academy of Sciences Publication Activity Database

Chailleux, E.; Salvia, M.; Jaffrezic-Renault, N.; Matějec, Vlastimil; Kašík, Ivan

2001-01-01

Roč. 10, č. 2 (2001), s. 194-202 ISSN 0964-1726. [SPIE Annual International Symposium on Smart Structures and Materials /8./. Newport Beach, 04.03.2001-08.03.2001] R&D Projects: GA ČR GA102/99/0548; GA AV ČR KSK2067107 Projekt 07/01:4074 Institutional research plan: CEZ:AV0Z2067918 Keywords : fibre optic sensors * process monitoring Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 1.199, year: 2001

Scattering of Neutrons by Liquid Bromine; Diffusion des neutrons par le brome liquide; R; Dispersion de neutrones por bromo liquido

Energy Technology Data Exchange (ETDEWEB)

Coote, G E; Haywood, B C [Atomic Energy of Canada Ltd., Chalk River, Ontario (Canada)

1963-01-15

Neutrons of 0.037 eV and 0.0088 eV were scattered from a thin sample of liquid bromine at room temperature, and the energy distributions of the scattered neutrons measured at angles from 10{sup o} to 160{sup o} by the time-of-flight method. The angular distribution confirms the results of a previous study by Caglioti. Spectra were expressed in the form of the ''scattering law'' S({alpha},{beta}) of Egelstaff and analysed to derive the generalized frequency distribution p({beta}) of atomic motions in the liquid. The function p({beta}) has a broad smooth peak centred at {beta}{approx}0.3, and shows no evidence for discrete levels in the measured range 0<{beta}< 0.8: the general shape of the curve supports the 'quasi-crystalline' picture of the liquid. Difficulty in the absolute normalization of p({beta}) is discussed. (author) [French] Des neutrons de 0,037 eV et 0,0088 eV ont ete dissuses par un echantillon mince de brome liquide a la temperature ambiante; on a mesure, par la methode du temps de vol, les distributions d'energies des neutrons diffuses, pour des angles compris entre 10{sup o} et 160{sup o}. La distribution angulaire confirme les resultats d'une etude anterieure faite par Caglioti. Les spectres ont ete exprimes d'apres la ''loi de dispersion'' S({alpha},{beta}) d'Egelstaff et analyses pour determiner la distribution generalisee des frequences p({beta}) des mouvements atomiques dans le liquide. La fonction p({beta}) comporte un pic large et a faible pente dont le centre est a {beta} {approx} 0,3 et ne presente aucune indication de niveaux discrets dans la gamme mesuree 0 < {beta} < 0,8; la forme generale de la courbe confirme l'image ''quasi cristalline'' du liquide. Les auteurs examinent les difficultes qui s'opposent a la normalisation absolue de p({beta}). (author) [Spanish] Los autores han estudiado la dispersion de neutrones de 0,037 eV y 0,0088 eV en una muestra de bromo liquido de espesor reducido, a temperatura ambiente. La distribucion

MODELISATION DE LA CINETIQUE CHIMIQUE DANS LA REDUCTION DES OXYDES D4AZOTE PAR DECHARGE COURONNE.

OpenAIRE

MEDJAHDI, Sarah ines

2015-01-01

CE TRAVAIL DE recherche rentre dans le cadre général de modélisation de la réduction des oxydes d'azote . l'utilisation des réacteurs a plasma froid non-thermique généré par des décharges couronnes est actuellement l'une des techniques les puis promettre .ses pour la destruction des oxydes d'azote .en effet , le traitement des gaz pollués par les décharges couronnes est notamment rendu possible par la multiplication des décharges Électriques .

Modified magnetic anisotropy at LaCoO3/La0.7Sr0.3MnO3 interfaces

Directory of Open Access Journals (Sweden)

M. Cabero

2017-09-01

Full Text Available Controlling magnetic anisotropy is an important objective towards engineering novel magnetic device concepts in oxide electronics. In thin film manganites, magnetic anisotropy is weak and it is primarily determined by the substrate, through induced structural distortions resulting from epitaxial mismatch strain. On the other hand, in cobaltites, with a stronger spin orbit interaction, magnetic anisotropy is typically much stronger. In this paper, we show that interfacing La0.7Sr0.3MnO3 (LSMO with an ultrathin LaCoO3 (LCO layer drastically modifies the magnetic anisotropy of the manganite, making it independent of the substrate and closer to the magnetic isotropy characterizing its rhombohedral structure. Ferromagnetic resonance measurements evidence a tendency of manganite magnetic moments to point out-of-plane suggesting non collinear magnetic interactions at the interface. These results may be of interest for the design of oxide interfaces with tailored magnetic structures for new oxide devices.

Interpretation of anomalous optical conductivity in the ferromagnetic metallic state of La0.7Ca0.3MnO3 manganites

International Nuclear Information System (INIS)

Varshney, Dinesh; Kaurav, N.; Singh, R.K.

2006-01-01

Observed frequency dependent optical response of La 0.7 Ca 0.3 MnO 3 has been analysed within the two- component scheme. One is the coherent free carrier excitations and the other is incoherent motion of carriers from one site to other leading to a polaron formation. The frequency dependent relaxation rates are expressed in terms of memory functions and the coherent carriers leads to a sharp peak at zero frequency and a long tail in the infrared region. The hopping of carriers from Mn to Mn and Mn to O site yields peak values around 0.4 and 4.0 e V in the optical conductivity centred at mid-infrared region. (author)

42 CFR 417.1 - Definitions.

Science.gov (United States)

2010-10-01

...: (1) Physician services (§ 417.101(a)(1)); (2) Outpatient services and inpatient hospital services..., nurses, podiatrists, optometrists, physicians' assistants, clinical psychologists, social workers... statistical area as designated by the Office of Management and Budget and which does not contain a city whose...

On Uselessness of Limit Orders

Czech Academy of Sciences Publication Activity Database

Šmíd, Martin

2007-01-01

Roč. 2007, č. 24 (2007), s. 45-57 ISSN 1212-074X R&D Projects: GA ČR GD402/03/H057; GA ČR GA402/07/1113; GA ČR(CZ) GA402/06/1417 Institutional research plan: CEZ:AV0Z10750506 Keywords : market microstructure * limit order market * portfolio selection Subject RIV: AH - Economics

AKT (protein kinase B) is implicated in meiotic maturation of porcine oocytes

Czech Academy of Sciences Publication Activity Database

Kalous, Jaroslav; Kubelka, Michal; Šolc, Petr; Šušor, Andrej; Motlík, Jan

2009-01-01

Roč. 138, - (2009), s. 645-654 ISSN 1470-1626 R&D Projects: GA ČR GA204/06/1297; GA ČR GA523/03/0857; GA ČR GA524/07/1087 Institutional research plan: CEZ:AV0Z50450515 Keywords : protein kinase * porcine oocyte * oocyte maturation Subject RIV: CE - Biochemistry Impact factor: 2.579, year: 2009

Maladie de Horton révélée par une dyspnée

Science.gov (United States)

Mahfoudhi, Madiha; Mamlouk, Habiba; Turki, Sami; Kheder, Adel

2015-01-01

Les manifestations pleuro-pulmonaires de la maladie de Horton sont rares et peu connues. Elles peuvent être inaugurales, à l'origine d'un retard à la prise en charge si elles sont méconnues. Il s'agissait d'un patient âgé de 75 ans, admis pour une dyspnée, une toux chronique et une fièvre. Il a reçu une antibiothérapie et a bénéficié d'une fibroscopie bronchique avec lavage broncho-alvéolaire à la recherche d'un germe, qui a révélé plutôt, une alvéolite lymphocytaire. L’évolution était marquée par la persistance des signes cliniques et du syndrome inflammatoire biologique. Un angio-scanner thoracique et une échographie cardiaque étaient sans anomalies. Une origine cardiaque, musculaire, hématologique, néoplasique, vasculaire ou métabolique de la dyspnée a été éliminée. Une maladie de Horton a été évoquée. La biopsie de l'artère temporale a confirmé le diagnostic d'une maladie de Horton. L’évolution sous corticothérapie était marquée par la disparition des signes cliniques et biologiques. Les manifestations pleuro-pulmonaires au cours de la maladie de Horton sont rares, et classiquement, rarement révélatrices de la maladie. La dyspnée peut initialement égarer le diagnostic vers d'autres étiologies notamment infectieuses. Le but de ce travail est d'insister sur le fait que la connaissance de ces différentes manifestations respiratoires au cours de la maladie de Horton (toux persistante, dyspnée, épanchement pleural) est utile au clinicien afin de prescrire une corticothérapie, chez un sujet le plus souvent âgé ayant un état fébrile et inflammatoire prolongé, permettant ainsi d’éviter l'apparition de complications. PMID:26161171

Forage pétrolier assisté par jet Jet-Assisted Oil Drilling

Directory of Open Access Journals (Sweden)

Bardin C.

2006-11-01

Full Text Available La destruction des roches par jet est une technique qui présente un réel intérêt dans le domaine du forage pétrolier comme en témoignent les études déjà réalisées sur le sujet depuis une vingtaine d'années. Des essais sur chantier ont fait apparaître des améliorations substantielles en vitesse d'avancement grâce aux outils combinés mécaniques et jets haute pression. Cet article explique, après une courte bibliographie sur le sujet, les motivations d'une nouvelle étude menée par l'institut Français du Pétrole (IFP au sein de l'Association de Recherche sur les Techniques d'Exploitation du Pétrole (ARTEP. L'objectif de cette étude est d'utiliser le pouvoir destructeur de la cavitation dans le cas des forages profonds en utilisant les capacités de pompage actuellement disponibles sur chantier. Cet objectif nécessite le développement d'une technique capable de créer une cavitation érosive à sigma = 2. 5 ; sigma étant défini par le rapport de la pression à l'aval du dispositif cavitant sur la chute de pression dans ce même dispositif. L'érosion de cavitation étant très dépendante des conditions de pression et de température, il a été nécessaire de concevoir des moyens d'essai permettant de simuler les conditions de fond de forage dans le cas de forage par grande profondeur. Le banc d'essai (70 MPa, 120 °C est présenté dans ce papier, ainsi que quelques essais relatifs à la destruction des roches par jet. The destruction of rocks by jetting is an important technique in the field of cil drilling, as shown by research done on this subject for some 20 years now. Fields tests have revealed substantial improvements in rates of penetration with the use of combined mechanical and high-pressure jet bits. After a brief bibliography on the subject, this paper explains the motives for a new research project being car-ried out by Institut Français du Pétrole (IFP within the ARTEP association (Association de Recherche

Mitochondrial DNA in the hybrid zone between Mus musculus musculus and Mus musculus domesticus: a comparison of two transects

Czech Academy of Sciences Publication Activity Database

Božíková, Eva; Munclinger, P.; Teeter, K. C.; Tucker, P. K.; Macholán, Miloš; Piálek, Jaroslav

2005-01-01

Roč. 84, č. 3 (2005), s. 363-378 ISSN 0024-4066. [The genus Mus as a model for evolutionary studies - a symposium in honour of Louis Thaler. Brno, 28.07.2003-30.07.2003] R&D Projects: GA ČR GA206/03/0205; GA ČR GA206/01/0989 Institutional research plan: CEZ:AV0Z6093917 Keywords : allozyme * gene flow * house mouse Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.261, year: 2005

Grandeurs caractéristiques de la machine synchrone obtenues analytiquement à partir d'une réduction de modèle par une technique des multiéchelles de temps

OpenAIRE

Guesbaoui , H.

1995-01-01

Il est bien connu qu'il n'est pas possible d'avoir une écriture simple des courants et des tensions pour une machine synchrone modélisée par plus d'un amortisseur par axe d et q de Park. De plus, seules des méthodes numériques permettent un calcul approché de ses grandeurs caractéristiques. Dans cet article nous proposons de déterminer les constantes de temps sous une forme analytique à partir de l'écriture de sous-systèmes réduits du premier ordre décrivant les régimes subtransitoire, transi...

Impedance spectroscopic and dielectric analysis of Ba{sub 0.7}Sr{sub 0.3}TiO{sub 3} thin films

Energy Technology Data Exchange (ETDEWEB)

Rouahi, A. [Grenoble Electrical Engineering Laboratory (G2E Lab), CNRS, University of Grenoble (UJF), 25 Rue des Martyrs, BP 166, 38042 Grenoble Cedex 9 (France); Laboratory of Materials, Organization and Properties (LMOP), Campus Universities, El Manar, 2092 Tunis (Tunisia); Kahouli, A., E-mail: kahouli.kader@yahoo.fr [Grenoble Electrical Engineering Laboratory (G2E Lab), CNRS, University of Grenoble (UJF), 25 Rue des Martyrs, BP 166, 38042 Grenoble Cedex 9 (France); Laboratory of Materials, Organization and Properties (LMOP), Campus Universities, El Manar, 2092 Tunis (Tunisia); Sylvestre, A., E-mail: alain.sylvestre@grenoble.cnrs.fr [Grenoble Electrical Engineering Laboratory (G2E Lab), CNRS, University of Grenoble (UJF), 25 Rue des Martyrs, BP 166, 38042 Grenoble Cedex 9 (France); Defaye, E. [CEA-LETI, MINATEC Campus, 17 rue des Martyrs, 38054 Grenoble Cedex 9 (France); Yangui, B. [Laboratory of Materials, Organization and Properties (LMOP), Campus Universities, El Manar, 2092 Tunis (Tunisia)

2012-07-15

Highlights: Black-Right-Pointing-Pointer The material exhibits the contribution of both grain and grain boundaries in the electric response of Ba{sub 0.7}Sr{sub 0.3}TiO{sub 3}. Black-Right-Pointing-Pointer The plot of normalized complex dielectric modulus and impedance as a function of frequency exhibits both short and long-range conduction in the film. Black-Right-Pointing-Pointer The frequency dependence of ac conductivity exhibits a polaron hopping mechanism with activation energy of 0.38 eV. Black-Right-Pointing-Pointer The complex dielectric modulus analysis confirmed the presence of a non-Debye type of conductivity relaxation deduced from the KWW function. - Abstract: Polycrystalline Ba{sub 0.7}Sr{sub 0.3}TiO{sub 3} thin film with Pt/BST/Pt/TiO{sub 2}/SiO{sub 2} structure was prepared by ion beam sputtering. The film was post annealed at 700 Degree-Sign C. The dielectric and electric modulus properties were studied by impedance spectroscopy over a wide frequency range [0.1-10{sup 5} Hz] at different temperatures [175-350 Degree-Sign C]. The Nyquist plots (Z Double-Prime vs . Z Prime ) show the contribution of both grain and grain boundaries at higher temperature on the electric response of BST thin films. Moreover, the resistance of grains decreases with the rise in temperature and the material exhibits a negative temperature coefficient of resistance. The electric modulus plot indicates the non-Debye type of dielectric relaxation. The values of the activation energy computed from both plots of Z Double-Prime and M Double-Prime are 0.86 eV and 0.81 eV respectively, which reveals that the species responsible for conduction are the same. The scaling behavior of M{sup Double-Prime }/M{sup Double-Prime }{sub max} shows the temperature independent nature of relaxation time. The plot of normalized complex dielectric modulus and impedance as a function of frequency exhibits both short and long-range conduction in the film.

Výběr relevantních informací pro podporu rozhodování v medicíně

Czech Academy of Sciences Publication Activity Database

Kalina, Jan; Zvárová, Jana

6. dubna (2016) ISSN 1803-179X. [Telemedicína 2016 /12./. 14.03.2016-14.03.2016, Brno] Institutional support: RVO:67985807 Keywords : telemedicína * elektronická dokumentace * informační systémy ve zdravotnictví Subject RIV: IN - Informatics, Computer Science http://www.akutne.cz/res/publikace/07-kalinabrno2016.pdf

La preuve par le nombre

Directory of Open Access Journals (Sweden)

Hélène Verdier

2012-04-01

Full Text Available S’il en était besoin, la question des usages et de la finalité des résultats de l’inventaire général pourrait être abordée par le nombre : nombre d’œuvres répertoriées, de communes inventoriées, de clichés photographiques réalisés, de dossiers, de consultations des notices dans les bases de données… Les additions aujourd’hui sont éloquentes, mais elles laissent dans l’ombre le rôle de l’inventaire qui, en mettant en œuvre une démarche systématique de connaissance, participe à l’ identificatio...

9 CFR 417.5 - Records.

Science.gov (United States)

2010-01-01

... and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE REGULATORY REQUIREMENTS UNDER THE FEDERAL MEAT INSPECTION ACT AND THE POULTRY PRODUCTS INSPECTION ACT HAZARD ANALYSIS AND... records documenting the establishment's HACCP plan: (1) The written hazard analysis prescribed in § 417.2...

Nondestructive indication of fatigue damage and residual lifetime in ferromagnetic construction materials

Czech Academy of Sciences Publication Activity Database

Tomáš, Ivan; Kovářík, O.; Vértesy, G.; Kadlecová, Jana

2014-01-01

Roč. 25, č. 6 (2014), "065601-1"-"065601-10" ISSN 0957-0233. [International Symposium on Measurement Technology and Intelligent Instruments /11./ (ISMTII). Aachen, 01.07.2013-03.07.2013] R&D Projects: GA ČR(CZ) GAP108/12/1872 Institutional support: RVO:68378271 Keywords : fatigue * residual lifetime * magnetic nondestructive evaluation * ferromagnetic construction materials Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.433, year: 2014

40 CFR 417.150 - Applicability; description of the manufacture of spray dried detergents subcategory.

Science.gov (United States)

2010-07-01

... detergents, including but not limited to assembly and storage of raw materials, crutching, spray drying... manufacture of spray dried detergents subcategory. 417.150 Section 417.150 Protection of Environment... POINT SOURCE CATEGORY Manufacture of Spray Dried Detergents Subcategory § 417.150 Applicability...

A Structural Study of the Pseudo-Binary Mercury Chalcogenide Alloy HgSe_{0.7}S_{0.3} at High Pressure

CERN Document Server

Kozlenko, D P; Ehm, L; Knorr, K; Hull, S; Shchennikov, V V; Voronin, V I

2002-01-01

The structure of the pseudo-binary mercury chalcogenide alloy HgSe_{0.7}S_{0.3} has been studied by means of X-ray and neutron powder diffraction at pressure up to 8.5 GPa. A phase transition from the cubic zinc blende structure to the hexagonal cinnabar structure was observed at P{\\sim}1 GPa. The obtained structural parameters were used for the analysis of the geometrical relationship between the zinc blende and the cinnabar phases. The zinc blende-cinnabar phase transition is discussed in the framework of Landau theory of the phase transitions. It was found that the possible order parameter for the structural transformation is the spontaneous strain e_{4}. This assignment agrees with previously observed high pressure behaviour of the elastic constants of other mercury chalcogenides.

A structural study of the pseudo-binary mercury chalcogenide alloy HgSe0.7S0.3 at high pressure

International Nuclear Information System (INIS)

Kozlenko, D.P.; Savenko, B.N.; Ehm, L.; Knorr, K.; Hull, S.; Shchennikov, V.V.; Voronin, V.I.

2002-01-01

The structure of the pseudo-binary mercury chalcogenide alloy HgSe 0.7 S 0.3 has been studied by means of X-ray and neutron powder diffraction at pressure up to 8.5 GPa. A phase transition from the cubic zinc blende structure to the hexagonal cinnabar structure was observed at P∼1 GPa. The obtained structural parameters were used for the analysis of the geometrical relationship between the zinc blende and the cinnabar phases. The zinc blende-cinnabar phase transition is discussed in the framework of the Landau theory of phase transitions. It was found that the possible order parameter for the structural transformation is the spontaneous strain e 4 . This assignment agrees with previously observed high pressure behaviour of the elastic constants of other mercury chalcogenides

Mechanisms Responsible for the Large Piezoelectricity at the Tetragonal-Orthorhombic Phase Boundary of (1-x)BaZr0.2Ti0.8O3-xBa0.7Ca0.3TiO3 System.

Science.gov (United States)

Yang, Tao; Ke, Xiaoqin; Wang, Yunzhi

2016-09-16

Recently it was found that in the lead-free (1-x)BaZr0.2Ti0.8O3-xBa0.7Ca0.3TiO3 (BZT-xBCT) system, the highest piezoelectric d33 coefficient appears at the tetragonal (T) - orthorhombic (O) phase boundary rather than the O - rhombohedral (R) phase boundary, but the physical origin of it is still unclear. In this work we construct the phase diagram of the BZT-xBCT system using a generic sixth-order Landau free energy polynomial and calculate the energy barrier (EB) for direct domain switching between two variants of the stable low-symmetry ferroelectric phase. We find that the EB at the T-O phase boundary is lower than that at the O-R phase boundary and EB may serve as a rigorous quantitative measure of the degree of polarization anisotropy through Landau potential. The calculations may shed some light on the physical origin of the highest piezoelectric coefficients as well as the softest elastic compliance at the T-O phase boundary observed in experiments.

Determinations of its Absolute Dimensions and Distance by the Analyses of Light and Radial-Velocity Curves of the Contact Binary -I. V417 Aquilae

Directory of Open Access Journals (Sweden)

Jae Woo Lee

2004-06-01

Full Text Available New photometric and spectroscopic solutions of W-type overcontact binary V417 Aql were obtained by solving the UBV light curves of Samec et al. (1997 and radial-velocity ones of Lu & Rucinski (1999 with the 2003 version of the Wilson-Devinney binary code. In the light curve synthesis the light of a third-body, which Qian (2003 proposed, was considered and obtained about 2.7%, 2.2%, and 0.4% for U, B, and V bandpasses, respectively. The model with third-light is better fitted to eclipse parts than that with no third-light. Absolute dimensions of V417 Aql are determined from our solution as M1=0.53 M⊙, M2=1.45 M⊙, R1=0.84 R⊙ and R2=1.31 M⊙, and the distance to it is deduced as about 216pc. Our distance is well consistent with that (204pc derived from Rucinski & Duerbeck's (1997 relation, MV=MV(log P, B-V, but is more distant than that (131±40pc determined by the Hipparcos trigonometric parallax. The difference may result from the relatively large error of Hipparcos parallax for V417 Aql.

Magnetic properties of rare-earth-doped La.sub.0.7./sub.Sr.sub.0.3./sub.MnO.sub.3./sub.

Czech Academy of Sciences Publication Activity Database

Veverka, Pavel; Kaman, Ondřej; Knížek, Karel; Novák, Pavel; Maryško, Miroslav; Jirák, Zdeněk

2017-01-01

Roč. 29, č. 3 (2017), 1-9, č. článku 035803. ISSN 0953-8984 R&D Projects: GA ČR GA15-10088S Institutional support: RVO:68378271 Keywords : crystal field splitting * Tb 3+ electronic levels * ab initio calculations * perovskite manganite * bulk versus nanoparticles Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics , supercond.) Impact factor: 2.649, year: 2016

Radial growth and ring formation process in clonal plant Eriophorum angustifolium on postmined peatland in the Šumava Mts., Czech Republic

Czech Academy of Sciences Publication Activity Database

Lanta, Vojtěch; Janeček, Štěpán; Doležal, Jiří

2008-01-01

Roč. 45, č. 1 (2008), s. 44-54 ISSN 0003-3847 R&D Projects: GA ČR GD206/03/H034; GA ČR GA526/07/0808 Institutional research plan: CEZ:AV0Z60050516 Keywords : Clonal plant * Eriophorum angustifolium * Experiments Subject RIV: EF - Botanics Impact factor: 0.361, year: 2008

Carrier doping into a superconducting BaPb0.7Bi0.3O3‑δ epitaxial film using an electric double-layer transistor structure

Science.gov (United States)

Komori, S.; Kakeya, I.

2018-06-01

Doping evolution of the unconventional superconducting properties in BaBiO3-based compounds has yet to be clarified in detail due to the significant change of the oxygen concentration accompanied by the chemical substitution. We suggest that the carrier concentration of an unconventional superconductor, BaPb0.7Bi0.3O3‑δ , is controllable without inducing chemical or structural changes using an electric double-layer transistor structure. The critical temperature is found to decrease systematically with increasing carrier concentration.

Un « gouvernement des journalistes par le Pouvoir politique » par défaut ?

Directory of Open Access Journals (Sweden)

Matthieu Lardeau

2013-12-01

Full Text Available Cet article présente les interactions de deux mouvements concomitants apparusprincipalement dans les décennies 1950 à 1970 dans le champ de la presse française : d’un côté les initiatives – consécutives à la démarche pionnière, en 1951, de création de la première Société des journalistes (SDJ au sein du Monde – menées par les journalistes de rédactions de quotidiens pour créer des SDJ dont la destination peut aller jusqu’à gouverner les journaux; de l’autre côté, les « réponses » apportées par les Pouvoirs politique et public pour contenir ces initiatives visant à étendre le pouvoir des journalistes dans la gestion et la gouvernance de leurs journaux. Cette étude exploratoire repose principalement sur l’analyse de deux types de littérature, souvent déconsidérés ou négligés par le champ académique, en dépit de leur grande richesse : (1 la littérature professionnelle, ayant pour principaux auteurs les journalistes et managers de presse (Périer Daville, Boegner, Pigasse, etc., florissante depuis 1944 et singulièrement durant les décennies 1960 et 1970 ; (2 la littérature grise constituée notamment par des rapports publics rédigés par des institutions comme les services du Premier ministre (commissions Lindon de 1970 et Serisé de 1972, le Conseil économique et social, etc. Nos principaux résultats montrent que les propositions ou actions menées par les journalistes (1 restent le plus souvent inexploitées in concreto par les journalistes eux-mêmes; (2 entrent le plus souvent en opposition avec les politiques de nouveaux actionnaires ou directions de journaux et avec les projets des autorités politiques et publiques qui cherchent à encadrer l’autonomie de la profession journalistique pour mieux gouverner celle-ci ; (3 combien in fine les représentants des différents acteurs impliqués s’accordent pour contenir l’émergence d’un « gouvernement des journalistes » par les

Une pénurie d’eau gérée par l’inégalité : le cas de la ville de Djibouti

OpenAIRE

Rayaleh, Hassan-Omar

2009-01-01

La ville de Djibouti est confrontée depuis sa création à un déficit structurel de production d’eau par rapport aux besoins de sa population. Face à cette situation, l’Office National des Eaux de Djibouti a mis en place une stratégie de gestion de la pénurie qui se traduit par un certain nombre d’inégalités. Inégalité d’alimentation entre les espaces centraux de la ville, considérés comme prioritaires, et les périphéries urbaines qui reçoivent moins d’eau. Inégalité d’accès à l’eau entre les u...

Long-term Regularities in Distribution of Global Solar and Interplanetary Magnetic Fields

Czech Academy of Sciences Publication Activity Database

Ambrož, Pavel

2013-01-01

Roč. 37, č. 2 (2013), s. 637-642 ISSN 1845-8319. [Hvar Astrophysical Colloquium /12./. Hvar, 03.09.2012-07.09.2012] R&D Projects: GA AV ČR IAA300030808 Institutional support: RVO:67985815 Keywords : interplanetary magnetic field * solar wind Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

Programmation réactive en OCaml

OpenAIRE

Deleuze , Christophe

2009-01-01

15 pages; International audience; La programmation réactive permet d'écrire des programmes sous forme d'un ensemble de processus qui s'exécutent de manière synchronisée et communiquent par diffusion de signaux. Ce paradigme peut être fourni par des langages spécialisés (parfois basés sur des langages “classiques”) ou par des bibliothèques. Le langage ReactiveML est un tel langage réactif basé sur OCaml. Nous décrivons ici une bibliothèque OCaml fournissant les construc- tions réactives de Rea...

Exchange-bias-like effect in Pr{sub 0.75}Tb{sub 0.25}Al{sub 2} and Pr{sub 0.7}Tb{sub 0.3}Al{sub 2} samples

Energy Technology Data Exchange (ETDEWEB)

Tedesco, J.C.G., E-mail: tedesco.jcg@gmail.com [Instituto de Física “Gleb Wataghin”, Universidade Estadual de Campinas—UNICAMP, 13083-859 Campinas, SP (Brazil); Pires, M.J.M. [Instituto de Ciência e Tecnologia—ICT, Universidade Federal dos Vales do Jequitinhonha e Mucuri—UFVJM, 39100-000 Diamantina, MG (Brazil); Carvalho, A. Magnus G. [Divisão de Metrologia de Materiais (DIMAT), INMETRO, 25250-020 Duque de Caxias, RJ (Brazil); Sousa, V.S.R. de [Instituto de Física “Armando Dias Tavares”, Universidade do Estado do Rio de Janeiro—UERJ, 20550-013 Rio de Janeiro, RJ (Brazil); Cardoso, L.P.; Coelho, A.A. [Instituto de Física “Gleb Wataghin”, Universidade Estadual de Campinas—UNICAMP, 13083-859 Campinas, SP (Brazil)

2013-08-15

The magnetic behavior of pseudobinary Pr{sub 0.7}Tb{sub 0.3}Al{sub 2} and Pr{sub 0.75}Tb{sub 0.25}Al{sub 2} compounds was studied, and a predominant ferrimagnetic ordering was observed. Noteworthy characteristics such as negative magnetization, compensation points and exchange-bias-like (EB-like) effect were found. This EB-like effect was observed at temperatures below the compensation points. The effect is somewhat different from the one already studied in similar systems combining light and heavy rare earths. The results indicate that the EB-like effect characteristics are related to the conduction electron magnetic polarization and an induced unidirectional anisotropy present in these compounds. - Highlights: ► Ferrimagnetic behavior is observed in Pr{sub 0.7}Tb{sub 0.3}Al{sub 2} and Pr{sub 0.75}Tb{sub 0.25}Al{sub 2} materials. ► Magnetic data indicate a strong unidirectional anisotropy in studied materials. ► Studied materials present the exchange-bias-like effect. ► Exchange-bias-like effect explained in analogy with the known mechanism of thin films.

40 CFR 180.1111 - Bacillus subtilis GB03; exemption from the requirement of a tolerance.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Bacillus subtilis GB03; exemption from... FOOD Exemptions From Tolerances § 180.1111 Bacillus subtilis GB03; exemption from the requirement of a tolerance. The biofungicide Bacillus subtilis GB03 is exempted from the requirement of a tolerance in or on...

Protein-Nanocrystal Conjugates Support a Single Filament Polymerization Model in R1 Plasmid Segregation

Energy Technology Data Exchange (ETDEWEB)

Choi, Charina L.; Claridge, Shelley A.; Garner, Ethan C.; Alivisatos, A. Paul; Mullins, R. Dyche

2008-07-15

To ensure inheritance by daughter cells, many low-copy number bacterial plasmids, including the R1 drug-resistance plasmid, encode their own DNA segregation systems. The par operon of plasmid R1 directs construction of a simple spindle structure that converts free energy of polymerization of an actin-like protein, ParM, into work required to move sister plasmids to opposite poles of rod-shaped cells. The structures of individual components have been solved, but little is known about the ultrastructure of the R1 spindle. To determine the number of ParM filaments in a minimal R1 spindle, we used DNA-gold nanocrystal conjugates as mimics of the R1 plasmid. Wefound that each end of a single polar ParM filament binds to a single ParR/parC-gold complex, consistent with the idea that ParM filaments bind in the hollow core of the ParR/parC ring complex. Our results further suggest that multifilament spindles observed in vivo are associated with clusters of plasmidssegregating as a unit.

Morphological Features of Diamond Crystals Dissolved in Fe0.7S0.3 Melt at 4 GPa and 1400°C

Science.gov (United States)

Sonin, V. M.; Zhimulev, E. I.; Pomazanskiy, B. S.; Zemnuhov, A. L.; Chepurov, A. A.; Afanasiev, V. P.; Chepurov, A. I.

2018-01-01

An experimental study of the dissolution of natural and synthetic diamonds in a sulfur-bearing iron melt (Fe0.7S0.3) with high P-T parameters (4 GPa, 1400°C) was performed. The results demonstrated that under these conditions, octahedral crystals with flat faces and rounded tetrahexahedral diamond crystals are transformed into rounded octahedroids, which have morphological characteristics similar to those of natural diamonds from kimberlite. It was suggested that, taking into account the complex history of individual natural diamond crystals, including the dissolution stages, sulfur-bearing metal melts up to sulfide melts were not only diamond-forming media during the early evolution of the Earth, but also natural solvents of diamond in the mantle environment before the formation of kimberlitic melts.

Methyltransferase Erm(37) Slips on rRNA to Confer Atypical Resistance in Mycobacterium tuberculosis

Czech Academy of Sciences Publication Activity Database

Madsen, Ch. T.; Jakobsen, L.; Buriánková, Karolína; Doucet-Populaire, F.; Perdonet, J. L.; Douthwaite, S.

2005-01-01

Roč. 280, č. 47 (2005), s. 38942-38947 ISSN 0021-9258 R&D Projects: GA ČR GA310/03/0292 Institutional research plan: CEZ:AV0Z50200510 Keywords : methyltransferase erm * mycobacterium tuberculosis * rRNA Subject RIV: EE - Microbiology, Virology Impact factor: 5.854, year: 2005

42 CFR 417.155 - How the HMO option must be included in the health benefits plan.

Science.gov (United States)

2010-10-01

... printed materials that meet the requirements of § 417.124(b). (ii) Access may not be more restrictive or... benefits plan. 417.155 Section 417.155 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT... Organizations in Employee Health Benefits Plans § 417.155 How the HMO option must be included in the health...

Structural, magnetic, magnetocaloric effect and critical behavior of La{sub 0.7}Sr{sub 0.3−x}□{sub x}MnO{sub 3}(0 ≤ x ≤ 0.05)

Energy Technology Data Exchange (ETDEWEB)

Makni-Chakroun, J., E-mail: makni.jihed@yahoo.fr [LT2S Lab, Digital Research Centre of Sfax, Sfax Technopark, BP 275, 3021 Sakiet-Ezzit (Tunisia); Sfifir, I.; Cheikhrouhou-Koubaa, W.; Koubaa, M. [LT2S Lab, Digital Research Centre of Sfax, Sfax Technopark, BP 275, 3021 Sakiet-Ezzit (Tunisia); Cheikhrouhou, A. [Material Physics Laboratory, Faculty of Sciences of Sfax, B.P. 1171, Sfax University, 3000 Sfax (Tunisia)

2017-06-15

Highlights: • The samples crystallize in the rhombohedral structure with R-3C space group. • Curie temperature T{sub C} decreases with lacuna. • (1/χ) versus temperature indicates Griffiths phase occurrence. • Result show that the paramagnetic-ferromagnetic transition is of second order. • Widom scaling relation confirms the critical exponent value. - Abstract: In this paper, we present the effect of Strontium vacancies on the structure and magnetic properties of La{sub 0.7}Sr{sub 0.3−x}□{sub x}MnO{sub 3} nano-sized compounds (x = 0; 0.01; 0.03 and 0.05), synthesized using the sol-gel method. X-ray diffraction revealed that these manganites crystallized in the rhombohedral structure with space group R3-C. From magnetization measurements as function of temperature and magnetic applied field, we have noticed a large magnetic entropy change (∆S{sub M}) around Curie temperature. ∆S{sub M} is found to decrease with the deficiency content (2.30 J/kg·K for x = 0–1.33 J/kg·K for x = 0.05 under magnetic field change µ{sub 0}∆H = 5 T). This behavior is accompanied by a slight reduction of the Curie temperature (T{sub C} = 338 and 328 K for x = 0 and 0.05, respectively). These results show that our materials are potential candidates for magnetic refrigerants working in above room temperature. The refined values of the critical exponents β, γ and δ obtained from the modified Arrott plots and Kouvel-Fisher method indicated that the behavior of the parent sample and the samples with 1and 3% of strontium-deficient are characterized by long-range mean-field behavior (with β = 0.50; γ = 1). However, for 5% lacuna, the magnetic behavior is close to the theoretical 3D-Heisemberg prediction with short-range exchange coupling.

Profils des enfants infectes par le vih en debut du traitement ...

African Journals Online (AJOL)

But : Décrire les profils des enfants infectés par le VIH au début du traitement antirétroviral. Matériels et méthode: Les dossiers des enfants infectés par le VIH dans la région maritime ont été analysés de mai 2008 à février 2010 par le comité thérapeutique. Résultats: Parmi les 96 dossiers analysés, 66,67% venaient du ...

Integrodifferentialgleichungen in der Analyse innerer Dynamik von Planetengetrieben

Czech Academy of Sciences Publication Activity Database

Hortel, Milan; Škuderová, Alena

2010-01-01

Roč. 10, č. 1 (2010), s. 249-250 ISSN 1617-7061. [Annual Meeting of the International Association of Applied Mathematics and Mechanics (GAMM) /81./. Karlsruhe, 22.03.2010-26.03.2010] R&D Projects: GA ČR(CZ) GA101/07/0884 Institutional research plan: CEZ:AV0Z20760514 Keywords : integrodifferential equations * nonlinear dynamics * parametric vibration Subject RIV: BI - Acoustics http://onlinelibrary.wiley.com/journal/10.1002/(ISSN)1617-7061

2018-03-29T07:44:07Z https://www.ajol.info/index.php/all/oai oai:ojs ...

African Journals Online (AJOL)

There was significant difference (p = 0.00 and p = 0.03) in EC and TSS that ranged from 52 to 330 μScm-1 and 0.89 to 2.93 mgL-1 respectively. Spring water had higher EC and TSS than the boreholes. Faecal coliforms ranged from 14 to 50 CFU/100 ml and was significantly higher (p = 0.006) for the spring water than ...

Synthetic study on cystinyl peptides using solution and solid phase metodology: human IgG1 hinge region

Czech Academy of Sciences Publication Activity Database

Niederhafner, Petr; Gut, Vladimír; Ježek, Jan; Buděšínský, Miloš; Kašička, Václav; Wünsch, Erich; Hlaváček, Jan

2010-01-01

Roč. 39, č. 3 (2010), s. 641-650 ISSN 0939-4451 R&D Projects: GA ČR GA203/03/1362; GA ČR GA203/07/1517 Institutional research plan: CEZ:AV0Z40550506 Keywords : hinge region * immunoglobulin * prion protein * solution synthesis * solid phase synthesis Subject RIV: CC - Organic Chemistry Impact factor: 4.106, year: 2010

On a Flat-shape Emission in the Solar Flare on 7th June 2012

Czech Academy of Sciences Publication Activity Database

Kotrč, Pavel; Kupryakov, Yu. A.; Kashapova, L. K.; Bárta, Miroslav

2013-01-01

Roč. 37, č. 2 (2013), s. 555-562 ISSN 1845-8319. [Hvar Astrophysical Colloquium /12./. Hvar, 03.09.2012-07.09.2012] R&D Projects: GA ČR GAP209/12/1652; GA ČR GA13-24782S Institutional support: RVO:67985815 Keywords : solar flare * energy relase * energy transport Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

Microcrédits et performances financière et sociale des institutions de microfinance au Cameroun

Directory of Open Access Journals (Sweden)

Serge Messomo Ellé

2017-09-01

Full Text Available L’objectif de ce travail a été de déterminer les types de microcrédits qui expliquent les performances financière et sociale des institutions de microfinance au Cameroun (IMFs. Parmi les IMFs, 159 ont été analysées par le biais des statistiques descriptives et des équations de régression linéaire multiple. Les résultats obtenus montrent que les types d’activités financées expliquent faiblement les performances financière et sociale des IMFs au Cameroun. Par contre, les types de microcrédits accordés ont une forte emprise sur la viabilité financière et sociale de ces IMFs. Les implications managériales de ces résultats suggèrent aux IMFs d’accroître leurs performances financière et sociale au plan des types d’activités financées.

Real-time X-ray microradiographic imaging and image correlation for local strain mapping in single trabecula under mechanical load

Czech Academy of Sciences Publication Activity Database

Doktor, Tomáš; Jiroušek, Ondřej; Kytýř, Daniel; Zlámal, Petr; Jandejsek, Ivan

2011-01-01

Roč. 6, č. 11 (2011), s. 7-12 ISSN 1748-0221. [International workshop on radiation imaging detectors /13./. Zurich, 03.07.2011-07.07.2011] R&D Projects: GA ČR(CZ) GAP105/10/2305 Institutional research plan: CEZ:AV0Z20710524 Keywords : pixelated detectors and associated VLSI electronics * X-ray radiography and digital radiography * digital image correlation * human trabecula Subject RIV: JJ - Other Materials Impact factor: 1.869, year: 2011 http://dx.doi.org/10.1088/1748-0221/6/11/C11007

Parasitisme de Dacryodes edulis par le genre Tapinanthus ...

African Journals Online (AJOL)

SARAH

31 août 2013 ... Parasitisme de Dacryodes edulis par le genre. Tapinanthus (Loranthaceae) et répartition de la myrmécofaune associée à Logbessou Plateau. (Douala, Cameroun). Massako F1*, Tchatat M2, Mony R3, Ladoh Yemeda CF1, Dibong SD1,4,5. 1Laboratoire de Biologie et Physiologie des Organismes ...

Influence of friction on stress and strain distributions in small punch creep test models

Czech Academy of Sciences Publication Activity Database

Dymáček, Petr; Seitl, Stanislav; Milička, Karel; Dobeš, Ferdinand

417-418, - (2010), s. 561-564 ISSN 1013-9826. [International Conference on Fracture and Damage Mechanics /8./. Malta, 08.09.2009-10.09.2009] R&D Projects: GA AV ČR(CZ) IAA200410801; GA AV ČR(CZ) 1QS200410502 Institutional research plan: CEZ:AV0Z20410507 Keywords : small punch test * creep * chromium steel * finite element method Subject RIV: JG - Metallurgy www.scientific.net/KEM.417-418.561

Local and average structures of 0.7Pb(Mg1/3Nb2/3)O3 - 0.3PbZrO3

International Nuclear Information System (INIS)

Krishna, P.S.R.; Shinde, A.B.; Narasimhan, S.L.; Tiwari, V.S.; Singh, G.

2005-01-01

The local and average structure of 0.7Pb(Mg 1/3 Nb 2/3 )O 3 - 0.3PbZrO 3 (PMN-PZ) was studied by neutron diffraction. The Rietveld refinement was carried out to determine the average, long-range crystallographic structure, while the pair density function (PDF) analysis was used in studying the local atomic structure. The local atomic structure determined by the PDF analysis, was found to be significantly different from the average crystallographic structure determined by the Rietveld analysis. These results show that the conflict between the local structural preference and the average structure is not limited to relax or ferroelectric oxides, but may be widely prevalent in mixed-ion ferroelectrics. (author)

Electrical transport of (1-x)La0.7Ca0.3MnO3+xAl2O3 composites

International Nuclear Information System (INIS)

Phong, P.T.; Khiem, N.V.; Dai, N.V.; Manh, D.H.; Hong, L.V.; Phuc, N.X.

2009-01-01

We report the resistivity (ρ)-temperature (T) patterns in (1-x)La 0,7 Ca 0,3 MnO 3 +xAl 2 O 3 composites (0≤x≤0.05) over a temperature regime of 50-300 K. Al 2 O 3 addition has increased the resistivity of these composites. The Curie temperature (T C ) is almost independent on the Al 2 O 3 content and is about 250 K for all the samples, while the metal-insulator transition temperature (T MI ) decreases with increasing Al 2 O 3 content. Based on the phenomenological equation for conductivity under a percolation approach, which is dependent on the phase segregation of ferromagnetic metallic clusters and paramagnetic insulating regions, we fitted the experimental data (ρ-T) from 50 to 300 K and find that the activation barrier increases as Al 2 O 3 content increases.

40 CFR 417.73 - Effluent limitations guidelines representing the degree of effluent reduction attainable by the...

Science.gov (United States)

2010-07-01

... economically achievable. 417.73 Section 417.73 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Manufacture of Bar Soaps Subcategory § 417.73 Effluent limitations guidelines representing the degree of...

7th International Seminar on Tropical Swine Production 2017 on the Occasion of the 45th Anniversary of Cuba's Swine Research Institute

Directory of Open Access Journals (Sweden)

Royal Academy for Overseas Sciences

2016-01-01

Full Text Available 7th International Seminar on Tropical Swine Production 2017 on the Occasion of the 45th Anniversary of Cuba's Swine Research Institute. Cet article analyse les facteurs qui influencent l'adoption du Mucuna pruriens en zone cotonnière ouest du Burkina Faso. Les données ont été collectées dans 3 villages par la méthode active de recherche participative et par enquête auprès de 50 exploitations impliquées dans le développement de techniques de production du mucuna adaptées aux systèmes de production locaux. La co-construction de ces techniques s'est faite de 2005 à 2015 selon une démarche de recherche-action en partenariat. Les résultats de la régression logistique révèlent que les variables qui influent positivement la décision d'adopter sont le nombre d'actifs et de fosses fumières, le sexe, l'accès au marché, l'expérimentation du M. pruriens, la pratique de l'embouche (P&amp;amp;amp;amp;amp;amp;amp;amp;lt;0,1 et le nombre de participation aux réunions de la plateforme d'innovation par l'exploitant (P&amp;amp;amp;amp;amp;amp;amp;amp;lt;0,05. Par contre la quantité d'urée appliquée par hectare et le revenu de l'exploitation affectent négativement l'adoption (P&amp;amp;amp;amp;amp;amp;amp;amp;lt;0,1. La réussite des actions de développement de la culture des légumineuses fourragères passe par la prise en compte raisonnée de ces facteurs.

40 CFR 417.60 - Applicability; description of the manufacture of soap flakes and powders subcategory.

Science.gov (United States)

2010-07-01

... manufacture of soap flakes and powders subcategory. 417.60 Section 417.60 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS SOAP AND DETERGENT MANUFACTURING POINT SOURCE CATEGORY Manufacture of Soap Flakes and Powders Subcategory § 417.60 Applicability...

Posttreatment with group II metabotropic glutamate receptor agonist 2R,4R-4-aminopyrrolidine-2,4-dicarboxylate is only weakly effective on seizures in immature rats

Czech Academy of Sciences Publication Activity Database

Folbergrová, Jaroslava; Druga, Rastislav; Tsenov, Grygoriy; Haugvicová, Renata; Otáhal, Jakub

2009-01-01

Roč. 1273, - (2009), s. 144-154 ISSN 0006-8993 R&D Projects: GA ČR(CZ) GA309/05/2015; GA ČR GA309/08/0292; GA ČR(CZ) GA304/07/1137 Institutional research plan: CEZ:AV0Z50110509; CEZ:AV0Z50200510 Keywords : DL-homocysteic acid-induced seizures * posttreatment with 2R * 4R-APDC * partial protection Subject RIV: FH - Neuro logy Impact factor: 2.463, year: 2009

Synthetic Biology R&D Risks: Social-Institutional Contexts Matter!

Science.gov (United States)

Wolfe, Amy K; Campa, Maria Fernanda; Bergmann, Rachael A; Stelling, Savannah C; Bjornstad, David J; Shumpert, Barry L

2016-05-01

Factors that shape actual research practices - 'social and institutional context' - typically are missing from considerations of synthetic biology R&D-related risk and containment. We argue that analyzing context is essential in identifying circumstances that create, amplify, or diminish risk, and in revealing new opportunities for avoiding or managing those risks. Copyright © 2016 Elsevier Ltd. All rights reserved.

Resistance changes of Pr0.7Ca0.3MnO3 films deposited through rf-magnetron sputtering

International Nuclear Information System (INIS)

Lee, Kwangseok; Han, Seungwoo; Park, Kyoungwan; Sok, Junghyun

2006-01-01

In this paper, the resistance-change behavior of a perovskite material was studied. In particular, Pr 0.7 Ca 0.3 MnO 3 (PCMO) films were deposited on a Pt bottom electrode by using an rf-magnetron sputtering system. The PCMO films showed a resistance-switching behavior at room temperature. They were then deposited at 300 .deg. C with different oxygen flow rates, and the deposited films were post-annealed at various temperatures in an O 2 or N 2 atmosphere. The ratio of the resistance change of the post-annealed PCMO films in the high-resistance state to that in the low-resistance state in an O 2 atmosphere turned out to be much larger than that of the post-annealed films in a N 2 atmosphere. The electrical properties of the PCMO films were also significantly affected by the top electrode. The resistance changes of the Ag/PCMO/Pt device turned out to be larger than those of the Au/PCMO/Pt device. It can, therefore, be concluded that the O 2 content and the top electrode improve the electroresistance.

Characteristics of La0.7Ca0.3MnO3-Cu composites fabricated by an electroless process

International Nuclear Information System (INIS)

Xiong, Y H; Song, S J; Xu, W; Pi, H L; Ren, Z M; Zhang, J; Bao, X C; Xiong, J; Li, D G; Huang, W H; Sun, C L; Cheng, X W; Xiong, C S

2007-01-01

Ferromagnet-metal-type composites, La 0.7 Ca 0.3 MnO 3 (LCMO)-Cu, have been fabricated by a three-step route. We got LCMO powder using the conventional solid state method. Then, LCMO powders coated by Cu are obtained using a novel electroless plating technique, in which the contents of copper are controlled by changing the plating time. Finally these powders are pelletized and then sintered at different temperatures in argon. The powders coated by Cu are characterized by x-ray powder diffraction and scanning electron microscope. The temperature dependence of resistivity and the magnetoresistance in the applied field of 3000 Oe are measured. It is observed that the metal-insulator transition temperature (Tp) is improved above 20 K approximately up to 280 K compared with that of LCMO powder using the conventional solid state method without being coated by Cu; meanwhile, a second broad peak occurs in low temperature in the resistivity-temperature curve when sintering temperature is changed. Also an anisotropic magnetoresistance effect is observed

Evaluation du niveau de connaissance des patients sur la gestion du traitement par les antis vitamines K dans le service de cardiologie de Ouagadougou

Science.gov (United States)

Samadoulougou, André; Temoua Naibe, Dangwé; Mandi, Germain; Yameogo, Relwendé Aristide; Kabore, Elisé; Millogo, Georges; Yameogo, Nobila Valentin; Kologo, Jonas Koudougou; Thiam/Tall, Anna; Toguyeni, Boubacar Jean Yves; Zabsonre, Patrice

2014-01-01

Introduction Les antivitamines K (AVK), traitement anticoagulant oral le plus largement prescrit, posent un réel problème de santé publique du fait de leur risque iatrogène. L'objectif de cette étude était de préciser le niveau de connaissance des patients sur la gestion de leur traitement par les AVK. Méthodes Il s'est agi d'une enquête transversale descriptive réalisée au CHU-Yalgado Ouédraogo, sur une période de 03 mois : du 1er mars au 31 mai 2012. Un questionnaire a été administré aux patients bénéficiant d'un traitement AVK depuis au moins un mois. Résultats Soixante-dix patients ont été inclus dans l'étude dont 30 hommes. L'âge moyen était de 49 ans ± 16 ans. Les cardiopathies et la maladie thromboembolique veineuse justifiant l'institution du traitement AVK étaient retrouvées respectivement dans 58,6% et 41,4% des cas. Le nom de l'AVK et la raison exacte du traitement étaient connus respectivement dans 91,4% et 67,1% des cas. Plus de la moitié des patients (68,6%) savaient que les AVK rendaient le sang plus fluide. Quarante-six patients (65,7%) citaient l'INR comme examen biologique de surveillance du traitement et seulement 28 patients (40%) connaissaient les valeurs cibles. La majorité des patients ne connaissait pas les risques encourus en cas de surdosage (72,8%) et de sous-dosage (71,4%). Une automédication par anti-inflammatoire non stéroïdien était signalée par 18 patients (25,7%). Les choux (74,3%) et la laitue (62,9%), aliments à consommer avec modération, étaient les plus cités. Conclusion Les connaissances des patients sur la gestion des AVK étaient fragmentaires et insuffisantes pour assurer la sécurité et l'efficacité du traitement. La création d'un programme d'éducation thérapeutique sur les AVK s'avère alors nécessaire. PMID:25870741

76 FR 61720 - Eunice Kennedy Shriver National Institute of Child Health & Human Development; Notice of Closed...

Science.gov (United States)

2011-10-05

... National Institute of Child Health & Human Development; Notice of Closed Meeting Pursuant to section 10(d... Institute of Child Health and Human Development Special Emphasis Panel, PAR-10-194, PAR10-203, PAR-11- 183... Institute of Child Health and Human Development, NIH, 6100 Executive Blvd., Room 5B01-G, Bethesda, MD 20892...

40 CFR 417.110 - Applicability; description of the SO3 solvent and vacuum sulfonation subcategory.

Science.gov (United States)

2010-07-01

... solvent and vacuum sulfonation subcategory. 417.110 Section 417.110 Protection of Environment... POINT SOURCE CATEGORY SO3 Solvent and Vacuum Sulfonation Subcategory § 417.110 Applicability; description of the SO3 solvent and vacuum sulfonation subcategory. The provisions of this subpart are...

Comparison MAAP5.03 with MAAP5.04 from Recombination of CO point of view

Energy Technology Data Exchange (ETDEWEB)

Kim, ChulSoo; Kim, HyoungKi; Ryu, InChul; Moon, YoungTae [KEPCO Engineering and Construction, Daejeon (Korea, Republic of)

2016-10-15

To mitigate Molten Core-Concrete Interaction (MCCI) progress, a limestone-like concrete is used to be selected as the reactor cavity floor material. However because of the fact that they contain higher CO than the siliceous concrete, it leads to a lot of CO generation than siliceous case. Basically it has been known that PAR can deplete carbon monoxide (CO) as well as hydrogen. But, MAAP5.03 or earlier does not provide the CO recombination model. To reflect the current issue pertinent to the CO depletion by PARs, the developer of MAAP code, FAI (Fauske and Associate, LLC) implements CO recombination model into MAAP5.04 beta version, very recently. In this paper, CO concentration for the plant application by using MAAP5.03 and MAAP5.04 beta version are compared to investigate the performance of newly implemented CO recombination model in MAAP5.04 beta version. During severe accident in PWR, carbon monoxide may be released in addition to hydrogen due to MCCI. Because carbon monoxide is combustible gas, mass of CO can have an impact on the containment integrity under the combustible gas combustion. In the MAAP5.03 or earlier, PAR is modeled such that it can eliminate hydrogen only. Therefore, mass of carbon monoxide is calculated more than reality. To reflect the possible gap of threats from the combustible gas, MAAP5.04 beta version incorporates CO recombination model very recently based on the experiment. According to the CO mass distribution with and without the consideration of CO recombination by PARs, a massive elimination of CO generated by MCCI is predicted in the containment.

Microstructure and thermal stability of Cu/Zr0.3Al0.7N/Zr0.2Al0.8N/Al34O60N6 cermet-based solar selective absorbing coatings

Science.gov (United States)

Meng, Jian-ping; Guo, Rui-rui; Li, Hu; Zhao, Lu-ming; Liu, Xiao-peng; Li, Zhou

2018-05-01

Solar selective absorbing coatings play a valuable role in photo-thermal conversion for high efficiency concentrating solar power systems (CSP). In this paper, a novel Cu/Zr0.3Al0.7N/Zr0.2Al0.8N/Al34O60N6 cermet-based solar selective absorbing coating was successfully deposited by ion beam assisted deposition. The optical properties, microstructure and element distribution in depth were investigated by spectroscopic ellipsometry, UV-vis-NIR spectrophotometer, transmission electron microscope (TEM) and Auger electron spectroscopy (AES), respectively. A high absorptance of 0.953 and a low thermal emittance of 0.079 at 400 °C are obtained by the integral computation according to the whole reflectance from 300 nm to 28,800 nm. After annealing treatment at 400 °C (in vacuum) for 192 h, the deposited coating exhibits the high thermal stability. Whereas, the photothermal conversion efficiency decreases from 12.10 to 6.86 due to the emittance increase after annealing at 600 °C for 192 h. Meanwhile, the nitrogen atom in the Zr0.3Al0.7N sub-layer diffuses toward the adjacent sub-layer due to the spinodal decomposition of metastable c-ZrAlN and the phase transition from c-AlN to h-AlN, which leads to the composition of the Zr0.3Al0.7N sub-layer deviates the initial design. This phenomenon has a guide effect for the thermal-stability improvement of cermet coatings. Additionally, a serious diffusion between copper and silicon substrate also contributes to the emittance increase.

9 CFR 417.1 - Definitions.

Science.gov (United States)

2010-01-01

... CRITICAL CONTROL POINT (HACCP) SYSTEMS § 417.1 Definitions. For purposes of this part, the following... control point. A point, step, or procedure in a food process at which control can be applied and, as a... limit. The maximum or minimum value to which a physical, biological, or chemical hazard must be...

La lecture de Merleau-Ponty par Renaud Barbaras

Czech Academy of Sciences Publication Activity Database

Pechar, Jiří

2015-01-01

Roč. 11, č. 2 (2015), s. 1-6 ISSN 1336-6556 Institutional support: RVO:67985955 Keywords : Merleau-Ponty * Husserl * phenomenology * linguistics of Ferdinand de Saussure Subject RIV: AA - Philosophy ; Religion http://www.ostium.sk/sk/la-lecture-de-merleau-ponty-par-renaud-barbaras/

Modélisation informatique de la production d’énergie renouvelable à partir de biogaz par transformation anaérobique dumélange de résidus d’agrumes et defumier de bovins

Directory of Open Access Journals (Sweden)

Edwin Dario Cendales L.

2014-03-01

Full Text Available Dans cet article nous avons simulé par ordinateur le processus de digestion anaérobique d’un mélange homogénéisé de fumier bétail et de résidus d’agrumes afin d’évaluer la viabilité des énergies renouvelables à partir de la transformation des déchets. Sur la base des résultats obtenus et grâce au développement de la phase expérimentale lors de laquelle étaient mesurées de façon périodiques les variables de contrôle du processus de biodégradation anaérobique tels que le pH, l’alcalinité, la demande chimique en oxygène (total et soluble, nous avons établi les performances des paramètres du processus et déterminé des valeurs pour la comparaison entre résultats expérimentaux et résultats informatiques. Nous avons en outre réalisé une simulation du processus de digestion anaérobique dans des conditions similaires à celles précédemment établis par d’autres essais expérimentaux à travers la mise en oeuvre du modèle ADM-1. Grâce aux résultats obtenus par le biais de simulations et mesures expérimentales, nous avons évalué la précision du modèle concernant les valeurs des mesures expérimentales. Un modèle simplifié pour l’évaluation de l’énergie produite par une installation à échelle réduite qui effectue le traitement anaérobique des résidus organiques a finalement été mis en place. Le modèle a montré qu’il existe au départ un déficit énergétique pour que le processus se réalise, mais une fois la production de biogaz enclenchée, le processus devient autonome et le système fournit une quantité croissante d’énergie disponible.

4D Art: corps réels et virtuels, une réalité augmentée

Directory of Open Access Journals (Sweden)

Michel Lemieux

2016-05-01

Full Text Available La compagnie canadienne 4D Art surprend le regard du public et interroge les sens de réalité et présence, par l’interaction scénique de corps réels et virtuels en mouvement. Pour comprendre le processus créateur des spectacles de 4D Art, on présente un entretien inédit réalisé avec les directeurs artistiques Michel Lemieux et Victor Pilon. Les motivations artistiques du jeu réel et virtuel, les procédés employés dans la création des figures virtuelles et les défis vécus par les acteurs sont exposés par les créateurs.

Funding Research Through the Online Partnership to Accelerate Research (OnPAR

Directory of Open Access Journals (Sweden)

Martin A. Dueñas, MPA

2016-10-01

Full Text Available OnPAR—the Online Partnership to Accelerate Research—seeks to provide a second opportunity for funding of high-quality, unfunded applications originally submitted to the National Institutes of Health and other national and international funding agencies. OnPAR will match applicable, unfunded applications with the research priorities of nongovernment organizations such as private biomedical foundations, pharmaceutical companies, venture capital funds, and other private funds. Funding organization members will review and make final funding decisions through a simple, 2-step process whereby applicants can submit public abstracts directly to OnPAR. If a member requests additional information, then, by invitation only, an applicant can submit their original unfunded application and their peer review summary statement. Advancing research discovery and drug development to improve clinical outcomes for patients afflicted with or at risk for disease is the primary goal of OnPAR. OnPAR invites the scientific community to fully participate in this new funding paradigm by submitting their National Institutes of Health public abstracts so that funding members can review and potentially support these high-quality, unfunded applications.

R-ES-ONANCE

Indian Academy of Sciences (India)

A Vision of Nature in All Her. Colours. G S Ranganath. Light and C%r in the Outdoors. MGJ Minnaert. Springer-Verlag, 1993 pp.417, DM78. When we are face to face with the grandeur ... tempted to look more closely and cqrefully at all that has only ... of an earlier book entitled Light and Colour in the Open Air published in ...

13 ISOLA Roulon-Doko WEB 03.pmd

African Journals Online (AJOL)

Owner

groupes dont font partie les Gbaya 'bodoé chez qui je travaille. ... parole à un autre … et c'est à tour de rôle que tous ceux qui le souhaitent pourront dire un conte. Lorsque le conte comporte un, voire plusieurs chants, l'auditoire est toujours sollicité pour faire le répons du chant lancé par le conteur, à qui il revient de.

42 CFR 417.806 - Financial records, statistical data, and cost finding.

Science.gov (United States)

2010-10-01

... 42 Public Health 3 2010-10-01 2010-10-01 false Financial records, statistical data, and cost... MEDICAL PLANS, AND HEALTH CARE PREPAYMENT PLANS Health Care Prepayment Plans § 417.806 Financial records, statistical data, and cost finding. (a) The principles specified in § 417.568 apply to HCPPs, except those in...

Age-related prodiabetogenic effects of transgenic resistin in spontaneously hypertensive rats

Czech Academy of Sciences Publication Activity Database

Pravenec, Michal; Zídek, Václav; Landa, Vladimír; Kazdová, L.; Kurtz, T.

2006-01-01

Roč. 23, Suppl. 4 (2006), s. 271-271 ISSN 0742-3071. [World Diabetes Congress /19./. 03.12.2006-07.12.2006, Cape Town] R&D Projects: GA ČR(CZ) GA301/06/0028 Institutional research plan: CEZ:AV0Z50110509 Keywords : resistin * autocrine effects * transgenic Subject RIV: ED - Physiology

The occurrence of Troglodytella abrassarti (Brumpt and Joyeux, 1912) in captive gorillas

Czech Academy of Sciences Publication Activity Database

Pomajbíková, K.; Petrželková, Klára Judita; Tokiwa, T.; Imai, S.; Modrý, David

2008-01-01

Roč. 79, č. 5 (2008), s. 372-373 ISSN 0015-5713. [Congress of the European Federation for Primatology /2./. 03.09.2007-07.09.2007, Prague] R&D Projects: GA ČR GA524/06/0264 Institutional research plan: CEZ:AV0Z60930519 Keywords : gorillas * parasites * Zoo Subject RIV: EG - Zoology

Parasites of chimpanzees in Kalinzu Forest Reserve, Uganda, with emphasis on comensal protozoans

Czech Academy of Sciences Publication Activity Database

Petrášová, J.; Pomajbíková, K.; Petrželková, Klára Judita; Jirků, M.; Profousová, Ilona; Modrý, David; Hashimoto, C.

2008-01-01

Roč. 79, č. 5 (2008), s. 370 ISSN 0015-5713. [Congress of the European Federation for Primatology /2./. 03.09.2007-07.09.2007, Prague] R&D Projects: GA ČR GA524/06/0264 Institutional research plan: CEZ:AV0Z60930519 Keywords : parasites * chimpanzee * Uganda Subject RIV: EG - Zoology

The comparison of cyclic deformation curve determination for ADI

Czech Academy of Sciences Publication Activity Database

Zapletal, J.; Obrtlík, Karel; Věchet, S.

308 2005, - (2005), s. 305-309 ISSN 1429-6055. [Miedzynarodowe sympozjum /20./. Ustroň-Jaszowiec, 07.12.2005-09.12.2005] R&D Projects: GA ČR(CZ) GA106/03/1265 Institutional research plan: CEZ:AV0Z20410507 Keywords : cyclic stress-strain curve * austempered ductile iron Subject RIV: JG - Metallurgy

Islam et engagements au Sénégal : résultats d'un programme de recherche demandé par l'Ambassade du Royaume des Pay-Bas à Dakar

NARCIS (Netherlands)

Kaag, M.M.A.

2011-01-01

Ce volume collectif rassemble les résultats de travaux menés par des chercheurs sénégalais et néerlandais selon trois axes de recherche concernant le Sénégal: la relation entre islam et politique, la relation entre islam et économie, le rôle de l'islam dans le débat public sur la bonne gouvernance.

Ultrastructure of the proglottid tegument (neodermis) of the cestode Echinophallus wageneri (Pseudophyllidea: Echinophallidae), a parasite of the bathypelagic fish Centrolophus niger

Czech Academy of Sciences Publication Activity Database

Poddubnaya, L. G.; Scholz, Tomáš; Kuchta, Roman; Levron, Céline; Bruňanská, Magdaléna

2007-01-01

Roč. 101, č. 2 (2007), s. 373-383 ISSN 0932-0113 R&D Projects: GA ČR GA206/03/1317; GA ČR GD524/03/H133; GA ČR GA524/04/0342; GA ČR GP524/07/P039; GA MŠk LC522 Grant - others:Vedecká grantová agentúra Ministerstva školstva Slovenskej republiky a Slovenskej akadémie vied(SK) VEGA2/4177/04 Institutional research plan: CEZ:AV0Z60220518 Keywords : ultrastructure * microtriches * tapeworms Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.512, year: 2007

La pelade par plaques

Science.gov (United States)

Spano, Frank; Donovan, Jeff C.

2015-01-01

Résumé Objectif Présenter aux médecins de famille des renseignements de base pour faire comprendre l’épidémiologie, la pathogenèse, l’histologie et l’approche clinique au diagnostic de la pelade par plaques. Sources des données Une recension a été effectuée dans PubMed pour trouver des articles pertinents concernant la pathogenèse, le diagnostic et le pronostic de la pelade par plaques. Message principal La pelade par plaques est une forme de perte pileuse auto-immune dont la prévalence durant une vie est d’environ 2 %. Des antécédents personnels ou familiaux de troubles auto-immuns concomitants, comme le vitiligo ou une maladie de la thyroïde, peuvent être observés dans un petit sous-groupe de patients. Le diagnostic peut souvent être posé de manière clinique en se fondant sur la perte de cheveux non cicatricielle et circulaire caractéristique, accompagnée de cheveux en « point d’exclamation » en périphérie chez ceux dont le problème en est aux premiers stades. Le diagnostic des cas plus complexes ou des présentations inhabituelles peut être facilité par une biopsie et un examen histologique. Le pronostic varie largement et de mauvais résultats sont associés à une apparition à un âge précoce, une perte importante, la variante ophiasis, des changements aux ongles, des antécédents familiaux ou des troubles auto-immuns concomitants. Conclusion La pelade par plaques est une forme auto-immune de perte de cheveux périodiquement observée en soins primaires. Les médecins de famille sont bien placés pour identifier la pelade par plaques, déterminer la gravité de la maladie et poser le diagnostic différentiel approprié. De plus, ils sont en mesure de renseigner leurs patients à propos de l’évolution clinique de la maladie ainsi que du pronostic général selon le sous-type de patients.

Neutron scattering studies of the anomalous magnetic alloy Fe/sub 0.7/Al/sub 0.3/

International Nuclear Information System (INIS)

Motoya, K.; Shapiro, S.M.; Muraoka, Y.

1983-01-01

Small-angle total and inelastic neutron scattering measurements were performed on a single crystal of the ordered alloy Fe/sub 0.7/Al/sub 0.3/. The behavior of the Q dependence of the small-angle intensity can be classified into four temperature regions which correspond to the bulk behavior: (i) T>T/sub c/ = 510 K (paramagnetic region); the line shape is Lorentzian with kappa→0 as T>T/sub c/. (ii) 300 K -2 as expected from spin waves. (iii) 100 K< T<300 K (near T/sub c//sup inv/); I(Q)approx.Q/sup -alpha/, with α being T dependent and reaching a maximum value α = 2.6. In this region the T dependence of the intensity exhibits a peak which is Q dependent. Near T/sub c//sup inv/roughly-equal160 K, a thermal hysteresis and novel time dependence of the scattering is observed. (iv) T<100 K (spin-glass regime); the line shape is again Lorentzian with kappa increasing with decreasing T. No anomaly is observed at T/sub f/roughly-equal90 K. The inelastic measurements reveal that spin waves exist in the ferromagnetic regime but disappear as the temperature is lowered. For temperatures less than T/sub c//sup inv/, an elastic central peak appears which increases as T is decreased. The results are interpreted in terms of random-field effects

Microstructure, Magnetic, and Magnetoresistance Properties of La0.7Sr0.3MnO3:CuO Nanocomposite Thin Films.

Science.gov (United States)

Fan, Meng; Wang, Han; Misra, Shikhar; Zhang, Bruce; Qi, Zhimin; Sun, Xing; Huang, Jijie; Wang, Haiyan

2018-02-14

(La 0.7 Sr 0.3 MnO 3 ) 0.67 :(CuO) 0.33 (LSMO:CuO) nanocomposite thin films were deposited on SrTiO 3 (001), LaAlO 3 (001), and MgO (001) substrates by pulsed laser deposition, and their microstructure as well as magnetic and magnetoresistance properties were investigated. X-ray diffraction (XRD) and transmission electron microscopy (TEM) results show that LSMO:CuO films grow as highly textured self-assembled vertically aligned nanocomposite (VAN), with a systematic domain structure and strain tuning effect based on the substrate type and laser deposition frequency. A record high low-field magnetoresistance (LFMR) value of ∼80% has been achieved in LSMO:CuO grown on LaAlO 3 (001) substrate under high frequency. Detailed analysis indicates that both the strain state and the phase boundary effect play a significant role in governing the overall LFMR behavior.

Multistage Stochastic Programming via Autoregressive Sequences

Czech Academy of Sciences Publication Activity Database

Kaňková, Vlasta

2007-01-01

Roč. 15, č. 4 (2007), s. 99-110 ISSN 0572-3043 R&D Projects: GA ČR GA402/07/1113; GA ČR(CZ) GA402/06/0990; GA ČR GD402/03/H057 Institutional research plan: CEZ:AV0Z10750506 Keywords : Economic proceses * Multistage stochastic programming * autoregressive sequences * individual probability constraints Subject RIV: BB - Applied Statistics, Operational Research

42 CFR 417.564 - Apportionment and allocation of administrative and general costs.

Science.gov (United States)

2010-10-01

... general costs. 417.564 Section 417.564 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT... providing medical care. Enrollment, marketing, and other administrative and general costs that benefit the... benefit of which cannot be quantitatively measured (such as facility costs), the total allowable costs of...

Étude de faisabilité de l’estérification d’un diacide par distillation réactive Feasibility Study of Diacid Esterification by Reactive Distillation

Directory of Open Access Journals (Sweden)

Steger C.

2010-09-01

Full Text Available Cette étude propose une approche systématique de la conception d’une colonne à distiller réactive. Elle a été appliquée avec succès au cas peu étudié des réactions consécutives. L’estérification de l’acide 2 methyl glutarique par le méthanol a été traitée. Les 3 premières étapes de la méthode montrent la faisabilité de la production dans une colonne hybride avec un taux de reflux faible et la nécessité de travailler avec un excès de méthanol. Ces résultats théoriques ont ensuite été consolidés par un pilotage sur une colonne de diamètre 75 mm. Dans tous les régimes pilotés, les résultats obtenus sont significativement supérieurs à un réacteur en lit fixe même avec des excès de réactif plus importants. A systematic methodology for the design of reactive distillation columns has been successfully applied to a mixture with consecutive chemical reactions, i.e. esterification of 2-methyl glutaric acid with methanol. The feasibility of production within a hybride reactive distillation column operated at a low reflux ratio with an excess of methanol has been validated by the first steps of this approach. These results have been experimentally confirmed within a lab-scale reactive distillation column (75 mm inner diameter. Performances are significantly improved for all investigated process conditions in comparison to corresponding fixed bed reactor.

Single-molecule surface-enhanced Raman spectroscopy from a molecularly-bridged silver nanoparticle dimer

Czech Academy of Sciences Publication Activity Database

Vlčková, B.; Moskovits, M.; Pavel, I.; Šišková, Karolína; Sládková, M.; Šlouf, Miroslav

2008-01-01

Roč. 455, 4-6 (2008), s. 131-134 ISSN 0009-2614 R&D Projects: GA ČR GA203/07/0717 Grant - others:NSF(US) OISE-0406665; Institute of Collaborative Biotechnologies(US) DAAD19-03-D-0004; GA MŠk(CZ) 1P0MO750 Institutional research plan: CEZ:AV0Z40500505 Keywords : SM-SERS * nanoparticle dimer * silver nanoparticles Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.169, year: 2008

Development of an Asymbiotic Reference Line for Pea cv. Bohatýr by De Novo Mutagenesis

Czech Academy of Sciences Publication Activity Database

Novák, Karel; Šlajs, Martin; Biedermannová, Eva; Vondrys, Josef

2005-01-01

Roč. 45, - (2005), s. 1837-1843 ISSN 0011-183X R&D Projects: GA ČR GA521/00/0937; GA ČR GA521/03/0192 Institutional research plan: CEZ:AV0Z50200510 Keywords : mutagenesis * bohatýr * nitrogen fixation Subject RIV: EE - Microbiology, Virology Impact factor: 0.925, year: 2005

Is the Pearson r[squared] Biased, and if So, What Is the Best Correction Formula?

Science.gov (United States)

Wang, Zhongmiao; Thompson, Bruce

2007-01-01

In this study the authors investigated the use of 5 (i.e., Claudy, Ezekiel, Olkin-Pratt, Pratt, and Smith) R[squared] correction formulas with the Pearson r[squared]. The authors estimated adjustment bias and precision under 6 x 3 x 6 conditions (i.e., population [rho] values of 0.0, 0.1, 0.3, 0.5, 0.7, and 0.9; population shapes normal, skewness…

Effect of Colloidal Silica on Rheological Properties of Common Pharmaceutical Excipients.

Czech Academy of Sciences Publication Activity Database

Majerová, D.; Kulaviak, Lukáš; Růžička, Marek; Štěpánek, F.; Zámostný, P.

2016-01-01

Roč. 106, SI (2016), s. 2-8 ISSN 0939-6411. [International Granulation Workshop /7./. Sheffield, 29.06.2015-03.07.2015] R&D Projects: GA ČR(CZ) GA15-05534S Institutional support: RVO:67985858 Keywords : powder flow * cohesion * glidants Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 4.159, year: 2016

Institute of Social Studies Trust (ISST) : Institutional Support | CRDI ...

International Development Research Centre (IDRC) Digital Library (Canada)

Le CRDI lance un nouveau projet dans la région de l'ANASE. L'honorable Chrystia Freeland, ministre du Commerce international, a annoncé le lancement d'un nouveau projet financé par le Centre de recherches pour le développement international (CRDI). Voir davantageLe CRDI lance un nouveau projet dans la région ...

Preparation and physical properties of (PVA0.7(NaBr0.3(H3PO4xM solid acid membrane for phosphoric acid – Fuel cells

Directory of Open Access Journals (Sweden)

F. Ahmad

2013-03-01

Full Text Available A solid acid membranes based on poly (vinyl alcohol (PVA, sodium bromide (NaBr and phosphoric acid (H3PO4 were prepared by a solution casting method. The morphological, IR, electrical and optical properties of the (PVA0.7(NaBr0.3(H3PO4xM solid acid membranes where x = 0.00, 0.85, 1.7, 3.4, 5.1 M were investigated. The variation of film morphology was examined by scanning electron microscopy (SEM studies. FTIR spectroscopy has been used to characterize the structure of polymer and confirms the complexation of phosphoric acid with host polymeric matrix. The temperature dependent nature of ionic conductivity and the impedance of the polymer electrolytes were determined along with the associated activation energy. The ionic conductivity at room temperature was found to be strongly depends on the H3PO4 concentration which it has been achieved to be of the order 4.3 × 10−3 S/cm at ambient temperature. Optical measurements showed a decrease in optical band gap and an increase in band tail width with the increase of phosphoric acid. The data shows that the (PVA0.7(NaBr0.3(H3PO4xM solid acid membrane is promising for intermediate temperature phosphoric acid fuel cell applications.

Translational control and differential RNA decay are key elements regulating postsegregational expression of the killer protein encoded by the parB locus of plasmid R1

DEFF Research Database (Denmark)

Gerdes, K; Helin, K; Christensen, O W

1988-01-01

The parB locus of plasmid R1, which mediates plasmid stability via postsegregational killing of plasmid-free cells, encodes two genes, hok and sok. The hok gene product is a potent cell-killing protein. The hok gene is regulated at the translational level by the sok gene-encoded repressor, a small...

9 CFR 417.8 - Agency verification.

Science.gov (United States)

2010-01-01

....8 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... ANALYSIS AND CRITICAL CONTROL POINT (HACCP) SYSTEMS § 417.8 Agency verification. FSIS will verify the... plan or system; (f) Direct observation or measurement at a CCP; (g) Sample collection and analysis to...

Anisotropic modulation of magnetic properties and the memory effect in a wide-band (011)-Pr0.7Sr0.3MnO3/PMN-PT heterostructure

KAUST Repository

Zhao, Ying-Ying

2015-04-24

Memory effect of electric-field control on magnetic behavior in magnetoelectric composite heterostructures has been a topic of interest for a long time. Although the piezostrain and its transfer across the interface of ferroelectric/ferromagnetic films are known to be important in realizing magnetoelectric coupling, the underlying mechanism for nonvolatile modulation of magnetic behaviors remains a challenge. Here, we report on the electric-field control of magnetic properties in wide-band (011)-Pr0.7Sr0.3MnO3/0.7Pb(Mg1/3Nb2/3)O3-0.3PbTiO3 heterostructures. By introducing an electric-field-induced in-plane anisotropic strain field during the cooling process from room temperature, we observe an in-plane anisotropic, nonvolatile modulation of magnetic properties in a wide-band Pr0.7Sr0.3MnO3 film at low temperatures. We attribute this anisotropic memory effect to the preferential seeding and growth of ferromagnetic (FM) domains under the anisotropic strain field. In addition, we find that the anisotropic, nonvolatile modulation of magnetic properties gradually diminishes as the temperature approaches FM transition, indicating that the nonvolatile memory effect is temperature dependent. By taking into account the competition between thermal energy and the potential barrier of the metastable magnetic state induced by the anisotropic strain field, this distinct memory effect is well explained, which provides a promising approach for designing novel electric-writing magnetic memories.

Contribution de la tomographie par coherence optique au diagnostic ...

African Journals Online (AJOL)

Contribution de la tomographie par coherence optique au diagnostic de la neuropathie optique toxique. C.O.A. Abouki, S Alamou, C.R.A. Assavedo, L Odoulami-Yehouessi, I Sounouvou, S Hounnou-Tchabi ...

Etude par simulation hil des performances d'un statcom pour la ...

African Journals Online (AJOL)

Ce travail présente l'étude par simulation Hardware In the Loop (HIL) des performances d'un STATCOM pour la stabilisation de la tension délivrée par une génératrice asynchrone triphasée auto excitée dans un réseau autonome. Nous avons combiné l'utilisation du logiciel de simulation LABVIEW et la carte ARDUINO ...

Quantum Monte Carlo for noncovalent interactions: an efficient protocol attaining benchmark accuracy

Czech Academy of Sciences Publication Activity Database

Dubecký, M.; Derian, R.; Jurečka, P.; Mitas, L.; Hobza, Pavel; Otyepka, M.

2014-01-01

Roč. 16, č. 38 (2014), s. 20915-20923 ISSN 1463-9076 R&D Projects: GA ČR GBP208/12/G016 Grant - others:GA ČR(CZ) GAP208/10/1742; GA MŠk(CZ) ED2.1.00/03.0058; European Social Fund(XE) CZ.1.07/2.3.00/30.0004; European Social Fund(XE) CZ.1.07/2.3.00/20.0058 Program:GA; ED Institutional support: RVO:61388963 Keywords : basis set limit * interaction energies * CCSD(T) Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.493, year: 2014

Some Tests for Evaluation of Contingency Tables (for Biomedical Applications)

Czech Academy of Sciences Publication Activity Database

Kalina, Jan

2011-01-01

Roč. 7, č. 1 (2011), s. 37-50 ISSN 1336-9180 R&D Projects: GA MŠk(CZ) 1M06014 Institutional research plan: CEZ:AV0Z10300504 Keywords : contingency tables * hypothesis testing Subject RIV: BB - Applied Statistics , Operational Research http://jamsi.fpv.ucm.sk/docs/v07n01_05_2011/v07_n01_03_KALINA.pdf

Suppression of slow capacitance relaxation phenomenon in Pt/Ba0.3Sr0.7TiO3/Pt thin film ferroelectric structures by annealing in oxygen atmosphere

KAUST Repository

Altynnikov, A. G.

2014-01-27

The impact of oxygen annealing on the switching time of ferroelectric thin film capacitor structures Pt/Ba0.3Sr0.7TiO3/Pt was investigated. The response of their capacitance on pulsed control voltages before and after annealing was experimentally measured. It was demonstrated that the annealing results in suppression of the capacitance slow relaxation processes and increase of the threshold control voltages. These structures can therefore be attractive for fabrication of fast acting microwave devices. © 2014 Author(s).

Local rhombohedral symmetry in Tb{sub 0.3}Dy{sub 0.7}Fe{sub 2} near the morphotropic phase boundary

Energy Technology Data Exchange (ETDEWEB)

Ma, Tianyu, E-mail: maty@zju.edu.cn [State Key Laboratory of Silicon Materials, Department of Materials Science and Engineering, Key Laboratory of Novel Materials for Information Technology of Zhejiang Province, Cyrus Tang Center for Sensor Materials and Applications, Zhejiang University, Hangzhou 310027 (China); Ferroic Physics Group, National Institute for Materials Science, 1-2-1 Sengen, Tsukuba 305-0047, Ibaraki (Japan); Liu, Xiaolian; Pan, Xingwen; Li, Xiang; Jiang, Yinzhu; Yan, Mi, E-mail: mse-yanmi@zju.edu.cn [State Key Laboratory of Silicon Materials, Department of Materials Science and Engineering, Key Laboratory of Novel Materials for Information Technology of Zhejiang Province, Cyrus Tang Center for Sensor Materials and Applications, Zhejiang University, Hangzhou 310027 (China); Li, Huiying; Fang, Minxia [Multi-disciplinary Materials Research Center, Frontier Institute of Science and Technology, Xi' an Jiaotong University, Xi' an 710049 (China); Ren, Xiaobing, E-mail: ren.xiaobing@nims.go.jp [Ferroic Physics Group, National Institute for Materials Science, 1-2-1 Sengen, Tsukuba 305-0047, Ibaraki (Japan); Multi-disciplinary Materials Research Center, Frontier Institute of Science and Technology, Xi' an Jiaotong University, Xi' an 710049 (China)

2014-11-10

The recently reported morphotropic phase boundary (MPB) in a number of giant magnetostrictive materials (GMMs) has drawn considerable interest to the local symmetry/structure near MPB region of these materials. In this letter, by in-situ X-ray diffraction and AC magnetic susceptibility measurements, we show that Tb{sub 0.3}Dy{sub 0.7}Fe{sub 2}, the typical composition of Terfenol-D GMMs, has coexistence of rhombohedral and tetragonal phases over a wide temperature range in the vicinity of MPB. High resolution transmission electron microscopy provides direct evidence for local rhombohedral symmetry of the ferromagnetic phase and reveals regular-shaped nanoscale domains below 10 nm. The nano-sized structural/magnetic domains are hierarchically inside a single micron-sized stripe-like domain with the same average magnetization direction. Such domain structures are consistent with the low magnetocrystalline anisotropy and easy magnetic/structural domain switching under magnetic field, thus generating large magnetostriction at low field.

Tilted magnetization of a La0.7Sr0.3MnO3/LaAlO3 (001) thin film

International Nuclear Information System (INIS)

Liebmann, M.; Kaiser, U.; Schwarz, A.; Wiesendanger, R.; Pi, U.H.; Noh, T.W.; Khim, Z.G.; Kim, D.-W.

2004-01-01

A La 0.7 Sr 0.3 MnO 3 thin film epitaxially grown on a LaAlO 3 (001) substrate by pulsed laser deposition has been investigated by means of low-temperature magnetic force microscopy under high stability conditions. The ferromagnetic film exhibits a stress-induced perpendicular easy axis of magnetization. The domain structure was imaged at zero field after (i) thermal demagnetization, (ii) saturation in an in-plane field and (iii) saturation in an out-of-plane magnetic field, respectively. Stripe domains were observed in all cases, however, contrast and domain width are increased after out-of-plane saturation while alignment of stripe domains in field direction occurs after in-plane saturation. A quantitative analysis of the image contrast suggests a variable in-plane component of the magnetization, dependent on the magnetic history of the sample. Calculations of domain width and contrast from the relevant energy contributions are compared with experimental results

Magnetic pinning-effect in Nd0.7Ca0.3MnO3/YBa2Cu3O7 bilayer

International Nuclear Information System (INIS)

Hsu, Daniel; Lin, J.G.; Wu, W.F.

2007-01-01

The vortex lines of superconductor can be driven by electrical currents, which are often coupled with a reliable control of flux quanta movement by defects or magnetic domains. In this work, the magnetic pinning-effect in Nd 0.7 Ca 0.3 MnO 3 /YBa 2 Cu 3 O 7 (NCMO/YBCO) bilayers is investigated. It is found that by increasing the field from 0 to 5 Tesla, the critical current I c of pure YBCO film at 50 K is suppressed by three orders of magnitude. However, in the NCMO/YBCO bilayer I c is less sensitive to the field and maintains at the level of 100 mA at high field. This result indicates that the magnetic pinning effect of NCMO is much more efficient than the conventional routes, which maybe related to the fine domain structure of NCMO film. (copyright 2008 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

Optimisation de tournées de véhicules dans le cadre de la logistique inverse : modélisation et résolution par des méthodes hybrides

OpenAIRE

Grellier , Emilie

2008-01-01

Vehicle routing problems in inverse logistics : modelling and solving with hybrid methods; Optimisation des tournées de véhicules dans le cadre de la logistique inverse : modélisation et résolution par des méthodes hybrides

Dynamic Filament Formation by a Divergent Bacterial Actin-Like ParM Protein.

Directory of Open Access Journals (Sweden)

Anthony J Brzoska

Full Text Available Actin-like proteins (Alps are a diverse family of proteins whose genes are abundant in the chromosomes and mobile genetic elements of many bacteria. The low-copy-number staphylococcal multiresistance plasmid pSK41 encodes ParM, an Alp involved in efficient plasmid partitioning. pSK41 ParM has previously been shown to form filaments in vitro that are structurally dissimilar to those formed by other bacterial Alps. The mechanistic implications of these differences are not known. In order to gain insights into the properties and behavior of the pSK41 ParM Alp in vivo, we reconstituted the parMRC system in the ectopic rod-shaped host, E. coli, which is larger and more genetically amenable than the native host, Staphylococcus aureus. Fluorescence microscopy showed a functional fusion protein, ParM-YFP, formed straight filaments in vivo when expressed in isolation. Strikingly, however, in the presence of ParR and parC, ParM-YFP adopted a dramatically different structure, instead forming axial curved filaments. Time-lapse imaging and selective photobleaching experiments revealed that, in the presence of all components of the parMRC system, ParM-YFP filaments were dynamic in nature. Finally, molecular dissection of the parMRC operon revealed that all components of the system are essential for the generation of dynamic filaments.

Asymmetric Deformation of Bubble Shape: Cause or Effect of Vortex-Shedding?

Czech Academy of Sciences Publication Activity Database

Wichterle, K.; Večeř, M.; Růžička, Marek

2014-01-01

Roč. 68, č. 1 (2014), s. 74-79 ISSN 0366-6352 R&D Projects: GA ČR GA104/07/1110 Grant - others:GA MŠMT(CZ) CZ.1.05/2.1.00/03.0082 Institutional support: RVO:67985858 Keywords : bubble * bubble shape * bubble velocity Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 1.468, year: 2014

Study of individual and group affective processes in the crew of a simulated mission to Mars: Positive affectivity as a valuable indicator of changes in the crew affectivity

Czech Academy of Sciences Publication Activity Database

Poláčková Šolcová, Iva; Lačev, A.; Šolcová, Iva

2014-01-01

Roč. 100, 07-08 (2014), s. 57-67 ISSN 0094-5765 R&D Projects: GA ČR(CZ) GAP407/11/2226 Institutional support: RVO:68081740 Keywords : Mars -500 * Group isolation * Emotion * Emotion regulation * Mood Subject RIV: AN - Psychology Impact factor: 1.122, year: 2014 http://dx.doi.org/10.1016/j.actaastro.2014.03.016

Study of individual and group affective processes in the crew of a simulated mission to Mars: Positive affectivity as a valuable indicator of changes in the crew affectivity

Czech Academy of Sciences Publication Activity Database

Poláčková Šolcová, Iva; Lačev, A.; Šolcová, Iva

2014-01-01

Roč. 100, 07-08 (2014), s. 57-67 ISSN 0094-5765 R&D Projects: GA ČR(CZ) GAP407/11/2226 Institutional support: RVO:68081740 Keywords : Mars-500 * Group isolation * Emotion * Emotion regulation * Mood Subject RIV: AN - Psychology Impact factor: 1.122, year: 2014 http://dx.doi.org/10.1016/j.actaastro.2014.03.016

Pore Structure and Effective Permeability of Metallic Filters

Czech Academy of Sciences Publication Activity Database

Hejtmánek, Vladimír; Veselý, M.; Čapek, P.

2013-01-01

Roč. 410, č. 2013 (2013), 012110 ISSN 1742-6588. [International Conference on Mathematical Modelling in Physical Sciences (IC-MSQUARE) /1./. Budapest, 03.09.2012-07.09.2012] R&D Projects: GA ČR(CZ) GAP204/11/1206 Institutional support: RVO:67985858 Keywords : stochastic reconstruction * porous media * effective permeability Subject RIV: CF - Physical ; Theoretical Chemistry

La prise en charge des suicides par précipitation en traumatologie

Directory of Open Access Journals (Sweden)

Abdelmajid Elmrini

2010-09-01

Full Text Available OBJECTIFS: A travers ce travail, l’épidémiologie et la psychopathologie du suicide par précipitation seront rappelées, le rôle du chirurgien traumatologue dans la restauration physique et psychique sera démontré. METHODES: Nous rapportons une étude rétrospective de 15 suicidants par précipitation admis pour des traumatismes complexes de l’appareil locomoteur entre 2004 et 2007. RESULTATS: Il s’agissait de primosuicidants, comprenant 10 femmes et 5 hommes. L’âge moyen des hommes est de 26,5 ans (24-34 ans et celui des femmes de 40,7 ans (17-45 ans. Le bilan lésionnel des suicidants a retrouvé 14 fractures des membres inférieurs, 4 traumatisme du rachis avec compression médullaire dans 1 cas, une fracture du bassin; deux traumatismes du membre supérieur. Aucun de ces patients n’a présenté de lésions viscérales ni de traumatismes crâniofacial. 80% (n = 12 des patients souffraient d’une affection psychiatrique avant leur passage à l’acte suicidaire : 8 pour une pathologie dépressive et 4 pour une schizophrénie. Chaque suicidant a subi au moins un acte chirurgical. Tous les patients avaient poursuivi la prise en charge psychiatrique en ambulatoire. Nos résultats fonctionnels étaient satisfaisants sans complications. Aucun des patients n’a récidivé. La pathologie suicidaire représente un problème de santé publique. Le suicide par précipitation représente 5 % de l’ensemble des modalités suicidaires. Les traumatismes occasionnés par ce mode suicidaire sont complexes et graves. Leur prise en charge nécessite une collaboration multidisciplinaire. CONCLUSION: La réparation chirurgicale permet à la fois le rétablissement de la fonction et l’amélioration psychique du sujet prévenant contre une rechute dépressive ou une récidive suicidaire.

Assessing Institutional Characteristics on Microcredit Default in Kenya: A Comparative Analysis of Microfinance Institutions and Financial Intermediaries

Science.gov (United States)

Muthoni, Muturi Phyllis

2016-01-01

A major concern on microcredit repayment remains a major obstacle to the Micro Financial Institutions (MFIs) and Financial Intermediaries (FIs) in Kenya. The health of MFI sector in Sub Sahara Africa (SSA) is a cause of concern due to the increased portfolio at risk (PAR). This region records the highest risk globally with its PAR 30 greater than…

Etude par imagerie radar des pollutions pétrolières

Directory of Open Access Journals (Sweden)

G. Rees

2004-06-01

Full Text Available En Russie, chaque année, les déversements de pétrole représentent un cinquième de la production totale. Les plus importants se produisent dans le domaine périglaciaire où le milieu naturel est d’une extrême fragilité. Les pipelines sont soumis à de rudes conditions notamment à la corrosion et aux processus cryogéniques. Le risque de rupture augmente en conséquence. La surveillance des déversements d’hydrocarbures, contrainte par l’immensité et la fréquente inaccessibilité du réseau de pipelines, peut être réalisée par le recours à la télédétection. L’objectif de ce travail est de fournir, à travers l’exemple de la catastrophe d’Usinsk (Rép. de Komi survenue en 1994, des outils d’analyse des images radar. Outre leur capacité à s’affranchir du couvert nuageux, les capteurs radar apportent des informations complémentaires à celles fournies par des capteurs optiques. L’exploitation thématique de ces images est rendue difficile par un certain nombre de facteurs perturbateurs tels que les caractéristiques propres du capteur, la direction de visée, la topographie et le phénomène de chatoiement (speckle. Le travail présenté montre le rôle prépondérant joué par ces corrections qui permettent de disposer de données quantitatives comparables d’une date à une autre. La méthode mise au point ici pour le suivi temporel de l’épanchement de pétrole d’Usinsk à partir de trois images radar, est discutée notamment dans ses limites et son aspect opérationnel possible.

Thermal strain-induced dielectric anisotropy in Ba0.7Sr0.3TiO3 thin films grown on silicon-based substrates

International Nuclear Information System (INIS)

Zhu, X. H.; Defaye, E.; Aied, M.; Guigues, B.; Dubarry, C.

2009-01-01

Dielectric properties of Ba 0.7 Sr 0.3 TiO 3 (BST) thin films, which were prepared on silicon-based substrates by ion beam sputtering and postdeposition annealing method, were systematically investigated in different electrode configurations of metal-insulator-metal and coplanar interdigital capacitors. It was found that a large dielectric anisotropy exists in the films with better in-plane dielectric properties (higher dielectric permittivity and tunability) than those along the out-of-plane direction. The observed anisotropic dielectric responses are explained qualitatively in terms of a thermal strain effect that is related to dissimilar film strains along the in-plane and out-of-plane directions. Another reason for the dielectric anisotropy is due to different influences of the interfacial low-dielectric layer between the BST film and the substrate (metal electrode).

Thermal strain-induced dielectric anisotropy in Ba0.7Sr0.3TiO3 thin films grown on silicon-based substrates

Science.gov (United States)

Zhu, X. H.; Guigues, B.; Defaÿ, E.; Dubarry, C.; Aïd, M.

2009-07-01

Dielectric properties of Ba0.7Sr0.3TiO3 (BST) thin films, which were prepared on silicon-based substrates by ion beam sputtering and postdeposition annealing method, were systematically investigated in different electrode configurations of metal-insulator-metal and coplanar interdigital capacitors. It was found that a large dielectric anisotropy exists in the films with better in-plane dielectric properties (higher dielectric permittivity and tunability) than those along the out-of-plane direction. The observed anisotropic dielectric responses are explained qualitatively in terms of a thermal strain effect that is related to dissimilar film strains along the in-plane and out-of-plane directions. Another reason for the dielectric anisotropy is due to different influences of the interfacial low-dielectric layer between the BST film and the substrate (metal electrode).

Glycopeptide dendrimers, Part III – a review: Use of glycopeptide dendrimers in immunotherapy and diagnosis of cancer and viral diseases

Czech Academy of Sciences Publication Activity Database

Niederhafner, Petr; Reiniš, Milan; Šebestík, Jaroslav; Ježek, Jan

2008-01-01

Roč. 14, č. 5 (2008), s. 556-587 ISSN 1075-2617 R&D Projects: GA MZe QF3115; GA ČR GA203/03/1362; GA ČR GA203/07/1517; GA AV ČR KAN200520703 Institutional research plan: CEZ:AV0Z40550506; CEZ:AV0Z50520514 Keywords : glycoconjugates * glycodendrimers * glycopeptides * anticancer vaccines * antiviral vaccines Subject RIV: CC - Organic Chemistry Impact factor: 1.654, year: 2008

Larval trematodes (Digenea) of the great pond snail, Lymnaea stagnalis (L.), (Gastropoda, Pulmonata) in Central Europe: a survey of species and key to their identification

Czech Academy of Sciences Publication Activity Database

Faltýnková, Anna; Našincová, Vanda; Kablásková, Lenka

2007-01-01

Roč. 14, č. 1 (2007), s. 39-51 ISSN 1252-607X R&D Projects: GA AV ČR IAA6022404; GA ČR GP524/07/P086; GA ČR GD524/03/H133; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Trematoda * Mollusca * cercaria * metacercaria * Lymnaea stagnalis Subject RIV: EG - Zoology Impact factor: 0.713, year: 2007

48 CFR 9904.417-60 - Illustrations.

Science.gov (United States)

2010-10-01

... expense to this construction project and the resultant acquisition cost for financial reporting purposes... accordance with 9904.414, accumulated in the construction-in-progress account for this project amounted to... consideration must be given to the rate at which costs have been incurred in accordance with 9904.417-50(a)(2...

Opportunistic nature of the mammalian microsporidia: experimental transmission of Trachipleistophora extenrec (Fungi: Microsporidia) between mammalian and insect hosts

Czech Academy of Sciences Publication Activity Database

Vávra, Jiří; Kamler, M.; Modrý, David; Koudela, Břetislav

2011-01-01

Roč. 108, č. 6 (2011), 1565-1573 ISSN 0932-0113 R&D Projects: GA ČR GD524/03/H133; GA ČR GA524/07/1003 Institutional research plan: CEZ:AV0Z60220518 Keywords : NOSEMA-ALGERAE * BRACHIOLA-ALGERAE * AIDS PATIENT * HOMINIS * INFECTION * PATHOGEN * DIPTERA * ULTRASTRUCTURE * CULICIDAE * SEQUENCES Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.149, year: 2011

Optimizing Conditions for Ultrasound Extraction of Fullerenes from Coal Matrices

Czech Academy of Sciences Publication Activity Database

Vítek, P.; Jehlička, J.; Frank, Otakar; Hamplová, Věra; Pokorná, Zdeňka; Juha, Libor; Boháček, J.

2009-01-01

Roč. 17, č. 2 (2009), s. 109-122 ISSN 1536-383X R&D Projects: GA ČR GA205/07/0772; GA ČR GA205/03/1468 Institutional research plan: CEZ:AV0Z40400503; CEZ:AV0Z10100520 Keywords : fullerene C60 * Ultrasound -assisted extraction * Extraction yield * Fullerene decomposition Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.710, year: 2009

On Bubble Rising in Countercurrent Flow

Czech Academy of Sciences Publication Activity Database

Večeř, M.; Leštinský, P.; Wichterle, K.; Růžička, Marek

2012-01-01

Roč. 10, č. 2012 (2012), A30 ISSN 1542-6580 R&D Projects: GA ČR GA104/09/0972; GA ČR GA104/07/1110 Grant - others:GA MŠMT(CZ) CZ.1.05/2.1.00/03.0069 Institutional support: RVO:67985858 Keywords : ellipsoidal bubble * bubble shape * bubble velocity Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 0.790, year: 2011

Spectral investigation of two asteroidal fireballs

Czech Academy of Sciences Publication Activity Database

Borovička, Jiří

2006-01-01

Roč. 97, 3-4 (2006), s. 279-293 ISSN 0167-9295. [Asteroids, Comets, Meteors 2005. Búzios, 07.08.2005-12.08.2005] R&D Projects: GA ČR GA205/05/0543; GA ČR GA205/03/1404 Institutional research plan: CEZ:AV0Z10030501 Keywords : asteroids * meteors * spectroscopy Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 0.252, year: 2006

Dynamical "in situ" observation of biological samples using variable pressure scanning electron microscope

Czech Academy of Sciences Publication Activity Database

Neděla, Vilém

2008-01-01

Roč. 126, - (2008), 012046:1-4 ISSN 1742-6588. [Electron Microscopy and Analysis Group Conference 2007 (EMAG 2007). Glasgow, 03.09.2007-07.09.2007] R&D Projects: GA ČR(CZ) GA102/05/0886; GA AV ČR KJB200650602 Institutional research plan: CEZ:AV0Z20650511 Keywords : biological sample * VP-SEM * dynamical experiments Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

Valorisation de l’eau par l’élevage bovin : enseignements tirés de longs suivis d’exploitations dans le plateau du Saïs

Directory of Open Access Journals (Sweden)

Mohamed Taher Sraïri

2016-10-01

Full Text Available La contrainte hydrique constitue un facteur limitant avéré de la production agricole dans un pays aride à semi-aride comme le Maroc. Dans cette étude, la valorisation de l’eau par l’élevage bovin a été étudiée, dans des exploitations du plateau du Saïs irriguant à partir de la nappe et/ou de sources. Le protocole de recherche a caractérisé les termes de la valorisation volumétrique et économique de l’eau par l’élevage bovin, par l’adoption d’une série de visites mensuelles à quatre exploitations au cours de deux années successives : 2014 et 2015. Les objectifs de ces suivis visaient : i la détermination des volumes d’eau utilisés, en prenant en compte la diversité de leurs origines (précipitations, eau d’irrigation de surface ou souterraine, et eau virtuelle correspondant aux volumes utilisés pour la production des aliments achetés à l’extérieur de l’exploitation, ii les quantités de biomasse des fourrages fauchés, iii le suivi des rations distribuées aux vaches et celles destinées à leur descendance ainsi que leurs contenus en nutriments (énergie et azote, et iv les quantités de lait et de viande produites. Les résultats démontrent que l’élevage bovin est surtout lié à l’eau pluviale et, à un degré moindre, à l’eau virtuelle puisque ces sources hydriques représentent respectivement 52,5 et 31,7 % des besoins totaux pour produire du lait et 37,9 et 57,5 % pour produire de la viande. L’élevage bovin ne mobilise que très peu l’eau souterraine qui représente en moyenne 7,6 et 0,7 % des besoins hydriques pour produire du lait et de la viande. Les empreintes hydriques moyennes pour les productions bovines, définies comme la somme des consommations d’eau de toutes origines, étaient respectivement de 1,33 m3 par litre de lait et 7,5 m3 par kg de poids vif. Les valorisations économiques de l’eau d’irrigation par l’élevage bovin étaient de 3,8 et 15,5 DH par m3

PARs for combustible gas control in advanced light water reactors

International Nuclear Information System (INIS)

Hosler, J.; Sliter, G.

1997-01-01

This paper discusses the progress being made in the United States to introduce passive autocatalytic recombiner (PAR) technology as a cost-effective alternative to electric recombiners for controlling combustible gas produced in postulated accidents in both future Advanced Light Water Reactors (ALWRs) and certain U. S. operating nuclear plants. PARs catalytically recombine hydrogen and oxygen, gradually producing heat and water vapor. They have no moving parts and are self-starting and self-feeding, even under relatively cold and wet containment conditions. Buoyancy of the hot gases they create sets up natural convective flow that promotes mixing of combustible gases in a containment. In a non-inerted ALWR containment, two approaches each employing a combination of PARs and igniters are being considered to control hydrogen in design basis and severe accidents. In pre-inerted ALWRs, PARs alone control radiolytic oxygen produced in either accident type. The paper also discusses regulatory feedback regarding these combustible gas control approaches and describes a test program being conducted by the Electric Power Research Institute (EPRI) and Electricite de France (EdF) to supplement the existing PAR test database with performance data under conditions of interest to U.S. plants. Preliminary findings from the EPRI/EdF PAR model test program are included. Successful completion of this test program and confirmatory tests being sponsored by the U. S. NRC are expected to pave the way for use of PARs in ALWRs and operating plants. (author)

75 FR 28031 - National Institute of Dental & Craniofacial Research; Notice of Closed Meetings

Science.gov (United States)

2010-05-19

... Craniofacial Research Special Emphasis Panel; Teleconference Review of R03 Applications for Mechanisms, Models... Research Special Emphasis Panel; Teleconference Review of Small Research Grants for Data Analysis and....121, Oral Diseases and Disorders Research, National Institutes of Health, HHS). Dated: May 13, 2010...

Second order magnetic phase transition and scaling analysis in iron doped manganite La{sub 0.7}Ca{sub 0.3}Mn{sub 1−x}Fe{sub x}O{sub 3} compounds

Energy Technology Data Exchange (ETDEWEB)

Ginting, Dianta [Department of Applied Physics and Institute of Natural Sciences, Kyung Hee University, Yong-in 446-701 (Korea, Republic of); Nanto, Dwi [Physics Education, Syarif Hidayatullah State Islamic University, Jakarta 15412 (Indonesia); Denny, Yus Rama [Department of Electrical Engineering, University of Sultan Ageng Tirtayasa, Banten 42435 (Indonesia); Tarigan, Kontan [Department of Mechanical Engineering, Mercu Buana University, Jakarta-Barat, Jakarta 11650 (Indonesia); Hadi, Syamsul [Department of Mechanical Engineering, State Polytechnic of Malang, East Java 65100 (Indonesia); Ihsan, Mohammad [PSTBM-BATAN, Kawasan Puspiptek Serpong, Tangerang Selatan, Banten 15314 (Indonesia); Institute of Electronic Materials, University of Wollongong, Wollongong NSW 2522 (Australia); Rhyee, Jong-Soo, E-mail: jsrhyee@khu.ac.kr [Department of Applied Physics and Institute of Natural Sciences, Kyung Hee University, Yong-in 446-701 (Korea, Republic of)

2015-12-01

We investigated magnetic properties of La{sub 0.7}Ca{sub 0.3}Mn{sub 1−x}Fe{sub x}O{sub 3} (x=0.09 and 0.11) compounds in terms of isothermal magnetization analysis and scaling behavior with various critical exponents. From the Landau theory of magnetic phase transition, we found that the paramagnetic to ferromagnetic phase transition in La{sub 0.7}Ca{sub 0.3}Mn{sub 1−x}Fe{sub x}O{sub 3} (x=0.09 and 0.11) compounds is the type of second order magnetic transition (SOMT), which contrary to the first order magnetic transition (FOMT) for low Fe-doped compounds (x<0.09) in previous reports. When we investigate the critical behavior of the compounds near T=T{sub c} by the modified Arrott plot, Kouvel–Fisher plots, and critical isothermal analysis, the estimated critical exponents β, γ, and δ are in between the theoretically predicted values for three-dimensional Heisenberg and mean-field interaction models. It is noteworthy that the scaling relations are obeyed in terms of renormalization magnetization m=ε{sup −β}M(H,ε) and renormalized field h=|ε|{sup β+γ}H. Temperature-dependent effective exponents β{sub eff} and γ{sub eff} correspond to the ones of disordered ferromagnets. It is shown that the magnetic state of the compounds is not fully described by the conventional localized-spin interaction model because the ferromagnetic interaction has itinerant character by increasing Fe-doping concentration. - Highlights: • The ferromagnetic phase transition is of second order in La{sub 0.7}Ca{sub 0.3}Mn{sub 1−x}Fe{sub x}O{sub 3}. • The critical exponents are in between the 3D Heisenberg and mean-field models. • The ferromagnetic interaction becomes more itinerant by Fe-doping.

Directed and persistent movement arises from mechanochemistry of the ParA/ParB system.

Science.gov (United States)

Hu, Longhua; Vecchiarelli, Anthony G; Mizuuchi, Kiyoshi; Neuman, Keir C; Liu, Jian

2015-12-22

The segregation of DNA before cell division is essential for faithful genetic inheritance. In many bacteria, segregation of low-copy number plasmids involves an active partition system composed of a nonspecific DNA-binding ATPase, ParA, and its stimulator protein ParB. The ParA/ParB system drives directed and persistent movement of DNA cargo both in vivo and in vitro. Filament-based models akin to actin/microtubule-driven motility were proposed for plasmid segregation mediated by ParA. Recent experiments challenge this view and suggest that ParA/ParB system motility is driven by a diffusion ratchet mechanism in which ParB-coated plasmid both creates and follows a ParA gradient on the nucleoid surface. However, the detailed mechanism of ParA/ParB-mediated directed and persistent movement remains unknown. Here, we develop a theoretical model describing ParA/ParB-mediated motility. We show that the ParA/ParB system can work as a Brownian ratchet, which effectively couples the ATPase-dependent cycling of ParA-nucleoid affinity to the motion of the ParB-bound cargo. Paradoxically, this resulting processive motion relies on quenching diffusive plasmid motion through a large number of transient ParA/ParB-mediated tethers to the nucleoid surface. Our work thus sheds light on an emergent phenomenon in which nonmotor proteins work collectively via mechanochemical coupling to propel cargos-an ingenious solution shaped by evolution to cope with the lack of processive motor proteins in bacteria.

Vacancy defects in epitaxial La0.7Sr0.3MnO3 thin films probed by a slow positron beam

International Nuclear Information System (INIS)

Jin, S W; Zhou, X Y; Wu, W B; Zhu, C F; Weng, H M; Wang, H Y; Zhang, X F; Ye, B J; Han, R D

2004-01-01

Vacancy defects in epitaxial La 0.7 Sr 0.3 MnO 3 (LSMO) thin films on LaAlO 3 substrates were detected using a variable energy positron beam. The line-shape S parameter of the epitaxial thin films deposited at different oxygen pressures was measured as a function of the implanting positron energy E. Our results show that the S parameter of the films changes non-monotonically with their deposition oxygen pressures. For the films deposited at lower oxygen pressures, the increase in S value in the films is attributed to the increase in oxygen vacancies and/or related defect-V O complexes, and for those deposited at higher oxygen pressures, the larger S parameter of the films is caused by the grain boundaries and/or metallic ion vacancies. The surface morphology of the films was also characterized to analyse the open volume defects in the LSMO films

PAR1 activation affects the neurotrophic properties of Schwann cells.

Science.gov (United States)

Pompili, Elena; Fabrizi, Cinzia; Somma, Francesca; Correani, Virginia; Maras, Bruno; Schininà, Maria Eugenia; Ciraci, Viviana; Artico, Marco; Fornai, Francesco; Fumagalli, Lorenzo

2017-03-01

Protease-activated receptor-1 (PAR1) is the prototypic member of a family of four G-protein-coupled receptors that signal in response to extracellular proteases. In the peripheral nervous system, the expression and/or the role of PARs are still poorly investigated. High PAR1 mRNA expression was found in the rat dorsal root ganglia and the signal intensity of PAR1 mRNA increased in response to sciatic nerve transection. In the sciatic nerve, functional PAR1 receptor was reported at the level of non-compacted Schwann cell myelin microvilli of the nodes of Ranvier. Schwann cells are the principal population of glial cells of the peripheral nervous system which myelinate axons playing an important role during axonal regeneration and remyelination. The present study was undertaken in order to determine if the activation of PAR1 affects the neurotrophic properties of Schwann cells. Our results suggest that the stimulation of PAR1 could potentiate the Schwann cell ability to favour nerve regeneration. In fact, the conditioned medium obtained from Schwann cell cultures challenged with a specific PAR1 activating peptide (PAR1 AP) displays increased neuroprotective and neurotrophic properties with respect to the culture medium from untreated Schwann cells. The proteomic analysis of secreted proteins in untreated and PAR1 AP-treated Schwann cells allowed the identification of factors differentially expressed in the two samples. Some of them (such as macrophage migration inhibitory factor, matrix metalloproteinase-2, decorin, syndecan 4, complement C1r subcomponent, angiogenic factor with G patch and FHA domains 1) appear to be transcriptionally regulated after PAR1 AP treatment as shown by RT-PCR. Copyright © 2017 Elsevier Inc. All rights reserved.

Phylogenetic position of Dracunculus medinensis and some related nematodes inferred from 18S rRNA

Czech Academy of Sciences Publication Activity Database

Wijová, Martina; Moravec, František; Horák, Aleš; Modrý, David; Lukeš, Julius

2005-01-01

Roč. 96, č. 2 (2005), s. 133-135 ISSN 0932-0113 R&D Projects: GA ČR GA524/03/0061 Institutional research plan: CEZ:AV0Z60220518 Keywords : Dracunculus * Nematoda * phylogeny Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.226, year: 2005

Le paludisme grave d’importation chez l’adulte: étude rétrospective de treize cas admis en réanimation à Marrakech

Science.gov (United States)

El Mezouari, El Mostafa; Belhadj, Ayoub; Ziani, Mohamed; Boughanem, Mohamed; Moutaj, Redouane

2016-01-01

Le paludisme d’importation est une affection de plus en plus fréquente en zone non endémique. Les formes graves représentent 10 % des cas de paludisme à Plasmodium falciparum. Au Maroc, plus de 50 cas de paludisme sont enregistrés chaque année dont 83 % à P. falciparum. Ont été inclus dans l’étude tous les patients ayant développé un paludisme grave, admis au service de réanimation durant la période comprise entre le 1er Novembre 2009 et le 31 décembre 2015. Les principales données épidémiologiques, les motifs d’admission, la prise en charge et l’évolution ont été étudiés. Treize patients sont retenus. L’âge moyen est de 31 ans. Tous les patients ont séjourné en afrique subsaharienne et étaient non-immuns. La chimioprophylaxie était adéquate dans 33% des cas. Le délai moyen entre le début des symptômes et l’instauration du traitement était de six jours. La parasitémie moyenne initiale était de 12 %. Les motifs d’admission en réanimation étaient un coma (15%), une convulsion (07%), une détresse respiratoire (07%), une prostration (07%), une insuffisance rénale (07%), un choc associé à un ictère et une acidose (07%) et enfin une insuffisance rénale conjuguée à un coma (07%). Tous les patients ont reçu un traitement par la quinine intraveineuse avec une dose de charge dans 100 % des cas. Le taux de mortalité était de 23 %. Les causes du décès étaient dues à la défaillance multi viscérale et au syndrome de détresse respiratoire aigu. La mortalité des formes graves du paludisme reste élevée. L’adéquation de la chimioprophylaxie associée à la précocité du diagnostic et du traitement permettrait d’améliorer significativement le pronostic de cette parasitose. PMID:28292141

Results of Preliminary Tests of PAR Bunch Cleaning

CERN Document Server

Yao, Chihyuan; Grelick, Arthur; Lumpkin, Alex H; Sereno, Nicholas S

2005-01-01

A particle accumulator ring (PAR) is used at the Advanced Photon Source (APS) to collect multiple linac bunches and compress them into a 0.3-ns (rms) single bunch for booster injection. A 9.77-MHz fundamental rf system and a 117.3-MHz harmonic rf system are employed for initial beam capture and bunch length compression. Satellite bunches with very low charge form due to rf phase drifts or beam loading change. These satellites, when injected into the booster and then into the storage ring (SR), cause bunch impurity at three buckets from the target bucket. Storage ring and booster bunch cleaning was tried but proved to be difficult due to the top-up mode of operation in the storage ring and tune drift in the booster synchrotron. Recently we implemented a PAR bunch-cleaning system with tune-modulated harmonic rf knockout. Preliminary tests gave a measured SR bunch purity of better than 10

Patērētāju uzvedības pētījums par ēdienu piegādes portālu Hungryhouse.co.uk kā e-komercijas dalībnieku.

OpenAIRE

Dembovska, Gerda

2013-01-01

Darba tēma -patērētāju uzvedības pētījums par ēdienu piegādes portālu Hungryhouse.co.uk kā e-komercijas dalībnieku. Autore apraksta patērētāja uzvedības izpētes un e-komercijas teorētiskos aspektus,analizē uzņēmuma Hungryhouse.co.uk. darbību Lielbritānijā,veic aptauju par Hungryhouse.co.uk.pastāvēšanas iespējām Latvijā. Darba mērķis -pamatojoties uz patērētāju uzvedības un e-komercijas teorētiskām atziņām,kā arī uz iedzīvotāju aptaujas rezultātiem, izpētīt ēdiena piegādes portāla Hungryho...

Un examen de l'économie politique de la violence dans les régions ...

International Development Research Centre (IDRC) Digital Library (Canada)

Mais ces démarches sont souvent freinées par la faiblesse institutionnelle, minées par des intérêts divergents ou par la corruption, et contrecarrées par de puissants réseaux illicites. Les ressources et le niveau d'influence dont jouissent ces réseaux dépassent de loin ceux dont disposent la plupart des services frontaliers et ...

Magneto-electric properties and magnetic entropy change in perovskite La{sub 0.7}Sr{sub 0.3}Mn{sub 1−x}Ti{sub x}O{sub 3}

Energy Technology Data Exchange (ETDEWEB)

Bau, Le Viet, E-mail: levietbau@hdu.edu.vn; An, Nguyen Manh

2016-12-15

The ceramic samples of La{sub 0.7}Sr{sub 0.3}Mn{sub 1−x}Ti{sub x}O{sub 3}(x=0; 0.05; 0.1; 0.2 and 0.3) were synthesized by the conventional solid state reaction method. Their electric, magnetic and magnetocaloric properties have been investigated. The transition temperature declines and a significant influence on the width of the ferro-paramagnetic phase transition is observed as increasing Ti concentration. Moreover, the sign of spin-glass is expected to exist in the high concentration samples. For fully replacing Ti{sup 4+} for Mn{sup 4+}, the canted spin state is formed. The substitution Ti for Mn increases resistivity quickly and the insulating–metallic transition temperature shifts toward lower temperature. For x>0.1 samples, the insulating state is observed even in ferromagnetic phase. The substitution Ti shifts the CME to room temperature while almost persists the value of entropy change. Although the maximum value of CME reduces slightly, the temperature range happening MCE is expended and then improves the relative cooling power. These properties could be explained in term of DE interaction and phase separation phenomenon. - Highlights: • Electro-magnetic properties and CME of La{sub 0.7}Sr{sub 0.3}Mn{sub 1-x}Ti{sub x}O{sub 3} have been investigated. • T{sub C} declines and the width of the F-M phase transition is observed as increasing Ti concentration. • For fully replacing Ti{sup 4+} for Mn{sup 4+}, the canted spin state is formed. • The substitution Ti for Mn increases resistivity quickly and T{sub P} shifts toward lower temperature. • The substitution Ti shifts CME to 300 K while almost persists the value of entropy change. • Relative cooling power (RCP) increases with substitution 5% Ti for Mn.

Reentrant spin glass behavior in polycrystalline La0.7Sr0.3Mn1-XFeXO 3

Directory of Open Access Journals (Sweden)

Xavier Jr. M.M.

2004-01-01

Full Text Available The magnetic and transport properties of the compound La0.7Sr0.3Mn1-xFe xO 3 (0.1 < x <0.4 have been studied by means of electrical resistivity, AC magnetic susceptibility, and DC magnetization. At low concentrations (x <0.1, the system displays essentially para-to-ferromagnetic transitions as the temperature is decreased, although a decrease in the magnetic moment has been observed in previous studies at temperatures a little below T C. This ferromagnetism is explained by double exchange theory in terms of the formation of Mn+3/Mn+4 ions pairs in the system. At concentrations in the range 0.1 < x <0.4 the system is more complex. Increased Fe doping not only weakens the ferromagnetic (FM order and augments the resistivity of the samples, but also induces the appearance of a reentrant spin glass phase at low temperatures (T < 60 K. Irreversibility of the magnetization measured with zero field cooling and with field cooling has been observed. In addition, the AC susceptibility peak position varies with frequency. All these effects are characteristic of spin glass behavior. The results have been interpreted based in an increase of frustration due to increasing competition between FM Mn+3/Mn+4 interactions and antiferromagnetic interactions between ions at the boundaries of Fe clusters.

Effect of a magnetic field on the permittivity of 80%La0.7Sr0.3MnO3/20%GeO2 composite

Science.gov (United States)

Kabirov, Yu. V.; Gavrilyachenko, V. G.; Bogatin, A. S.; Sitalo, E. I.; Yatsenko, V. K.

2018-01-01

The dielectric properties of a magnetoresistive conducting two-phase 80%La0.7Sr0.3MnO3/20%GeO2 (wt %) composite have been studied near the percolation threshold in magnetic fields from 0 to 15 kOe at frequencies of the measurement field from 5 kHz to 1 MHz. The samples have inductive impedances; i.e., their permittivities can be considered negative due to a high conductivity in this frequency range. The permittivity increases in magnitude in magnetic field, and the values of the magnetodielectric coefficient reach 23% at room temperature. The reasons for the effect of magnetic field on the dielectric permittivity of samples are discussed.

Characterization and Electrocatalytic Properties of Titanium-Based Ru0.3Co0.7−xCex Mixed Oxide Electrodes for Oxygen Evolution in Alkaline Solution

Directory of Open Access Journals (Sweden)

Hongjun Wu

2011-01-01

Full Text Available Ti-supported RuO2-Co3O4-CeO2 (Ru0.3Co0.7−xCex oxide, 0≤x≤0.7 electrodes were prepared by sol-gel process. The phase structure, surface morphology, and microstructure of the oxide layer were characterized by X-ray diffraction (XRD and scanning electron microscopy (SEM. Electrocatalytic activity and oxygen evolution reaction (OER kinetics on these electrodes in 1.0 mol⋅dm−3 KOH solution were studied by recording open-circuit potential, cyclic voltammetry, and polarisation curves. The results showed that the appropriate content of CeO2 could reduce the grain size and increase active surface area. The electrocatalytic activity shows a strong dependence on the CeO2 content in the film. Catalytic performance of mixed oxide electrodes with 40 mol % CeO2 was the best, with the greatest voltammetric charge, 86.23 mC⋅cm−2, and the smallest apparent activation energy for OER at 0.60 V was 22.76 kJ⋅mol−1.

48 CFR 9904.417-40 - Fundamental requirement.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Fundamental requirement... ACCOUNTING STANDARDS COST ACCOUNTING STANDARDS 9904.417-40 Fundamental requirement. The cost of money applicable to the investment in tangible and intangible capital assets being constructed, fabricated, or...

Structural and dielectric properties of Ba{sub 0.7}Sr{sub 0.3}TiO{sub 3} thin films grown by PLD

Energy Technology Data Exchange (ETDEWEB)

James, K. K.; Satish, B.; Jayaraj, M. K. [Nanophotonic and Optoelectronic Devices Laboratory, Department of Physics, Cochin University of Science and Technology, Kerala (India)

2014-01-28

Ferroelectric thin films of Ba{sub 0.7}Sr{sub 0.3}TiO{sub 3} (BST) were deposited on Si/SiO{sub 2}/TiO{sub 2}/Pt (PtSi) substrate by pulsed laser deposition (PLD). Crystalline films with perovskite structure were obtained without post-deposition annealing. Phase purity of the deposited films was confirmed by x-ray diffraction. The lowest value of FWHM obtained for the film deposited at oxygen pressure 5.4×10{sup −4} mbar and substrate temperature 600°C, indicates the high crystallinity of the film. The room temperature dielectric constant at 100 kHz was 85. Butterfly loop, which is the characteristic of ferroelectric materials, was obtained in the regime of −4 to +4V. The leakage current density was nearly 9×10{sup −13} Acm{sup −2}.

Magnetic, electrical transport and electron spin resonance studies of Fe-doped manganite LaMn0.7Fe0.3O3+δ

International Nuclear Information System (INIS)

Liu, X.J.; Li, Z.Q.; Yu, A.; Liu, M.L.; Li, W.R.; Li, B.L.; Wu, P.; Bai, H.L.; Jiang, E.Y.

2007-01-01

We have investigated the magnetic, electrical transport and electron spin resonance (ESR) properties of polycrystalline Fe-doped manganite LaMn 0.7 Fe 0.3 O 3+ δ prepared by sol-gel method. A typical cluster-glass feature is presented by DC magnetization and AC susceptibility measurements and a sharp but shallow memory effect was observed. Symmetrical Lorentzian lines of the Mn/Fe spectra were detected above 120 K, where the sample is a paramagnetic (PM) insulator. When the temperature decreases from 120 K, magnetic clusters contributed from ferromagnetic (FM) interaction between Mn 3+ and Mn 3+ /Fe 3+ ions develop and coexist with PM phase. At lower temperature, these FM clusters compete with antiferromagnetic (AFM) ones between Fe 3+ ions, which are associated with a distinct field-cooled (FC) effect in characteristic of cluster-glass state

Chemical, physical, profile and laboratory analysis oceanographic data collected aboard the Ferrel in the Gulf of Mexico from 2010-07-30 to 2010-08-03 in response to the Deepwater Horizon Oil Spill event (NODC Accession 0069062)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Chemical, physical, profile and laboratory analysis oceanographic data were collected aboard the Ferrel in the Gulf of Mexico from 2010-07-30 to 2010-08-03 in...

The role of lubracants in reactive compatibilization of polyolefin blends

Czech Academy of Sciences Publication Activity Database

Hlavatá, Drahomíra; Kruliš, Zdeněk; Horák, Zdeněk; Lednický, František; Hromádková, Jiřina

2001-01-01

Roč. 176, - (2001), s. 93-106 ISSN 1022-1360. [International Conference on Polymer Modification, Degradation and Stabilization /1./. Palermo , 03.09.2000-07.09.2000] R&D Projects: GA ČR GA106/99/0556; GA AV ČR IBS4050008; GA AV ČR KSK2050602 Institutional research plan: CEZ:AV0Z4050913 Keywords : polyolefins * recycling * reactive compatibilization Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.634, year: 2001

Structure of the mouse galectin-4 N-terminal carbohydrate-recognition domain reveals the mechanism of oligosaccharide recognition

Czech Academy of Sciences Publication Activity Database

Krejčiříková, Veronika; Pachl, Petr; Fábry, Milan; Malý, Petr; Řezáčová, Pavlína; Brynda, Jiří

2011-01-01

Roč. 67, Pt3 (2011), 204-211 ISSN 0907-4449 R&D Projects: GA ČR GA203/09/0820; GA ČR GA304/03/0090; GA ČR GA301/07/0600 Institutional research plan: CEZ:AV0Z50520514; CEZ:AV0Z50520701; CEZ:AV0Z40550506 Keywords : S-type lectins * carbohydrate binding * molecular recognition Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 12.619, year: 2011

Structural, magnetotransport and thermal properties of Sm substituted La{sub 0.7−x}Sm{sub x}Ba{sub 0.3}MnO{sub 3} (0≤x≤0.2) manganites

Energy Technology Data Exchange (ETDEWEB)

Modi, Anchit, E-mail: anchitmodi87@gmail.com [Department of Physics, Barkatullah University, Bhopal 462026 (India); Bhat, Masroor Ahmad; Pandey, Devendra K. [Department of Physics, Barkatullah University, Bhopal 462026 (India); Tarachand [UGC-DAE, Consortium for Scientific Research, University Campus, Khandwa Road, Indore 452001 (India); Bhattacharya, Shovit [Technical Physics Division, Bhabha Atomic Research Center, Mumbai 400085 (India); Gaur, N.K. [Department of Physics, Barkatullah University, Bhopal 462026 (India); Okram, G.S. [UGC-DAE, Consortium for Scientific Research, University Campus, Khandwa Road, Indore 452001 (India)

2017-02-15

In the present paper we studied the structural, magnetotransport and thermopower properties of a series of polycrystalline La{sub 0.7−x}Sm{sub x}Ba{sub 0.3}MnO{sub 3} (0≤x≤0.2) compounds which were synthesized by conventional solid state reaction techniques. The Rietveld refinement of the X-ray diffraction pattern predicts the formation of single-phase compositions and doping of La{sup 3+} by Sm{sup 3+} ion converted the chemical structure form rhombohedral (R-3C) to orthorhombic (Imma) The scanning electron microscopy show clean smooth and densified structure images be a sign of good crystalline nature of the samples. The temperature dependent electrical resistivity is measured by standard four-probe method between 5 and 300 K exhibits Metal–Insulator Transition MIT which shows the decreasing trend with increasing Sm doping content and metallic state (TT{sub p2}) are explained within the framework of variable range hopping (VRH) and small polaron hopping (SPH) models. The application of magnetic field suppresses the resistivity in entire temperature range and with increasing the Sm{sup 3+} content the samples showed very high magnetoresistance. The thermoelectric power (S) of the reported samples exhibit a crossover from positive to negative value and it increases in doped samples. The analysis of thermoelectric power data confirms the applicability of the small polaron hopping model in high temperature region and in low temperature fitted to an equation containing diffusion, magnon drag, phonon drag and electron-spin fluctuation term. An appropriate justification for the observed behavior is specified. - Highlights: • La{sub 0.7

The nature of bonding and electronic properties of graphene and benzene with iridium adatoms

Czech Academy of Sciences Publication Activity Database

Lazar, P.; Granatier, Jaroslav; Klimeš, J.; Hobza, Pavel; Otyepka, M.

2014-01-01

Roč. 16, č. 38 (2014), s. 20818-20827 ISSN 1463-9076 R&D Projects: GA ČR GBP208/12/G016 Grant - others:GA MŠk(CZ) ED2.1.00/03.0058; European Social Fund(XE) CZ.1.07/2.3.00/20.0017; European Social Fund(XE) CZ.1.07/2.3.00/20.0058 Program:ED Institutional support: RVO:61388963 Keywords : transition metal atoms * augmented wave method * CASPT2 Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.493, year: 2014

L'Asie du Sud peut-elle éliminer les obstacles au travail rémunéré ...

International Development Research Centre (IDRC) Digital Library (Canada)

22 janv. 2018 ... Il est donc prioritaire d'élaborer et de mettre en place des politiques ... à la vie économique et qui reconnaissent et valorisent les soins non ... par semaine aux activités professionnelles et non professionnelles ... par le CRDI au Bangladesh a révélé qu'une combinaison de formation, ... Tous droits réservés.

Stable generator of polydisperse aerosol

Czech Academy of Sciences Publication Activity Database

Mikuška, Pavel

2001-01-01

Roč. 32, Suppl. 1 (2001), s. S823-S824 ISSN 0021-8502. [European Aerosol Conference 2001. Leipzig, 03.09.2001-07.09.2001] R&D Projects: GA AV ČR IAA4031105 Institutional research plan: CEZ:AV0Z4031919 Keywords : aerosol generator * fine aerosol * polydisperse aerosol Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 1.605, year: 2001

Antimicrobial-resistant Enterobacteriaceae from humans and wildlife in Dzanga-Sangha Protected Area, Central African Republic

Czech Academy of Sciences Publication Activity Database

Janatová, M.; Albrechtová, K.; Petrželková, Klára Judita; Dolejská, M.; Papoušek, I.; Masaříková, M.; Čížek, A.; Todd, A.; Shutt, K.; Kalousová, Barbora; Profousová-Pšenková, I.; Modrý, D.; Literák, I.

2014-01-01

Roč. 171, 3-4 (2014), s. 422-431 ISSN 0378-1135. [Symposium on Antimicrobial Resistance in Animals and the Environment /5./. Ghent, 30.06.2013-03.07.2013] R&D Projects: GA ČR GA206/09/0927 Institutional support: RVO:68081766 Keywords : ESBL * PMQR * Enterobacteriaceae * Resistance * Gorilla Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.511, year: 2014

Firefly luciferase gene contains a cryptic promoter

Czech Academy of Sciences Publication Activity Database

Vopálenský, V.; Mašek, T.; Horváth, Ondřej; Vicenová, B.; Mokrejš, M.; Pospíšek, M.

2008-01-01

Roč. 14, č. 9 (2008), s. 1720-1729 ISSN 1355-8382 Grant - others:GAČR(CZ) GA204/03/1487; GAČR(CZ) GA301/07/0607; Mšk(CZ) LC06066 Program:LC Institutional research plan: CEZ:AV0Z50520514 Keywords : luciferase * cryptic promoter * hepatitis C virus Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.018, year: 2008

Klíčové faktory určující chemickou diverzitu aluviálních vod

Czech Academy of Sciences Publication Activity Database

Pithart, David; Pechar, Libor

3,21, 2-3 (2004), s. 269-273 ISSN 1212-0731. [Agroregion 2004. České Budějovice, 06.09.2004-07.09.2004] R&D Projects: GA MŽP SM/640/18/03; GA ČR GA206/01/1113 Institutional research plan: CEZ:AV0Z6087904 Keywords : riparian zone * alluvial pools * water chemistry Subject RIV: DA - Hydrology ; Limnology

Transition elements in tabulate coral skeletons: seawater vs. sediment

Czech Academy of Sciences Publication Activity Database

Hladil, Jindřich; Voltr, J.

2003-01-01

Roč. 7, 9th International Symposium on Fossil Cnidaria and Porifera Abstracts. (2003), s. 36 ISSN 1608-8166. [International Symposium on Fossil Cnidaria and Porifera /9./. 03.08.2003-07.08.2003, Graz] R&D Projects: GA AV ČR IAA3013209 Institutional research plan: CEZ:AV0Z3013912 Keywords : transition elements * coral increments * Devonian Subject RIV: DB - Geology ; Mineralogy

Isolation of the NHA1 gene from two Debaryomyces hansenii strains

Czech Academy of Sciences Publication Activity Database

Velková, Klára; Sychrová, Hana

2005-01-01

Roč. 22, č. S1 (2005), S178-S178 ISSN 0749-503X. [International Conference on Yeast Genetics and Molecular Biology /22./. 07.08.2005-12.08.2005, Bratislava] R&D Projects: GA ČR(CZ) GD204/03/H066 Institutional research plan: CEZ:AV0Z50110509 Keywords : Debaryomyces hansenii * Na+/H+ antiporter Subject RIV: EE - Microbiology, Virology

Polymorphisms of ST2-IL18R1-IL18RAP gene cluster: a new risk for autoimmune thyroid diseases.

Science.gov (United States)

Wang, X; Zhu, Y F; Li, D M; Qin, Q; Wang, Q; Muhali, F S; Jiang, W J; Zhang, J A

2016-02-01

Interleukin 33 (IL33) / ST2 pathway and ST2-interlukin18 receptor1-interlukin18 receptor accessory protein (ST2-IL18R1-IL18RAP) gene cluster have been involved in many autoimmune diseases but few report in autoimmune thyroid diseases (AITD). In this study, we investigated whether polymorphisms of IL33, ST2, IL18R1, and IL18RAP are associated with Graves' disease (GD) and Hashimoto's thyroiditis (HT), two major forms of AITD, among a Chinese population. A total of 11 SNPs were explored in a case-control study including 417 patients with GD, 250 HT patients and 301 controls, including rs1929992, rs10975519, rs10208293, rs6543116, rs1041973, rs3732127, rs11465597, rs1035130, rs2293225, rs1035127, rs917997 of IL 33, ST2-IL18R1-IL18RAP gene cluster. Genotyping of these SNPs was performed using matrix-assisted laser desorption / ionization-time-of-flight mass spectrometer (MALDI-TOF-MS) platform from Sequenom. The frequencies of allele A and AA+AG genotype of rs6543116 (ST2) in HT patients were significantly increased compared with those of the controls (P = 0.029/0.021, OR = 1.31/1.62). And in another SNP rs917997, AA+AG genotype presented an increased frequency in HT subjects compared with controls (P = 0.046, OR = 1.53). Furthermore, the haplotype GAGCCCG from ST2-IL18R1-IL18RAP gene cluster (rs6543116, rs1041973, rs1035130, rs3732127, rs1035127, rs2293225, rs917997) was associated with increased susceptibility to GD with an OR of 2.03 (P = 0.022, 95% CI = 1.07-3.86). Some SNPs of ST2-IL18R1-IL18RAP gene cluster might increase the risk of susceptibility of HT and GD in Chinese Han population. © 2015 John Wiley & Sons Ltd.