
Sample records for inhibitor phenylmethanesulfonyl fluoride

  1. Some Investigations on Protease Enzyme Production Kinetics Using Bacillus licheniformis BBRC 100053 and Effects of Inhibitors on Protease Activity

    Directory of Open Access Journals (Sweden)

    Zahra Ghobadi Nejad


    Full Text Available Due to great commercial application of protease, it is necessary to study kinetic characterization of this enzyme in order to improve design of enzymatic reactors. In this study, mathematical modeling of protease enzyme production kinetics which is derived from Bacillus licheniformis BBRC 100053 was studied (at 37°C, pH 10 after 73 h in stationary phase, and 150 rpm. The aim of the present paper was to determine the best kinetic model and kinetic parameters for production of protease and calculating Ki (inhibition constant of different inhibitors to find the most effective one. The kinetic parameters Km (Michaelis-Menten constant and Vm (maximum rate were calculated 0.626 mM and 0.0523 mM/min. According to the experimental results, using DFP (diisopropyl fluorophosphate and PMSF (phenylmethanesulfonyl fluoride as inhibitors almost 50% of the enzyme activity could be inhibited when their concentrations were 0.525 and 0.541 mM, respectively. Ki for DFP and PMSF were 0.46 and 0.56 mM, respectively. Kinetic analysis showed that the Lineweaver-Burk model was the best fitting model for protease production kinetics DFP was more effective than PMSF and both of them should be covered in the group of noncompetitive inhibitors.

  2. Minimally invasive monitoring of skeletal muscle hypermetabolism induced by the phosphodiesterase-III-inhibitor milrinone and sodium fluoride. (United States)

    Schuster, Frank; Johannsen, Stephan; Roewer, Norbert; Anetseder, Martin


    We hypothesized that the phosphodiesterase-III-inhibitor milrinone and the non-specific G-protein activator sodium fluoride increase the skeletal muscular lactate levels as a sign of a hypermetabolic response. With approval of the local animal care committee Sprague-Dawley rats were killed and artificially perfused either with Ringer's solution or sodium fluoride 110 mM, while milrinone 1.32 mM or Ringer's solution at 1 μl/min was applied via microdialysis probes in both hind limbs. Lactate was measured spectrophotometrically in the dialysate. Baseline lactate levels before drug application did not differ between hind limbs. Local infusion of milrinone via microdialysis did not significantly increase intramuscular lactate concentrations compared with the Ringer control group. Muscular perfusion with sodium fluoride resulted in a significant increase of lactate and was potentiated by combination with local milrinone. Phosphodiesterase-III-inhibition alone does not significantly influence the lactate levels in skeletal muscle of sacrificed rats. Sodium fluoride infusion leads to an intramuscular lactate increase, which was further potentiated by local inhibition of phosphodiesterase-III. The fluoride-mediated hypermetabolic response following sodium fluoride could be a possible explanation for the observed myotoxic adverse effects in individuals treated by fluoride-containing agents. © 2012 The Authors. JPP © 2012. Royal Pharmaceutical Society.

  3. Pancreatic elastase in human serum. Determination by radioimmunoassay

    Energy Technology Data Exchange (ETDEWEB)

    Geokas, M.C. (Univ. of California, Davis); Brodrick, J.W.; Johnson, J.H.; Largman, C.


    This study demonstrates that a serine endopeptidase of pancreatic origin (elastase 2) circulates in human blood. A specific and highly sensitive radioimmunoassay has been developed for pancreatic elastase 2 in human serum. The inactivation of elastase 2 employed as radioiodinated tracer with an active site-specific reagent (phenylmethanesulfonyl fluoride) was necessary to prevent its binding by serum ..cap alpha../sub 1/-antitrypsin and ..cap alpha../sub 2/-macroglobulin while maintaining its immunoreactivity. The assay is based upon competition of standard human pancreatic elastase 2 with /sup 125/I-labeled phenylmethanesulfonyl elastase 2 for specific antibody binding sites, after which a second antibody precipitation step is used to separate bound from free /sup 125/I-labeled phenylmethanesulfonyl elastase 2. The minimum detectable concentration of elastase 2 was 0.9 ng/ml. The average normal fasting serum level determined was 71 ng/ml, approximately 80-fold greater than the minimum detectable amount.

  4. JNK and NADPH Oxidase Involved in Fluoride-Induced Oxidative Stress in BV-2 Microglia Cells

    Directory of Open Access Journals (Sweden)

    Ling Yan


    Full Text Available Excessive fluoride may cause central nervous system (CNS dysfunction, and oxidative stress is a recognized mode of action of fluoride toxicity. In CNS, activated microglial cells can release more reactive oxygen species (ROS, and NADPH oxidase (NOX is the major enzyme for the production of extracellular superoxide in microglia. ROS have been characterized as an important secondary messenger and modulator for various mammalian intracellular signaling pathways, including the MAPK pathways. In this study we examined ROS production and TNF-α, IL-1β inflammatory cytokines releasing, and the expression of MAPKs in BV-2 microglia cells treated with fluoride. We found that fluoride increased JNK phosphorylation level of BV-2 cells and pretreatment with JNK inhibitor SP600125 markedly reduced the levels of intracellular and NO. NOX inhibitor apocynin and iNOS inhibitor SMT dramatically decreased NaF-induced ROS and NO generations, respectively. Antioxidant melatonin (MEL resulted in a reduction in JNK phosphorylation in fluoride-stimulated BV-2 microglia. The results confirmed that NOX and iNOS played an important role in fluoride inducing oxidative stress and NO production and JNK took part in the oxidative stress induced by fluoride and meanwhile also could be activated by ROS in fluoride-treated BV-2 cells.

  5. JNK and NADPH Oxidase Involved in Fluoride-Induced Oxidative Stress in BV-2 Microglia Cells (United States)

    Yan, Ling; Liu, Shengnan; Wang, Chen; Wang, Fei; Song, Yingli; Yan, Nan; Xi, Shuhua; Liu, Ziyou; Sun, Guifan


    Excessive fluoride may cause central nervous system (CNS) dysfunction, and oxidative stress is a recognized mode of action of fluoride toxicity. In CNS, activated microglial cells can release more reactive oxygen species (ROS), and NADPH oxidase (NOX) is the major enzyme for the production of extracellular superoxide in microglia. ROS have been characterized as an important secondary messenger and modulator for various mammalian intracellular signaling pathways, including the MAPK pathways. In this study we examined ROS production and TNF-α, IL-1β inflammatory cytokines releasing, and the expression of MAPKs in BV-2 microglia cells treated with fluoride. We found that fluoride increased JNK phosphorylation level of BV-2 cells and pretreatment with JNK inhibitor SP600125 markedly reduced the levels of intracellular O2 ·− and NO. NOX inhibitor apocynin and iNOS inhibitor SMT dramatically decreased NaF-induced ROS and NO generations, respectively. Antioxidant melatonin (MEL) resulted in a reduction in JNK phosphorylation in fluoride-stimulated BV-2 microglia. The results confirmed that NOX and iNOS played an important role in fluoride inducing oxidative stress and NO production and JNK took part in the oxidative stress induced by fluoride and meanwhile also could be activated by ROS in fluoride-treated BV-2 cells. PMID:24072958

  6. Fluoride-induced IL-8 release in human epithelial lung cells: Relationship to EGF-receptor-, SRC- and MAP-kinase activation

    International Nuclear Information System (INIS)

    Refsnes, Magne; Skuland, Tonje; Schwarze, Per E.; Ovrevik, Johan; Lag, Marit


    Exposure of human epithelial lung cells to fluorides is known to induce a marked increase in the release of interleukin (IL)-8, a chemokine involved in neutrophil recruitment. In the present study, the involvement of mitogen-activating protein kinases (MAPKs), the role of upstream activation of Src family kinases (SFKs), epidermal growth factor receptor (EGFR) activation and the interrelationships between these pathways in fluoride-induced IL-8 were examined in a human epithelial lung cell line (A549). Sodium fluoride strongly activated MAPK, in particular JNK1/2 and p38. The ERK1/2-inhibitor PD98059, the p38-inhibitor SB202190 and the JNK1/2-inhibitor SP600125 partially inhibited the fluoride-induced IL-8 response. Combinations of these inhibitors reduced the responses nearly to basal levels. Treatment with siRNA against JNK2 also reduced the IL-8 response to fluoride. Furthermore, fluoride activated SFKs, which was abolished by the SFK-inhibitor PP2. PP2 substantially inhibited the increased levels of IL-8, and partially reduced the fluoride-induced activation of ERK1/2, p38 and JNK1/2. Fluoride exposure also led to a phosphorylation of the EGFR, that was partially inhibited by PP2. AG1478, an EGFR-inhibitor, partially reduced the fluoride-induced IL-8 response and the phosphorylation of JNK1/2 and ERK1/2, but less the phosphorylation of p38. The effects of AG1478 were less than that of PP2. In conclusion, our findings suggest that the fluoride-induced IL-8 release involves the combined activation of ERK1/2, JNK1/2 and p38, and that the phosphorylation of these kinases, and in particular JNK1/2 and ERK1/2, partly, is mediated via a SFK-dependent EGFR-linked pathway. SFK-dependent, but EGFR-independent mechanisms seem important, and especially for phosphorylation of p38

  7. Fluoride absorption: independence from plasma fluoride levels

    International Nuclear Information System (INIS)

    Whitford, G.M.; Williams, J.L.


    The concept that there are physiologic mechanisms to homeostatically regulate plasma fluoride concentrations has been supported by results in the literature suggesting an inverse relationship between plasma fluoride levels and the absorption of the ion from the gastrointestinal tract of the rat. The validity of the relationship was questioned because of possible problems in the experimental design. The present work used four different methods to evaluate the effect of plasma fluoride levels on the absorption of the ion in rats: (i) the percentage of the daily fluoride intake that was excreted in the urine; (ii) the concentration of fluoride in femur epiphyses; (iii) the net areas under the time-plasma fluoride concentration curves after intragastric fluoride doses; and (iv) the residual amounts or fluoride in the gastrointestinal tracts after the intragastric fluoride doses. None of these methods indicated that plasma fluoride levels influence the rate or the degree or fluoride absorption. It was concluded that, unless extremely high plasma fluoride levels are involved (pharmacologic or toxic doses), the absorption of the ion is independent of plasma levels. The results provide further evidence that plasma fluoride concentrations are not homeostatically regulated

  8. Fluoride varnish or fluoride mouth rinse?

    DEFF Research Database (Denmark)

    Keller, M K; Klausen, BJ; Twetman, S


    OBJECTIVE: In many Danish communities, school-based fluoride programs are offered to children with high caries risk in adjunct to tooth brushing. The purpose of this field trial was to compare the caries-preventive effectiveness of two different fluoride programs in 6-12 year olds. BASIC RESEARCH...... different schools were enrolled after informed consent and their class unit was randomly allocated to one of two fluoride programs. INTERVENTIONS: One group received a semi-annual fluoride varnish applications (FV) and the other group continued with an existing program with fluoride mouth rinses once per...... in caries development over two years among children participating in a school-based fluoride varnish or mouth rinse program....

  9. Fluoride release from fluoride varnishes under acidic conditions. (United States)

    Lippert, F


    The aim was to investigate the in vitro fluoride release from fluoride varnishes under acidic conditions. Poly(methyl methacrylate) blocks (Perspex, n=3 per group) were painted with 80 ± 5 mg fluoride varnish (n=10) and placed into artificial saliva for 30 min. Then, blocks were placed into either 1% citric acid (pH 2.27) or 0.3% citric acid (pH 3.75) solutions (n=3 per solution and varnish) for 30 min with the solutions being replaced every 5 min. Saliva and acid solutions were analyzed for fluoride content. Data were analyzed using three-way ANOVA (varnish, solution, time). The three-way interaction was significant (p>0.0001). Fluoride release and release patterns varied considerably between varnishes. Fluoride release in saliva varied by a factor of more than 10 between varnishes. Some varnishes (CavityShield, Nupro, ProFluorid, Vanish) showed higher fluoride release in saliva than during the first 5 min of acid exposure, whereas other varnishes (Acclean, Enamel-Pro, MI Varnish, Vella) showed the opposite behavior. There was little difference between acidic solutions. Fluoride release from fluoride varnishes varies considerably and also depends on the dissolution medium. Bearing in mind the limitations of laboratory research, the consumption of acidic drinks after fluoride varnish application should be avoided to optimize the benefit/risk ratio.

  10. Fluoridated Water (United States)

    ... Genetics Services Directory Cancer Prevention Overview Research Fluoridated Water On This Page What is fluoride, and where is it found? What is water fluoridation? When did water fluoridation begin in the ...

  11. Urinary fluoride excretion after application of fluoride varnish and use of fluoride toothpaste in young children

    DEFF Research Database (Denmark)

    Lockner, Frida; Twetman, Svante; Stecksén-Blicks, Christina


    BACKGROUND: The efficacy and safety of combined use of topical fluoride products are essential issues that must be monitored. AIM: To assess urinary excretion of fluoride after application of two different dental varnishes containing 2.26% fluoride in 3- to 4-year-old children and to compare...... the levels with and without parallel use of fluoride toothpaste. DESIGN: Fifteen healthy children were enrolled to a randomized crossover trial that was performed in two parts: Part I with twice-daily tooth brushing with fluoride toothpaste and Part II with twice-daily brushing with a non-fluoride toothpaste....... After a 1-week run-in period, 0.1 mL of the two fluoride varnishes (Duraphat and Profluorid Varnish) was topically applied in a randomized order. Baseline and experimental urine was collected during 6-h periods. The fluoride content was determined with an ion-sensitive electrode. RESULTS...

  12. Non-ferrous metals, anorganic and organic materials resistent to fluorides

    International Nuclear Information System (INIS)

    Hauffe, K.


    Aluminium and its alloys are resistant in fluoride solutions up to 400 K. Aluminium is also a suitable reactor material for the thermal decomposition of acidic fluorides between 750 and 825 K. Brass corrodes at room temperature in a 0,1 m KF solution with and without inhibitors very slowly ( -1 ). Nickel and the nickel alloys Inconel 600, Hastelloy N and Monel 500 are the most resistant materials against fluoride solutions and melts. A similar behavior exhibit zirconium-titanium-iron and zirconium-titanium-molybdenum alloys, respectively. From the inorganic compounds, compressed graphite, Al 2 O 3 and hexaborides of earth and rare earth metals, particularly LaB 6 , are extraordinarily resistant against fluorine ions at high temperatures. If the reaction temperature remains below 370 K, then polymers and resins, e.g. polyolefines, PVC, acrylic and epoxy resins and fluorcarbon resins can be employed as coating or compound material (resin + carbon fibers) resistant against fluorine ions up to 370 K. (orig.) [de

  13. Effect of biocides and anionic homopolymeric inhibitors on the ...

    African Journals Online (AJOL)

    This paper describes the effect of biocides and of the anionic homopolymeric inhibitors on the precipitation behavior of calcium fluoride (CaF2).The efficiency of inhibitors in the presence and absence of biocides was calculated using the half-life (t1/2) approach, where 50% of the concentration has been precipitated.

  14. Fluoride (United States)

    Opalescence® ... Fluoride is used to prevent tooth decay. It is taken up by teeth and helps to strengthen ... and block the cavity-forming action of bacteria. Fluoride usually is prescribed for children and adults whose ...

  15. Other Fluoride Products (United States)

    ... Private Wells Infant Formula Fluorosis Public Health Service Recommendation Water Operators & Engineers Water Fluoridation Additives Shortages of Fluoridation Additives Drinking Water Pipe Systems CDC-Sponsored Water Fluoridation Training Links to Other ...

  16. Industrial fluoride pollution: chronic fluoride poisoning in Cornwall Island cattle

    Energy Technology Data Exchange (ETDEWEB)

    Krook, L.; Maylin, G.A.


    An aluminum plant on the south bank of the St. Lawrence River, southwest of Cornwall Island, Ontario, Canada, has emitted 0.816 metric tons of fluoride daily since 1973. Considerably higher amounts were emitted from 1959 to 1973. The plant was designated as the major source of fluoride emissions impacting on Cornwall Island. Cattle located on this island showed signs of chronic fluoride poisoning. This poisoning was manifested clinically by stunted growth and dental fluorosis to a degree of severe interference with drinking and mastication. This Cornwall Island herds study indicates that the established tolerance level of fluoride for performance of dairy and beef cattle is not valid since the tolerance level was set based on experiments with healthy calves which were exposed to dietary fluoride from 3 to 4 months of age and not on cattle which were chronically exposed to fluoride from conception to death. 56 references.

  17. Urinary fluoride excretion in preschool children after intake of fluoridated milk and use of fluoride-containing toothpaste

    DEFF Research Database (Denmark)

    Norman, M; Twetman, S; Hultgren Talvilahti, A


    Objective: To assess the urinary fluoride excretion in preschool children after drinking fluoridated milk with 0.185 mg F and 0.375 mg F and to study the impact of use of fluoride toothpaste. Basic research design: Double-blind cross-over study. Participants: Nine healthy children, 2.5-4.5 years...

  18. Effects of sodium fluoride on MAPKs signaling pathway in the gills of a freshwater teleost, Cyprinus carpio. (United States)

    Cao, Jinling; Chen, Jianjie; Wang, Jundong; Klerks, Paul; Xie, Lingtian


    Exposure to elevated levels of fluoride can cause a variety of adverse effects in fish. Previously we showed that fluoride causes injuries and apoptosis in the gills of Cyprinus carpio. In this study, the effects of fluoride on caspase-3 activity and on accumulation of proteins in the MAPKs pathways were evaluated using Western blotting and immunohistochemistry methods in vivo and in vitro. In vivo experiments showed that the caspase-3 activity increased with fluoride exposure level in a dose-dependent pattern Western blotting and immunohistochemistry results indicated that ERK relative activation tended to decrease as a function of fluoride exposure concentration. In contrast, relative activation of JNK increased with fluoride exposure level. Fluoride exposure did not appear to affect p38 activation. Furthermore, pretreatment of branchial cells with MAPK-specific inhibitors effectively prevented JNK induction and ERK inhibition, respectively, as well as reversed caspase-3 activity in fluoride-treated branchial cells. Our results indicate that activation of JNK and inactivation of ERK were caused by increased ROS and decreased antioxidant capacity in the gills of chronically exposed C. carpio described previously, which eventually caused the observed apoptosis in the fluoride-exposed gills and cells in C. carpio. JNK activation and ERK inactivation mechanism play a crucial role in gill impairment induced by chronic fluorosis. These findings contribute to a better understanding of the initial molecular and cellular events in the gill of fish chronically exposed to fluoride. Copyright © 2014 Elsevier B.V. All rights reserved.

  19. Oral fluoride retention after professional topical application in children with caries activity: comparison between 1.23% fluoride foam and fluoride gel

    Directory of Open Access Journals (Sweden)

    Cecília Claudia Costa Ribeiro


    Full Text Available Objective: This study evaluated fluoride retention in the saliva of children with caries activity after topical fluoride application in the form of gel and foam. Methods: A cross-sectional, blind and randomized study, conducted with ten caries-active children aged between 8 and 10 years, in two stage, with a washout interval of two weeks between them. The treatments consisted of: a application of 2mL acidulated phosphate fluoride of the gel type in a mold and b application of 2mL acidulated phosphate fluoride of the foam type in a mold. After the washout, the treatments were inverted. Non-stimulated saliva was collected from the children at the times of 5, 15, 30 and 60 minutes after topical fluoride application. For statistical analysis the Student’s-t test was used, with a level of significance of 5%. Results: Saliva analysis was performed using a fluoride-specific electrode (ISE25F/ Radiometer, Copenhagen, Denmark at the Aquatic Science Center of the Federal University of Marana, which revealed differences after 5 minutes (p=0.0055 and 15 minutes (p=0.0208. The topical application of fluoride in the gel form revealed a higher concentration of fluoride in the saliva. Conclusion: There were differences in the retention of fluoride in the saliva of children with caries activity after the topical application of fluoride gel and the topical application of fluoride foam after 5 and 15 minutes of their application. The topical application of fluoride foam is recommended, on the basis of the lower probability of toxicity during its use.

  20. Eukaryotic resistance to fluoride toxicity mediated by a widespread family of fluoride export proteins. (United States)

    Li, Sanshu; Smith, Kathryn D; Davis, Jared H; Gordon, Patricia B; Breaker, Ronald R; Strobel, Scott A


    Fluorine is an abundant element and is toxic to organisms from bacteria to humans, but the mechanisms by which eukaryotes resist fluoride toxicity are unknown. The Escherichia coli gene crcB was recently shown to be regulated by a fluoride-responsive riboswitch, implicating it in fluoride response. There are >8,000 crcB homologs across all domains of life, indicating that it has an important role in biology. Here we demonstrate that eukaryotic homologs [renamed FEX (fluoride exporter)] function in fluoride export. FEX KOs in three eukaryotic model organisms, Neurospora crassa, Saccharomyces cerevisiae, and Candida albicans, are highly sensitized to fluoride (>200-fold) but not to other halides. Some of these KO strains are unable to grow in fluoride concentrations found in tap water. Using the radioactive isotope of fluoride, (18)F, we developed an assay to measure the intracellular fluoride concentration and show that the FEX deletion strains accumulate fluoride in excess of the external concentration, providing direct evidence of FEX function in fluoride efflux. In addition, they are more sensitive to lower pH in the presence of fluoride. These results demonstrate that eukaryotic FEX genes encode a previously unrecognized class of fluoride exporter necessary for survival in standard environmental conditions.

  1. No Calcium-Fluoride-Like Deposits Detected in Plaque Shortly after a Sodium Fluoride Mouthrinse


    Vogel, G.L.; Tenuta, L.M.A.; Schumacher, G.E.; Chow, L.C.


    Plaque ‘calcium-fluoride-like’ (CaF2-like) and fluoride deposits held by biological/bacterial calcium fluoride (Ca-F) bonds appear to be the source of cariostatic concentrations of fluoride in plaque fluid. The aim of this study was to quantify the amounts of plaque fluoride held in these reservoirs after a sodium fluoride rinse. 30 and 60 min after a 228 μg/g fluoride rinse, plaque samples were collected from 11 volunteers. Each sample was homogenized, split into 2 aliquots (aliquots 1 and 2...

  2. Urinary fluoride output in children following the use of a dual-fluoride varnish formulation

    Directory of Open Access Journals (Sweden)

    Kelly Polido Kaneshiro Olympio


    Full Text Available OBJECTIVE: This study evaluated the bioavailability of fluoride after topical application of a dual-fluoride varnish commercially available in Brazil, when compared to DuraphatTM. MATERIAL AND METHODS: The urinary fluoride output was evaluated in seven 5-year-old children after application of the fluoride varnishes, in two different phases. In the first phase (I, children received topical application of the fluoride varnish Duofluorid XII (2.92% fluorine, calcium fluoride + 2.71% fluorine, sodium fluoride, FGM TM. After 1-month interval (phase II, the same amount (0.2 mL of the fluoride varnish Duraphat (2.26% fluorine, sodium fluoride, ColgateTM was applied. Before each application all the volunteers brushed their teeth with placebo dentifrice for 7 days. Urinary collections were carried out 24 h prior up to 48 h after the applications. Fluoride intake from the diet was also estimated. Fluoride concentration in diet samples and urine was analyzed with the fluoride ion-specific electrode and a miniature calomel reference electrode coupled to a potentiometer. Data were tested by ANOVA and Tukey's post hoc test (p<0.05. RESULTS: There were significant differences in the urinary fluoride output between phases I and II. The use of Duofluorid XII did not significantly increase the urinary fluoride output, when compared to baseline levels. The application of Duraphat caused a transitory increase in the urinary fluoride output, returning to baseline levels 48 h after its use. CONCLUSIONS: The tested varnish formulation, which has been shown to be effective in in vitro studies, also can be considered safe.

  3. Fluoride Rinses, Gels and Foams

    DEFF Research Database (Denmark)

    Twetman, Svante; Keller, Mette K


    AIM: The aim of this conference paper was to systematically review the quality of evidence and summarize the findings of clinical trials published after 2002 using fluoride mouth rinses, fluoride gels or foams for the prevention of dental caries. METHODS: Relevant papers were selected after...... (6 on fluoride mouth rinse, 10 on fluoride gel and 3 on fluoride foam); 6 had a low risk of bias while 2 had a moderate risk. All fluoride measures appeared to be beneficial in preventing crown caries and reversing root caries, but the quality of evidence was graded as low for fluoride mouth rinse......, moderate for fluoride gel and very low for acidulated fluoride foam. No conclusions could be drawn on the cost-effectiveness. CONCLUSIONS: This review, covering the recent decade, has further substantiated the evidence for a caries-preventive effect of fluoride mouth rinse, fluoride gel and foam...

  4. Metabolomic Effects of Xylitol and Fluoride on Plaque Biofilm in Vivo (United States)

    Takahashi, N.; Washio, J.


    Dental caries is initiated by demineralization of the tooth surface through acid production from sugar by plaque biofilm. Fluoride and xylitol have been used worldwide as caries-preventive reagents, based on in vitro-proven inhibitory mechanisms on bacterial acid production. We attempted to confirm the inhibitory mechanisms of fluoride and xylitol in vivo by performing metabolome analysis on the central carbon metabolism in supragingival plaque using the combination of capillary electrophoresis and a time-of-flight mass spectrometer. Fluoride (225 and 900 ppm F−) inhibited lactate production from 10% glucose by 34% and 46%, respectively, along with the increase in 3-phosphoglycerate and the decrease in phosphoenolpyruvate in the EMP pathway in supragingival plaque. These results confirmed that fluoride inhibited bacterial enolase in the EMP pathway and subsequently repressed acid production in vivo. In contrast, 10% xylitol had no effect on acid production and the metabolome profile in supragingival plaque, although xylitol 5-phosphate was produced. These results suggest that xylitol is not an inhibitor of plaque acid production but rather a non-fermentative sugar alcohol. Metabolome analyses of plaque biofilm can be applied for monitoring the efficacy of dietary components and medicines for plaque biofilm, leading to the development of effective plaque control. PMID:21940519

  5. Metabolomic effects of xylitol and fluoride on plaque biofilm in vivo. (United States)

    Takahashi, N; Washio, J


    Dental caries is initiated by demineralization of the tooth surface through acid production from sugar by plaque biofilm. Fluoride and xylitol have been used worldwide as caries-preventive reagents, based on in vitro-proven inhibitory mechanisms on bacterial acid production. We attempted to confirm the inhibitory mechanisms of fluoride and xylitol in vivo by performing metabolome analysis on the central carbon metabolism in supragingival plaque using the combination of capillary electrophoresis and a time-of-flight mass spectrometer. Fluoride (225 and 900 ppm F(-)) inhibited lactate production from 10% glucose by 34% and 46%, respectively, along with the increase in 3-phosphoglycerate and the decrease in phosphoenolpyruvate in the EMP pathway in supragingival plaque. These results confirmed that fluoride inhibited bacterial enolase in the EMP pathway and subsequently repressed acid production in vivo. In contrast, 10% xylitol had no effect on acid production and the metabolome profile in supragingival plaque, although xylitol 5-phosphate was produced. These results suggest that xylitol is not an inhibitor of plaque acid production but rather a non-fermentative sugar alcohol. Metabolome analyses of plaque biofilm can be applied for monitoring the efficacy of dietary components and medicines for plaque biofilm, leading to the development of effective plaque control.

  6. The cariostatic mechanisms of fluoride

    Directory of Open Access Journals (Sweden)

    Kata Rošin-Grget


    Full Text Available This article discusses the possible cariostatic mechanisms of the action of fluoride. In the past, fluoride inhibition of caries was ascribed to reduced solubility of enamel due to incorporation of fluoride (F– into the enamel minerals. The present evidence from clinical and laboratory studies suggests that the caries-preventive mode of action of fluoride is mainly topical. There is convincing evidence that fluoride has a major effect on demineralisation and remineralisation of dental hard tissue. The source of this fluoride could either be fluorapatite (formed due to the incorporation of fluoride into enamel or calcium fluoride (CaF2-like precipitates, which are formed on the enamel and in the plaque after application of topical fluoride. Calcium fluoride deposits are protected from rapid dissolution by a phosphate –protein coating of salivary origin. At lower pH, the coating is lost and an increased dissolution rate of calcium fluoride occurs. The CaF2, therefore, act as an efficient source of free fluoride ions during the cariogenic challenge. The current evidence indicates that fluoride has a direct and indirect effect on bacterial cells, although the in vivo implications of this are still not clear. Conclusion. A better understanding of the mechanisms of the action of fluoride is very important for caries prevention and control. The effectiveness of fluoride as a cariostatic agent depends on the availability of free fluoride in plaque during cariogenic challenge, i.e. during acid production. Thus, a constant supply of low levels of fluoride in biofilm/saliva/dental interference is considered the most beneficial in preventing dental caries.

  7. The cariostatic mechanisms of fluoride. (United States)

    Rošin-Grget, Kata; Peroš, Kristina; Sutej, Ivana; Bašić, Krešimir


    This article discusses the possible cariostatic mechanisms of the action of fluoride. In the past, fluoride inhibition of caries was ascribed to reduced solubility of enamel due to incorporation of fluoride (F-) into the enamel minerals. The present evidence from clinical and laboratory studies suggests that the caries-preventive mode of action of fluoride is mainly topical. There is convincing evidence that fluoride has a major effect on demineralisation and remineralisation of dental hard tissue. The source of this fluoride could either be fluorapatite (formed due to the incorporation of fluoride into enamel) or calcium fluoride (CaF2)-like precipitates, which are formed on the enamel and in the plaque after application of topical fluoride. Calcium fluoride deposits are protected from rapid dissolution by a phosphate -protein coating of salivary origin. At lower pH, the coating is lost and an increased dissolution rate of calcium fluoride occurs. The CaF2, therefore, act as an efficient source of free fluoride ions during the cariogenic challenge. The current evidence indicates that fluoride has a direct and indirect effect on bacterial cells, although the in vivo implications of this are still not clear. A better understanding of the mechanisms of the action of fluoride is very important for caries prevention and control. The effectiveness of fluoride as a cariostatic agent depends on the availability of free fluoride in plaque during cariogenic challenge, i.e. during acid production. Thus, a constant supply of low levels of fluoride in biofilm/saliva/dental interference is considered the most beneficial in preventing dental caries. Copyright © 2013 by Academy of Sciences and Arts of Bosnia and Herzegovina.

  8. Fluoride and Oral Health. (United States)

    O'Mullane, D M; Baez, R J; Jones, S; Lennon, M A; Petersen, P E; Rugg-Gunn, A J; Whelton, H; Whitford, G M


    The discovery during the first half of the 20th century of the link between natural fluoride, adjusted fluoride levels in drinking water and reduced dental caries prevalence proved to be a stimulus for worldwide on-going research into the role of fluoride in improving oral health. Epidemiological studies of fluoridation programmes have confirmed their safety and their effectiveness in controlling dental caries. Major advances in our knowledge of how fluoride impacts the caries process have led to the development, assessment of effectiveness and promotion of other fluoride vehicles including salt, milk, tablets, toothpaste, gels and varnishes. In 1993, the World Health Organization convened an Expert Committee to provide authoritative information on the role of fluorides in the promotion of oral health throughout the world (WHO TRS 846, 1994). This present publication is a revision of the original 1994 document, again using the expertise of researchers from the extensive fields of knowledge required to successfully implement complex interventions such as the use of fluorides to improve dental and oral health. Financial support for research into the development of these new fluoride strategies has come from many sources including government health departments as well as international and national grant agencies. In addition, the unique role which industry has played in the development, formulation, assessment of effectiveness and promotion of the various fluoride vehicles and strategies is noteworthy. This updated version of 'Fluoride and Oral Health' has adopted an evidence-based approach to its commentary on the different fluoride vehicles and strategies and also to its recommendations. In this regard, full account is taken of the many recent systematic reviews published in peer reviewed literature.

  9. Fluoride level in saliva after bonding orthodontic brackets with a fluoride containing adhesive

    NARCIS (Netherlands)

    Ogaard, B; Arends, J; Helseth, H; Dijkman, G; vanderKuijl, M

    The fluoride level in saliva is considered an important parameter in caries prevention. Elevation of the salivary fluoride level by a fluoride-releasing orthodontic bonding adhesive would most likely be beneficial in the prevention of enamel caries. In this study, the fluoride level in saliva was

  10. Fluoride release, recharge and flexural properties of polymethylmethacrylate containing fluoridated glass fillers. (United States)

    Al-Bakri, I A; Swain, M V; Naoum, S J; Al-Omari, W M; Martin, E; Ellakwa, A


    The purpose of this study was to investigate the effect of fluoridated glass fillers on fluoride release, recharge and the flexural properties of modified polymethylmethacrylate (PMMA). Specimens of PMMA denture base material with various loading of fluoridated glass fillers (0%, 1%, 2.5%, 5% and 10% by weight) were prepared. Flexural properties were evaluated on rectangular specimens (n = 10) aged in deionized water after 24 hours, 1 and 3 months. Disc specimens (n = 10) were aged for 43 days in deionized water and lactic acid (pH 4.0) and fluoride release was measured at numerous intervals. After ageing, specimens were recharged and fluoride re-release was recorded at 1, 3 and 7 days after recharge. Samples containing 2.5%, 5% and 10% glass fillers showed significantly (p glass fillers specimens. All experimental specimens exhibited fluoride release in both media. The flexural strength of specimens decreased in proportion to the percentage filler inclusion with the modulus of elasticity values remaining within ISO Standard 1567. The modified PMMA with fluoridated glass fillers has the ability to release and re-release fluoride ion. Flexural strength decreased as glass filler uploading increased. © 2014 Australian Dental Association.

  11. Fluoride glass fiber optics

    CERN Document Server

    Aggarwal, Ishwar D


    Fluoride Glass Fiber Optics reviews the fundamental aspects of fluoride glasses. This book is divided into nine chapters. Chapter 1 discusses the wide range of fluoride glasses with an emphasis on fluorozirconate-based compositions. The structure of simple fluoride systems, such as BaF2 binary glass is elaborated in Chapter 2. The third chapter covers the intrinsic transparency of fluoride glasses from the UV to the IR, with particular emphasis on the multiphonon edge and electronic edge. The next three chapters are devoted to ultra-low loss optical fibers, reviewing methods for purifying and

  12. A simple and colorimetric fluoride receptor and its fluoride-responsive organogel

    Energy Technology Data Exchange (ETDEWEB)

    Yu Xudong, E-mail: [College of Science, Hebei University of Science and Technology, Yuhua Road 70, Shijiazhuang 050080 (China); Li Yajuan [College of Science, Hebei University of Science and Technology, Yuhua Road 70, Shijiazhuang 050080 (China); Yin Yaobing; Yu Decai [College of Science, Hebei University of Engineering, 199 South street of Guangming, Handan 056038 (China)


    In this paper, a new p-nitrophenylhydrozine-based anion receptor 1 containing cholesterol group had been designed and synthesized. It could selectively recognize fluoride among different anions tested with color changes from pale yellow to red for visual detection. Simultaneously, it could gel in cyclohexane, and the gel was also fluoride-responsive. When treated with TBAF (tetra-n-butylammonium fluoride), the gel could undergo gel-sol transition accompanied by color, morphology and surface changes. The binding mechanism had been investigated by UV-vis and {sup 1}HNMR (proton nuclear magnetic resonance spectra) titrations. From SEM (scanning electron microscope), SAXS (small-angle X-ray scattering), IR (Infrared Spectroscopy) and CA (contact angle) experiments, it was indicated that the addition of F{sup -} could destroy the molecule assembly of host 1 in the gel state, thus resulting in the gel-to-sol transition due to the binding site competition effect. To the best of our knowledge, this was the simplest fluoride-responsive organogel with high selectivity. Highlights: Black-Right-Pointing-Pointer A novel kind receptor for selective recognition of fluoride had been designed. Black-Right-Pointing-Pointer Its organogel was also fluoride-responsive. Black-Right-Pointing-Pointer This is the simplest fluoride-responsive organogel with high selectivity.

  13. Fluoride metabolism in plants

    Energy Technology Data Exchange (ETDEWEB)

    Peters, R; Shorthouse, M


    Grass seedlings exposed to inorganic fluoride solutions do not take up appreciable amounts of fluoride until concentrations of more than 1.0 mM (19 p.p.m.) are used. No formation of organic fluoride has been found, even with exposure to 15.75 mM fluoride, indicating that there is no formation of fluoroacetate or similar compounds. 8 references, 2 tables.

  14. Bottled Water and Fluoride (United States)

    ... Private Wells Infant Formula Fluorosis Public Health Service Recommendation Water Operators & Engineers Water Fluoridation Additives Shortages of Fluoridation Additives Drinking Water Pipe Systems CDC-Sponsored Water Fluoridation Training Links to Other ...

  15. Fluoride release and recharge abilities of contemporary fluoride-containing restorative materials and dental adhesives. (United States)

    Dionysopoulos, Dimitrios; Koliniotou-Koumpia, Eugenia; Helvatzoglou-Antoniades, Maria; Kotsanos, Nikolaos


    The aim of this study was to evaluate the fluoride release of five fluoride-releasing restorative materials and three dental adhesives, before and after NaF solution treatment. Five restorative materials (Fuji IX GP, GC Corp.; Ketac N100, 3M ESPE; Dyract Extra, Dentsply; Beautifil II, Shofu Inc.; Wave, SDI) and three dental adhesives (Stae, SDI; Fluorobond II - Shofu Inc.; Prime & Bond NT, Dentsply) were investigated before and after NaF solution treatment. A fluoride ion-selective electrode was to measure fluoride concentrations. During the 86-day period before NaF solution treatment, Fuji IX GP released the highest amount of fluoride among the restorative materials while Prime & Bond NT was the highest among the dental adhesives. After NaF solution treatment, Fuji IX GP again ranked the highest in fluoride release among the restorative materials while Fluorobond II ranked the highest among dental adhesives. It was concluded that the compositions and setting mechanisms of fluoride-containing dental materials influenced their fluoride release and recharge abilities.

  16. No calcium-fluoride-like deposits detected in plaque shortly after a sodium fluoride mouthrinse. (United States)

    Vogel, G L; Tenuta, L M A; Schumacher, G E; Chow, L C


    Plaque 'calcium-fluoride-like' (CaF(2)-like) and fluoride deposits held by biological/bacterial calcium fluoride (Ca-F) bonds appear to be the source of cariostatic concentrations of fluoride in plaque fluid. The aim of this study was to quantify the amounts of plaque fluoride held in these reservoirs after a sodium fluoride rinse. 30 and 60 min after a 228 microg/g fluoride rinse, plaque samples were collected from 11 volunteers. Each sample was homogenized, split into 2 aliquots (aliquots 1 and 2), centrifuged, and the recovered plaque fluid combined and analyzed using microelectrodes. The plaque mass from aliquot 1 was retained. The plaque mass from aliquot 2 was extracted several times with a solution having the same fluoride, calcium and pH as the plaque fluid in order to extract the plaque CaF(2)-like deposits. The total fluoride in both aliquots was then determined. In a second experiment, the extraction completeness was examined by applying the above procedure to in vitro precipitates containing known amounts of CaF(2)-like deposits. Nearly identical fluoride concentrations were found in both plaque aliquots. The extraction of the CaF(2)-like precipitates formed in vitro removed more than 80% of these deposits. The results suggest that either CaF(2)-like deposits were not formed in plaque or, if these deposits had been formed, they were rapidly lost. The inability to form persistent amounts of CaF(2)-like deposits in plaque may account for the relatively rapid loss of plaque fluid fluoride after the use of conventional fluoride dentifrices or rinses. (c) 2010 S. Karger AG, Basel.

  17. Synthesis of 2-deoxy-2-[18F]-fluoro-β-mannosyl [18F]-fluoride as a potential imaging probe for glycosidases

    International Nuclear Information System (INIS)

    McCarter, J.D.; Withers, S.G.; Adam, M.J.


    The mechanism-based glycosidase inhibitor 2-deoxy-2-[ 18 F]-fluoro-Β-mannosyl 2-[ 18 F]-fluoride was synthesized and its covalent binding to Agrobacterium Β-glucosidase was demonstrated in vitro. (Author)

  18. Fluoride concentration in urine after silver diamine fluoride application on tooth enamel (United States)

    Sari, D. L.; Bahar, A.; Gunawan, H. A.; Adiatman, M.; Rahardjo, A.; Maharani, D. A.; Toptanci, I. R.; Yavuz, I.


    Silver Diammine Fluoride (SDF), which contains fluoride, is known to inhibit tooth enamel demineralization and increase fluoride concentrations in saliva and urine. The aim of this study is to analyze the fluoride concentration in urine after application of SDF on tooth enamel. Urine from four subjects was collected prior to, 30 minutes after, and two and three hours after the application of SDF, and an ion-selective electrode was used to measure the fluoride concentrations. There was no significant difference between time 1 and time 2, time 1 and time 3, time 1 and time 4, time 2 and 3 (p > 0.05), and there was a significant difference between time 2 and time 4 as well as time 3 and time 4 (p < 0.05). There was a decrease in the concentration of fluoride ions in urine from the baseline to 30 minutes after application, and an increase from baseline to two and three hours after the application of SDF.

  19. Water Fluoridation Statistics - Percent of PWS population receiving fluoridated water (United States)

    U.S. Department of Health & Human Services — 2000-2014. Water Fluoridation Statistics is a biennial report of the percentage and number of people receiving fluoridated water from 2000 through 2014, originally...

  20. Water Fluoridation Statistics - Percent of PWS population receiving fluoridated water (United States)

    U.S. Department of Health & Human Services — 2000-2014 Water Fluoridation Statistics is a biennial report of the percentage and number of people receiving fluoridated water from 2000 through 2014, originally...

  1. Fluoride releasing and enamel demineralization around orthodontic brackets by fluoride-releasing composite containing nanoparticles. (United States)

    Melo, Mary A S; Morais, Weslanny A; Passos, Vanara F; Lima, Juliana P M; Rodrigues, Lidiany K A


    Fluoride-containing materials have been suggested to control enamel demineralization around orthodontic brackets during the treatment with fixed appliances. The improvement of their properties has been made through innovations, such as the application of nanotechnology by incorporation of nanofillers. This in vitro study evaluated the capacity of fluoride releasing and enamel demineralization inhibition of fluoride-releasing nanofilled cement around orthodontic brackets using an artificial caries biofilm model. Forty bovine enamel discs were selected by evaluating surface microhardness and randomized into four groups (n = 10): non-fluoride-releasing microfilled composite, fluoride-releasing microfilled composite, resin-modified glass ionomer cement (RMGI), and fluoride-releasing nanofilled composite (FN). After brackets bonding in each disc, the specimens were subjected to a cariogenic challenge through a Streptococcus mutans biofilm model. After the experimental period, the biofilm formed around the brackets was collected for fluoride analysis and the mineral loss around the brackets was determined by integrated demineralization via cross-sectional microhardness measurement at 20 and 70 μm from the bracket margin. Additionally, samples of each group were subjected to energy-dispersive X-ray spectroscopy (EDX) analysis examined under a scanning electron microscopy (SEM). ANOVA followed by Tukey test were applied for fluoride concentration and mineral loss data, respectively. At both distances, only RMGI statistically differed from the other groups presenting the lowest demineralization, although there was a trend to a lower demineralization of enamel around brackets in FN group. Similar condition was found to fluoride concentration and EDX/SEM analysis. Under the cariogenic exposure condition of this study, the fluoride-releasing nanofilled material had similar performance to fluoride-releasing microfilled materials. The presence of nanofillers in the fluoride

  2. Oral fluoride levels 1 h after use of a sodium fluoride rinse: effect of sodium lauryl sulfate. (United States)

    Vogel, Gerald L; Schumacher, Gary E; Chow, Laurence C; Tenuta, Livia M A


    Increasing the concentration of free fluoride in oral fluids is an important goal in the use of topical fluoride agents. Although sodium lauryl sulfate (SLS) is a common dentifrice ingredient, the influence of this ion on plaque fluid and salivary fluid fluoride has not been examined. The purpose of this study was to investigate the effect of SLS on these parameters and to examine the effect of this ion on total (or whole) plaque fluoride, an important source of plaque fluid fluoride after a sufficient interval following fluoride administration, and on total salivary fluoride, a parameter often used as a surrogate measure of salivary fluid fluoride. Ten subjects accumulated plaque for 48 h before rinsing with a 12 mmol/l NaF (228 µg/g F) rinse containing or not containing 0.5% (w/w) SLS. SLS had no statistically significant effect on total plaque and total saliva fluoride but significantly increased salivary fluid and plaque fluid fluoride (by 147 and 205%, respectively). These results suggest that the nonfluoride components of topical agents can be manipulated to improve the fluoride release characteristics from oral fluoride reservoirs and that statistically significant change may be observed in plaque fluid and salivary fluid fluoride concentrations that may not be observed in total plaque and total saliva fluoride concentrations.

  3. Human leukocyte and porcine pancreatic elastase: X-ray crystal structures, mechanism, substrate specificity, and mechanism-based inhibitors

    International Nuclear Information System (INIS)

    Bode, W.; Meyer, E. Jr.; Powers, J.C.


    The serine protease family of enzymes is one of the most widely studied group of enzymes, as evidenced by the fact that more crystal structures are available for individuals of this superfamily than for any other homologous group of enzymes. These enzymes contain a conserved triad of catalytic residues including Ser-195, His-57, and Asp-102. The active-site serine is very nucleophilic, and serine proteases are inhibited by specific serine protease reagents such as diisopropyl phosphorofluoridate (DFP), phenylmethanesulfonyl fluoride, and 3,4-dichloroisocoumarin. Elastases are a group of proteases that possess the ability to cleave the important connective tissue protein elastin. Elastin has the unique property of elastic recoil, is widely distributed in vertebrate tissue, and is particularly abundant in the lungs, arteries, skin, and ligaments. Human neutrophil elastase and pancreatic elastase are two major serine proteases that cleave elastin. Neutrophil elastase is found in the dense granules of polymorphonuclear leukycytes and is essential for phagocytosis and defense against infection by invading microorganisms. Pancreatic elastase is stored as an inactive zymogen in the pancreas and is secreted into the intestines where it becomes activated by trypsin and then participates in digestion. Both elastases cleave substrates at peptide bonds where the P 1 residue is an amino acid residue with a small alkyl side chain

  4. The cariostatic mechanisms of fluoride


    Kata Rošin-Grget; Kristina Peroš; Ivana Šutej; Krešimir Bašić


    This article discusses the possible cariostatic mechanisms of the action of fluoride. In the past, fluoride inhibition of caries was ascribed to reduced solubility of enamel due to incorporation of fluoride (F–) into the enamel minerals. The present evidence from clinical and laboratory studies suggests that the caries-preventive mode of action of fluoride is mainly topical. There is convincing evidence that fluoride has a major effect on demineralisation and remineralisation of dental hard t...

  5. Small molecule fluoride toxicity agonists. (United States)

    Nelson, James W; Plummer, Mark S; Blount, Kenneth F; Ames, Tyler D; Breaker, Ronald R


    Fluoride is a ubiquitous anion that inhibits a wide variety of metabolic processes. Here, we report the identification of a series of compounds that enhance fluoride toxicity in Escherichia coli and Streptococcus mutans. These molecules were isolated by using a high-throughput screen (HTS) for compounds that increase intracellular fluoride levels as determined via a fluoride riboswitch reporter fusion construct. A series of derivatives were synthesized to examine structure-activity relationships, leading to the identification of compounds with improved activity. Thus, we demonstrate that small molecule fluoride toxicity agonists can be identified by HTS from existing chemical libraries by exploiting a natural fluoride riboswitch. In addition, our findings suggest that some molecules might be further optimized to function as binary antibacterial agents when combined with fluoride. Copyright © 2015 Elsevier Ltd. All rights reserved.

  6. Fluoride varnishes and enamel caries

    NARCIS (Netherlands)

    Bruyn, Hugo de


    Topical fluoride applications have the aim of increasing the fluoride uptake in enamel and consequently reducing caries. In the early ‘60s fluoride varnishes were introduced because they had a long contact period with the enamel which resulted in a higher fluoride uptake than from other topical

  7. Daily Fluoride Intake from Iranian Green Tea: Evaluation of Various Flavorings on Fluoride Release

    Directory of Open Access Journals (Sweden)

    Afshin Maleki


    Full Text Available With increased awareness of the health benefits of the compounds in green tea, especially polyphenols, its consumption is rising. The main purpose of this study is to determine the effect of different additives on the released fluoride into tea liquor and also daily fluoride intake. The concentrations of fluoride, nitrate, sulfate, and chloride were measured in 15 different flavored green teas (Refah-Lahijan. The fluoride and other anion concentrations were measured by ion chromatography method. The data were analyzed with Statistical Package for the Social Sciences version 16.0. The results showed that the minimum and maximum concentrations of fluoride in the green tea infusions were 0.162 mg/L (cinnamon-flavored green tea and 3.29 mg/L (bagged peach-flavored green tea, respectively. The mean concentration of fluoride in the green tea leaves was 52 mg/kg, and approximately 89% of the fluoride was released from the green tea leaves into the infusions after brewing. The fluoride concentrations varied significantly among the examined green teas ( P 0.05. Finally, drinking of the studied green teas cannot make a significant contribution to the daily dietary intake of F for consumers.

  8. Alimentary fluoride intake in preschool children

    Directory of Open Access Journals (Sweden)

    Lencova Erika


    Full Text Available Abstract Background The knowledge of background alimentary fluoride intake in preschool children is of utmost importance for introducing optimal and safe caries preventive measures for both individuals and communities. The aim of this study was to assess the daily fluoride intake analyzing duplicate samples of food and beverages. An attempt was made to calculate the daily intake of fluoride from food and swallowed toothpaste. Methods Daily alimentary fluoride intake was measured in a group of 36 children with an average age of 4.75 years and an average weight of 20.69 kg at baseline, by means of a double plate method. This was repeated after six months. Parents recorded their child's diet over 24 hours and collected duplicated portions of food and beverages received by children during this period. Pooled samples of food and beverages were weighed and solid food samples were homogenized. Fluoride was quantitatively extracted from solid food samples by a microdiffusion method using hexadecyldisiloxane and perchloric acid. The content of fluoride extracted from solid food samples, as well as fluoride in beverages, was measured potentiometrically by means of a fluoride ion selective electrode. Results Average daily fluoride intake at baseline was 0.389 (SD 0.054 mg per day. Six months later it was 0.378 (SD 0.084 mg per day which represents 0.020 (SD 0.010 and 0.018 (SD 0.008 mg of fluoride respectively calculated per kg bw/day. When adding the values of unwanted fluoride intake from the toothpaste shown in the literature (0.17-1.21 mg per day the estimate of the total daily intake of fluoride amounted to 0.554-1.594 mg/day and recalculated to the child's body weight to 0.027-0.077 mg/kg bw/day. Conclusions In the children studied, observed daily fluoride intake reached the threshold for safe fluoride intake. When adding the potential fluoride intake from swallowed toothpaste, alimentary intake reached the optimum range for daily fluoride intake

  9. Effects of fluoride and other halogen ions on the external stress corrosion cracking of Type 304 austenitic stainless steel

    International Nuclear Information System (INIS)

    Whorlow, K.M.; Hutto, F.B. Jr.


    The drip procedure from the Standard Test Method for Evaluating the Influence of Thermal Insulation on External Stress Corrosion Cracking Tendency of Austenitic Stainless Steel (ASTM C 692-95a) was used to research the effect of halogens and inhibitors on the External Stress Corrosion Cracking (ESCC) of Type 304 stainless steel as it applies to Nuclear Regulatory Commission Regulatory Guide 1.36, Nonmetallic Thermal Insulation for Austenitic Stainless Steel. The solutions used in this research were prepared using pure chemical reagents to simulate the halogens and inhibitors found in insulation extraction solutions. The results indicated that sodium silicate compounds that were higher in sodium were more effective for preventing chloride-induced ESCC in Type 304 austenitic stainless steel. Potassium silicate (all-silicate inhibitor) was not as effective as sodium silicate. Limited testing with sodium hydroxide (all-sodium inhibitor) indicated that it may be effective as an inhibitor. Fluoride, bromide, and iodide caused minimal ESCC which could be effectively inhibited by sodium silicate. The addition of fluoride to the chloride/sodium silicate systems at the threshold of ESCC appeared to have no synergistic effect on ESCC. The mass ratio of sodium + silicate (mg/kg) to chloride (mg/kg) at the lower end of the NRC RG 1.36 Acceptability Curve was not sufficient to prevent ESCC using the methods of this research

  10. Comparative evaluation of fluoride release from PRG-composites and compomer on application of topical fluoride: An in-vitro study

    Directory of Open Access Journals (Sweden)

    Dhull K


    Full Text Available Aims and Objective: To determine the fluoride release from Giomer and Compomer, using different topical fluoride regimes, and to compare the amount of fluoride release from giomer with that of compomer. Materials and Method: Forty-eight specimens of each giomer and compomer were divided into four treatment groups, namely, control group, fluoridated dentifrice (500 ppm once daily group, fluoridated dentifrice (500 ppm twice daily group, fluoridated dentifrice (500 ppm once daily + fluoridated mouthwash (225 ppm group. Each specimen was suspended in demineralizing solution for six hours and remineralizing solution for 18 hours. Fluoride release was measured in both the demineralizing solution and remineralizing solution daily for seven days. Total daily fluoride release for each specimen was calculated by adding the amount released in the demineralizing solution to that released in remineralizing solution. Results and Conclusion: The fluoride release (ppm was found to be more in Giomer when compared to Compomer. The fluoride released from Giomer and Compomer was significantly greater in the acidic demineralizing solution than in the neutral remineralizing solution. It was found that increasing fluoride exposure significantly increased fluoride release from the giomer and compomer. It was found that the fluoride release from the subgroups of giomer and compomer was in the following order: fluoridated dentifrice twice daily > fluoridated dentifrice once daily + fluoridated mouthwash > fluoridated dentifrice once daily > control group. It was found that the giomer showed a greater fluoride uptake than the compomer.

  11. Fluoride retention by kaolin clay

    DEFF Research Database (Denmark)

    Kau, P. M. H.; Smith, D. W.; Binning, Philip John


    To evaluate the potential effectiveness of kaolin clay liners in storage of fluoride contaminated waste, an experimental study of the sorption and desorption behaviour of fluoride in kaolin clay was conducted. The degree of fluoride sorption by kaolin was found to depend on solution p......H and available fluoride concentration with equilibrium being achieved within 24 h. A site activation process involving the uptake of fluoride was also observed at the initial stages of sorption. This behaviour was attributed to a layer expansion process of the clay during sorption. The maximum fluoride sorption...... capacity was found to be 18.3 meq/100 g at pH 6 and 8.6 meq/100 g at pH 7. A competitive Langmuir sorption isotherm where sorption is dependant on both pH and fluoride concentration is employed to characterise the experimental sorption and desorption data. The sorption and desorption isotherms revealed...


    Directory of Open Access Journals (Sweden)

    S. V. Kuznetsov


    Full Text Available Subject of Study. The paper deals with preparation processes of ultradisperse, homogeneous powder Sr1-хNdхF2+х (х= 0.003-0.2, with use of ammonium fluoride as the fluorinating agent taken over 114-120 % from stoichiometry. Method. Nitrate of strontium, neodymium nitrate hexahydrate, with the content equal to 99. 99 % of the basic substance and ammonium fluoride were used as the source of substances. Activated powders of strontium fluoride were obtained by the method of deposition from aqueous solutions by washing the precipitate with a solution of ammonium fluoride, taken over 114 - 120% from stoichiometry. The washed precipitate was centrifuged for 5-7 min, dried in the air at 30-350 C. Heat treatment of the dried precipitate was carried out in two stages: the first stage at the temperature of 200- 2500 C for 0.5-1 hour, the second one at 550- 6000 C for 2-3 hours. X-ray analysis of the synthesized samples was carried out on a Bruker D8 Advance diffractometer, radiation Cu K. The size and shape measuring of the particles of activated strontium fluoride was carried out by means of electron microscope Carl Zeiss NVision 40. The content of neodymium in activated powders of strontium fluoride was determined by the method of spectral emission analysis on the device LEA - S500. Chemical analysis for determination of ammonium ion (NH4+ content in the obtained samples was performed by the method of Kjeldahl. Calculations of lattice parameters, size of coherent scattering regions and the values of micro-deformations were carried out by TOPAS program. Main Results. Preparation processes of ultradisperse, homogeneous powder Sr1-хNdхF2+х (х= 0.003-0.2, with use of ammonium fluoride as the fluorinating agent taken over 114-120 % from stoichiometry, provides obtaining the firm solution Sr1-x-yNdx(NH4yF2+x-y of the cubic fluorite structure. It has been found out that the morphology and size of the resulting product depend on the quantity of

  13. Fluoride analysis

    Energy Technology Data Exchange (ETDEWEB)

    Brandt, C S


    The methods and procedures for the detection and estimation of fluoride are varied and numerous. The problems of sampling, contamination, and loss in sampling waters, plant and animal tissues and atmospheres are discussed, along with brief descriptors of methods most commonly used. Techniques for separating fluorides from matrixes are discussed, as well as gravimetric, calorimetric, and spectrophotometric analytical techniques.

  14. Story of Fluoridation (United States)

    ... Home Health Info Health Topics Fluoride Share The Story of Fluoridation It started as an observation, that ... this time using photospectrographic analysis, a more sophisticated technology than that used by McKay. Churchill asked an ...

  15. Private Well Water and Fluoride (United States)

    ... Private Wells Infant Formula Fluorosis Public Health Service Recommendation Water Operators & Engineers Water Fluoridation Additives Shortages of Fluoridation Additives Drinking Water Pipe Systems CDC-Sponsored Water Fluoridation Training Links to Other ...

  16. Fluoride in diet (United States)

    Diet - fluoride ... bones and teeth. Too much fluoride in the diet is very rare. Rarely, infants who get too ... of essential vitamins is to eat a balanced diet that contains a variety of foods from the ...

  17. Physiology and toxicity of fluoride

    Directory of Open Access Journals (Sweden)

    Dhar Vineet


    Full Text Available Fluoride has been described as an essential element needed for normal development and growth of animals and extremely useful for human beings. Fluoride is abundant in the environment and the main source of fluoride to humans is drinking water. It has been proved to be beneficial in recommended doses, and at the same time its toxicity at higher levels has also been well established. Fluoride gets accumulated in hard tissues of the body and has been know to play an important role in mineralization of bone and teeth. At high levels it has been known to cause dental and skeletal fluorosis. There are suggested effects of very high levels of fluoride on various body organs and genetic material. The purpose of this paper is to review the various aspects of fluoride and its importance in human life.

  18. Physiology and toxicity of fluoride. (United States)

    Dhar, Vineet; Bhatnagar, Maheep


    Fluoride has been described as an essential element needed for normal development and growth of animals and extremely useful for human beings. Fluoride is abundant in the environment and the main source of fluoride to humans is drinking water. It has been proved to be beneficial in recommended doses, and at the same time its toxicity at higher levels has also been well established. Fluoride gets accumulated in hard tissues of the body and has been know to play an important role in mineralization of bone and teeth. At high levels it has been known to cause dental and skeletal fluorosis. There are suggested effects of very high levels of fluoride on various body organs and genetic material. The purpose of this paper is to review the various aspects of fluoride and its importance in human life.

  19. Fluoride barriers in Nb/Pb Josephson junctions (United States)

    Asano, H.; Tanabe, K.; Michikami, O.; Igarashi, M.; Beasley, M. R.


    Josephson tunnel junctions are fabricated using a new class of artificial barriers, metal fluorides (Al fluoride and Zr fluoride). These fluoride barriers are deposited on the surface of a Nb base electrode, which are previously cleaned using a CF4 cleaning process, and covered by a Pb counterelectrode. The junctions with both Al fluoride and Zr fluoride barriers exhibit good tunneling characteristics and have low specific capacitance. In the case of Zr fluoride, it is observed that reasonable resistances are obtained even at thickness greater than 100 A. This phenomenon might be explained by tunneling via localized states in Zr fluoride.

  20. Fluoride exposure and indicators of thyroid functioning in the Canadian population: implications for community water fluoridation. (United States)

    Barberio, Amanda M; Hosein, F Shaun; Quiñonez, Carlos; McLaren, Lindsay


    There are concerns that altered thyroid functioning could be the result of ingesting too much fluoride. Community water fluoridation (CWF) is an important source of fluoride exposure. Our objectives were to examine the association between fluoride exposure and (1) diagnosis of a thyroid condition and (2) indicators of thyroid functioning among a national population-based sample of Canadians. We analysed data from Cycles 2 and 3 of the Canadian Health Measures Survey (CHMS). Logistic regression was used to assess associations between fluoride from urine and tap water samples and the diagnosis of a thyroid condition. Multinomial logistic regression was used to examine the relationship between fluoride exposure and thyroid-stimulating hormone (TSH) level (low/normal/high). Other available variables permitted additional exploratory analyses among the subset of participants for whom we could discern some fluoride exposure from drinking water and/or dental products. There was no evidence of a relationship between fluoride exposure (from urine and tap water) and the diagnosis of a thyroid condition. There was no statistically significant association between fluoride exposure and abnormal (low or high) TSH levels relative to normal TSH levels. Rerunning the models with the sample constrained to the subset of participants for whom we could discern some source(s) of fluoride exposure from drinking water and/or dental products revealed no significant associations. These analyses suggest that, at the population level, fluoride exposure is not associated with impaired thyroid functioning in a time and place where multiple sources of fluoride exposure, including CWF, exist. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2017. All rights reserved. No commercial use is permitted unless otherwise expressly granted.

  1. Water Fluoridation: A Critical Review of the Physiological Effects of Ingested Fluoride as a Public Health Intervention (United States)


    Fluorine is the world's 13th most abundant element and constitutes 0.08% of the Earth crust. It has the highest electronegativity of all elements. Fluoride is widely distributed in the environment, occurring in the air, soils, rocks, and water. Although fluoride is used industrially in a fluorine compound, the manufacture of ceramics, pesticides, aerosol propellants, refrigerants, glassware, and Teflon cookware, it is a generally unwanted byproduct of aluminium, fertilizer, and iron ore manufacture. The medicinal use of fluorides for the prevention of dental caries began in January 1945 when community water supplies in Grand Rapids, United States, were fluoridated to a level of 1 ppm as a dental caries prevention measure. However, water fluoridation remains a controversial public health measure. This paper reviews the human health effects of fluoride. The authors conclude that available evidence suggests that fluoride has a potential to cause major adverse human health problems, while having only a modest dental caries prevention effect. As part of efforts to reduce hazardous fluoride ingestion, the practice of artificial water fluoridation should be reconsidered globally, while industrial safety measures need to be tightened in order to reduce unethical discharge of fluoride compounds into the environment. Public health approaches for global dental caries reduction that do not involve systemic ingestion of fluoride are urgently needed. PMID:24719570

  2. Review on fluoride-releasing restorative materials--fluoride release and uptake characteristics, antibacterial activity and influence on caries formation. (United States)

    Wiegand, Annette; Buchalla, Wolfgang; Attin, Thomas


    The purpose of this article was to review the fluoride release and recharge capabilities, and antibacterial properties, of fluoride-releasing dental restoratives, and discuss the current status concerning the prevention or inhibition of caries development and progression. Information from original scientific full papers or reviews listed in PubMed (search term: fluoride release AND (restorative OR glass-ionomer OR compomer OR polyacid-modified composite resin OR composite OR amalgam)), published from 1980 to 2004, was included in the review. Papers dealing with endodontic or orthodontic topics were not taken into consideration. Clinical studies concerning secondary caries development were only included when performed in split-mouth design with an observation period of at least three years. Fluoride-containing dental materials show clear differences in the fluoride release and uptake characteristics. Short- and long-term fluoride releases from restoratives are related to their matrices, setting mechanisms and fluoride content and depend on several environmental conditions. Fluoride-releasing materials may act as a fluoride reservoir and may increase the fluoride level in saliva, plaque and dental hard tissues. However, clinical studies exhibited conflicting data as to whether or not these materials significantly prevent or inhibit secondary caries and affect the growth of caries-associated bacteria compared to non-fluoridated restoratives. Fluoride release and uptake characteristics depend on the matrices, fillers and fluoride content as well as on the setting mechanisms and environmental conditions of the restoratives. Fluoride-releasing materials, predominantly glass-ionomers and compomers, did show cariostatic properties and may affect bacterial metabolism under simulated cariogenic conditions in vitro. However, it is not proven by prospective clinical studies whether the incidence of secondary caries can be significantly reduced by the fluoride release of

  3. Silver diamine fluoride: a caries "silver-fluoride bullet". (United States)

    Rosenblatt, A; Stamford, T C M; Niederman, R


    The antimicrobial use of silver compounds pivots on the 100-year-old application of silver nitrate, silver foil, and silver sutures for the prevention and treatment of ocular, surgical, and dental infections. Ag(+) kills pathogenic organisms at concentrations of linings, water purification systems, hospital gowns, and caries prevention. To distill the current best evidence relative to caries, this systematic review asked: Will silver diamine fluoride (SDF) more effectively prevent caries than fluoride varnish? A five-database search, reference review, and hand search identified 99 human clinical trials in three languages published between 1966 and 2006. Dual review for controlled clinical trials with the patient as the unit of observation, and excluding cross-sectional, animal, in vitro studies, and opinions, identified 2 studies meeting the inclusion criteria. The trials indicated that SDF's lowest prevented fractions for caries arrest and caries prevention were 96.1% and 70.3%, respectively. In contrast, fluoride varnish's highest prevented fractions for caries arrest and caries prevention were 21.3% and 55.7%, respectively. Similarly, SDF's highest numbers needed to treat for caries arrest and caries prevention were 0.8 (95% CI=0.5-1.0) and 0.9 (95% CI=0.4-1.1), respectively. For fluoride varnish, the lowest numbers needed to treat for caries arrest and prevention were 3.7 (95% CI=3.4-3.9) and 1.1 (95% CI=0.7-1.4), respectively. Adverse events were monitored, with no significant differences between control and experimental groups. These promising results suggest that SDF is more effective than fluoride varnish, and may be a valuable caries-preventive intervention. As well, the availability of a safe, effective, efficient, and equitable caries-preventive agent appears to meet the criteria of both the WHO Millennium Goals and the US Institute of Medicine's criteria for 21st century medical care.

  4. 49 CFR 173.163 - Hydrogen fluoride. (United States)


    ... 49 Transportation 2 2010-10-01 2010-10-01 false Hydrogen fluoride. 173.163 Section 173.163... Hydrogen fluoride. (a) Hydrogen fluoride (hydrofluoric acid, anhydrous) must be packaged as follows: (1) In... filling ratio of 0.84. (b) A cylinder removed from hydrogen fluoride service must be condemned in...

  5. Inhibitors for the corrosion of reactive metals: titanium and zirconium and their alloys in acid media

    International Nuclear Information System (INIS)

    Petit, J.A.; Chatainier, G.; Dabosi, F.


    The search for effective corrosion inhibitors for titanium and zirconium in acid media is growing because of the considerable increase in the use of these materials in chemical process equipment. It still remains limited, as appears from this review, because of the exceptionally high corrosion resistance of the metals. Titanium has received the greater attention. Its corrosion rate can be lowered by introduction in the medium of multivalent ions, inorganic and organic oxidants. Care should be taken to hold the concentration at a level exceeding some critical value, otherwise the corrosion rate increases. Complexing organic agents do not show such hazardous behaviour. The very rapid corrosion of titanium and zirconium in fluoride media may be lessened by complexing the fluoride ions. Though rarely encountered, localized corrosion may be avoided by using inhibitors. In some cases good corrosion inhibitors for titanium are dissolution accelerators for zirconium. (author)



    Bandlapalli Pavani; Mandava Ragini; David Banji; Otilia J F Banji; N Gouri Pratusha


    There are many incidents of fluoride toxicity whether it is acute or chronic. Fluoride toxicity is an environmental hazard which arises from the upper layers of geological crust and is dissolved in water. Prolonged drinking of such water causes chronic fluoride toxicity. Use of fluoride containing compounds for various purposes such as dental products, metal, glass, refrigerator and chemical industries act as a source of fluoride poisoning and increase the risk of toxicity. This review reflec...

  7. Fluoride in groundwater: toxicological exposure and remedies. (United States)

    Jha, S K; Singh, R K; Damodaran, T; Mishra, V K; Sharma, D K; Rai, Deepak


    Fluoride is a chemical element that is found most frequently in groundwater and has become one of the most important toxicological environmental hazards globally. The occurrence of fluoride in groundwater is due to weathering and leaching of fluoride-bearing minerals from rocks and sediments. Fluoride when ingested in small quantities (dental health by reducing dental caries, whereas higher concentrations (>1.5 mg/L) may cause fluorosis. It is estimated that about 200 million people, from among 25 nations the world over, may suffer from fluorosis and the causes have been ascribed to fluoride contamination in groundwater including India. High fluoride occurrence in groundwaters is expected from sodium bicarbonate-type water, which is calcium deficient. The alkalinity of water also helps in mobilizing fluoride from fluorite (CaF2). Fluoride exposure in humans is related to (1) fluoride concentration in drinking water, (2) duration of consumption, and (3) climate of the area. In hotter climates where water consumption is greater, exposure doses of fluoride need to be modified based on mean fluoride intake. Various cost-effective and simple procedures for water defluoridation techniques are already known, but the benefits of such techniques have not reached the rural affected population due to limitations. Therefore, there is a need to develop workable strategies to provide fluoride-safe drinking water to rural communities. The study investigated the geochemistry and occurrence of fluoride and its contamination in groundwater, human exposure, various adverse health effects, and possible remedial measures from fluoride toxicity effects.

  8. The effect of fluoride on the scavenging of organophosphates by human butyrylcholinesterase in buffer solutions and human plasma

    International Nuclear Information System (INIS)

    Ashani, Yacov; Segev, Omri; Balan, Ayala


    Fluoride ion is a reversible inhibitor of human butyrylcholinesterase (HuBChE) that is a viable drug candidate against organophosphates (OPs) toxicity. Since large numbers of communities in many countries are occasionally exposed to relatively high amount of fluoride, its effect on the kinetics of inhibition of HuBChE by OPs was investigated. In saline phosphate, pH 7.4, fluoride in the lower millimolar range significantly slowed the inhibition of HuBChE by paraoxon, DFP, echothiophate, soman, sarin, and VX. The kinetics of the inhibition was found consistent with the formation of a reversible fluoride-HuBChE complex that is at least 25-fold less active towards phosphorylation or phosphonylation than the free enzyme. Heat inactivation experiments indicate that the binding of fluoride to HuBChE probably involves enhanced cross-domain interaction via hydrogen bonds formation that may decrease enzyme activity. In spite of distinct structural differences among the OP used, the dissociation constants of the fluoride-HuBChE reversible complex varied over a narrow range (K F , 0.31-0.70 mM); however, K F in human plasma increased to 2.75-3.40 mM. 19 F-NMR spectroscopy revealed that fluoride ion is complexed to plasma components, an observation that explains in part the apparent increase in K F . Results suggest that an estimate of the relative decrease in the rate of OPs sequestration in presence of fluoride can be obtained from the fraction of the free HuBChE (1 + [F]/K F ) -1 . Considering K F values in human plasma, it is concluded that the scavenging efficacy of OPs by HuBChE is not compromised by the normal concentration range of circulating fluoride ions

  9. Purification process of uranium hexafluoride containing traces of plutonium fluoride and/or neptunium fluoride

    International Nuclear Information System (INIS)

    Aubert, J.; Bethuel, L.; Carles, M.


    In this process impure uranium hexafluoride is contacted with a metallic fluoride chosen in the group containing lead fluoride PbF 2 , uranium fluorides UFsub(4+x) (0 3 at a temperature such as plutonium and/or neptunium are reduced and pure uranium hexafluoride is recovered. Application is made to uranium hexafluoride purification in spent fuel reprocessing [fr

  10. Physiology and toxicity of fluoride


    Dhar Vineet; Bhatnagar Maheep


    Fluoride has been described as an essential element needed for normal development and growth of animals and extremely useful for human beings. Fluoride is abundant in the environment and the main source of fluoride to humans is drinking water. It has been proved to be beneficial in recommended doses, and at the same time its toxicity at higher levels has also been well established. Fluoride gets accumulated in hard tissues of the body and has been know to play an important role in mineralizat...

  11. The Effect of Calcium Pre-Rinse on Salivary Fluoride After 900 ppm Fluoride Mouthwash: A Randomized Clinical Trial

    Directory of Open Access Journals (Sweden)

    Nahid Ramazani


    Full Text Available Objective: Calcium fluoride deposit during fluoride application. Uptake and retention of fluoride by saliva depends generally on the concentration of calcium. In this study, the ef-fect of calcium pre-rinse on salivary fluoride concentration after a 900 ppm fluoride mouthwash was investigated.Materials and Methods: This cross-over double-blind randomized clinical trial was con-ducted in a girls' dormitory in Zahedan University of Medical Sciences, southeast Iran. In this study, 42 female dental students were chosen using simple randomization. During the first phase, 21 subjects (group A used fluoride rinse (F regimen and the remaining (group B used calcium pre-rinse followed immediately by fluoride rinse (Ca + F regi-men. In the second phase, participants rinsed using the mouthwashes not previously used. Prior to each phase prophylaxis was performed and no fluoridated product was used dur-ing a two-week interval between the phases. Salivary samples were taken immediately be-fore (baseline, 1 and 12 hours after rinsing. The salivary fluoride concentration was de-termined using fluoride sensitive electrode. Repeated measures ANOVA was used for sta-tistical analysis and the significance level was set at P<0.05.Results: There was significant difference between fluoride concentrations at different time points (P< 0.001. Significant differences were observed when the different time points of two regimens were examined. In contrast to this, the baseline before using F regimen and the baseline before using Ca + F regimen did not show any significance (P= 0.070.Conclusion: Pre-rinsing with calcium before fluoride is recommended because of signifi-cant increases in salivary fluoride concentration.

  12. Fluoride resistance in Streptococcus mutans

    NARCIS (Netherlands)

    Liao, Ying


    Fluoride has been used as the most effective anti-caries agent for over five decades. It functions not only on the dental hard tissues, but also as an antimicrobial agent. It is known that oral bacteria are able to develop resistance to fluoride, which may affect the effectiveness of fluoride in

  13. Molecular mechanisms of fluoride toxicity. (United States)

    Barbier, Olivier; Arreola-Mendoza, Laura; Del Razo, Luz María


    Halfway through the twentieth century, fluoride piqued the interest of toxicologists due to its deleterious effects at high concentrations in human populations suffering from fluorosis and in in vivo experimental models. Until the 1990s, the toxicity of fluoride was largely ignored due to its "good reputation" for preventing caries via topical application and in dental toothpastes. However, in the last decade, interest in its undesirable effects has resurfaced due to the awareness that this element interacts with cellular systems even at low doses. In recent years, several investigations demonstrated that fluoride can induce oxidative stress and modulate intracellular redox homeostasis, lipid peroxidation and protein carbonyl content, as well as alter gene expression and cause apoptosis. Genes modulated by fluoride include those related to the stress response, metabolic enzymes, the cell cycle, cell-cell communications and signal transduction. The primary purpose of this review is to examine recent findings from our group and others that focus on the molecular mechanisms of the action of inorganic fluoride in several cellular processes with respect to potential physiological and toxicological implications. This review presents an overview of the current research on the molecular aspects of fluoride exposure with emphasis on biological targets and their possible mechanisms of involvement in fluoride cytotoxicity. The goal of this review is to enhance understanding of the mechanisms by which fluoride affects cells, with an emphasis on tissue-specific events in humans. Copyright © 2010 Elsevier Ireland Ltd. All rights reserved.

  14. Fluoride-releasing restorative materials and secondary caries. (United States)

    Hicks, John; Garcia-Godoy, Franklin; Donly, Kevin; Flaitz, Catherine


    Secondary caries is responsible for 60 percent of all replacement restorations in the typical dental practice. Risk factors for secondary caries are similar to those for primary caries development. Unfortunately, it is not possible to accurately predict which patients are at risk for restoration failure. During the past several decades, fluoride-releasing dental materials have become a part of the dentist's armamentarium. Considerable fluoride is released during the setting reaction and for periods up to eight years following restoration placement. This released fluoride is readily taken up by the cavosurface tooth structure, as well as the enamel and root surfaces adjacent to the restoration. Resistance against caries along the cavosurface and the adjacent smooth surface has been shown in both in vitro and in vivo studies. Fluoride-releasing dental materials provide for improved resistance against primary and secondary caries in coronal and root surfaces. Plaque and salivary fluoride levels are elevated to a level that facilitates remineralization. In addition, the fluoride released to dental plaque adversely affects the growth of lactobacilli and mutans streptococci by interference with bacterial enzyme systems. Fluoride recharging of these dental materials is readily achieved with fluoridated toothpastes, fluoride mouthrinses, and other sources of topical fluoride. This allows fluoride-releasing dental materials to act as intraoral fluoride reservoirs. The improvement in the properties of dental materials with the ability to release fluoride has improved dramatically in the past decade, and it is anticipated that in the near future the vast majority of restorative procedures will employ fluoride-releasing dental materials as bonding agents, cavity liners, luting agents, adhesives for orthodontic brackets, and definitive restoratives.

  15. Metabolic inhibitors as stimulating factors for citric acid production

    International Nuclear Information System (INIS)

    Adham, N.Z.; Ahmed, E.M.; Refai, H.A.E.


    The effect of some metabolic inhibitors on citric acid (CA) production by Aspergillus niger in cane molasses medium was investigated. Addition of 0.01-0.1 mM iodoacetic acid and sodium arsenate, 0.05-1.0 mM sodium malonate, 0.01 mM sodium azide, 0.01-0.05 mM sodium fluoride, 0.1-1.0 mM EDTA stimulated CA production (5-49%). Higher concentrations (10 mM) of iodoacetic acid, sodium malonate and 0.5 mM sodium azide caused a complete inhibition of fungal growth, Iodoacetic acid, sodium arsenate and sodium fluoride (0.2 mM) caused a remarkable inhibition of CA production. The implications of those preliminary functions was discussed. (author)

  16. Fluoride uptake into the developing enamel and dentine of sheep incisors following daily ingestion of fluoridated milk or water

    International Nuclear Information System (INIS)

    Cuttress, T.W.; Suckling, G.W.; Gao, J.; Coote, G.E.


    The caries preventive action of fluoride is common knowledge, although some of the mechanisms involved remain equivocal. At present, raised local levels of fluoride at, or in, the surface of tooth enamel is the most commonly accepted explanation of the anti-cariogenic action of fluoride. However, fluoride incorporated as fluorapatite into the tooth during its formation remains a possible alternative or complementary anti-cariogenic mechanism. If so, regular ingestion of fluoride during tooth formation is beneficial. Although use of fluoridated water is the preferred method in public health programmes, access to suitable potable water is required, and often this in not feasible. Fresh, preserved, or dried cow's milk products are widely used as nutritional and dietary items in most populations, particularly for young children. Milk is a practical, controllable means for regular delivery of fluoride. Processing of milk is commonly centralised and uses standardised conditions, allowing easy supplementation of fluoride for distribution to communities. The purpose of this study was to resolve the question of availability of fluoride ingested in milk compared with fluoride ingested in water by measuring fluoride deposition in the developing permanent incisors of young sheep. Incisors were analysed using a proton microprobe. (author). 18 refs., 1 tabs., 3 figs

  17. Influence of the method of fluoride administration on toxicity and fluoride concentrations in Japanese quail (United States)

    Fleming, W.J.; Schuler, C.A.


    Young Japanese quail (Coturnix japonica) were administered NaF for 16 d either in their diet or by esophageal intubation. Based on the total fluoride ion (Emg F-) intake over the l6-d experimental period, fluoride administered by intubation was at least six times more toxic than that fed in the diet. Dietary concentrations of 1,000 ppm F- (Emg F- for 16 d = approx. 144) produced no mortality, whereas intubated doses produced 73% or greater mortality in all groups administered 54 mg F- /kg/d or more (Emg F- for 16 d _ approx. 23 mg). GraphIc companson of the regression of log F- ppm in femurs/mg F- intake showed that fluoride levels in the femurs of quail administered fluoride by intubation were higher than in those administered fluoride in the diet.

  18. Application of Titanium Compounds to Reduce Fluoride Ion in Water Resources with High Fluoride Ion Contents

    Directory of Open Access Journals (Sweden)

    Fariborz Riahi


    Full Text Available The present work describes studies on the sorption of fluoride ions from water by titanium compounds used in water treatment to reduce fluoride content in water resources. There are different methods of reducing fluoride ion in water, each associated with specific problems such as secondary contamination, environmental contamination, high costs, or the need for primary and secondary treatment. In this study, application of titanium sulfate and Metatitanic acid produced from titanium ore concentrate (ileminite is investigated in the removal of fluoride ion and the possibility of complete purification of fluorine containing wastewater is examined to determine the optimal conditions. Metatitanic acid has a great sorption property for fluoride ion. Also titanium sulfate is a suitable and more effective material for this purpose. Efficiency of this material in reducing fluoride ion content is 99.9% and it is possible to refresh sorbet material for reuse without problems arising from Ti+4 ion contamination.

  19. Toxic effects of fluoride on organisms. (United States)

    Zuo, Huan; Chen, Liang; Kong, Ming; Qiu, Lipeng; Lü, Peng; Wu, Peng; Yang, Yanhua; Chen, Keping


    Accumulation of excess fluoride in the environment poses serious health risks to plants, animals, and humans. This endangers human health, affects organism growth and development, and negatively impacts the food chain, thereby affecting ecological balance. In recent years, numerous studies focused on the molecular mechanisms associated with fluoride toxicity. These studies have demonstrated that fluoride can induce oxidative stress, regulate intracellular redox homeostasis, and lead to mitochondrial damage, endoplasmic reticulum stress and alter gene expression. This paper reviews the present research on the potential adverse effects of overdose fluoride on various organisms and aims to improve our understanding of fluoride toxicity. Copyright © 2018 Elsevier Inc. All rights reserved.

  20. Magnetic interactions through fluoride

    DEFF Research Database (Denmark)

    Pedersen, Kasper Steen; Sigrist, Marc; Weihe, Høgni


    support the parameter values and resolve |E| ≈ 0.04 cm(-1). The exchange coupling constant (J) is 1 order of magnitude smaller than that found in comparable systems with linear oxide bridging but comparable to typical magnitudes through cyanide, thus underlining the potential of fluoride complexes......The nature of the magnetic interaction through fluoride in a simple, dinuclear manganese(III) complex (1), bridged by a single fluoride ion in a perfectly linear fashion, is established by experiment and density functional theory. The magnitude of the antiferromagnetic exchange interaction...

  1. [The effect of fluoride-containing tooth paste on dental plaque and on fluoride level in the mouth]. (United States)

    Oomori, H


    Various kinds of fluoride have been used for a long time and there are many reports concerning fluorides and their effects. Recently, the caries-inhibiting action of fluoride-containing tooth paste has been given much attention. In this study, I tried to clarify the residual time and amount of fluoride derived from the fluoride-containing tooth paste in the mouth, as well as to assess possible variation in bacterial composition in the dental plaque bacteriologically and biochemically. In the study on the fluoride clearance from the mouth, both 1.0 g and 0.5 g of paste showed the same reduction rates; and about an 80% reduction was recognized between the value at 3 minutes and that at 30 minutes, and about a 40% reduction from the 30-minute to the 60-minute interval. Next, a study on the variation in plaque bacteria was carried out. The total number of the CFU on each plate was not different between samples obtained before and after the use of the tooth paste; moreover, no difference was noted between aerobic and anaerobic culture. However, when plaque before and after brushing with fluoride-containing tooth paste were cultured in 10% sucrose solution, the differences of acid production such as lactic acid, acetic acid, and formic acid were demonstrated. Namely, these acid productions were inhibited after the use of fluoride, especially lactic acid was strongly inhibited. On the other hand, when Str. mutans from the plaque obtained after the use of fluoride-containing tooth paste was cultured in fluoride-free BHI broth, the inhibition of acid from carbohydrates was not shown clearly.(ABSTRACT TRUNCATED AT 250 WORDS)

  2. Physiologic Conditions Affect Toxicity of Ingested Industrial Fluoride

    Directory of Open Access Journals (Sweden)

    Richard Sauerheber


    Full Text Available The effects of calcium ion and broad pH ranges on free fluoride ion aqueous concentrations were measured directly and computed theoretically. Solubility calculations indicate that blood fluoride concentrations that occur in lethal poisonings would decrease calcium below prevailing levels. Acute lethal poisoning and also many of the chronic effects of fluoride involve alterations in the chemical activity of calcium by the fluoride ion. Natural calcium fluoride with low solubility and toxicity from ingestion is distinct from fully soluble toxic industrial fluorides. The toxicity of fluoride is determined by environmental conditions and the positive cations present. At a pH typical of gastric juice, fluoride is largely protonated as hydrofluoric acid HF. Industrial fluoride ingested from treated water enters saliva at levels too low to affect dental caries. Blood levels during lifelong consumption can harm heart, bone, brain, and even developing teeth enamel. The widespread policy known as water fluoridation is discussed in light of these findings.

  3. Physiologic conditions affect toxicity of ingested industrial fluoride. (United States)

    Sauerheber, Richard


    The effects of calcium ion and broad pH ranges on free fluoride ion aqueous concentrations were measured directly and computed theoretically. Solubility calculations indicate that blood fluoride concentrations that occur in lethal poisonings would decrease calcium below prevailing levels. Acute lethal poisoning and also many of the chronic effects of fluoride involve alterations in the chemical activity of calcium by the fluoride ion. Natural calcium fluoride with low solubility and toxicity from ingestion is distinct from fully soluble toxic industrial fluorides. The toxicity of fluoride is determined by environmental conditions and the positive cations present. At a pH typical of gastric juice, fluoride is largely protonated as hydrofluoric acid HF. Industrial fluoride ingested from treated water enters saliva at levels too low to affect dental caries. Blood levels during lifelong consumption can harm heart, bone, brain, and even developing teeth enamel. The widespread policy known as water fluoridation is discussed in light of these findings.

  4. Potential fluoride toxicity from oral medicaments: A review. (United States)

    Ullah, Rizwan; Zafar, Muhammad Sohail; Shahani, Nazish


    The beneficial effects of fluoride on human oral health are well studied. There are numerous studies demonstrating that a small amount of fluoride delivered to the oral cavity decreases the prevalence of dental decay and results in stronger teeth and bones. However, ingestion of fluoride more than the recommended limit leads to toxicity and adverse effects. In order to update our understanding of fluoride and its potential toxicity, we have described the mechanisms of fluoride metabolism, toxic effects, and management of fluoride toxicity. The main aim of this review is to highlight the potential adverse effects of fluoride overdose and poorly understood toxicity. In addition, the related clinical significance of fluoride overdose and toxicity has been discussed.

  5. Effects of hydrogen fluoride on plants

    Energy Technology Data Exchange (ETDEWEB)

    Yamazoe, F


    Symptoms of fluorosis in plants are chlorotic markings around the tip or edges of young leaves. Examples of damage to plants and livestock by fluorides are listed, including the retarded growth of silkworms fed on mulberry leaves polluted by more than 30 ppm fluorides. Plants can be classified into six groups according to their resistance to hydrogen fluoride. Threshold values of the fluoride concentration range from 5-10 ppb for the plants. Gladiolus is normally employed as a plant indicator for hydrogen fluoride and silkworms as indicator insects. The relationship between plant damage by fluorides and exposure time, density, soil, fertilizer, meteorology and location are examined. Several preventive measures are listed, including the spraying of water or lime on plant leaves. It is concluded that the establishment of an environmental standard is difficult because of the extremely high sensitivity of the plants to the gas. 8 references.

  6. Sirt1 overexpression suppresses fluoride-induced p53 acetylation to alleviate fluoride toxicity in ameloblasts responsible for enamel formation. (United States)

    Suzuki, Maiko; Ikeda, Atsushi; Bartlett, John D


    Low-dose fluoride is an effective caries prophylactic, but high-dose fluoride is an environmental health hazard that causes skeletal and dental fluorosis. Treatments to prevent fluorosis and the molecular pathways responsive to fluoride exposure remain to be elucidated. Previously we showed that fluoride activates SIRT1 as an adaptive response to protect cells. Here, we demonstrate that fluoride induced p53 acetylation (Ac-p53) [Lys379], which is a SIRT1 deacetylation target, in ameloblast-derived LS8 cells in vitro and in enamel organ in vivo. Here we assessed SIRT1 function on fluoride-induced Ac-p53 formation using CRISPR/Cas9-mediated Sirt1 knockout (LS8 Sirt/KO ) cells or CRISPR/dCas9/SAM-mediated Sirt1 overexpressing (LS8 Sirt1/over ) cells. NaF (5 mM) induced Ac-p53 formation and increased cell cycle arrest via Cdkn1a/p21 expression in Wild-type (WT) cells. However, fluoride-induced Ac-p53 was suppressed by the SIRT1 activator resveratrol (50 µM). Without fluoride, Ac-p53 persisted in LS8 Sirt/KO cells, whereas it decreased in LS8 Sirt1/over . Fluoride-induced Ac-p53 formation was also suppressed in LS8 Sirt1/over cells. Compared to WT cells, fluoride-induced Cdkn1a/p21 expression was elevated in LS8 Sirt/KO and these cells were more susceptible to fluoride-induced growth inhibition. In contrast, LS8 Sirt1/over cells were significantly more resistant. In addition, fluoride-induced cytochrome-c release and caspase-3 activation were suppressed in LS8 Sirt1/over cells. Fluoride induced expression of the DNA double strand break marker γH2AX in WT cells and this was augmented in LS8 Sirt1/KO cells, but was attenuated in LS8 Sirt1/over cells. Our results suggest that SIRT1 deacetylates Ac-p53 to mitigate fluoride-induced cell growth inhibition, mitochondrial damage, DNA damage and apoptosis. This is the first report implicating Ac-p53 in fluoride toxicity.

  7. Eukaryotic resistance to fluoride toxicity mediated by a widespread family of fluoride export proteins


    Li, Sanshu; Smith, Kathryn D.; Davis, Jared H.; Gordon, Patricia B.; Breaker, Ronald R.; Strobel, Scott A.


    Although fluoride is plentiful in the environment and is commonly used at high concentrations in oral hygiene products, little has been known about how biological systems overcome the toxic effects of this anion. We demonstrate that a protein called FEX in many fungi is essential for cell survival in the presence of high fluoride concentrations. The protein is required for the rapid expulsion of cytoplasmic fluoride, indicating that many eukaryotic species that carry FEX genes likely avoid fl...

  8. Gramicidin D enhances the antibacterial activity of fluoride


    Nelson, James W.; Zhou, Zhiyuan; Breaker, Ronald R.


    Fluoride is a toxic anion found in many natural environments. One of the major bacterial defenses against fluoride is the cell envelope, which limits passage of the membrane-impermeant fluoride anion. Accordingly, compounds that enhance the permeability of bacterial membranes to fluoride should also enhance fluoride toxicity. In this study, we demonstrate that the pore-forming antibiotic gramicidin D increases fluoride uptake in B. subtilis and that the antibacterial activity of this compound...

  9. Accumulation of fluoride by plants and vegetables

    International Nuclear Information System (INIS)

    Njenga, L.W.; Kariuki, D.N.


    Fluoride in plant and vegetable samples has been determined using ion selective electrode. The analysis was carried out after ashing the sample on an open flame, adding perchloric acid and allowing the hydrogen fluoride to diffuse into sodium hydroxide layer.The results obtained show that kale and pumpkins can accumulate more than ten times their normal values of fluoride while plants were found to accumulate upto 100μg/g fluoride when exposed to highlevels of fluoride in water or soil. (author)

  10. Spatial distribution mapping of drinking water fluoride levels in Karnataka, India: fluoride-related health effects. (United States)

    Chowdhury, Chitta R; Shahnawaz, Khijmatgar; Kumari, Divya; Chowdhury, Avidyuti; Bedi, Raman; Lynch, Edward; Harding, Stewart; Grootveld, Martin


    (1) To estimate the concentrations of fluoride in drinking water throughout different zones and districts of the state of Karnataka. (2) To investigate the variation of fluoride concentration in drinking water from different sources, and its relationships to daily temperature and rainfall status in the regional districts. (3) To develop an updated fluoride concentration intensity map of the state of Karnataka, and to evaluate these data in the context of fluoride-related health effects such as fluorosis and their prevalence. Aqueous standard solutions of 10, 100 and 1,000 ppm fluoride (F - ) were prepared with analytical grade Na + /F - and a buffer; TISAB II was incorporated in both calibration standard and analysis solutions in order to remove the potentially interfering effects of trace metal ions. This analysis was performed using an ion-selective electrode (ISE), and mean determination readings for n = 5 samples collected at each Karnataka water source were recorded. The F - concentration in drinking water in Karnataka state was found to vary substantially, with the highest mean values recorded being in the north-eastern zone (1.61 ppm), and the lowest in the south-western one (only 0.41 ppm). Analysis of variance (ANOVA) demonstrated that there were very highly significant 'between-zone' and 'between-districts-within-zones' sources of variation (p water source F - levels within this state. The southern part of Karnataka has low levels of F - in its drinking water, and may require fluoridation treatment in order to mitigate for dental caries and further ailments related to fluoride deficiency. However, districts within the north-eastern region have contrastingly high levels of fluoride, an observation which has been linked to dental and skeletal fluorosis. This highlights a major requirement for interventional actions in order to ensure maintenance of the recommended range of fluoride concentrations (0.8-1.5 ppm) in Karnataka's drinking water

  11. Gramicidin D enhances the antibacterial activity of fluoride. (United States)

    Nelson, James W; Zhou, Zhiyuan; Breaker, Ronald R


    Fluoride is a toxic anion found in many natural environments. One of the major bacterial defenses against fluoride is the cell envelope, which limits passage of the membrane-impermeant fluoride anion. Accordingly, compounds that enhance the permeability of bacterial membranes to fluoride should also enhance fluoride toxicity. In this study, we demonstrate that the pore-forming antibiotic gramicidin D increases fluoride uptake in Bacillus subtilis and that the antibacterial activity of this compound is potentiated by fluoride. Polymyxin B, another membrane-targeting antibiotic with a different mechanism of action, shows no such improvement. These results, along with previous findings, indicate that certain compounds that destabilize bacterial cell envelopes can enhance the toxicity of fluoride. Copyright © 2014 Elsevier Ltd. All rights reserved.

  12. Potential fluoride toxicity from oral medicaments: A review

    Directory of Open Access Journals (Sweden)

    Rizwan Ullah


    Full Text Available The beneficial effects of fluoride on human oral health are well studied. There are numerous studies demonstrating that a small amount of fluoride delivered to the oral cavity decreases the prevalence of dental decay and results in stronger teeth and bones. However, ingestion of fluoride more than the recommended limit leads to toxicity and adverse effects. In order to update our understanding of fluoride and its potential toxicity, we have described the mechanisms of fluoride metabolism, toxic effects, and management of fluoride toxicity. The main aim of this review is to highlight the potential adverse effects of fluoride overdose and poorly understood toxicity. In addition, the related clinical significance of fluoride overdose and toxicity has been discussed.

  13. Growth of fluoride treated Kalanchoe pinnata plants

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, H N; Applegate, H G


    Kalanchoe pinnata plants can absorb fluoride through roots. The absorption is related to the amount of fluoride applied to the soil. There appeared to be a relationship between the amount of fluoride adsorbed and the subsequent growth of the plants. Plants which adsorbed the largest amounts of fluoride had the greatest increase in growth.

  14. Well Waters Fluoride in Enugu, Nigeria

    Directory of Open Access Journals (Sweden)

    ISI Ogbu


    Full Text Available Abnormal fluoride levels in drinking water have been associated with adverse health effects. To determine the fluoride content of well waters in Enugu, southeastern Nigeria, water samples from 50 artisan wells chosen by multistage sampling procedure from the 5 zones of Enugu municipality were analyzed in duplicates for their fluoride content. The zonal mean values were 0.60, 0.70, 0.62, 0.62, and 0.63 mg/L for Abakpa Nike, Achara Layout, Obiagu/ Ogui, Trans Ekulu and Uwani, respectively (p<0.05. The mean value for the whole city was 0.63 mg/L. Although, the mean level of fluoride recorded in this study is currently within safe limits (1.5 mg/L, WHO 2011, it is important to monitor continuously the fluoride content of well waters in the municipality in view of the increasing industrial activities going on in the city and heavy reliance on well water for domestic purposes and the widespread use of consumer products containing fluoride.

  15. The effects of fluoride, strontium, theobromine and their combinations on caries lesion rehardening and fluoridation. (United States)

    Lippert, Frank


    The aim was to investigate the effects of fluoride, strontium, theobromine and their combinations on caries lesion rehardening and fluoridation (EFU) under pH cycling conditions. Human enamel specimens were demineralized at 37°C for 24h using a pH 5.0 solution containing 50mM lactic acid and 0.2% Carbopol 907 which was 50% saturated with respect to hydroxyapatite. Lesions were assigned to nine treatment groups (n=16) based on Knoop surface microhardness indentation length. aqueous solutions were: placebo, 11.9mM sodium fluoride (F), 23.8mM sodium fluoride (2×F), 1.1mM strontium chloride hexahydrate (Sr), 1.1mM F theobromine, Sr+theobromine, F+Sr, F+theobromine, F+Sr+theobromine. Lesions were pH cycled for 5d (daily protocol: 3×1min-treatment; 2×60min-demineralization; 4×60min & overnight-artificial saliva). Knoop indentation length was measured again and%surface microhardness recovery (%SMHr) calculated. EFU was determined using the acid-etch technique. Data were analysed using ANOVA. Model showed fluoride dose-response for both variables (2×F>F>placebo). For%SMHr, F+Sr+/-theobromine resulted in more rehardening than F, however less than 2×F. F+theobromine was similar to F. For EFU, F+Sr was inferior to F, F+theobromine and F+Sr+theobromine which were similar and inferior to 2×F. In absence of fluoride, Sr, theobromine or Sr+theobromine were virtually indistinguishable from placebo and inferior to F. It can be concluded that a) strontium aids rehardening but not EFU and only in presence of fluoride; b) theobromine does not appear to offer any anti-caries benefits in this model; c) there are no synergistic effects between strontium and theobromine in the presence or absence of fluoride. Copyright © 2017 Elsevier Ltd. All rights reserved.

  16. A review of slow-release fluoride devices. (United States)

    Toumba, K J; Al-Ibrahim, N S; Curzon, M E J


    Fluoride has been used to combat dental caries using a number of different clinical approaches. An exciting relatively new development is fluoride slow-releasing devices that consistently elevate intra-oral fluoride levels of plaque and saliva for prolonged periods of up to two years. The literature on the use of slow-releasing fluoride devices in dentistry were reviewed. A Medline search on key words was carried out. All papers in English were individually reviewed. Slow-releasing fluoride devices have been shown to be effective in elevating salivary fluoride levels in both animals and human studies and to enhance the remineralisation of dental enamel. They have been demonstrated to be safe to use and without the risk of fluoride toxicity. A double blind randomised clinical trial demonstrated 76% fewer new carious surface increment in high caries-risk children after two years. These devices have a number of potential uses in dentistry and in particular have great potential for caries prevention of non-compliant high caries-risk groups.

  17. Effects of fluoridated milk on root dentin remineralization.

    Directory of Open Access Journals (Sweden)

    Wolfgang H Arnold

    Full Text Available The prevalence of root caries is increasing with greater life expectancy and number of retained teeth. Therefore, new preventive strategies should be developed to reduce the prevalence of root caries. The aim of this study was to investigate the effects of fluoridated milk on the remineralization of root dentin and to compare these effects to those of sodium fluoride (NaF application without milk.Thirty extracted human molars were divided into 6 groups, and the root cementum was removed from each tooth. The dentin surface was demineralized and then incubated with one of the following six solutions: Sodium chloride NaCl, artificial saliva, milk, milk+2.5 ppm fluoride, milk+10 ppm fluoride and artificial saliva+10 ppm fluoride. Serial sections were cut through the lesions and investigated with polarized light microscopy and quantitative morphometry, scanning electron microscopy (SEM and energy-dispersive X-ray spectroscopy (EDS. The data were statistically evaluated using a one-way ANOVA for multiple comparisons.The depth of the lesion decreased with increasing fluoride concentration and was the smallest after incubation with artificial saliva+10 ppm fluoride. SEM analysis revealed a clearly demarcated superficial remineralized zone after incubation with milk+2.5 ppm fluoride, milk+10 ppm fluoride and artificial saliva+10 ppm fluoride. Ca content in this zone increased with increasing fluoride content and was highest after artificial saliva+10 ppm fluoride incubation. In the artificial saliva+10 ppm fluoride group, an additional crystalline layer was present on top of the lesion that contained elevated levels of F and Ca.Incubation of root dentin with fluoridated milk showed a clear effect on root dentin remineralization, and incubation with NaF dissolved in artificial saliva demonstrated a stronger effect.

  18. Fluoride Increase in Saliva and Dental Biofilm due to a Meal Prepared with Fluoridated Water or Salt: A Crossover Clinical Study. (United States)

    Lima, Carolina V; Tenuta, Livia M A; Cury, Jaime A


    Knowledge about fluoride delivery to oral fluids from foods cooked with fluoridated water and salt is scarce, and no study has evaluated fluoride concentrations in saliva or biofilm during meal consumption. In this randomized double-blind crossover study, 12 volunteers ingested meals (rice, beans, meat, and legumes) prepared with nonfluoridated water and salt (control group), fluoridated water (0.70 mg F/L; water group), and fluoridated salt (183.7 mg F/kg; salt group). Whole saliva was collected before meal ingestion, during mastication, and up to 2 h after meal ingestion. Dental biofilm was collected before and immediately after meal ingestion. Fluoride concentrations in saliva and dental biofilm were determined by an ion-specific electrode. The mean (±standard deviation; n = 4) fluoride concentrations in meals prepared for the control, water, and salt groups were 0.039 ± 0.01, 0.43 ± 0.04, and 1.71 ± 0.32 μg F/g, respectively. The three groups had significantly different fluoride concentrations in saliva collected during mastication (p water > control). The fluoride concentration in saliva returned to baseline 30 min after meal ingestion in the water group but remained high for up to 2 h in the salt group (p = 0.002). The fluoride concentration in biofilm fluid differed only between the salt and control groups (p = 0.008). The mastication of foods cooked with fluoridated water and salt increases fluoride concentrations in oral fluids and may contribute to the local effect of these community-based fluoride interventions on caries control. © 2018 S. Karger AG, Basel.

  19. Estimation of atmospheric fluoride by limed filter papers

    International Nuclear Information System (INIS)

    Smith, D.R.


    The limed filter paper method of static sampling of atmospheric fluoride is reviewed in this report. Use of the technique, in conjunction with precise measurement of the absorbed fluoride and calibration with dynamic air sampling techniques, to estimate atmospheric fluoride levels, is considered to give only qualitative data (± 50%). The limed filter paper method is site specific due to variations in meteorological conditions. Its main value is to indicate seasonal and annual trends in fluoride exposure of vegetation. Subject to these considerations, the lower and upper limits of atmospheric fluoride exposure and the applicability to atmospheric fluoride estimation under routine or emergency fluoride release conditions are discussed, with special emphasis on the limiting factors

  20. Scandium fluorides

    International Nuclear Information System (INIS)

    Melnikov, P.; Nalin, M.; Messaddeq, Y.


    A new modification of scandium fluoride has been synthesised. The compound is deficient in fluorine, with the composition ScF 2.76 . It belongs to the tetragonal system, lattice parameters being a=3.792 and c=6.740 A and may be obtained at low temperatures by the decomposition of the precursor NH 4 ScF 4 . The reaction is topotactic, tetragonal parameters of the precursor are a=4.021 and c=6.744 A. Structural relationships with various fluorides and ammonium aminofluorides are discussed. This synthesis route with IR-assisted decomposition should be considered as a soft-chemistry approach. (orig.)

  1. Atmospheric fluoride levels in some Ontario peach orchards

    Energy Technology Data Exchange (ETDEWEB)

    Drowley, W B; Rayner, A C; Jephcott, C M


    As a result of suture injury to peaches, a survey was taken to determine monthly atmospheric fluoride levels in the soft fruit-growing area of the Niagara Peninsula of Ontario. Although the injury was confined to a few orchards, it was found necessary to locate stations for fluoride sampling over a wide area. The limed-paper candle method was used for fluoride collection. Unwashed and washed peach leaves were analyzed for fluoride content. Fluoride was separated from all samples by the Willard-Winter distillation procedure and estimated colorimetrically. It was found that a general background level of atmospheric fluoride existed in the whole surveyed area and that the levels were highest in and near the area of peach injury. The fluoride content of peach leaves was also highest in this area. The coincidence of high fluoride levels and suture injury to peaches suggests that atmospheric fluoride was the causal agent. When lime sprays were applied to peach trees in the damaged area, a reduction in the incidence of suture injury was observed.

  2. Adverse effects of fluoride towards thyroid hormone metabolism

    Directory of Open Access Journals (Sweden)

    Enggar Abdullah Idris MZ


    Full Text Available An easily ionized fluoride compound like Sodium Fluoride (NaF has been used thus far as a dental caries prevention substance. However, fluoride ions also have a negative effect because it is very toxic. Several types of research on the effect of fluoride on guinea pigs and human beings indicate the presence synthesis obstruction of T3 and T4 that causes declined production, known as hypothyroidism. Hypothyroidism condition may obstruct tissue growth process and metabolism so as to impact various body organ systems. Preventive efforts against hypothyroidism caused by fluoride include avoiding diffusible fluoride compound intake, like NaF, in a long run systemic use, whereas efforts to overcome fluoride intoxication include consuming food that is rich in calcium, vitamin D, and antioxidant.

  3. Fluoride and Water (For Parents) (United States)

    ... risk of tooth decay" on the label. The Controversy Over Fluoride Opponents of water fluoridation have questioned ... Us Contact Us Partners Editorial Policy Permissions Guidelines Privacy Policy & Terms of Use Notice of Nondiscrimination Visit ...

  4. Physiologic Conditions Affect Toxicity of Ingested Industrial Fluoride


    Richard Sauerheber


    The effects of calcium ion and broad pH ranges on free fluoride ion aqueous concentrations were measured directly and computed theoretically. Solubility calculations indicate that blood fluoride concentrations that occur in lethal poisonings would decrease calcium below prevailing levels. Acute lethal poisoning and also many of the chronic effects of fluoride involve alterations in the chemical activity of calcium by the fluoride ion. Natural calcium fluoride with low solubility and toxicity ...

  5. Fluoride Removal from Water by Reverse Osmosis Membrane

    Directory of Open Access Journals (Sweden)

    Sara Namavar


    Full Text Available As fluoride concentration in drinking water is one of the effective parameters in human health, finding the way to remove excess amount of fluoride from drinking water is very important in water supply projects. Today, with developing in technology and finding new methods, the use of membrane technology for producing fresh water get improved. In this study the efficiency of reverse osmosis method to remove fluoride from water was investigated. Initial concentration of fluoride, sulfate and electrical conductivity in feed water and the effect of associated cation with fluoride ion were studied. All tests adapted from “Standard Methods for Examination of Water and Wastewater”. Determination of fluoride concentration was done according the standard SPANDS method by using a spectrophotometer DR/5000. Obtain results show that with increasing in concentration of fluoride and sulfate and electrical conductivity in feed water the efficiency of RO membrane to remove fluoride reduced. In addition, this efficiency for CaF2 was higher than NaF.


    Kanduti, Domen; Sterbenk, Petra; Artnik, Barbara


    Appropriate oral health care is fundamental for any individual's health. Dental caries is still one of the major public health problems. The most effective way of caries prevention is the use of fluoride. The aim of our research was to review the literature about fluoride toxicity and to inform physicians, dentists and public health specialists whether fluoride use is expedient and safe. Data we used in our review were systematically searched and collected from web pages and documents published from different international institutions. Fluoride occurs naturally in our environment but we consume it in small amounts. Exposure can occur through dietary intake, respiration and fluoride supplements. The most important factor for fluoride presence in alimentation is fluoridated water. Methods, which led to greater fluoride exposure and lowered caries prevalence, are considered to be one of the greatest accomplishments in the 20th century`s public dental health. During pregnancy, the placenta acts as a barrier. The fluoride, therefore, crosses the placenta in low concentrations. Fluoride can be transmitted through the plasma into the mother's milk; however, the concentration is low. The most important action of fluoride is topical, when it is present in the saliva in the appropriate concentration. The most important effect of fluoride on caries incidence is through its role in the process of remineralization and demineralization of tooth enamel. Acute toxicity can occur after ingesting one or more doses of fluoride over a short time period which then leads to poisoning. Today, poisoning is mainly due to unsupervised ingestion of products for dental and oral hygiene and over-fluoridated water. Even though fluoride can be toxic in extremely high concentrations, it`s topical use is safe. The European Academy of Paediatric Dentistry (EAPD) recommends a preventive topical use of fluoride supplements because of their cariostatic effect.

  7. Strontium-90 fluoride data sheet

    Energy Technology Data Exchange (ETDEWEB)

    Fullam, H.T.


    This report is a compilation of available data and appropriate literature references on the properties of strontium-90 fluoride and nonradioactive strontium fluoride. The objective of the document is to compile in a single source pertinent data to assist potential users in the development, licensing, and use of /sup 90/SrF/sub 2/-fueled radioisotope heat sources for terrestrial power conversion and thermal applications. The report is an update of the Strontium-90 Fluoride Data Sheet (BNWL-2284) originally issued in April 1977.

  8. Biochemical analysis of a papain-like protease isolated from the latex of Asclepias curassavica L. (United States)

    Liggieri, Constanza; Obregon, Walter; Trejo, Sebastian; Priolo, Nora


    Most of the species belonging to Asclepiadaceae family usually secrete an endogenous milk-like fluid in a network of laticifer cells in which sub-cellular organelles intensively synthesize proteins and secondary metabolites. A new papain-like endopeptidase (asclepain c-II) has been isolated and characterized from the latex extracted from petioles of Asclepias curassavica L. (Asclepiadaceae). Asclepain c-II was the minor proteolytic component in the latex, but showed higher specific activity than asclepain c-I, the main active fraction previously studied. Both enzymes displayed quite distinct biochemical characteristics, confirming that they are different enzymes. Crude extract was purified by cation exchange chromatography (FPLC). Two active fractions, homogeneous by sodium dodecyl sulphate-polyacrylamide gel electrophoresis and mass spectrometry, were isolated. Asclepain c-II displayed a molecular mass of 23,590 Da, a pI higher than 9.3, maximum proteolytic activity at pH 9.4-10.2, and showed poor thermostability. The activity of asclepain c-II is inhibited by cysteine proteases inhibitors like E-64, but not by any other protease inhibitors such as 1,10-phenantroline, phenylmethanesulfonyl fluoride, and pepstatine. The Nterminal sequence (LPSFVDWRQKGVVFPIRNQGQCGSCWTFSA) showed a high similarity with those of other plant cysteine proteinases. When assayed on N-alpha-CBZ-amino acid-p-nitrophenyl esters, the enzyme exhibited higher preference for the glutamine derivative. Determinations of kinetic parameters were performed with N-alpha-CBZ-L-Gln-p-nitrophenyl ester as substrate: K(m)=0.1634 mM, k(cat)=121.48 s(-1), and k(cat)/K(m)=7.4 x 10(5) s(-1)/mM.

  9. Potential fluoride toxicity from oral medicaments: A review


    Rizwan Ullah; Muhammad Sohail Zafar; Nazish Shahani


    The beneficial effects of fluoride on human oral health are well studied. There are numerous studies demonstrating that a small amount of fluoride delivered to the oral cavity decreases the prevalence of dental decay and results in stronger teeth and bones. However, ingestion of fluoride more than the recommended limit leads to toxicity and adverse effects. In order to update our understanding of fluoride and its potential toxicity, we have described the mechanisms of fluoride metabolism, tox...

  10. Low-levels of fluoride in plaque and saliva and their effects on the demineralisation and remineralisation of enamel; role of fluoride toothpastes. (United States)

    Lynch, R J M; Navada, R; Walia, R


    To summarise support for current consensus on the likely means by which fluoride toothpastes reduce caries and review some relevant studies of the effect of low levels of fluoride on the demineralisation and remineralisation of enamel. The major anti-caries effect of fluoride toothpastes is thought to result from small but protracted elevations in levels of fluoride in plaque and saliva. Fluoride incorporated into enamel systemically does not reduce enamel solubility sufficiently to exert an anti-caries effect. Fluoride has the potential to exert an anti-caries benefit largely through three mechanisms; inhibition of demineralisation, promotion of remineralisation and interference with bacterial growth and metabolism. However, the low levels of fluoride thought to influence caries are insufficient to have a significant effect via the latter mechanism. Thus reductions in caries resulting from the use of fluoride toothpastes can be linked to modification of the demineralisation/remineralisation balance by direct effects on dental mineral exerted topically by low levels of fluoride. Numerous in vitro studies have shown that low levels of fluoride, typical of those found after many hours in resting plaque and saliva, and resulting from the regular use of fluoride toothpastes, can have a profound effect on enamel demineralisation and remineralisation.

  11. Fluoride release and cariostatic potential of orthodontic adhesives with and without daily fluoride rinsing.

    NARCIS (Netherlands)

    Chin, M.Y.; Sandham, A.; Rumachik, E.N.; Ruben, J.L.; Huysmans, M.C.D.N.J.M.


    INTRODUCTION: In this study, we aimed to evaluate the fluoride-release profiles and caries lesion development in an enamel model with brackets cemented with 4 orthodontic adhesives with and without daily fluoride exposure. METHODS: Four orthodontic adhesives (Ketac Cem mu, 3M ESPE, Seefeld, Germany;

  12. Fluoride release and cariostatic potential of orthodontic adhesives with and without daily fluoride rinsing

    NARCIS (Netherlands)

    Chin, Yeen; Sandham, John; Rumachik, Elena N.; Ruben, Jan L.; Huysmans, Marie-Charlotte D. N. J. M.


    Introduction: In this study, we aimed to evaluate the fluoride-release profiles and caries lesion development in an enamel model with brackets cemented with 4 orthodontic adhesives with and without daily fluoride exposure. Methods: Four orthodontic adhesives (Ketac Cem mu, 3M ESPE, Seefeld, Germany;

  13. Acute toxicity of ingested fluoride. (United States)

    Whitford, Gary Milton


    This chapter discusses the characteristics and treatment of acute fluoride toxicity as well as the most common sources of overexposure, the doses that cause acute toxicity, and factors that can influence the clinical outcome. Cases of serious systemic toxicity and fatalities due to acute exposures are now rare, but overexposures causing toxic signs and symptoms are not. The clinical course of systemic toxicity from ingested fluoride begins with gastric signs and symptoms, and can develop with alarming rapidity. Treatment involves minimizing absorption by administering a solution containing calcium, monitoring and managing plasma calcium and potassium concentrations, acid-base status, and supporting vital functions. Approximately 30,000 calls to US poison control centers concerning acute exposures in children are made each year, most of which involve temporary gastrointestinal effects, but others require medical treatment. The most common sources of acute overexposures today are dental products - particularly dentifrices because of their relatively high fluoride concentrations, pleasant flavors, and their presence in non-secure locations in most homes. For example, ingestion of only 1.8 ounces of a standard fluoridated dentifrice (900-1,100 mg/kg) by a 10-kg child delivers enough fluoride to reach the 'probably toxic dose' (5 mg/kg body weight). Factors that may influence the clinical course of an overexposure include the chemical compound (e.g. NaF, MFP, etc.), the age and acid-base status of the individual, and the elapsed time between exposure and the initiation of treatment. While fluoride has well-established beneficial dental effects and cases of serious toxicity are now rare, the potential for toxicity requires that fluoride-containing materials be handled and stored with the respect they deserve. Copyright © 2011 S. Karger AG, Basel.

  14. Inhibition of cellular oxidation by fluoride

    Energy Technology Data Exchange (ETDEWEB)

    Borei, H


    An attempt has been made to investigate the inhibition by fluoride of the oxidative processes which occur in the cell by way of the cytochrome oxidase-cytochrome system. Some chemical and physical properties of the fluoride ion are discussed, together with certain quantitative methods for the determination of fluoride. An exhaustive review of the literature concerning the effect of fluoride on enzymic processes has been compiled. The experiments have shown that the point of the attack by fluoride is to be found among the cytochromes. The inhibitory mechanism appears to be such that the haemoprotein is prevented from taking part in the preceding and succeeding links in the reaction chain. The blocking action leaves the prosthetic group of the haemoprotein completely unchanged. The experimental results indicate the formation of a fluorophosphoprotein complex, analogous to that found in the case of enolase. Magnesium may possibly play a part in this process.

  15. Acute toxicity of uranium hexafluoride, uranyl fluoride and hydrogen fluoride

    International Nuclear Information System (INIS)

    Just, R.A.


    Uranium hexafluoride (UF 6 ) released into the atmosphere will react rapidly with moisture in the air to form the hydrolysis products uranyl fluoride (UO 2 F 2 ) and hydrogen fluoride (HF). Uranium compounds such as UF 6 and UO 2 F 2 exhibit both chemical toxicity and radiological effects, while HF exhibits only chemical toxicity. This paper describes the development of a methodology for assessing the human health consequences of a known acute exposure to a mixture of UF 6 , UO 2 F 2 , and HF. 4 refs., 2 figs., 5 tabs

  16. Evaluation of toxic action of fluorides on agricultural plants

    Directory of Open Access Journals (Sweden)

    V. N. Grishko


    Full Text Available The toxicity of potassium fluoride, sodium fluoride and ammonium fluoride for pea, maize, oat and onion was studied. It was found that the level of the toxic influence had grown with increase of fluoride concentration in the media of growth (from 5 to 100 mg of F–/l. By increase of the toxic influence the agricultural crops are disposed in the following row: oat < onion < maize < pea. Ammonium fluoride demonstrates lesser toxicity, than potassium and sodium fluorides. Under low concentrations of fluoride compounds (5 and 10 mg of F–/l stimulation of roots growth is noted only for the oat.

  17. Mechanisms of inhibition by fluoride of urease activities of cell suspensions and biofilms of Staphylococcus epidermidis, Streptococcus salivarius, Actinomyces naeslundii and of dental plaque. (United States)

    Barboza-Silva, E; Castro, A C D; Marquis, R E


    Fluoride is known to be a potent inhibitor of bacterial ureases and can also act in the form of hydrofluoric acid as a transmembrane proton conductor to acidify the cytoplasm of intact cells with possible indirect, acid inhibition of urease. Our research objectives were to assess the inhibitory potencies of fluoride for three urease-positive bacteria commonly found in the mouth and to determine the relative importance of direct and indirect inhibition of ureases for overall inhibition of intact cells or biofilms. The experimental design involved intact bacteria in suspensions, mono-organism biofilms, cell extracts, and dental plaque. Standard enzymatic assays for ammonia production from urea were used. We found that ureolysis by cells in suspensions or mono-organism biofilms of Staphylococcus epidermidis, Streptococcus salivarius or Actinomyces naeslundii was inhibited by fluoride at plaque levels of 0.1-0.5 mm in a pH-dependent manner. The results of experiments with the organic weak acids indomethacin and capric acid, which do not directly inhibit urease enzyme, indicated that weak-acid effects leading to cytoplasmic acidification are also involved in fluoride inhibition. However, direct fluoride inhibition of urease appeared to be the major mechanism for reduction in ureolytic activity in acid environments. Results of experiments with freshly harvested supragingival dental plaque indicated responses to fluoride similar to those of S. salivarius with pH-dependent fluoride inhibition and both direct and indirect inhibition of urease. Fluoride can act to diminish alkali production from urea by oral bacteria through direct and indirect mechanisms.

  18. Determination of Fluoride in Different Toothpaste Formulations

    International Nuclear Information System (INIS)

    Kamau, N.G.; Njoroge, M.; Njau, M.


    Fluoride ion selective electrode was used to determine fluoride ion concentrations in seven brands of toothpaste. These were the only available formulations found in Kenya. The brands were classified into three groups-fluoridated, non fluoridated or not indicated. However, there was no independent indication of their quantitative composition. The analysed brands had fluoride content between 0.0033% and 0.096%. These values compared favourably with those obtained elsewhere. The calculated lowest limit of detection (LLD) was 0.01 ppmF- . The mean calibration curve gave a slope of of -50.0mV. which was not significantly different from the theoretical value of 5.88mV at 23 degrees celsius at 95% confidence level

  19. Anhydrous hydrogen fluoride electrolyte battery. [Patent application (United States)

    Not Available


    It is an object of the invention to provide a primary cell or battery using ammonium fluoride--anhydrous hydrogen fluoride electrolyte having improved current and power production capabilities at low temperatures. It is operable at temperatures substantially above the boiling point of hydrogen fluoride. (GRA)

  20. Fluoride ions vs removal technologies: A study

    Directory of Open Access Journals (Sweden)

    Jagvir Singh


    Full Text Available Literature reported that drinking water is a precious and scarce resource and it has to be protected and kept free from any kind of contamination. Further, it has to be used carefully without wasting. Literature also reported that fluoride bearing rocks are abundant in India, as a result, fluoride leaches out and contaminates the adjacent water and soil resources. A high concentration of fluoride ions in ground water increases up to more than 30 mg/L. This high concentration of fluoride ions causes many harmful and dangerous effects on our datum. Fluoride ions in larger quantities i.e. 20–80 mg/day taken over a period of 10–20 years result in crippling and skeletal fluorosis, severely damaging the bone. In the present scenario, there is a continuously increasing worldwide concern for the development of fluoride treatment technologies. Possibilities of reducing the high fluorine content in groundwater are by defluorination process/dilution with the surface water which is a very simple technique but the addition of Ca2+ ions to a solution in contact with fluorite when experimented in distilled water caused an appreciable decrease in fluoride concentration. In this review article, we emphasized the relationship between high concentrations of fluoride ions and their compounds and their health impact.

  1. Risk Assessment of Fluoride Intake from Tea in the Republic of Ireland and its Implications for Public Health and Water Fluoridation (United States)

    Waugh, Declan T.; Potter, William; Limeback, Hardy; Godfrey, Michael


    The Republic of Ireland (RoI) is the only European Country with a mandatory national legislation requiring artificial fluoridation of drinking water and has the highest per capita consumption of black tea in the world. Tea is a hyperaccumulator of fluoride and chronic fluoride intake is associated with multiple negative health outcomes. In this study, fifty four brands of the commercially available black tea bag products were purchased and the fluoride level in tea infusions tested by an ion-selective electrode method. The fluoride content in all brands tested ranged from 1.6 to 6.1 mg/L, with a mean value of 3.3 mg/L. According to our risk assessment it is evident that the general population in the RoI is at a high risk of chronic fluoride exposure and associated adverse health effects based on established reference values. We conclude that the culture of habitual tea drinking in the RoI indicates that the total cumulative dietary fluoride intake in the general population could readily exceed the levels known to cause chronic fluoride intoxication. Evidence suggests that excessive fluoride intake may be contributing to a wide range of adverse health effects. Therefore from a public health perspective, it would seem prudent and sensible that risk reduction measures be implemented to reduce the total body burden of fluoride in the population. PMID:26927146

  2. Structural study of chlorine tri-fluoride and bromine penta-fluoride in liquid and solid phase

    International Nuclear Information System (INIS)

    Rousson, R.


    This research thesis reports the structural study of chlorine tri-fluoride and bromine penta-fluoride between 20 C and about -265 C. After some generalities on these compounds and a presentation of the experimental technique, the author reports and discusses results obtained with these both compounds: Raman spectrum for the liquid and for the solid phase, infrared spectrum for the solid phase, calorimetric measurements. In the case of chlorine tri-fluoride, the author studies the evolution of the liquid spectrum with temperature, shows the existence of an intermediate solid phase, and compares results obtained by Raman spectroscopy and nuclear magnetic resonance. He also applies to bromine penta-fluoride an analysis of normal coordinates of a XF 5 molecule: relationship between force constants and vibration frequencies, application of Wilson method, resolution of the molecular equation, determination of normal vibration modes [fr

  3. Current status of fluoride volatility method development

    Energy Technology Data Exchange (ETDEWEB)

    Uhlir, J.; Marecek, M.; Skarohlid, J. [UJV - Nuclear Research Institute, Research Centre Rez, CZ-250 68 Husinec - Rez 130 (Czech Republic)


    The Fluoride Volatility Method is based on a separation process, which comes out from the specific property of uranium, neptunium and plutonium to form volatile hexafluorides whereas most of fission products (mainly lanthanides) and higher transplutonium elements (americium, curium) present in irradiated fuel form nonvolatile tri-fluorides. Fluoride Volatility Method itself is based on direct fluorination of the spent fuel, but before the fluorination step, the removal of cladding material and subsequent transformation of the fuel into a powdered form with a suitable grain size have to be done. The fluorination is made with fluorine gas in a flame fluorination reactor, where the volatile fluorides (mostly UF{sub 6}) are separated from the non-volatile ones (trivalent minor actinides and majority of fission products). The subsequent operations necessary for partitioning of volatile fluorides are the condensation and evaporation of volatile fluorides, the thermal decomposition of PuF{sub 6} and the finally distillation and sorption used for the purification of uranium product. The Fluoride Volatility Method is considered to be a promising advanced pyrochemical reprocessing technology, which can mainly be used for the reprocessing of oxide spent fuels coming from future GEN IV fast reactors.

  4. Fluoride ions vs removal technologies: A study


    Singh, Jagvir; Singh, Prashant; Singh, Anuradha


    Literature reported that drinking water is a precious and scarce resource and it has to be protected and kept free from any kind of contamination. Further, it has to be used carefully without wasting. Literature also reported that fluoride bearing rocks are abundant in India, as a result, fluoride leaches out and contaminates the adjacent water and soil resources. A high concentration of fluoride ions in ground water increases up to more than 30 mg/L. This high concentration of fluoride ions ...

  5. Water fluoridation in 40 Brazilian cities: 7 year analysis

    Directory of Open Access Journals (Sweden)

    Suzely Adas Saliba MOIMAZ


    Full Text Available Objectives Fluoride levels in the public water supplies of 40 Brazilian cities were analyzed and classified on the basis of risk/benefit balance. Material and Methods Samples were collected monthly over a seven-year period from three sites for each water supply source. The samples were analyzed in duplicate in the laboratory of the Center for Research in Public Health - UNESP using an ion analyzer coupled to a fluoride-specific electrode. Results A total of 19,533 samples were analyzed, of which 18,847 were artificially fluoridated and 686 were not artificially fluoridated. In samples from cities performing water fluoridation, 51.57% (n=9,720 had fluoride levels in the range of 0.55 to 0.84 mg F/L; 30.53% (n=5,754 were below 0.55 mg F/L and 17.90% (n=3,373 were above 0.84 mg F/L (maximum concentration=6.96 mg F/L. Most of the cities performing fluoridation that had a majority of samples with fluoride levels above the recommended parameter had deep wells and more than one source of water supply. There was some variability in the fluoride levels of samples from the same site and between collection sites in the same city. Conclusions The majority of samples from cities performing fluoridation had fluoride levels within the range that provides the best combination of risks and benefits, minimizing the risk of dental fluorosis while preventing dental caries. The conduction of studies about water distribution systems is suggested in cities with high natural fluoride concentrations in order to optimize the use of natural fluoride for fluoridation costs and avoid the risk of dental fluorosis.

  6. Effect of some metabolic inhibitors on citric acid production Aspergillus niger

    Energy Technology Data Exchange (ETDEWEB)

    Agrawal, P.K.; Bhatt, C.S.; Viswanathan, L.


    Stationary cultures of Aspergillus niger grown on a synthetic medium have been used to study the effect of some metabolic inhibitors on citric acid production. Addition of 0.05 to 1 mM sodium malonate or 0.01 to 0.1 mM potassium ferricyanide, iodoacetate, sodium azide, soldium arsenate or sodium fluoride stimulated citric acid production (3.6 to 45%), but not total titratable acids. Addition of higher concentrations (0.2 to 10 mM) of later inhibitors caused a marked inhibition of fungal growth and citric acid production. The implications of these preliminary findings are discussed. (Refs. 25).


    Directory of Open Access Journals (Sweden)

    Domen Kanduti


    Full Text Available Appropriate oral health care is fundamental for any individual’s health. Dental caries is still one of the major public health problems. The most effective way of caries prevention is the use of fluoride. Fluoride occurs naturally in our environment and is always present in our lives. However, the concentration differs from area to area. Exposure can occur through diet, respiration and fluoride supplements. During pregnancy, the placenta acts as a barrier. The fluoride, therefore, crosses the placenta in low concentrations. Drinking water in Slovenia is not fluoridated; the amount of naturally present fluoride is very low. Fluoride can be toxic in extremely high concentrations. The most important effect of fluoride on caries incidence is through its role in the process of remineralisation and demineralisation of tooth enamel. The European Academy of Paediatric Dentistry (EAPD recommends a preventive topical use of fluoride supplements because of their cariostatic effect. 

  8. Histopathological changes of renal tissue following sodium fluoride administration in two consecutive generations of mice. Correlation with the urinary elimination of fluoride. (United States)

    Dimcevici Poesina, Nicoleta; Bălălău, Cristian; Nimigean, Vanda Roxana; Nimigean, Victor; Ion, Ion; Baconi, Daniela; Bârcă, Maria; Băran Poesina, Violeta


    The present study was designed to investigate the toxic effects (evaluated as histopathological changes) of sodium fluoride on the kidney in two consecutive generations of NMRI mice. An attempt to correlate the toxicity with the urinary elimination of fluoride has been made, as urinary fluoride excretion has been widely used as an indicator of fluoride intake and exposure. Six mixed (males and females) animal groups have been constituted by dividing the populations of mice derived from pregnant females (named "mothers" 0.5 mg sodium fluoride) treated with 0.5 mg sodium fluoride by daily gavage and pregnant females (named "mothers" 0.25 mg sodium fluoride) treated with 0.25 mg sodium fluoride by daily gavage; three types of sodium fluoride treatments were administrated: homeopathic, allopathic-homeopathic and allopathic. When the animals reached the adulthood, by randomization, they were selected in pairs for giving birth to the second generation of mice. No treatments were administrated to the second generation of mice; thus, the urinary elimination of fluoride in the second generation is attributed to exposure at sodium fluoride before birth. The administration of sodium fluoride to the first generation (F1) is realized until the mice reached the adulthood. For the first generation, the urine was collected at three times, every three weeks: at the age of four weeks, seven weeks and 11 weeks; single sampling urine, at the age of four weeks, has been conducted for the second generation. The urine samples have been analyzed using the ion selective electrode method for fluoride. For the histopathological examination, the animals were killed by cervical dislocation; the kidneys were collected in a 10% formalin solution. The preparation of samples for optical microscopy was realized with Hematoxylin-Eosin staining. The results indicate that the elimination of fluoride was similar (at the second evaluation, at 7-week-old of the first generation) for the both generations

  9. Method for identifying particulate fluoride compounds

    Energy Technology Data Exchange (ETDEWEB)

    Tufts, B J


    A method is described for identifying particulates containing fluorides and other complex fluorine compounds such as fluorosilicate in samples collected on membrane filters. The filter is treated with lead chloride to precipitate lead chlorofluoride at each fluoride-containing spot. This microspot is identified by examination in a light microscope. Sulfate and phosphate, which also precipitate if present, can be distinguished and do not interfere. Calibrations are given for the fluorides and the more insoluble salts, relating the original particle size to the reaction site size. Thus, the mass of the particles can be calculated. Results of some field tests in an area of fluoride pollution are given, and compared with standard testing procedures.

  10. Community water fluoridation on the Internet and social media. (United States)

    Mertz, Aaron; Allukian, Myron


    In the United States, 95 percent of teens and 85 percent of adults use the Internet. Two social media outlets, Facebook and Twitter, reach more than 150 billion users. This study describes anti-fluoridation activity and dominance on the Internet and social media, both of which are community water fluoridation (CWF) information sources. Monthly website traffic to major fluoridation websites was determined from June 2011 to May 2012. Facebook, Twitter, and YouTube fluoridation activity was categorized as "proCWF" or "anti-CWF." Twitter's anti-CWF tweets were further subcategorized by the argument used against CWF. Anti-CWF website traffic was found to exceed proCWF activity five- to sixty-fold. Searching "fluoride" and "fluoridation" on Facebook resulted in 88 to 100 percent anti-CWF groups and pages; "fluoridation" on Twitter and YouTube resulted in 64 percent anti-CWF tweets and 99 percent anti-CWF videos, respectively. "Cancer, " "useless, " and "poisonous" were the three major arguments used against fluoridation. Anti-fluoridation information significantly dominates the Internet and social media. Thousands of people are being misinformed daily about the safety, health, and economic benefits of fluoridation.

  11. Biomonitoring Equivalents for interpretation of urinary fluoride. (United States)

    Aylward, L L; Hays, S M; Vezina, A; Deveau, M; St-Amand, A; Nong, A


    Exposure to fluoride is widespread due to its natural occurrence in the environment and addition to drinking water and dental products for the prevention of dental caries. The potential health risks of excess fluoride exposure include aesthetically unacceptable dental fluorosis (tooth mottling) and increased skeletal fragility. Numerous organizations have conducted risk assessments and set guidance values to represent maximum recommended exposure levels as well as recommended adequate intake levels based on potential public health benefits of fluoride exposure. Biomonitoring Equivalents (BEs) are estimates of the average biomarker concentrations corresponding to such exposure guidance values. The literature on daily urinary fluoride excretion rates as a function of daily fluoride exposure was reviewed and BE values corresponding to the available US and Canadian exposure guidance values were derived for fluoride in urine. The derived BE values range from 1.1 to 2.1mg/L (1.2-2.5μg/g creatinine). Concentrations of fluoride in single urinary spot samples from individuals, even under exposure conditions consistent with the exposure guidance values, may vary from the predicted average concentrations by several-fold due to within- and across-individual variation in urinary flow and creatinine excretion rates and due to the rapid elimination kinetics of fluoride. Thus, the BE values are most appropriately applied to screen population central tendency estimates for biomarker concentrations rather than interpretation of individual spot sample concentrations. Copyright © 2015. Published by Elsevier Inc.


    Directory of Open Access Journals (Sweden)

    G. Karthikeyan, S. Siva Ilango


    Full Text Available Batch adsorption experiments using activated carbon prepared from Morringa Indica bark were conducted to remove fluoride from aqueous solution. A minimum contact time of 25 min was required for optimum fluoride removal. The influence of adsorbent, dose, pH, co-ions (cations and anions on fluoride removal by the activated carbon has been experimentally verified. The adsorption of fluoride was studied at 30 C, 40 C and 50 C. The kinetics of adsorption and adsorption isotherms at different temperatures were studied. The fluoride adsorption obeyed both Langmuir and Freundlich isotherms and followed a pseudo first order kinetic model. The thermodynamic studies revealed that the fluoride adsorption by Morringa Indica is an endothermic process indicating an increase in sorption rate at higher temperatures. The negative values of G indicate the spontaneity of adsorption. SEM and XRD studies confirmed the surface morphological characteristics of the adsorbent and the deposition of fluoride on the surface of the material.

  13. Effect of titanium tetrafluoride, amine fluoride and fluoride varnish on enamel erosion in vitro

    NARCIS (Netherlands)

    Vieira, A; Ruben, JL; Huysmans, MCDNJM


    This study aimed at evaluating the effect of 1 and 4% titanium tetrafluoride (TiF4) gels, amine fluoride (AmF) 1 and 0.25% and a fluoride varnish (FP) on the prevention of dental erosion. Two experimental groups served as controls, one with no pretreatment and another one pre-treated with a

  14. Fluoride-induced disruption of reproductive hormones in men

    International Nuclear Information System (INIS)

    Ortiz-Perez, Deogracias; Rodriguez-Martinez, Manuel; Martinez, Flavio; Borja-Aburto, V.H.; Castelo, Julio; Grimaldo, J.I.; Cruz, Esperanza de la; Carrizales, Leticia; Diaz-Barriga, Fernando


    Fluoride-induced reproductive effects have been reported in experimental models and in humans. However, these effects were found in heavily exposed scenarios. Therefore, in this work our objective was to study reproductive parameters in a population exposed to fluoride at doses of 3-27 mg/day (high-fluoride-exposed group--HFEG). Urinary fluoride levels, semen parameters, and reproductive hormones in serum (LH, FSH, estradiol, prolactin, inhibin-B, free and total testosterone) were measured. Results were compared with a group of individuals exposed to fluoride at lower doses: 2-13 mg/day (low-fluoride-exposed group-LFEG). A significant increase in FSH (P<0.05) and a reduction of inhibin-B, free testosterone, and prolactin in serum (P<0.05) were noticed in the HFEG. When HFEG was compared to LFEG, a decreased sensitivity was found in the FSH response to inhibin-B (P<0.05). A significant negative partial correlation was observed between urinary fluoride and serum levels of inhibin-B (r=-0.333, P=0.028) in LFEG. Furthermore, a significant partial correlation was observed between a chronic exposure index for fluoride and the serum concentrations of inhibin-B (r=-0.163, P=0.037) in HFEG. No abnormalities were found in the semen parameters studied in the present work, neither in the HFEG, nor in the LFEG. The results obtained indicate that a fluoride exposure of 3-27 mg/day induces a subclinical reproductive effect that can be explained by a fluoride-induced toxic effect in both Sertoli cells and gonadotrophs

  15. 4-phenylbutyrate Mitigates Fluoride-Induced Cytotoxicity in ALC Cells

    Directory of Open Access Journals (Sweden)

    Maiko Suzuki


    Full Text Available Chronic fluoride over-exposure during pre-eruptive enamel development can cause dental fluorosis. Severe dental fluorosis is characterized by porous, soft enamel that is vulnerable to erosion and decay. The prevalence of dental fluorosis among the population in the USA, India and China is increasing. Other than avoiding excessive intake, treatments to prevent dental fluorosis remain unknown. We previously reported that high-dose fluoride induces endoplasmic reticulum (ER stress and oxidative stress in ameloblasts. Cell stress induces gene repression, mitochondrial damage and apoptosis. An aromatic fatty acid, 4-phenylbutyrate (4PBA is a chemical chaperone that interacts with misfolded proteins to prevent ER stress. We hypothesized that 4PBA ameliorates fluoride-induced ER stress in ameloblasts. To determine whether 4PBA protects ameloblasts from fluoride toxicity, we analyzed gene expression of Tgf-β1, Bcl2/Bax ratio and cytochrome-c release in vitro. In vivo, we measured fluorosis levels, enamel hardness and fluoride concentration. Fluoride treated Ameloblast-lineage cells (ALC had decreased Tgf-β1 expression and this was reversed by 4PBA treatment. The anti-apoptotic Blc2/Bax ratio was significantly increased in ALC cells treated with fluoride/4PBA compared to fluoride treatment alone. Fluoride treatment induced cytochrome-c release from mitochondria into the cytosol and this was inhibited by 4PBA treatment. These results suggest that 4PBA mitigates fluoride-induced gene suppression, apoptosis and mitochondrial damage in vitro. In vivo, C57BL/6J mice were provided fluoridated water for six weeks with either fluoride free control-chow or 4PBA-containing chow (7 g/kg 4PBA. With few exceptions, enamel microhardness, fluorosis levels, and fluoride concentrations of bone and urine did not differ significantly between fluoride treated animals fed with control-chow or 4PBA-chow. Although 4PBA mitigated high-dose fluoride toxicity in vitro, a diet

  16. 4-phenylbutyrate Mitigates Fluoride-Induced Cytotoxicity in ALC Cells. (United States)

    Suzuki, Maiko; Everett, Eric T; Whitford, Gary M; Bartlett, John D


    Chronic fluoride over-exposure during pre-eruptive enamel development can cause dental fluorosis. Severe dental fluorosis is characterized by porous, soft enamel that is vulnerable to erosion and decay. The prevalence of dental fluorosis among the population in the USA, India and China is increasing. Other than avoiding excessive intake, treatments to prevent dental fluorosis remain unknown. We previously reported that high-dose fluoride induces endoplasmic reticulum (ER) stress and oxidative stress in ameloblasts. Cell stress induces gene repression, mitochondrial damage and apoptosis. An aromatic fatty acid, 4-phenylbutyrate (4PBA) is a chemical chaperone that interacts with misfolded proteins to prevent ER stress. We hypothesized that 4PBA ameliorates fluoride-induced ER stress in ameloblasts. To determine whether 4PBA protects ameloblasts from fluoride toxicity, we analyzed gene expression of Tgf -β 1, Bcl2 / Bax ratio and cytochrome-c release in vitro . In vivo , we measured fluorosis levels, enamel hardness and fluoride concentration. Fluoride treated Ameloblast-lineage cells (ALC) had decreased Tgf -β 1 expression and this was reversed by 4PBA treatment. The anti-apoptotic Blc2 / Bax ratio was significantly increased in ALC cells treated with fluoride/4PBA compared to fluoride treatment alone. Fluoride treatment induced cytochrome-c release from mitochondria into the cytosol and this was inhibited by 4PBA treatment. These results suggest that 4PBA mitigates fluoride-induced gene suppression, apoptosis and mitochondrial damage in vitro . In vivo , C57BL/6J mice were provided fluoridated water for six weeks with either fluoride free control-chow or 4PBA-containing chow (7 g/kg 4PBA). With few exceptions, enamel microhardness, fluorosis levels, and fluoride concentrations of bone and urine did not differ significantly between fluoride treated animals fed with control-chow or 4PBA-chow. Although 4PBA mitigated high-dose fluoride toxicity in vitro , a diet rich

  17. No Change in Bicarbonate Transport but Tight-Junction Formation Is Delayed by Fluoride in a Novel Ameloblast Model

    Directory of Open Access Journals (Sweden)

    Róbert Rácz


    Full Text Available We have recently developed a novel in vitro model using HAT-7 rat ameloblast cells to functionally study epithelial ion transport during amelogenesis. Our present aims were to identify key transporters of bicarbonate in HAT-7 cells and also to examine the effects of fluoride exposure on vectorial bicarbonate transport, cell viability, and the development of transepithelial resistance. To obtain monolayers, the HAT-7 cells were cultured on Transwell permeable filters. We monitored transepithelial resistance (TER as an indicator of tight junction formation and polarization. We evaluated intracellular pH changes by microfluorometry using the fluorescent indicator BCECF. Activities of ion transporters were tested by withdrawal of various ions from the bathing medium, by using transporter specific inhibitors, and by activation of transporters with forskolin and ATP. Cell survival was estimated by alamarBlue assay. Changes in gene expression were monitored by qPCR. We identified the activity of several ion transporters, NBCe1, NHE1, NKCC1, and AE2, which are involved in intracellular pH regulation and vectorial bicarbonate and chloride transport. Bicarbonate secretion by HAT-7 cells was not affected by acute fluoride exposure over a wide range of concentrations. However, tight-junction formation was inhibited by 1 mM fluoride, a concentration which did not substantially reduce cell viability, suggesting an effect of fluoride on paracellular permeability and tight-junction formation. Cell viability was only reduced by prolonged exposure to fluoride concentrations greater than 1 mM. In conclusion, cultured HAT-7 cells are functionally polarized and are able to transport bicarbonate ions from the basolateral to the apical fluid spaces. Exposure to 1 mM fluoride has little effect on bicarbonate secretion or cell viability but delays tight-junction formation, suggesting a novel mechanism that may contribute to dental fluorosis.

  18. Chronic fluoride toxicity: dental fluorosis. (United States)

    Denbesten, Pamela; Li, Wu


    Dental fluorosis occurs as a result of excess fluoride ingestion during tooth formation. Enamel fluorosis and primary dentin fluorosis can only occur when teeth are forming, and therefore fluoride exposure (as it relates to dental fluorosis) occurs during childhood. In the permanent dentition, this would begin with the lower incisors, which complete mineralization at approximately 2-3 years of age, and end after mineralization of the third molars. The white opaque appearance of fluorosed enamel is caused by a hypomineralized enamel subsurface. With more severe dental fluorosis, pitting and a loss of the enamel surface occurs, leading to secondary staining (appearing as a brown color). Many of the changes caused by fluoride are related to cell/matrix interactions as the teeth are forming. At the early maturation stage, the relative quantity of amelogenin protein is increased in fluorosed enamel in a dose-related manner. This appears to result from a delay in the removal of amelogenins as the enamel matures. In vitro, when fluoride is incorporated into the mineral, more protein binds to the forming mineral, and protein removal by proteinases is delayed. This suggests that altered protein/mineral interactions are in part responsible for retention of amelogenins and the resultant hypomineralization that occurs in fluorosed enamel. Fluoride also appears to enhance mineral precipitation in forming teeth, resulting in hypermineralized bands of enamel, which are then followed by hypomineralized bands. Enhanced mineral precipitation with local increases in matrix acidity may affect maturation stage ameloblast modulation, potentially explaining the dose-related decrease in cycles of ameloblast modulation from ruffle-ended to smooth-ended cells that occur with fluoride exposure in rodents. Specific cellular effects of fluoride have been implicated, but more research is needed to determine which of these changes are relevant to the formation of fluorosed teeth. As further

  19. Health effects of fluoride pollution caused by coal burning

    Energy Technology Data Exchange (ETDEWEB)

    Ando, M.; Tadano, M.; Yamamoto, S.; Tamura, K.; Chen, X. [Regional Environment Division, National Institute for Environmental Studies, Tsukuba, 305-0083 Ibaraki (Japan); Asanuma, S. [Japan Institute of Rural Medicine, Usuda, Nagano (Japan); Watanabe, T. [Saku Central Hospital, Usuda, Nagano (Japan); Kondo, T. [Matsumoto Dental College, Shiojiri, Nagano (Japan); Sakurai, S. [Otsuma Women' s University, Tama, Tokyo (Japan); Ji, R.; Liang, C.; Cao, S. [Institute of Environmental Health and Engineering, Beijing (China); Hong, Z. [Shanxi Maternity and Children' s Hospital, Taiyuan (China)


    Recently a huge amount of fluoride in coal has been released into indoor environments by the combustion of coal and fluoride pollution seems to be increasing in some rural areas in China. Combustion of coal and coal bricks is the primary source of gaseous and aerosol fluoride and these forms of fluoride can easily enter exposed food products and the human respiratory tract. Major human fluoride exposure was caused by consumption of fluoride contaminated food, such as corn, chilies and potatoes. For each diagnostic syndrome of dental fluorosis, a log-normal distribution was observed on the logarithm of urinary fluoride concentration in students in China. Urinary fluoride content was found to be a primary health indicator of the prevalence of dental fluorosis in the community. In the fluorosis areas, osteosclerosis in skeletal fluorosis patients was observed with a high prevalence. A biochemical marker of bone resorption, urinary deoxypyridinoline content was much higher in residents in China than in residents in Japan. It was suggested that bone resorption was stimulated to a greater extent in residents in China and fluoride may stimulate both bone resorption and bone formation. Renal function especially glomerular filtration rate was very sensitive to fluoride exposure. Inorganic phosphate concentrations in urine were significantly lower in the residents in fluorosis areas in China than in non-fluorosis area in China and Japan. Since airborne fluoride from the combustion of coal pollutes extensively both the living environment and food, it is necessary to reduce fluoride pollution caused by coal burning.

  20. Thermodynamic data-base for metal fluorides

    Energy Technology Data Exchange (ETDEWEB)

    Yoo, Jae Hyung; Lee, Byung Gik; Kang, Young Ho and others


    This study is aimed at collecting useful data of thermodynamic properties of various metal fluorides. Many thermodynamic data for metal fluorides are needed for the effective development, but no report of data-base was published. Accordingly, the objective of this report is to rearrange systematically the existing thermodynamic data based on metal fluorides and is to use it as basic data for the development of pyrochemical process. The physicochemical properties of various metal fluorides and metals were collected from literature and such existing data base as HSC code, TAPP code, FACT code, JANAF table, NEA data-base, CRC handbook. As major contents of the thermodynamic data-base, the physicochemical properties such as formation energy, viscosity, density, vapor pressure, etc. were collected. Especially, some phase diagrams of eutectic molten fluorides are plotted and thermodynamic data of liquid metals are also compiled. In the future, the technical report is to be used as basic data for the development of the pyrochemical process which is being carried out as a long-term nuclear R and D project.

  1. Thermodynamic data-base for metal fluorides

    International Nuclear Information System (INIS)

    Yoo, Jae Hyung; Lee, Byung Gik; Kang, Young Ho and others


    This study is aimed at collecting useful data of thermodynamic properties of various metal fluorides. Many thermodynamic data for metal fluorides are needed for the effective development, but no report of data-base was published. Accordingly, the objective of this report is to rearrange systematically the existing thermodynamic data based on metal fluorides and is to use it as basic data for the development of pyrochemical process. The physicochemical properties of various metal fluorides and metals were collected from literature and such existing data base as HSC code, TAPP code, FACT code, JANAF table, NEA data-base, CRC handbook. As major contents of the thermodynamic data-base, the physicochemical properties such as formation energy, viscosity, density, vapor pressure, etc. were collected. Especially, some phase diagrams of eutectic molten fluorides are plotted and thermodynamic data of liquid metals are also compiled. In the future, the technical report is to be used as basic data for the development of the pyrochemical process which is being carried out as a long-term nuclear R and D project

  2. Metal fluoride complexes of Na,K-ATPase: characterization of fluoride-stabilized phosphoenzyme analogues and their interaction with cardiotonic steroids. (United States)

    Cornelius, Flemming; Mahmmoud, Yasser A; Toyoshima, Chikashi


    The Na,K-ATPase belongs to the P-type ATPase family of primary active cation pumps. Metal fluorides like magnesium-, beryllium-, and aluminum fluoride act as phosphate analogues and inhibit P-type ATPases by interacting with the phosphorylation site, stabilizing conformations that are analogous to specific phosphoenzyme intermediates. Cardiotonic steroids like ouabain used in the treatment of congestive heart failure and arrhythmias specifically inhibit the Na,K-ATPase, and the detailed structure of the highly conserved binding site has recently been described by the crystal structure of the shark Na,K-ATPase in a state analogous to E2·2K(+)·P(i) with ouabain bound with apparently low affinity (1). In the present work inhibition, and subsequent reactivation by high Na(+), after treatment of shark Na,K-ATPase with various metal fluorides are characterized. Half-maximal inhibition of Na,K-ATPase activity by metal fluorides is in the micromolar range. The binding of cardiotonic steroids to the metal fluoride-stabilized enzyme forms was investigated using the fluorescent ouabain derivative 9-anthroyl ouabain and compared with binding to phosphorylated enzyme. The fastest binding was to the Be-fluoride stabilized enzyme suggesting a preformed ouabain binding cavity, in accord with results for Ca-ATPase where Be-fluoride stabilizes the E2-P ground state with an open luminal ion access pathway, which in Na,K-ATPase could be a passage for ouabain. The Be-fluoride stabilized enzyme conformation closely resembles the E2-P ground state according to proteinase K cleavage. Ouabain, but not its aglycone ouabagenin, prevented reactivation of this metal fluoride form by high Na(+) demonstrating the pivotal role of the sugar moiety in closing the extracellular cation pathway.

  3. Molten fluoride fuel salt chemistry

    International Nuclear Information System (INIS)

    Toth, L.M.; Del Cul, G.D.; Dai, S.; Metcalf, D.H.


    The chemistry of molten fluorides is traced from their development as fuels in the Molten Salt Reactor Experiment with important factors in their selection being discussed. Key chemical characteristics such as solubility, redox behavior, and chemical activity are explained as they relate to the behavior of molten fluoride fuel systems. Development requirements for fitting the current state of the chemistry to modern nuclear fuel system are described. It is concluded that while much is known about molten fluoride behavior which can be used effectively to reduce the amount of development required for future systems, some significant molten salt chemical questions must still be addressed. copyright American Institute of Physics 1995

  4. Milk fluoridation for the prevention of dental caries

    Directory of Open Access Journals (Sweden)

    Jolán Bánóczy


    Full Text Available The aim of this review is to give an overview of 55 years experience of milk fluoridation and draw conclusions about the applicability of the method. Fluoridated milk was first investigated in the early 1950s, almost simultaneously in Switzerland, the USA and Japan. Stimulated by the favourable results obtained from these early studies, the establishment of The Borrow Dental Milk Foundation (subsequently The Borrow Foundation in England gave an excellent opportunity for further research, both clinical and non-clinical, and a productive collaboration with the World Health Organization which began in the early 1980s. Numerous peer-reviewed publications in international journals showed clearly the bioavailability of fluoride in various types of milk. Clinical trials were initiated in the 1980s – some of these can be classed as randomised controlled trials, while most of the clinical studies were community preventive programmes. Conclusion. These evaluations showed clearly that the optimal daily intake of fluoride in milk is effective in preventing dental caries. The amount of fluoride added to milk depends on background fluoride exposure and age of the children: commonly in the range 0.5 to 1.0 mg per day. An advantage of the method is that a precise amount of fluoride can be delivered under controlled conditions. The cost of milk fluoridation programmes is low, about € 2 to 3 per child per year. Fluoridation of milk can be recommended as a caries preventive measure where the fluoride concentration in drinking water is suboptimal, caries experience in children is significant, and there is an existing school milk programme.

  5. Milk fluoridation for the prevention of dental caries. (United States)

    Bánóczy, Jolán; Rugg-Gunn, Andrew; Woodward, Margaret


    The aim of this review is to give an overview of 55 years experience of milk fluoridation and draw conclusions about the applicability of the method. Fluoridated milk was first investigated in the early 1950s, almost simultaneously in Switzerland, the USA and Japan. Stimulated by the favourable results obtained from these early studies, the establishment of The Borrow Dental Milk Foundation (subsequently The Borrow Foundation) in England gave an excellent opportunity for further research, both clinical and non-clinical, and a productive collaboration with the World Health Organization which began in the early 1980s. Numerous peer-reviewed publications in international journals showed clearly the bioavailability of fluoride in various types of milk. Clinical trials were initiated in the 1980s - some of these can be classed as randomised controlled trials, while most of the clinical studies were community preventive programmes. These evaluations showed clearly that the optimal daily intake of fluoride in milk is effective in preventing dental caries. The amount of fluoride added to milk depends on background fluoride exposure and age of the children: commonly in the range 0.5 to 1.0 mg per day. An advantage of the method is that a precise amount of fluoride can be delivered under controlled conditions. The cost of milk fluoridation programmes is low, about € 2 to 3 per child per year. Fluoridation of milk can be recommended as a caries preventive measure where the fluoride concentration in drinking water is suboptimal, caries experience in children is significant, and there is an existing school milk programme. Copyright © 2013 by Academy of Sciences and Arts of Bosnia and Herzegovina.

  6. Poisoning by coal smoke containing arsenic and fluoride

    Energy Technology Data Exchange (ETDEWEB)

    An, D.; He, Y.G.; Hu, Q.X. [Guizhou Sanitary and Epidemiological Station, Guiyang (China)


    An investigation was made into a disease involving skin pigmentation, keratosis of the hands and feet, dental discoloration, and generalized bone and joint pain, stiffness and rigidity, in the village of Bazhi, Zhijin County, Ghizhou Province, People`s Republic of China. Measurements were made of the arsenic and fluoride levels of coal, water, air, food, urine and hair in Bazhi and a control village, Xinzhai, in which coal with a low arsenic content was used. Up to 188 people, including children, in Bazhi and 752 in Xinzhai, were examined for the presence of chronic arsenium, skeletal fluorosis, dental fluorosis and electrocardiogram abnormalities. The coal in Bazhi was found to contain high levels of arsenic and fluoride resulting, after burning in homes without an adequate chimney systems, in pollution of air and food with arsenic and fluoride. The coal in Xinzhai did not cause arsenic pollution but did produce a higher level of fluoride pollution. It was concluded that the endemic disease in Bazhi was caused by pollution by coal smoke containing arsenic and fluoride. It is suggested that arsenic may act synergistically with fluoride so that a lower level of fluoride may produce fluoride toxicity with dental and skeletal fluorosis.

  7. New Insight on the Response of Bacteria to Fluoride (United States)

    Breaker, R.R.


    Fluoride has been used for decades to prevent caries and it is well established that this anion can inhibit the growth of bacteria. However, the precise effects that fluoride has on bacteria and the mechanisms that bacteria use to overcome fluoride toxicity have largely remained unexplored. Recently, my laboratory reported the discovery of biological systems that bacteria use to sense fluoride and reduce fluoride toxicity. These sensors and their associated genes are very widespread in biology, which has implications for a number of issues that are central to the use of fluoride for dental care. Below I provide a summary of our findings, comment on some of the key prospects for expanding our understanding of fluoride's effects on biology, and propose some future uses of this knowledge. PMID:22327376

  8. New insight on the response of bacteria to fluoride. (United States)

    Breaker, R R


    Fluoride has been used for decades to prevent caries and it is well established that this anion can inhibit the growth of bacteria. However, the precise effects that fluoride has on bacteria and the mechanisms that bacteria use to overcome fluoride toxicity have largely remained unexplored. Recently, my laboratory reported the discovery of biological systems that bacteria use to sense fluoride and reduce fluoride toxicity. These sensors and their associated genes are very widespread in biology, which has implications for a number of issues that are central to the use of fluoride for dental care. Below I provide a summary of our findings, comment on some of the key prospects for expanding our understanding of fluoride's effects on biology, and propose some future uses of this knowledge. Copyright © 2012 S. Karger AG, Basel.

  9. Bone fluoride determination for clinical investigation of osteoporosis

    International Nuclear Information System (INIS)

    Krishnan, S.S.; McNeill, K.G.; Hitchman, A.J.W.; Mernagh, J.R.; Lin, S.C.; Harrison, J.E.


    Sodium fluoride is the therapeutic agent known to stimulate bone growth with net increase in bone mineral mass in patients afflicted with osteoporosis, a common crippling bone disease. In order to study the effect of sodium fluoride treatment, a method of analysis for fluoride in bone has been developed using Neutron Activation Analysis (NAA). The technique proved to be simple, fast, reliable and non-destructive. Thus the sample, often bone biopsy specimen, is available, after fluoride analysis, for further histological studies. NAA was used to analyze both fluoride and calcium in the bone and the results expressed as F/Ca ratio was meaningful since it normalizes the fluoride to bone mineral mass which is the important factor in this study. Four years of fluoride treatment of osteoporotics showed significant increase of bone mass (up to 30%) in several patients. These increases were associated with histological bone picture of fluorosis. In the case of patients with renal osteodystrophy, there was evidence that fluorosis contributes to the bone disease. 3 references, 2 figures, 2 tables

  10. Solubility and fluoride release in ionomers and compomers. (United States)

    Bertacchini, S M; Abate, P F; Blank, A; Baglieto, M F; Macchi, R L


    The degree of solubility and the fluoride release of glass-ionomer cements and "compomers" were determined as a function of time. Three conventional glass-ionomer cements, three hybrid ionomers, and two compomers were included in the study. Disk-shaped specimens were prepared and immersed in a lactic acid solution. Solubility was evaluated from determinations of loss of mass as a function of time. To evaluate fluoride release, similar specimens were immersed in 50 mL of deionized water to which 50 mL of buffer solution was added. A fluoride ion detector was used to read the concentration of fluoride ion in the overall solution at different times after immersion. Material and time factors had a significant influence on results. The compomers showed less corrosion and fluoride release than the ionomers. Some correlation was found between solubility and fluoride leakage values. Components of both the ionomers and compomers that were studied can dissolve in water. The materials leak fluoride ions in amounts that differ according to the characteristics of the individual products.

  11. Sustainable approach for recycling waste lamb and chicken bones for fluoride removal from water followed by reusing fluoride-bearing waste in concrete. (United States)

    Ismail, Zainab Z; AbdelKareem, Hala N


    Sustainable management of waste materials is an attractive approach for modern societies. In this study, recycling of raw waste lamb and chicken bones for defluoridation of water has been estimated. The effects of several experimental parameters including contact time, pH, bone dose, fluoride initial concentration, bone grains size, agitation rate, and the effect of co-existing anions in actual samples of wastewater were studied for fluoride removal from aqueous solutions. Results indicated excellent fluoride removal efficiency up to 99.4% and 99.8% using lamb and chicken bones, respectively at fluoride initial concentration of 10 mg F/L and 120 min contact time. Maximum fluoride uptake was obtained at neutral pH range 6-7. Fluoride removal kinetic was well described by the pseudo-second order kinetic model. Both, Langmuir and Freundlich isotherm models could fit the experimental data well with correlation coefficient values >0.99 suggesting favorable conditions of the process. Furthermore, for complete sustainable management of waste bones, the resulted fluoride-bearing sludge was reused in concrete mixes to partially replace sand. Tests of the mechanical properties of fluoride sludge-modified concrete mixes indicated a potential environmentally friendly approach to dispose fluoride sludge in concrete and simultaneously enhance concrete properties. Copyright © 2015 Elsevier Ltd. All rights reserved.

  12. A novel serine protease with human fibrino(geno)lytic activities from Artocarpus heterophyllus latex. (United States)

    Siritapetawee, Jaruwan; Thumanu, Kanjana; Sojikul, Punchapat; Thammasirirak, Sompong


    A protease was isolated and purified from Artocarpus heterophyllus (jackfruit) latex and designated as a 48-kDa antimicrobial protease (AMP48) in a previous publication. In this work, the enzyme was characterized for more biochemical and medicinal properties. Enzyme activity of AMP48 was strongly inhibited by phenylmethanesulfonyl fluoride and soybean trypsin inhibitor, indicating that the enzyme was a plant serine protease. The N-terminal amino acid sequences (A-Q-E-G-G-K-D-D-D-G-G) of AMP48 had no sequence similarity matches with any sequence databases of BLAST search and other plant serine protease. The secondary structure of this enzyme was composed of high α-helix (51%) and low β-sheet (9%). AMP48 had fibrinogenolytic activity with maximal activity between 55 and 60°C at pH 8. The enzyme efficiently hydrolyzed α followed by partially hydrolyzed β and γ subunits of human fibrinogen. In addition, the fibrinolytic activity was observed through the degradation products by SDS-PAGE and emphasized its activity by monitoring the alteration of secondary structure of fibrin clot after enzyme digestion using ATR-FTIR spectroscopy. This study presented the potential role to use AMP48 as antithrombotic for treatment thromboembolic disorders such as strokes, pulmonary emboli and deep vein thrombosis. Copyright © 2012 Elsevier B.V. All rights reserved.

  13. Subcellular distribution of histone-degrading enzyme activities from rat liver

    International Nuclear Information System (INIS)

    Heinrich, P.C.; Raydt, G.; Puschendorf, B.; Jusic, M.


    Chromatin prepared from liver tissue contains a histone-degrading enzyme activity with a pH optimum of 7.5-8.0, whereas chromatin isolated from purified nuclei is devoid of it. The histone-degrading enzyme activity was assayed with radioactively labelled total histones from Ehrlich ascites tumor cells. Among the different subcellular fractions assayed, only lysosomes and mitochondria exhibited histone-degrading enzymes. A pH optimum around 4.0-5.0 was found for the lysosomal fraction, whereas 7.5-8.0 has been found for mitochondria. Binding studies of frozen and thawed lysosomes or mitochondria to proteinase-free chromatin demonstrate that the proteinase associated with chromatin isolated from frozen tissue originates from damaged mitochondria. The protein degradation patterns obtained after acrylamide gel electrophoresis are similar for the chromatin-associated and the mitochondrial proteinase and different from that obtained after incubation with lysosomes. The chromatin-associated proteinase as well as the mitochondrial proteinase are strongly inhibited by 1.0 mM phenylmethanesulfonyl fluoride. Weak inhibition is found for lysosomal proteinases at pH 5. Kallikrein-trypsin inhibitor, however, inhibits lysosomal proteinase activity and has no effect on either chromatin-associated or mitochondrial proteinases. The higher template activity of chromatin isolated from a total homogenate compared to chromatin prepared from nuclei may be due to the presence of this histone-degrading enzyme activity. (orig.) [de

  14. New Insight on the Response of Bacteria to Fluoride


    Breaker, R.R.


    Fluoride has been used for decades to prevent caries and it is well established that this anion can inhibit the growth of bacteria. However, the precise effects that fluoride has on bacteria and the mechanisms that bacteria use to overcome fluoride toxicity have largely remained unexplored. Recently, my laboratory reported the discovery of biological systems that bacteria use to sense fluoride and reduce fluoride toxicity. These sensors and their associated genes are very widespread in biolog...

  15. Widespread genetic switches and toxicity resistance proteins for fluoride. (United States)

    Baker, Jenny L; Sudarsan, Narasimhan; Weinberg, Zasha; Roth, Adam; Stockbridge, Randy B; Breaker, Ronald R


    Most riboswitches are metabolite-binding RNA structures located in bacterial messenger RNAs where they control gene expression. We have discovered a riboswitch class in many bacterial and archaeal species whose members are selectively triggered by fluoride but reject other small anions, including chloride. These fluoride riboswitches activate expression of genes that encode putative fluoride transporters, enzymes that are known to be inhibited by fluoride, and additional proteins of unknown function. Our findings indicate that most organisms are naturally exposed to toxic levels of fluoride and that many species use fluoride-sensing RNAs to control the expression of proteins that alleviate the deleterious effects of this anion.

  16. Effects of different amine fluoride concentrations on enamel remineralization. (United States)

    Naumova, E A; Niemann, N; Aretz, L; Arnold, W H


    The aim of this study was to investigate the effects of decreasing fluoride concentrations on repeated demineralizing challenges on human enamel. In 24 teeth, 3mm×3mm windows were prepared on the buccal and lingual sides and treated in a cycling demineralization-remineralization model. Remineralization was achieved with 100, 10 and 0.1 ppm fluoride from anime fluoride. Coronal sections were cut through the artificial lesions, and three sections per tooth were investigated using polarized light microscopy and scanning electron microscopy with quantitative element analysis. The morphology of the lesions was studied, and the extensions of the superficial layer and the body of the lesion were measured. Using element analysis, the Ca, P and F content were determined. The body of the lesion appeared remineralized after application of 100 ppm fluoride, while remineralization of the lesion was less successful after application of 10 and 0.1 ppm fluoride. The thickness of the superficial layer increased with decreasing fluoride concentrations, and also the extension of the body of the lesion increased. Ca and P content increased with increasing fluoride concentrations. The effectiveness of fluoride in enamel remineralization increased with increasing fluoride concentration. A consistently higher level of fluoride in saliva should be a goal in caries prevention. Copyright © 2012 Elsevier Ltd. All rights reserved.

  17. Risk perception, psychological heuristics and the water fluoridation controversy. (United States)

    Perrella, Andrea M L; Kiss, Simon J


    Increasingly, support for water fluoridation has come under attack. We seek an explanation, focusing on the case of Waterloo, Ontario, where a 2010 referendum overturned its water fluoridation program. In particular, we test whether individuals perceive the risks of water fluoridation based not on 'hard' scientific evidence but on heuristics and cultural norms. A sample of 376 residents in Waterloo were surveyed in June 2012 using random digit dialing. We use factor analysis, OLS regression, as well as t-tests to evaluate a survey experiment to test the credibility hypothesis. Perceptions of fluoride as a risk are lower among those who perceive fluoride's benefits (B = .473, p < 0.001) and those whose cultural view is 'egalitarian' (B = .156, p < 0.05). The experiment shows a lower level of perception of fluoride's benefits among respondents who are told that water fluoridation is opposed by a national advocacy group (Group A) compared to those who are told that the government and the World Health Organization support fluoridation (Group B) (t = 1.6547, p < 0.05), as well as compared to the control group (t = 1.8913, p < 0.05). There is no difference between Group B and the control, possibly because people's already general support for fluoridation is less prone to change when told that other public organizations also support fluoridation. Public health officials should take into account cultural norms and perceptions when individuals in a community appear to rise up against water fluoridation, with implications for other public health controversies.

  18. Antibacterial Effect of Silver Diamine Fluoride on Cariogenic Organisms. (United States)

    Lou, Yali; Darvell, Brain W; Botelho, Michael G


    To screen the possible antimicrobial activity of a range of clinically used, silver-based compounds on cariogenic organisms: silver diamine fluoride (SDF), silver fluoride, and silver nitrate. Preliminary screening disk-diffusion susceptibility tests were conducted on Mueller-Hinton agar plates inoculated with Streptococcus mutans, Lactobacillus acidophilus, and Actinomyces naeslundii, organisms known to be cariogenic. In order to identify which component of the silver compounds was responsible for any antibacterial (AB) effect, and to provide controls, the following were also investigated at high and low concentrations: sodium fluoride, ammonium fluoride, ammonium chloride, sodium fluoride, sodium chloride, and sodium nitrate, as well as deionized water as control. A volume of 10 pL of a test solution was dispensed onto a paper disk resting on the inoculated agar surface, and the plate incubated anaerobically at 37°C for 48 hours. The zones of inhibition were then measured. Silver diamine fluoride, silver fluoride, silver nitrate, and ammonium fluoride had significant AB effect (p effect at low concentration; the remaining other compounds had no effect. Silver ions appear to be the principal AB agent at both high and low concentration; fluoride ions only have an AB effect at high concentration, while ammonium, nitrate, chloride and sodium ions have none. The anticaries effect of topical silver solutions appears restricted to that of the silver ions. Silver compounds, such as SDF, silver fluoride, and silver nitrate have AB effect against cariogenic organisms and these may have clinical impact in arresting or preventing dental decay. Sodium fluoride did not have AB effect under the conditions tested.

  19. High Fluoride Dentifrices for Elderly and Vulnerable Adults

    DEFF Research Database (Denmark)

    Ekstrand, Kim Rud


    The primary aim of this work is to present the available evidence that toothpastes containing >1,500 ppm fluoride (2,500-2,800 and 5,000 ppm F) provide an additional caries preventive effect on root caries lesions in elderly patients compared to traditional dentifrices (1,000-1,450 ppm F......). The secondary aim of this paper is to discuss why high fluoride dentifrices in general should perform better than traditional F-containing toothpaste. When examining the few studies that have considered the preventive benefits of high fluoride products on root caries the relative risk appears to be around 0.......5, and the risk can thus be halved by exchanging traditional F-containing toothpaste for toothpaste containing 5,000 ppm F. There is reasonable evidence that high fluoride dentifrices significantly increase the fluoride concentration in saliva during the day and the fluoride concentration in plaque compared...

  20. Approaches to the accurate characterization of high purity metal fluorides and fluoride glasses (United States)

    Beary, E. S.; Paulsen, P. J.; Rains, T. C.; Ewing, K. J.; Jaganathan, J.; Aggarwal, I.


    The analytical challenges posed by the measurement of trace contaminants in high purity metal fluorides require that innovative chemical preparation procedures be used to enhance existing instrumental techniques. The instrumental techniques used to analyze these difficult matrices must be sensitive enough to detect extremely low levels of trace impurities, and the background interferences derived from the matrix (metal fluoride or glass) must be minimized. A survey of analytical techniques that have the necessary characteristics to analyze these materials will be given. In addition, means of controlling the chemical blank will be presented. Mass and atomic spectrometric techniques will be discussed, specifically graphite furnace atomic absorption spectrometry (GFAAS) and inductively coupled plasma-mass spectrometry (ICP-MS). Analytical procedures using GFAAS and ICP-MS have been developed to determine sub ppb (part per billion) levels of contaminants in high purity fluoride materials.

  1. Aluminium fluoride and magnesium, activators of heterotrimeric GTP-binding proteins, affect high-affinity binding of the fungal toxin fusicoccin to the fusicoccin-binding protein in oat root plasma membranes.

    NARCIS (Netherlands)

    de Boer, A.H.; Van der Molen, G.W.; Prins, H.B.A.; Korthout, H.A.A.J.; van der Hoeven, P.C.J.


    The fusicoccin-binding protein was solubilised from purified oat root plasma membranes. The solubilised protein retained full binding activity, provided that protease inhibitors were included. Sodium fluoride reduced the high-affinity [H-3]fusicoccin binding to almost zero in a

  2. Adsorption and exhaustion device for gaseoue uranium fluorides

    International Nuclear Information System (INIS)

    Kida, Yasuo; Nakamura, Yuichi.


    Purpose: To prevent gaseous uranium fluorides from passing through the adsorption layer upon exhausting the gaseous uranium, fluorides from a uranium fluoride processing facility through adsorption traps, by controlling the flow rate of the gaseous uranium fluorides passing through the layer constant. Constitution: An adsorption trap is connected by way of pipeways to a uranium fluoride processing facility, and a flow rate detector for detecting the flow rate of gaseous uranium fluorides and a pressure gauge for detecting the pressure at the inlet of the adsorption trap are disposed to the pipeways. The setting value for the pressure control is calculated from the detection value of the flow rate detector by the pressure control gage. Then, an operation amount for the pressure control valve is calculated based on the deviatoin between the setting value for the pressure control and the inlet pressure at the adsorption trap. This enables to control the flow rate of the gaseous uranium fluorides passing through the adsorption layer always constant thereby enabling to prevent excess increase in the flow rate which results in damages in the adsorption layer. (Moriyama, K.)

  3. The effective use of fluorides in public health

    DEFF Research Database (Denmark)

    Jones, Sheila; Burt, Brian A; Petersen, Poul Erik


    , systematic reviews summarizing these extensive databases have indicated that water fluoridation and fluoride toothpastes both substantially reduce the prevalence and incidence of dental caries. We present four case studies that illustrate the use of fluoride in modern public health practice, focusing on......Dental caries remain a public health problem for many developing countries and for underprivileged populations in developed countries. This paper outlines the historical development of public health approaches to the use of fluoride and comments on their effectiveness. Early research...

  4. Absorption, distribution and excretion of inhaled hydrogen fluoride in the rat

    Energy Technology Data Exchange (ETDEWEB)

    Morris, J.B.


    Rats were subjected to whole body HF exposure for 6 hrs or to nose-only HF exposure for 1 hr. Total and/or ionic fluoride concentrations in selected tissues were determined at various times following exposure. In rats sacrificed 6 hrs after whole body exposure, dose-dependent increases in lung, plasma, and kidney total and ionic fluoride concentration occurred. Rats excreted more fluoride in the urine after whole body exposure than could be explained by the amount of HF inhaled. Considerable evidence suggests that airborne HF deposits on fur and is then ingested due to preening activity. Urinary fluoride excretion was increased by nose-only exposure. The urinary fluoride excretion accounted for approximately twice the fluoride estimated to be inhaled during exposure. Tissue fluoride concentrations were elevated immediately after nose-only exposure. Fluoride concentrations in lung and kidney returned to control levels within 12 hrs. Plasma fluoride concentration was slightly elevated 24 hrs after the start of the 1 hr exposure but was at control levels at 96 hrs. Immediately following nose-only exposure, lung ionic fluoride concentrations were less than plasma ionic fluoride concentrations suggesting that the fluoride in the lung had reached that site via plasma transport rather than by inhalation. A dose-dependent increase in plasma ionic fluoride concentration occurred after upper respiratory tract HF exposure providing strong evidence that fluoride is absorbed systemically from that site. The plasma ionic fluoride concentration after upper respiratory tract exposure was of sufficient magnitude to account for the plasma fluoride concentrations observed in intact nose-only exposed rats. (ERB)

  5. Fluoride release and recharge behavior of a nano-filled resin-modified glass ionomer compared with that of other fluoride releasing materials. (United States)

    Mitra, Sumita B; Oxman, Joe D; Falsafi, Afshin; Ton, Tiffany T


    To compare the long-term fluoride release kinetics of a novel nano-filled two-paste resin-modified glass-ionomer (RMGI), Ketac Nano (KN) with that of two powder-liquid resin-modified glass-ionomers, Fuji II LC (FLC) and Vitremer (VT) and one conventional glass-ionomer, Fuji IX (FIX). Fluoride release was measured in vitro using ion-selective electrodes. Kinetic analysis was done using regression analysis and compared with existing models for GIs and compomers. In a separate experiment the samples of KN and two conventional glass-ionomers, FIX and Ketac Molar (KM) were subjected to a treatment with external fluoride source (Oral-B Neutra-Foam) after 3 months of fluoride release and the recharge behavior studied for an additional 7-day period. The cumulative amount of fluoride released from KN, VT and FLC and the release profiles were statistically similar but greater than that for FIX at P coating of KN with its primer and of DY with its adhesive did not significantly alter the fluoride release behavior of the respective materials. The overall rate for KN was significantly higher than for the compomer DY. DY showed a linear rate of release vs. t and no burst effect as expected for compomers. The nanoionomer KN showed fluoride recharge behavior similar to the conventional glass ionomers FIX and KM. Thus, it was concluded that the new RMGI KN exhibits fluoride ion release behavior similar to typical conventional and RMGIs and that the primer does not impede the release of fluoride.

  6. Fluoridation Basics (United States)

    ... return on investment for community water fluoridation (including productivity losses) ranged from $4 in small communities of ... National Center for Chronic Disease Prevention and Health Promotion Email Recommend Tweet YouTube Instagram Listen Watch RSS ...

  7. Fluoride removal performance of phosphoric acid treated lime ...

    African Journals Online (AJOL)

    Fluoride in drinking water above permissible levels is responsible for dental and skeletal fluorosis. In this study, removal of fluoride ions from water using phosphoric acid treated lime was investigated in continuous and point-of-use system operations. In the continuous column operations, fluoride removal performance was ...

  8. Fluoride uptake from restorative dental materials by human enamel

    International Nuclear Information System (INIS)

    Forsten, L.; Rytoemaa, I.; Anttila, A.; Keinonen, J.


    The purpose of the study was to determine the uptake in vitro of fluoride from restorative materials by tooth enamel and whether prior etching of the enamel causes a change of uptake. The outermost layer of the labial surface of extracted canines was removed by grinding and the enamel was covered with five different fluoride-containing materials ; a silicate, a composite resin, an amalgam, a silicophosphate, and a polycarboxylate luting cement. The material was either removed immediately or after storing the tooth in distilled water. The fluoride content was determined using a sensitive physical method based on the 19 F (p, αγ) 16 O reaction. In addition, the fluoride content of enamel after etching for different periods of time and of etched enamel which had been in contact with silicate cement was determined. The mean fluoride content of uncovered interior enamel was 226 parts 10 6 . All materials, except the composite, increased clearly the fluoride content of the underlying enamel. Etching of interior enamel also increased the fluoride values. No difference could be shown in fluoride uptake from silicate and composite resin between etched and unetched enamel. (author)

  9. Fluoride ion recognition by chelating and cationic boranes. (United States)

    Hudnall, Todd W; Chiu, Ching-Wen; Gabbaï, François P


    Because of the ubiquity of fluoride ions and their potential toxicity at high doses, researchers would like to design receptors that selectively detect this anion. Fluoride is found in drinking water, toothpaste, and osteoporosis drugs. In addition, fluoride ions also can be detected as an indicator of uranium enrichment (via hydrolysis of UF(6)) or of the chemical warfare agent sarin, which releases the ion upon hydrolysis. However, because of its high hydration enthalpy, the fluoride anion is one of the most challenging targets for anion recognition. Among the various recognition strategies that are available, researchers have focused a great deal of attention on Lewis acidic boron compounds. These molecules typically interact with fluoride anions to form the corresponding fluoroborate species. In the case of simple triarylboranes, the fluoroborates are formed in organic solvents but not in water. To overcome this limitation, this Account examines various methods we have pursued to increase the fluoride-binding properties of boron-based receptors. We first considered the use of bifunctional boranes, which chelate the fluoride anion, such as 1,8-diborylnaphthalenes or heteronuclear 1-boryl-8-mercurio-naphthalenes. In these molecules, the neighboring Lewis acidic atoms can cooperatively interact with the anionic guest. Although the fluoride binding constants of the bifunctional compounds exceed those of neutral monofunctional boranes by several orders of magnitude, the incompatibility of these systems with aqueous media limits their utility. More recently, we have examined simple triarylboranes whose ligands are decorated by cationic ammonium or phosphonium groups. These cationic groups increase the electrophilic character of these boranes, and unlike their neutral analogs, they are able to complex fluoride in aqueous media. We have also considered cationic boranes, which form chelate complexes with fluoride anions. Our work demonstrates that Coulombic and chelate

  10. Fluoride reactions with dental enamel following different forms of fluoride supply

    International Nuclear Information System (INIS)

    Hellstroem, I.; Ericsson, Y.


    The reactions with dental enamel of NaF as tablets dissolved in different beverages or supplied with NaCl, simulating domestic salt fluoridation, were studied in tests with enamel surfaces and enamel powder. It was confirmed that powdered enamel can react quite differently from enamel surfaces under certain conditions. Enamel surfaces took up much more fluoride (F) from orange juice than from water or milk, and neither the low pH nor the citrate content of the juice increased the formation of unstable CaF 2 in the enamel, as judged from a KOH leaching test. The F uptake by enamel surfaces from 0.25 mM NaF in 175 mM NaCl, corresponding to a dish prepared with salt containing 500 parts/10 6 F, was about 80 percent greater than from the same NaF concentration in water. This NaCl concentration did not increase the formation of CaF 2 in the enamel, as judged from the KOH test, while 350 mM NaCl caused a moderate increase. The investigations support the administration of NaF tablets with orange juice and the plans for domestic salt fluoridation. (author)

  11. Fluoride use in Controlling Dental Caries and Fluorosis

    Directory of Open Access Journals (Sweden)

    Gaurav Solanki


    Full Text Available Policy were introduced to control fluoride exposure and to reduce the prevalence of fluorosis. The study aimed of describing the prevalence, severity and risk factors for fluorosis, and to describe the trend of fluorosis among Indian children. The study also aimed of exploring the effect of the change in fluoride exposure on dental fluorosis and caries. Establishing an appropriate use of fluoride toothpaste could be successful in reducing fluorosis without a significant increase in caries experience. The use of fluorides for oral health has always involved a balance between the protective benefit against dental caries and the risk of developing fluorosis. The link between fluoride and dental health was established to determining the causes of dental fluorosis or enamel mottling. Fluorosis in Indian children was highly prevalent in the early 1990s.

  12. Fluoride remediation using floating macrophytes

    Directory of Open Access Journals (Sweden)

    Naba Kumar Mondal


    Full Text Available Six aquatic macrophytes, such as Pistia stratiotes, Ceratophyllum demersum, Nymphoides indica, Lemna major, Azolla pinnata,and Eichhornia crassipes were considered for remove fluoride from aqueous solution. Five different concentrations (10, 30, 50, and 100 ppm of fluoride solution were taken in 1 L plastic container. Fixed weight (20 g of macrophytes along with 500 ml fluoride solution was taken in each plastic container for 72 hours observation. Results demonstrated all the macrophytes show highest fluoride removal during 24 h to 48 h, but after 72 h their efficiency reduced drastically. The species N. indica showed better removal efficiency than other experimental macrophytes. In general, pigment measurement data indicated higher concentration at 72 h. However, Pistia sp. showed higher concentration of pigmentation at intermediate time interval (48 h. Higher level of dry weight to fresh weight ratio was recorded for L. major and A. pinnata at all concentrations, excepting at 10 ppm. In addition, all macrophytes showed lower RGR at higher concentration. Isotherm study indicated that macrophyte C. demersum is a good fitted with Freundlich and Langmuir isotherm whereas L. major with Langmuir isotherm during 24 hours.

  13. Density and surface tension of melts of zirconium and hafnium fluorides with lithium fluoride

    International Nuclear Information System (INIS)

    Katyshev, S.F.; Artemov, V.V.; Desyatnik, V.N.


    A study was conducted to determine the temperature dependence of the density and surface tension of melts of LiF-ZrF 4 and LiF-HfF 4 . Density and surface tension were determined by the method of maximum pressure in an argon bubble. On the basis of experimental data over the entire concentration range the molar volumes and their relative deviations from the additive molar volumes were calculated for 1100 0 K. The positive deviations of the molar volumes from additivity in the LiF-HfF 4 system (22.45%) were greater than in the LiF-ZrF 4 system (15.75%). This indicated that the reaction with lithium fluoride is intensified with the switch to the hafnium fluoride. Results also demonstrated that the fluorides are surface-active components in the molten mixtures

  14. Coprecipitation of iron and silver with barium fluoride

    International Nuclear Information System (INIS)

    Kopilova, N.V.; Khamidov, B.O.; Kashina, Z.A.; Ikrami, D.D.


    Distribution of trace contaminants of iron and silver at coprecipitation of barium fluoride is studied in present work. It is defined that iron almost completely coprecipitated with barium fluoride in wide range of ph 5.5-12. Silver coprecipitated with barium fluoride in ph range 4-7. The value of coprecipitation varies from 94% to 100%.

  15. Data on fluoride concentration level in villages of Asara (Alborz, Iran) and daily fluoride intake based on drinking water consumption. (United States)

    Akhavan, Giti; Dobaradaran, Sina; Borazjani, Jaleh Mohajeri


    In the present data article, fluoride concentration levels of drinking water (with spring or groundwater sources) in 10 villages of Asara area located in Alborz province were determined by the standard SPADNS method using a spectrophotometer (DR/2000 Spectrophotometer, USA). Daily fluoride intakes were also calculated based on daily drinking water consumption. The fluoride content were compared with EPA and WHO guidelines for drinking water.

  16. Sodium fluoride induces apoptosis in mouse embryonic stem cells through ROS-dependent and caspase- and JNK-mediated pathways

    International Nuclear Information System (INIS)

    Nguyen Ngoc, Tam Dan; Son, Young-Ok; Lim, Shin-Saeng; Shi, Xianglin; Kim, Jong-Ghee; Heo, Jung Sun; Choe, Youngji; Jeon, Young-Mi; Lee, Jeong-Chae


    Sodium fluoride (NaF) is used as a source of fluoride ions in diverse applications. Fluoride salt is an effective prophylactic for dental caries and is an essential element required for bone health. However, fluoride is known to cause cytotoxicity in a concentration-dependent manner. Further, no information is available on the effects of NaF on mouse embryonic stem cells (mESCs). We investigated the mode of cell death induced by NaF and the mechanisms involved. NaF treatment greater than 1 mM reduced viability and DNA synthesis in mESCs and induced cell cycle arrest in the G 2 /M phase. The addition of NaF induced cell death mainly by apoptosis rather than necrosis. Catalase (CAT) treatment significantly inhibited the NaF-mediated cell death and also suppressed the NaF-mediated increase in phospho-c-Jun N-terminal kinase (p-JNK) levels. Pre-treatment with SP600125 or z-VAD-fmk significantly attenuated the NaF-mediated reduction in cell viability. In contrast, intracellular free calcium chelator, but not of sodium or calcium ion channel blockers, facilitated NaF-induced toxicity in the cells. A JNK specific inhibitor (SP600125) prevented the NaF-induced increase in growth arrest and the DNA damage-inducible protein 45α. Further, NaF-mediated loss of mitochondrial membrane potential was apparently inhibited by pifithrin-α or CAT inhibitor. These findings suggest that NaF affects viability of mESCs in a concentration-dependent manner, where more than 1 mM NaF causes apoptosis through hydroxyl radical-dependent and caspase- and JNK-mediated pathways. -- Highlights: ► The mode of NaF-induced cell death and the mechanisms involved were examined. ► NaF induced mainly apoptotic death of mouse embryonic stem cells (mESCs). ► NaF induced mitochondrial-mediated and caspase-dependent apoptosis. ► JNK- and p53-mediated pathways are involved in NaF-mediated apoptosis in the cells. ► ROS are the up-stream effector in NaF-mediated activation of JNK and p53 in mESCs.

  17. Sodium fluoride induces apoptosis in mouse embryonic stem cells through ROS-dependent and caspase- and JNK-mediated pathways

    Energy Technology Data Exchange (ETDEWEB)

    Nguyen Ngoc, Tam Dan [Institute of Oral Biosciences and School of Dentistry (BK21 Program), Chonbuk National University, Jeonju 561-756 (Korea, Republic of); Son, Young-Ok [Graduate Center for Toxicology, School of Medicine, University of Kentucky, Lexington, KY 40536-0305 (United States); Lim, Shin-Saeng [Institute of Oral Biosciences and School of Dentistry (BK21 Program), Chonbuk National University, Jeonju 561-756 (Korea, Republic of); Department of Bioactive Material Sciences and Research Center of Bioactive Materials, Chonbuk National University, Jeonju 561-756 (Korea, Republic of); Shi, Xianglin [Graduate Center for Toxicology, School of Medicine, University of Kentucky, Lexington, KY 40536-0305 (United States); Kim, Jong-Ghee [Institute of Oral Biosciences and School of Dentistry (BK21 Program), Chonbuk National University, Jeonju 561-756 (Korea, Republic of); Heo, Jung Sun [Department of Maxillofacial Biomedical Engineering and Institute of Oral Biology, School of Dentistry, Kyung Hee University, Seoul 130-701 (Korea, Republic of); Choe, Youngji [Institute of Oral Biosciences and School of Dentistry (BK21 Program), Chonbuk National University, Jeonju 561-756 (Korea, Republic of); Jeon, Young-Mi, E-mail: [Institute of Oral Biosciences and School of Dentistry (BK21 Program), Chonbuk National University, Jeonju 561-756 (Korea, Republic of); Lee, Jeong-Chae, E-mail: [Institute of Oral Biosciences and School of Dentistry (BK21 Program), Chonbuk National University, Jeonju 561-756 (Korea, Republic of); Graduate Center for Toxicology, School of Medicine, University of Kentucky, Lexington, KY 40536-0305 (United States); Department of Bioactive Material Sciences and Research Center of Bioactive Materials, Chonbuk National University, Jeonju 561-756 (Korea, Republic of)


    Sodium fluoride (NaF) is used as a source of fluoride ions in diverse applications. Fluoride salt is an effective prophylactic for dental caries and is an essential element required for bone health. However, fluoride is known to cause cytotoxicity in a concentration-dependent manner. Further, no information is available on the effects of NaF on mouse embryonic stem cells (mESCs). We investigated the mode of cell death induced by NaF and the mechanisms involved. NaF treatment greater than 1 mM reduced viability and DNA synthesis in mESCs and induced cell cycle arrest in the G{sub 2}/M phase. The addition of NaF induced cell death mainly by apoptosis rather than necrosis. Catalase (CAT) treatment significantly inhibited the NaF-mediated cell death and also suppressed the NaF-mediated increase in phospho-c-Jun N-terminal kinase (p-JNK) levels. Pre-treatment with SP600125 or z-VAD-fmk significantly attenuated the NaF-mediated reduction in cell viability. In contrast, intracellular free calcium chelator, but not of sodium or calcium ion channel blockers, facilitated NaF-induced toxicity in the cells. A JNK specific inhibitor (SP600125) prevented the NaF-induced increase in growth arrest and the DNA damage-inducible protein 45α. Further, NaF-mediated loss of mitochondrial membrane potential was apparently inhibited by pifithrin-α or CAT inhibitor. These findings suggest that NaF affects viability of mESCs in a concentration-dependent manner, where more than 1 mM NaF causes apoptosis through hydroxyl radical-dependent and caspase- and JNK-mediated pathways. -- Highlights: ► The mode of NaF-induced cell death and the mechanisms involved were examined. ► NaF induced mainly apoptotic death of mouse embryonic stem cells (mESCs). ► NaF induced mitochondrial-mediated and caspase-dependent apoptosis. ► JNK- and p53-mediated pathways are involved in NaF-mediated apoptosis in the cells. ► ROS are the up-stream effector in NaF-mediated activation of JNK and p53 in mESCs.


    African Journals Online (AJOL)

    Preferred Customer

    Currently available treatment methods for removal of excess fluoride from water are broadly divided into three ... the application of nanoparticles as sorbents for fluoride removal. Sundaram [26] studied the ... Characterization of adsorbent.

  19. Process development for treatment of fluoride containing wastes

    Energy Technology Data Exchange (ETDEWEB)

    Singh, Mahesh; Kanvinde, V Y [Chemical Engineering Division, Bhabha Atomic Research Centre, Mumbai (India)


    Many chemical and metallurgical industries generate liquid wastes containing high values of fluorides in association of nitrates and other metals. Due to harmful effects of fluorides these type of wastes can not be disposed off in the environment without proper treatment. Bench-scale laboratory experiments were conducted to develop a process scheme to fix the fluorides as non-leachable solid waste and fluoride free treated liquid waste for their disposal. To optimize the important parameters, simulated synthetic and actual wastes were used. For this study, three waste streams were collected from Nuclear Fuel Complex, Hyderabad. (author). 6 tabs., 1 fig.

  20. Toxicity of fluoride to microorganisms in biological wastewater treatment systems. (United States)

    Ochoa-Herrera, Valeria; Banihani, Qais; León, Glendy; Khatri, Chandra; Field, James A; Sierra-Alvarez, Reyes


    Fluoride is a common contaminant in a variety of industrial wastewaters. Available information on the potential toxicity of fluoride to microorganisms implicated in biological wastewater treatment is very limited. The objective of this study was to evaluate the inhibitory effect of fluoride towards the main microbial populations responsible for the removal of organic constituents and nutrients in wastewater treatment processes. The results of short-term batch bioassays indicated that the toxicity of sodium fluoride varied widely depending on the microbial population. Anaerobic microorganisms involved in various metabolic steps of anaerobic digestion processes were found to be very sensitive to the presence of fluoride. The concentrations of fluoride causing 50% metabolic inhibition (IC(50)) of propionate- and butyrate-degrading microorganisms as well as mesophilic and thermophilic acetate-utilizing methanogens ranged from 18 to 43 mg/L. Fluoride was also inhibitory to nitrification, albeit at relatively high levels (IC(50)=149 mg/L). Nitrifying bacteria appeared to adapt rapidly to fluoride, and a near complete recovery of their metabolic activity was observed after only 4d of exposure to high fluoride levels (up to 500 mg/L). All other microbial populations evaluated in this study, i.e., glucose fermenters, aerobic glucose-degrading heterotrophs, denitrifying bacteria, and H(2)-utilizing methanogens, tolerated fluoride at very high concentrations (>500 mg/L).

  1. Laboratory investigations into the potential anticaries efficacy of fluoride varnishes. (United States)

    Lippert, Frank; Hara, Anderson Takeo; Martinez-Mier, Esperanza Angeles; Zero, Domenick T


    The purpose of this study was to investigate the potential anticaries efficacy of fluoride varnishes (FVs) by studying their ability to reharden and deliver fluoride to carious lesions and to release fluoride into saliva. Enamel carious lesions were created and allocated to 24 groups (11 FVs with two FV incubation times and two control groups) based on Knoop microhardness test values. FVs were applied to lesions, which were incubated in artificial saliva for two or six hours, with saliva being renewed hourly. FV was removed and lesions were remineralized in artificial saliva for 22 hours. Microhardness was measured and enamel fluoride uptake (EFU) was determined. Saliva samples (six-hour groups) were analyzed to determine fluoride release characteristics. Data were analyzed using analysis of variance. FVs differed considerably in their ability to reharden and deliver fluoride to carious lesions and in their fluoride release characteristics. Little consistency was found between investigated study variables for virtually all tested FVs. For example, a particular FV showed the highest EFU and fluoride release values but the lowest rehardening value. A longer FV contact time led to increased EFU for five of the 11 FVs. Some FVs delivered more fluoride to lesions in two hours than others did in six hours. Fluoride varnishes differ greatly in their in vitro anticaries efficacy.

  2. Protective effect of fluoride varnish and fluoride gel on enamel erosion: roughness, SEM-EDS, and µ-EDXRF studies. (United States)

    Soares, Luís Eduardo Silva; De Carvalho Filho, Antonio Carlos Belfort


    The effects of fluoride treatment on bovine enamel subjected to acid erosion were studied by roughness (Ra) measurements, scanning electron microscopy (SEM), energy dispersive spectroscopy (EDS), and microenergy-dispersive X-ray fluorescence spectrometry (μ-EDXRF). Enamel samples (63) were divided into nine groups (n = 7): artificial saliva (AS), Pepsi Twist(®) (PT), orange juice (OJ), Duraphat(®)  + Pepsi Twist(®) (DPH/PT), Duraphat(®)  + orange juice (DPH/OJ), Duofluorid(®)  + Pepsi Twist(®) (DUO/PT), Duofluorid(®)  + orange juice (DUO/OJ), fluoride gel + Pepsi Twist(®) (FG/PT), and fluoride gel + orange juice (FG/OJ). Fluoride was applied and the samples were submitted to six cycles (demineralization: Pepsi Twist(®) or orange juice, 10 min; remineralization: saliva, 1 h). The enamel surface in depth was exposed and 63 line-scan maps were performed. The elemental analysis by EDS revealed that only fluoride treated groups had any detectable fluorine after erosion cycles (DPH/PT: 3.50 wt%; DPH/OJ: 3.37 wt%; DUO/PT: 2.69 wt%; DUO/OJ: 3.54 wt%; FG/PT: 2.17 wt%; FG/OJ: 2.77 wt%). PT treatment resulted in significantly higher Ra values than the artificial saliva (P < 0.001). Scanning electron microscopy (SEM) analysis of fluoride protected enamel showed areas with some globular structures or a residual layer of varnish. The enamel thickness was significantly lower in PT (0.63 ± 0.087 mm) than in DPH/PT (0.87 ± 0.16 mm) and DUO/PT (0.92 ± 0.14 mm) groups (P < 0.01). Fluoride treatments protected enamel without Ra increase and loss of enamel tissue. © 2015 Wiley Periodicals, Inc.

  3. Water fluoridation for the prevention of dental caries. (United States)

    Iheozor-Ejiofor, Zipporah; Worthington, Helen V; Walsh, Tanya; O'Malley, Lucy; Clarkson, Jan E; Macey, Richard; Alam, Rahul; Tugwell, Peter; Welch, Vivian; Glenny, Anne-Marie


    Dental caries is a major public health problem in most industrialised countries, affecting 60% to 90% of school children. Community water fluoridation was initiated in the USA in 1945 and is currently practised in about 25 countries around the world; health authorities consider it to be a key strategy for preventing dental caries. Given the continued interest in this topic from health professionals, policy makers and the public, it is important to update and maintain a systematic review that reflects contemporary evidence. To evaluate the effects of water fluoridation (artificial or natural) on the prevention of dental caries.To evaluate the effects of water fluoridation (artificial or natural) on dental fluorosis. We searched the following electronic databases: The Cochrane Oral Health Group's Trials Register (to 19 February 2015); The Cochrane Central Register of Controlled Trials (CENTRAL; Issue 1, 2015); MEDLINE via OVID (1946 to 19 February 2015); EMBASE via OVID (1980 to 19 February 2015); Proquest (to 19 February 2015); Web of Science Conference Proceedings (1990 to 19 February 2015); ZETOC Conference Proceedings (1993 to 19 February 2015). We searched the US National Institutes of Health Trials Registry ( and the World Health Organization's WHO International Clinical Trials Registry Platform for ongoing trials. There were no restrictions on language of publication or publication status in the searches of the electronic databases. For caries data, we included only prospective studies with a concurrent control that compared at least two populations - one receiving fluoridated water and the other non-fluoridated water - with outcome(s) evaluated at at least two points in time. For the assessment of fluorosis, we included any type of study design, with concurrent control, that compared populations exposed to different water fluoride concentrations. We included populations of all ages that received fluoridated water (naturally or artificially

  4. Water Fluoridation Reporting System (Public Water Systems) (United States)

    U.S. Department of Health & Human Services — The Water Fluoridation Reporting System (WFRS) has been developed to provide tools to assist states in managing fluoridation programs. WFRS is designed to track all...


    Rirattanapong, Opas; Rirattanapong, Praphasri


    Abstract. In Thailand, the consumption of soy milk products is common but there is limited data about their fluoride content. The purpose of this study was to es- timate the fluoride content of soy milk products available in Thailand. Fluoride content was determined for 76 brands of soy milk using a F-ion-specific electrode. The fluoride concentrations ranged from 0.01 to 3.78 μg/ml. The fluoride content was not related to sugar content, soy bean content or the sterilization process. Among 3 brands of soy milk containing tea powder extract, the fluoride content was high (1.25 to 3.78 μg/ml). Most brands of soy milk tested in our study had fluoride content below the optimal daily intake but brands containing tea powder extract if consumed by children may increase their risk for fluorosis.

  6. Comparative evaluation of fluoride release and recharge of pre-reacted glass ionomer composite and nano-ionomeric glass ionomer with daily fluoride exposure: An in vitro study

    Directory of Open Access Journals (Sweden)

    Jayanthi Mungara


    Full Text Available Aim: This in vitro study was designed to investigate the effects of daily fluoride exposures on fluoride release and recharge by prereacted glass ionomer (PRG composite and nano-ionomeric glass ionomer. Materials and Methods: Seventy-two specimens (36 of each material were prepared and by placing the restorative materials into Teflon mold. Each specimen was subjected to one of three daily treatments (n = 12: (1 No fluoride treatment (control; (2 application of a fluoride dentifrice (1,000 ppm once daily; and (3 the same regimen as (2, plus immersion in a 0.05% sodium fluoride (NaF mouth rinse (225 ppm immediately following the dentifrice application. Specimens were suspended in a storage vial containing 10 ml demineralizing solution for 6 h and transferred to a new test tube containing 10 ml remineralizing solution for 18 h. Fluoride treatments of the specimens were completed every day prior to their immersion in the demineralizing solution. Media solutions were buffered with equal volumes of total ionic strength adjustment buffer (TISAB II; fluoride levels were measured using a digital ion analyzer and fluoride electrode throughout the 21 day duration of the experiment. Results: Nano-ionomeric glass ionomer showed a better amount of fluoride release than PRG composite irrespective of the fluoride treatment supplementation (P < 0.01. Additional fluoride supplementation improved fluoride release and recharge ability for both the materials when compared to their respective control groups. The fluoride recharge for both materials did not show any sustained pattern of release. Conclusion: Nano-ionomeric glass ionomer demonstrated a greater ability to release and recharge compared with that of PRG composite.

  7. Fluoride removal from water by nano filtration

    International Nuclear Information System (INIS)

    Bejaoui, Imen; Mnif, Amine; Hamrouni, Bechir


    As any oligo element, fluoride is necessary and beneficial for human health to low concentrations, but an excess amount of fluoride ions in drinking water has been known to cause undesirable effects, especially tooth and bones fluoro sis. The maximum acceptable concentration of fluoride in drinking water was fixed by the World Health Organization according to the climate in the range of 1 mg.L -1 to 1,2 mg.L -1 . Many methods have been used to remove fluoride from water such as precipitation, adsorption, electrocoagulation and membrane processes. Technologies using membrane processes are being used in many applications, particularly for brackish water desalination. Nano filtration seems to be the best process for a good selective defluorination of fluorinated waters. The main objective of this work was to investigate the retention of fluoride anions by nano filtration. The first part of this study deals with the characterisation of the NF HL2514TF membrane. The influence of various experimental parameters such as initial fluoride content, feed pressure, permeate flux, ionic strength, type of cation associated to fluoride and pH were studied in the second part. Results show that the retention order for the salts tested was TR(Na 2 SO 4 ) > TR(CaCl 2 ) > TR(NaCl), showing a retention sequence inversely proportional to the salt diffusion coefficients in water. It was also shown that charge effects could not be neglected, and a titration experiments confirmed that the NF membrane carry a surplus of negatively charged groups. Fluoride retention exceeds 60 pour cent, and increases with increasing concentration, where the rejection mechanism is related to the dielectric effects. Speigler-Kedem model was applied to experimental results in the aim to determine phenomenological parametersσand P s respectively, the reflexion coefficient of the membrane and the solute permeability of ions. The convective and diffusive parts of the mass transfer were quantified with

  8. Studies on the comparative effect of sodium fluoride on collagen ...

    African Journals Online (AJOL)

    Fluoride is an essential element for the normal development and growth of human beings. The main source of fluoride for humans is the intake of groundwater. At high levels, fluoride causes dental and skeletal fluorosis. In this study, control and sodium fluoride (NaF) treated groups of rats had significant (p < 0.05) higher ...

  9. Spectrophotometric determination of fluoride with alizarin complexone

    Energy Technology Data Exchange (ETDEWEB)

    Marczenko, Z; Lenarczyk, L [Politechnika Warszawska (Poland)


    The modification of direct spectrophotometric method of fluoride determination by alizarin complexone has been developed. It was shown that the lanthanum alizarin complexone chelate is more convenient than that of cerium (3). The influence of acetone, dioxane and dimethyl sulphoxide in water solution on the increase of sensitivity of the method and the rate of colour reaction has been determined. The optimal pH ranges for the reaction with lanthanum and cerium (3) have been estimated. Some amines having a large molecule are useful for extraction of blue fluoride complex with isobutanol. Dioctylamine was applied in a new extraction spectrophotometric procedure of fluoride determination. Conditions in reagent have been established. Both variants of the method have been applied to the fluoride determination in several chemicals. The obtained results show a good precision and accuracy.

  10. Removal of fluoride from water using aluminium containing compounds

    Institute of Scientific and Technical Information of China (English)

    M. Karthikeyan; K. P. Elango


    Batch adsorption studies were undertaken to assess the suitability of aluminium titanate (AT) and bismuth aluminate (BA) to remove fluoride ions from water.The effect of pH,dose of adsorbent,contact time,initial concentration,co-ions and temperature on fluoride removal efficiency were studied.The amounts of fluoride ions adsorbed,at 30℃ from 4 mg/L of fluoride ion solution,by AT and BA are 0.85 and 1.55 mg/g,respectively.The experimental data fitted well to the Freundlich and Langmuir isotherms.Thermodynamic parameters such as △H~0,△S~0 and △G~0 indicated that the removal of fluoride ions by AT is exothermic and non-spontaneous while that by BA is endothermic and spontaneous.Furrier transform infrared (FT-IR) analysis and X-ray diffraction (XRD) patterns of the adsorbent before and after adsorption indicated that fluoride ions are chemisorbed by these adsorbents.

  11. Synthesis and characterization of ruthenium fluorides and oxide fluorides with high oxidation states

    International Nuclear Information System (INIS)

    Meublat, L.


    The synthesis of ruthenium fluorides and oxide fluorides with high oxidation states was attempted from dioxide RuO 2 and tetroxide RuO 4 . Three fluorinating agents were used: fluorine, chlorine trifluoride and krypton difluoride. The reactions were achieved in anhydrous hydrogen fluoride at room temperature. Thus, the reaction of RuO 4 with CIF 3 enabled us to prepare chloryl hexafluororuthenate (V), CIO 2 + RuF 6 - , a new compound well identified by vibrational spectroscopy (infra-red and Raman), the structure of which was determined. The reaction of KrF 2 with RuO 4 gave the oxide tetrafluoride RuOF 4 , the previously published syntheses and properties of which were not in agreement with each other. This compound was definitely characterized here by chemical analysis, infra-red spectroscopy and X-ray powder diffraction. The product of thermal decomposition (70 0 C) of RuOF 4 is presumably RuF 4 since only oxygen is liberated during this decomposition. At last, the reaction of KrF 2 with RuO 2 probably leads to the formation of the new oxide fluoride RuO 2 F 4 . Indeed, no oxygen is given off during this reaction, the chemical analysis of the red-orange coloured solid residue is almost in agreement with the one proposed and its infra-red absorption spectrum indicates the presence of ruthenium-oxygen and ruthenium-terminal and bridging fluorine bonds [fr

  12. Synthesis and characterization of ruthenium fluorides and oxide fluorides with high oxidation states

    International Nuclear Information System (INIS)

    Meublat, L.


    The synthesis of ruthenium fluorides and oxide fluorides with high oxidation states was attempted from dioxide RuO 2 and tetroxide RuO 4 . Three fluorinating agents were used: fluorine, chlorine trifluoride and krypton difluoride. The reactions were achieved in anhydrous hydrogen fluoride at room temperature. Thus, the reaction of RuO 4 with CIF 3 enabled us to prepare chloryl hexafluororuthenate (V), ClO 2 + RuF 6 - , a new compound well idendified by vibrational spectroscopy (infra-red and Raman), the structure of which was determined. The reaction of KrF 2 with RuO 4 gave the oxide tetrafluoride RuOF 4 , the previously published syntheses and properties of which were not in agreement with each other. This compound was definitely characterized here by chemical analysis, infra-red spectroscopy and X-ray powder diffraction. The product of thermal decomposition (70 0 C) of RuOF 4 is presumably RuF 4 since only oxygen is liberated during this decomposition. At last, the reaction of KrF 2 with RuO 2 probably leads to the formation of the new oxide fluoride RuO 2 F 4 . Indeed, no oxygen is given off during this reaction, the chemical analysis of the red-orange coloured solid residue is almost in agreement with the one proposed and its infra-red absorption spectrum indicates the presence of ruthenium-oxygen and ruthenium-terminal and bridging fluorine bonds [fr

  13. Purification of Drinking Water from Fluorides by Reverse Osmosis

    Directory of Open Access Journals (Sweden)

    Aleksander A.


    Full Text Available Introduction: An important task in the sphere of sanitary and epidemiological welfare of the population of the Russian Federation is provision of drinking water. Tap water must not contain pathogenic bacteria and dangerous chemicals. Purification systems regulate the concentration of fluoride ions in drinking water. The aim of this paper is to study the possibility of purifying tap water from fluoride ions by reverse osmosis. Materials and Methods: We used the Alfa Laval PilotUnit 2.5 "RO/NF with a set of spiral-type membrane elements RO99-2517/48 to remove fluoride ions. We measured the concentration of fluoride ions by the potentiometric method using the Hanna HI 2211 (pH/mV/T. Fluoride-selective electrode ELIS 131 F was used as an indicator electrode and the standard chloride-silver electrode EVL-1M3 was used as a reference electrode. Both the calibration and buffer solutions were prepared from chemically pure reagents and A. R. purity for analysis reagents according to GOST 4386-89. Results: A single passage of water through the reverse osmosis membrane reduced the concentration of fluoride ions from 2.29 ± 0.02 to 0.240 ± 0.015 mg/l. Double passage of water reduced the concentration by a factor of two. As the concentration of fluoride ions increased in the retentate, the concentration in the filtrate slightly increased too. Purification of water reduced the concentration of fluoride ions from 20 mg/l, to 0.5 mg/l. Discussion and Conclusions: Thus, using the Alfa Laval PilotUnit 2.5" RO/NF with a set of spiral-type membrane elements RO99-2517/48 filters tap water of ions of fluoride to the maximum allowable concentration. This study opens the perspective of using reverse osmosis to purify tap water with high concentration of fluoride ions.

  14. Emissions of fluorides from welding processes. (United States)

    Szewczyńska, Małgorzata; Pągowska, Emilia; Pyrzyńska, Krystyna


    The levels of fluoride airborne particulates emitted from welding processes were investigated. They were sampled with the patented IOM Sampler, developed by J. H. Vincent and D. Mark at the Institute of Occupational Medicine (IOM), personal inhalable sampler for simultaneous collection of the inhalable and respirable size fractions. Ion chromatography with conductometric detection was used for quantitative analysis. The efficiency of fluoride extraction from the cellulose filter of the IOM sampler was examined using the standard sample of urban air particle matter SRM-1648a. The best results for extraction were obtained when water and the anionic surfactant N-Cetyl-N-N-N-trimethylammonium bromide (CTAB) were used in an ultrasonic bath. The limits of detection and quantification for the whole procedure were 8μg/L and 24μg/L, respectively. The linear range of calibration was 0.01-10mg/L, which corresponds to 0.0001-0.1mg of fluorides per m(3) in collection of a 20L air sample. The concentration of fluorides in the respirable fraction of collected air samples was in the range of 0.20-1.82mg/m(3), while the inhalable fraction contained 0.23-1.96mg/m(3) of fluorides during an eight-hour working day in the welding room. Copyright © 2015. Published by Elsevier B.V.

  15. Clinical Usefulness of 18F-fluoride Bone PET

    International Nuclear Information System (INIS)

    Kang, Ji Yeon; Lee, Won Woo; Lee, Byung Chul; Kim, Sang Eun; So, Young


    18 F-fluoride bone positron emission tomography (PET) has been reported as a useful bone imaging modality. However, no clinical bone PET study had been performed previously in Korea. The authors investigated the usefulness of 18 F-fluoride bone PET in Korean patients with malignant or benign bone disease. Eighteen consecutive patients (eight women, ten men; mean age, 55±12 years) who had undergone 18 F-fluoride bone PET for the evaluation of bone metastasis (n=13) or benign bone lesions (n=5) were included. The interpretation of bone lesions on 18 F-fluoride bone PET was determined by consensus of two nuclear medicine physicians, and final results were confirmed using combination of all imaging studies and/or clinical follow-up. The analysis was performed on the basis of lesion group. Thirteen patients with malignant disease had 15 lesion groups, among which seven were confirmed as metastatic bone lesions and eight were confirmed as non-metastatic lesions. 18 F-fluoride bone PET correctly identified six of seven metastatic lesions (sensitivity, 86%), and seven of eight non-metastatic lesions (specificity, 88%). On the other hand, five patients with benign conditions had five bone lesion groups; four were confirmed as benign bone diseases and the other one was confirmed as not a bone lesion. 18 F-fluoride bone PET showed correct results in all the five lesion groups. 18 F-fluoride bone PET showed promising potential for bone imaging in Korean patients with malignant diseases as well as with various benign bone conditions. Therefore, further studies are required on the diagnostic performance and cost-effectiveness of 18 F-fluoride bone PET.

  16. Combinatorial Effects of Aromatic 1,3-Disubstituted Ureas and Fluoride on In vitro Inhibition of Streptococcus mutans Biofilm Formation. (United States)

    Kaur, Gurmeet; Balamurugan, P; Uma Maheswari, C; Anitha, A; Princy, S Adline


    Dental caries occur as a result of disequilibrium between acid producing pathogenic bacteria and alkali generating commensal bacteria within a dental biofilm (dental plaque). Streptococcus mutans has been reported as a primary cariogenic pathogen associated with dental caries. Emergence of multidrug resistant as well as fluoride resistant strains of S. mutans due to over use of various antibiotics are a rising problem and prompted the researchers worldwide to search for alternative therapies. In this perspective, the present study was aimed to screen selective inhibitors against ComA, a bacteriocin associated ABC transporter, involved in the quorum sensing of S. mutans. In light of our present in silico findings, 1,3-disubstituted urea derivatives which had better affinity to ComA were chemically synthesized in the present study for in vitro evaluation of S. mutans biofilm inhibition. The results revealed that 1,3-disubstituted urea derivatives showed good biofilm inhibition. In addition, synthesized compounds exhibited potent synergy with a very low concentration of fluoride (31.25-62.5 ppm) in inhibiting the biofilm formation of S. mutans without affecting the bacterial growth. Further, the results were supported by confocal laser scanning microscopy. On the whole, from our experimental results we conclude that the combinatorial application of fluoride and disubstituted ureas has a potential synergistic effect which has a promising approach in combating multidrug resistant and fluoride resistant S. mutans in dental caries management.

  17. Protection From Dental Erosion: All Fluorides are Not Equal. (United States)

    Faller, Robert V; Noble, Warden H


    All fluoride sources help strengthen teeth against bacterial acids that cause caries. However, excessive exposure to dietary acids, which can result in dental erosion, presents a more aggressive level of challenge compared to caries. Despite the fact that almost all toothpastes contain fluoride, both the incidence and prevalence of dental erosion appear to be on the rise. This article: (1) describes key differences between caries and dental erosion and the ability of different fluoride sources to help prevent erosion; (2) discusses the importance of the evaluation of patients for dental erosion at the earliest stages using the Basic Erosive Wear Examination scoring system to help assess and educate patients; and (3) provides evidence-based information for making specific recommendations to patients with dental erosion. The objective of this article is to assess the comparative ability of fluoride agents to protect against dental erosion. Though all fluorides are able to help strengthen teeth against cariogenic acids, not all available sources of fluoride provide the same level of erosion protection. Daily use of a stabilized stannous fluoride dentifrice has been shown to provide the most effective means of protecting teeth against the increasing risk of dental erosion and erosive tooth wear.

  18. Chemical mechanism of the fluoride-inhibition of fermentation

    Energy Technology Data Exchange (ETDEWEB)

    Warburg, O; Christian, W


    Among the fluoride-sensitive fermentation elements, enolase is the most sensitive. An investigation was made, quantitatively, of fluoride inhibition for chemically pure magnesium-enolase using an optical enolase test. Data show that the effective compound for fluoride inhibition is a complex magnesium-fluoro-phosphate and that the magnesium-fluoro-phosphate inhibits fermentation by combining proportionally to its concentration with the ferment-protein in a dissociating manner.

  19. Magnesium fluoride recovery method

    International Nuclear Information System (INIS)

    Gay, R.L.; McKenzie, D.E.


    A method of obtaining magnesium fluoride substantially free from radioactive uranium from a slag formed in the production of metallic uranium by the reduction of depleted uranium tetrafluoride with metallic magnesium in a retort wherein the slag contains the free metals magnesium and uranium and also oxides and fluorides of the metals. The slag having a radioactivity level of at least about 7,000 rhoCi/gm. The method comprises the steps of: grinding the slag to a median particle size of about 200 microns; contacting the ground slag in a reaction zone with an acid having a strength of from about 0.5 to 1.5 N for a time of from about 4 to about 20 hours in the presence of a catalytic amount of iron; removing the liquid product; treating the particulate solid product; repeating the last two steps at least one more time to produce a solid residue consisting essentially of magnesium fluoride substantially free of uranium and having a residual radioactivity level of less than about 1000 rhoCi/gm

  20. Performance of novel hydroxyapatite nanowires in treatment of fluoride contaminated water

    Energy Technology Data Exchange (ETDEWEB)

    He, Junyong; Zhang, Kaisheng [Nano-Materials and Environmental Detection Laboratory, Institute of Intelligent Machines, Chinese Academy of Sciences, Hefei 230031 (China); Department of Chemistry, University of Science and Technology of China, Hefei, Anhui 230026 (China); Wu, Shibiao [Nano-Materials and Environmental Detection Laboratory, Institute of Intelligent Machines, Chinese Academy of Sciences, Hefei 230031 (China); Cai, Xingguo; Chen, Kai; Li, Yulian [Nano-Materials and Environmental Detection Laboratory, Institute of Intelligent Machines, Chinese Academy of Sciences, Hefei 230031 (China); Department of Chemistry, University of Science and Technology of China, Hefei, Anhui 230026 (China); Sun, Bai; Jia, Yong; Meng, Fanli; Jin, Zhen [Nano-Materials and Environmental Detection Laboratory, Institute of Intelligent Machines, Chinese Academy of Sciences, Hefei 230031 (China); Kong, Lingtao, E-mail: [Nano-Materials and Environmental Detection Laboratory, Institute of Intelligent Machines, Chinese Academy of Sciences, Hefei 230031 (China); Liu, Jinhuai [Nano-Materials and Environmental Detection Laboratory, Institute of Intelligent Machines, Chinese Academy of Sciences, Hefei 230031 (China)


    Highlights: • Novel ultralong hydroxyapatite (HAP) nanowires were developed for effective defluoridation. • High fluoride adsorption capacity, 40.65 mg/g at neutral pH. • The HAP nanowire membrane efficiently removed fluoride by dynamic adsorption. • The membrane could remove more than 98% fluoride, and filtered water amount reached 350 L/m{sup 2}. - Abstract: Novel ultralong hydroxyapatite (HAP) nanowires were successfully prepared for fluoride removal for the first time. The fluoride adsorption on the HAP nanowires was studied on a batch mode. The results revealed that the adsorption data could be well described by the Freundlich model, and the adsorption kinetic followed the pseudo-second-order model. The maximum of adsorption capacity was 40.65 mg/g at pH 7.0 when the fluoride concentration is 200 mg/L. The thermodynamic parameters suggested that the adsorption of fluoride was a spontaneous endothermic process. The FT-IR, XPS and Zeta potential analysis revealed that both anion exchange and electrostatic interactions were involved in the adsorption of fluoride. Furthermore, the HAP nanowires were made into HAP membrane through a simple process of suction filtration. Membrane filtration experiments revealed that the fluoride removal capabilities depended on the membrane thickness, flow rate and initial concentration of fluoride. The as-prepared membrane could remove fluoride efficiently through continues filtration. The filtered water amount could reach 350, 192, and 64 L/m{sup 2} when the fluoride concentrations were 4, 5 and 8 ppm, respectively, using the HAP membrane with only 150 μm thickness. The as-synthesized ultralong HAP nanowires were thus demonstrated to be very effective and biocompatible adsorbents for fluoride removal from contaminated water.

  1. Preparation and study of chlorine mono-fluoride and of chlorine oxi-fluorides; Preparation et etude du monofluorure et des oxyfluorures de chlore

    Energy Technology Data Exchange (ETDEWEB)

    Macheteau, Yves


    The objective of this engineering school report was to be a contribution to the study of a family of fluorine compounds: chlorine mono-fluoride (ClF), chlorine fluoride oxide (ClOF), chloryl fluoride (ClO{sub 2}F), perchloryl fluoride (ClO{sub 3}F) and perchloryl oxi-fluoride (ClO{sub 4}F). Such a study required very pure products to be obtained in order to be able to characterize them by different methods (infrared, micro-sublimation, and chromatography). The thermolysis of ClO{sub 2}F and ClO{sub 4}F has been particularly studied, and magnetic resonance has been used to establish a relationship between fluorine chemical displacement and the electro-negativity of the F-X bond where X represents the atom group to which fluorine is bonded.

  2. Sulfochlorphenol S as reagent for direct photometric determination of fluorides

    International Nuclear Information System (INIS)

    Dzhashi, D.O.; Dedkova, V.P.; Savvin, S.B.


    The system of zirconium-sulfochlorphenol S-fluoride was studied by the spectrophotometry method. The effect of pH, temperature and time on the formation of zirconium complexes with sulfochlorphenol S was investigated. A comparison of the above method of determining fluorides with other methods (using alizarinecomplexonate, quinalizarincomplexonate, cerium chelates, lanthanum, arsenazo 3) is presented. The sensitivity of determining fluorides with arsenazo 3 is lower than that with sulfochlorphenol S. The molar absorption coefficient is 3x10 4 , the reaction of determining fluorides with the aid of sulfochlorphenol S is highly selective. The method was used to determine fluorides in the supply water, zirconium solutions and electrolyzer cell. The range of concentration determination for fluorides is 0-3 μg/25 ml

  3. Effect of fluoride pretreatment on the solubility of synthetic carbonated apatite. (United States)

    Barry, A B; Zhuang, H; Baig, A A; Higuchi, W I


    The purpose of this research was to address the following question: How is the solubility of fluoride-pretreated carbonated apatite (CAP) in aqueous acidic media related to the equilibrium solution fluoride and/or the CAP adsorbed fluoride levels? A CAP sample prepared by a precipitation method at 70 degrees C containing approximately 6% carbonate was fluoride-treated (F adsorption from neutral aqueous solutions) to yield a approximately 1000 ppm F CAP and a approximately 3300 ppm F CAP. Metastable equilibrium solubility distributions were determined in acetate buffers at pH 5.0. Solution fluoride, calcium, phosphate, and pH were determined from the equilibrated solutions. The equilibrium solution fluoride levels were extremely low, e.g., as low as approximately 0.10 ppb to approximately 0.30 ppb at 50% dissolved for the two CAP preparations. The approximately 3300 ppm F CAP yielded a lower solubility than the approximately 1000 ppm F CAP (shift in the mean pKHAP value of 1.5-2 units). This can be attributed to the lower solution F(-) for the sample containing approximately 1000 ppm fluoride compared with the approximately 3300 ppm fluoride-containing CAP. These important findings suggest that a fluoride treatment simply may provide an adsorption fluoride depot for subsequent release, providing a solution fluoride effect upon the CAP solubility and not necessarily any intrinsic alteration of the mineral solubility.

  4. Fluoride loaded polymeric nanoparticles for dental delivery. (United States)

    Nguyen, Sanko; Escudero, Carlos; Sediqi, Nadia; Smistad, Gro; Hiorth, Marianne


    The overall aim of the present paper was to develop fluoride loaded nanoparticles based on the biopolymers chitosan, pectin, and alginate, for use in dental delivery. First, the preparation of nanoparticles in the presence of sodium fluoride (NaF) as the active ingredient by ionic gelation was investigated followed by an evaluation of their drug entrapment and release properties. Chitosan formed stable, spherical, and monodisperse nanoparticles in the presence of NaF and tripolyphoshate as the crosslinker, whereas alginate and pectin were not able to form any definite nanostructures in similar conditions. The fluoride loading capacity was found to be 33-113ppm, and the entrapment efficiency 3.6-6.2% for chitosan nanoparticles prepared in 0.2-0.4% (w/w) NaF, respectively. A steady increase in the fluoride release was observed for chitosan nanoparticles prepared in 0.2% NaF both in pH5 and 7 until it reached a maximum at time point 4h and maintained at this level for at least 24h. Similar profiles were observed for formulations prepared in 0.4% NaF; however the fluoride was released at a higher level at pH5. The low concentration, but continuous delivery of fluoride from the chitosan nanoparticles, with possible expedited release in acidic environment, makes these formulations highly promising as dental delivery systems in the protection against caries development. Copyright © 2017 Elsevier B.V. All rights reserved.

  5. Fluoride Concentration of Drinking-Water of Qom, Iran

    Directory of Open Access Journals (Sweden)

    Ahmad Reza Yari


    Full Text Available Background and Purpose: Fluoride is a natural element essential for human nutrition due to its benefits for dental enamel. It is well-documented that standard amounts of fluoride in drinkingwater can decrease the rate of dental caries. This study was conducted with the aim of measuring fluoride concentration of drinking-water supplies and urban distribution system in Qom, Iran. Materials and Methods: Results were subsequently compared against national and international standards. All sources of drinking-water of rural and urban areas were examined. To measure fluoride, the standard SPADNS method and a DR/4000s spectrophotometer were used. Results: Results showed that the mean of fluoride concentration in rural areas, mainly supplied with groundwater sources, was 0.41 mg/L, that of the urban distribution system 0.82 mg/L, that of Ali-Abad station 0.11 mg/L, and that of the private water desalination system 0.24 mg/L. Due to the hot climate of Qom, fluoride concentration means of all sources were lower than the permissible standards set by Iranian Standards and the WHO guidelines (except those of some of the groundwater sources and urban distribution systems. Conclusion: It seems that in most of the drinking-water sources the average fluoride concentration is not enough to prevent dental caries or strengthen dental enamel. It is concluded that Qom’s drinkingwater would require at least 0.4 mg/L to reach the minimum desirable standard.

  6. Removal of fluoride from aqueous nitric acid

    International Nuclear Information System (INIS)

    Pruett, D.J.; Howerton, W.B.; Mailen, J.C.


    Several methods for removing fluoride from aqueous nitric acid were investigated and compared with the frequently used aluminum nitrate-calcium nitrate (Ca 2+ -Al 3+ ) chemical trap-distillation system. Zirconium oxynitrate solutions were found to be superior in preventing volatilization of fluoride during distillation of the nitric acid, producing decontamination factors (DFs) on the order of 2 x 10 3 (vs approx. 500 for the Ca 2+ -Al 3+ system). Several other metal nitrate systems were tested, but they were less effective. Alumina and zirconia columns proved highly effective in removing HF from HF-HNO 3 vapors distilled through the columns; fluoride DFs on the order of 10 6 and 10 4 , respectively, were obtained. A silica gel column was very effective in adsorbing HF from HF-HNO 3 solutions, producing a fluoride DF of approx. 10 4

  7. Monitoring of fluoride in water samples using a smartphone

    International Nuclear Information System (INIS)

    Levin, Saurabh; Krishnan, Sunderrajan; Rajkumar, Samuel; Halery, Nischal; Balkunde, Pradeep


    In several parts of India, groundwater is the only reliable, year round source for drinking water. Prevention of fluorosis, a chronic disease resulting from excess intake of fluoride, requires the screening of all groundwater sources for fluoride in endemic areas. In this paper, the authors present a field deployable colorimetric analyzer based on an inexpensive smartphone embedded with digital camera for taking photograph of the colored solution as well as an easy-fit, and compact sample chamber (Akvo Caddisfly). Phones marketed by different smartphone makers were used. Commercially available zirconium xylenol orange reagent was used for determining fluoride concentration. A software program was developed to use with the phone for recording and analyzing the RGB color of the picture. Linear range for fluoride estimation was 0–2 mg l"−"1. Around 200 samples, which consisted of laboratory prepared as well as field samples collected from different locations in Karnataka, India, were tested with Akvo Caddisfly. The results showed a significant positive correlation between Ion Selective Electrode (ISE) method and Akvo Caddisfly (Phones A, B and C), with correlation coefficient ranging between 0.9952 and 1.000. In addition, there was no significant difference in the mean fluoride content values between ISE and Phone B and C except for Phone A. Thus the smartphone method is economical and suited for groundwater fluoride analysis in the field. - Highlights: • Fluoride is an inorganic pollutant in ground water, affecting human health. • A colorimetric method for measurement of fluoride in drinking water with smartphone • Measurement is by mixing water with zirconyl xylenol orange complex reagent. • Results are comparable with laboratory-based ion selective fluoride electrode method.

  8. Monitoring of fluoride in water samples using a smartphone

    Energy Technology Data Exchange (ETDEWEB)

    Levin, Saurabh [Akvo Foundation (Netherlands); Krishnan, Sunderrajan [INREM Foundation (India); Rajkumar, Samuel; Halery, Nischal; Balkunde, Pradeep [Akvo Foundation (Netherlands)


    In several parts of India, groundwater is the only reliable, year round source for drinking water. Prevention of fluorosis, a chronic disease resulting from excess intake of fluoride, requires the screening of all groundwater sources for fluoride in endemic areas. In this paper, the authors present a field deployable colorimetric analyzer based on an inexpensive smartphone embedded with digital camera for taking photograph of the colored solution as well as an easy-fit, and compact sample chamber (Akvo Caddisfly). Phones marketed by different smartphone makers were used. Commercially available zirconium xylenol orange reagent was used for determining fluoride concentration. A software program was developed to use with the phone for recording and analyzing the RGB color of the picture. Linear range for fluoride estimation was 0–2 mg l{sup −1}. Around 200 samples, which consisted of laboratory prepared as well as field samples collected from different locations in Karnataka, India, were tested with Akvo Caddisfly. The results showed a significant positive correlation between Ion Selective Electrode (ISE) method and Akvo Caddisfly (Phones A, B and C), with correlation coefficient ranging between 0.9952 and 1.000. In addition, there was no significant difference in the mean fluoride content values between ISE and Phone B and C except for Phone A. Thus the smartphone method is economical and suited for groundwater fluoride analysis in the field. - Highlights: • Fluoride is an inorganic pollutant in ground water, affecting human health. • A colorimetric method for measurement of fluoride in drinking water with smartphone • Measurement is by mixing water with zirconyl xylenol orange complex reagent. • Results are comparable with laboratory-based ion selective fluoride electrode method.

  9. Streptozotocin Aggravated Osteopathology and Insulin Induced Osteogenesis Through Co-treatment with Fluoride. (United States)

    Yang, Chen; Zhang, Mengmeng; Li, Yagang; Wang, Yan; Mao, Weixian; Gao, Yuan; Xu, Hui


    The role of insulin in the mechanism underlying the excessive fluoride that causes skeletal lesion was studied. The in vitro bone marrow stem cells (BMSC) collected from Kunming mice were exposed to varying concentrations of fluoride with or without insulin. The cell viability and early differentiation of BMSC co-treated with fluoride and insulin were measured by using cell counting kit-8 and Gomori modified calcium-cobalt method, respectively. We further investigated the in vivo effects of varying dose of fluoride on rats co-treated with streptozotocin (STZ). Wistar rats were divided into six groups which included normal control, 10 mg fluoride/kg day group, 20 mg fluoride/kg day group, STZ control, STZ+10 mg fluoride/kg day group, and STZ+20 mg fluoride/kg day group. The rats were administered with sodium fluoride (NaF) by gavage with water at doses 10 and 20 mg fluoride/kg day for 2 months. In a period of one month, half of rats in every group were treated with streptozotocin (STZ) once through intraperitoneal injection at 52 mg/kg body weight. The serum glucose, HbA1c, and insulin were determined. Bone mineral content and insulin release were assessed. The results showed insulin combined with fluoride stimulated BMSC cell viability in vitro. The bone mineral content reduced in rats treated with higher dose of fluoride and decreased immensely in rat co-treated with fluoride and STZ. Similarly, a combination treatment of a high dose of fluoride and STZ decreased insulin sensitivity and activity. To sum up, these data indicated fluoride influenced insulin release, activity, and sensitivity. Furthermore, the insulin state in vivo interfered in the osteogenesis in turn and implied there was a close relation between insulin and bone pathogenesis in the mechanism of fluoride toxicity.

  10. Fluorides in groundwater and its impact on health. (United States)

    Shailaja, K; Johnson, Mary Esther Cynthia


    Fluoride is a naturally occurring toxic mineral present in drinking water and causes yellowing of teeth, tooth problems etc. Fluorspar, Cryolite and Fluorapatite are the naturally occurring minerals, from which fluoride finds its path to groundwater through infiltration. In the present study two groundwater samples, Station I and Station II at Hyderabad megacity, the capital of Andhra Pradesh were investigated for one year from January 2001 to December 2001. The average fluoride values were 1.37 mg/l at Station I and 0.91 mg/l at Station II. The permissible limit given by BIS (1983) 0.6-1.2 mg/l and WHO (1984) 1.5 mg/l for fluoride in drinking water. The groundwaters at Station I exceeded the limit while at Station II it was within the limits. The study indicated that fluoride content of 0.5 mg/l is sufficient to cause yellowing of teeth and dental problems.

  11. A health risk assessment for fluoride in Central Europe. (United States)

    Fordyce, F M; Vrana, K; Zhovinsky, E; Povoroznuk, V; Toth, G; Hope, B C; Iljinsky, U; Baker, J


    Like many elements, fluorine (which generally occurs in nature as fluoride) is beneficial to human health in trace amounts, but can be toxic in excess. The links between low intakes of fluoride and dental protection are well known; however, fluoride is a powerful calcium-seeking element and can interfere with the calcified structure of bones and teeth in the human body at higher concentrations causing dental or skeletal fluorosis. One of the main exposure routes is via drinking water and the World Health Organisation currently sets water quality guidelines for the element. In Central Europe, groundwater resources that exceed the guideline value of 1.5 mg l-1 are widespread and effects on health of high fluoride in water have been reported. The aim of the current project was to develop a geographic information system (GIS) to aid the identification of areas where high-fluoride waters and fluorosis may be a problem; hence, where water treatment technologies should be targeted. The development of the GIS was based upon the collation and digitisation of existing information relevant to fluoride risk in Ukraine, Moldova, Hungary and Slovakia assembled for the first time in a readily accessible form. In addition, geochemistry and health studies to examine in more detail the relationships between high-fluoride drinking waters and health effects in the population were carried out in Moldova and Ukraine demonstrating dental fluorosis prevalence rates of 60-90% in adolescents consuming water containing 2-7 mg l-1 fluoride.

  12. Occurrence of fluoride in ground waters of Saudi Arabia (United States)

    Alabdulaaly, Abdulrahman I.; Al-Zarah, Abdullah I.; Khan, Mujahid A.


    The presence of elevated levels of fluoride in groundwater is considered a global problem. Fluoride in water derives mainly from dissolution of natural minerals in the rocks and soils with which water interacts. The most common fluorine-bearing minerals are fluorite, apatite and micas. Anthropogenic sources of fluoride include agricultural fertilizers and combustion of coal. In the present research, a survey of wells ( n = 1,060) was undertaken in all the 13 regions of the Kingdom of Saudi Arabia to assess the contained fluoride (F) levels. The results indicated variation in fluoride levels from 0.10 to 5.4 mg/L as F throughout the kingdom. The average fluoride levels in milligrams per liter as F were as follows in descending order: 1.80 (Hadwood Shamalyah), 1.37 (Hail), 1.33 (Eastern Province), 1.16 (Al Jouf), 1.11 (Qassim), 1.01 (Riyadh), 0.90 (Madina Al Munnawara), 0.81 (Tabouk), 0.74 (Makkah Al- Mukaramma), 0.73 (Jizan), 0.66 (Asir), 0.64 (Najran), and 0.60 (Al Baha). The results indicated that fluoride levels exceeded the USEPA maximum contaminant limits for drinking water (4 mg/L) in several wells ( n = 7) in different regions of the kingdom and that 13.96 % of the wells exceeded the World Health Organization recommended levels (1.5 mg/L). The results were also compared with the secondary USEPA contaminant standards of 2.0 mg/L for fluorides.

  13. Biochemical studies on the effect of fluoride on higher plants. II. The effect of fluoride on sucrose-synthesizing enzymes from higher plants

    Energy Technology Data Exchange (ETDEWEB)

    Yang, S F; Miller, G W


    A study was initiated to characterize the properties of partially purified phosphoglucomutase, uridine diphosphate glucose pyrophosphorylase and uridine diphosphate glucose-fructose transglucosyalse, from various plant sources, with respect to activation by metal ions and inhibition by fluoride. Of the three enzymes studied, only phosphoglucomutase was very sensitive to fluoride. It is likely that the inhibition of sucrose synthesis in fluoride-fumigated plants might be due to the inhibition of phosphoglucomutase, which plays an important role in carbohydrate metabolism. However, at present, there is insufficient evidence to show the inhibition of phosphoglucomutase in vivo by fumigation with hydrogen fluoride.

  14. Fluoride removal from aqueous solution by pumice: case study on ...

    African Journals Online (AJOL)


    conditions, the fluoride removal efficiency from Kuhbonan water by 2.8 mg/L fluoride was 74.64%. Eventually ... industrial wastewater containing fluoride is a key ..... solution using silica ceramic: Adsorption kinetics and equilibrium studies.

  15. Controlling the fluoride dosage in a patient with compromised salivary function. (United States)

    Eichmiller, Frederick C; Eidelman, Naomi; Carey, Clifton M


    High-concentration topical fluorides are used commonly to with compromised salivary function due to irradiation and chemotherapy. The authors describe a 50-year-old man with previously treated cancer who was using tray-applied topical fluoride gel. He complained of gastric symptoms, difficulty in swallowing, leg muscle soreness and knee joint soreness. A computed tomographic scan revealed thickening of the esophageal walls. An upper endoscopy revealed abnormal motility. The motility test indicated high-amplitude peristalsis and hypertensive lower esophageal sphincter, and urine testing indicated high levels of systemic fluoride. The patient's fluoride regimen was altered, and within a short period his urinary fluoride levels returned to normal and his symptoms resolved. Clinicians prescribing home-applied high-concentration fluorides need to be cognizant of the symptoms of fluoride toxicity, carefully monitor the patient's compliance with the treatment regimen, and adjust the dosage or mode of application to control the total ingested dose of fluoride.

  16. Chronic Fluoride Toxicity: Dental Fluorosis


    DenBesten, Pamela; Li, Wu


    Dental fluorosis occurs as a result of excess fluoride ingestion during tooth formation. Enamel fluorosis and primary dentin fluorosis can only occur when teeth are forming, and therefore fluoride exposure (as it relates to dental fluorosis) occurs during childhood. In the permanent dentition, this would begin with the lower incisors, which complete mineralization at approximately 2–3 years of age, and end after mineralization of the third molars. The white opaque appearance of fluorosed enam...

  17. Fluoride content and labelling of toothpastes marketed in India. (United States)

    Thakkar, V P; Rao, A; Rajesh, G; Shenoy, R; Pai, M


    To enumerate the fluoride content and labelling practices of toothpastes marketed in India and to determine if the content is in accordance with the information provided on the packaging. In vitro analysis of total and free available fluoride in 5 adult and 5 children's fluoride toothpastes in India using fluoride ion electrode. Information on the tube and carton was checked to assess the labelling. The mean Total Fluoride concentrations (TF) in the toothpastes labelled 1,000 ppm, 500ppm and 458 ppm were 1,000, 500 and 449mg/L (sd values 3, 5 and 4mg/L) respectively. The toothpastes' Total Soluble Fluoride (TSF) concentration was generally slightly less than the TF concentration. Overall mean percentage of TSF concentration was 94% sd 9%. The mean percentage of TSF concentration in SMFP (sodium monofluorophosphate)/CaCO3 (calcium carbonate) containing toothpastes was 86% sd 16% while that in NaF (sodium fluoride)/Si (silica) based toothpastes was 98% sd 1% and 95% sd 1% in the remaining toothpastes with unknown abrasive. NaF/Si based toothpastes had more TSF concentration than the others (plabelled following the guidelines of the regulatory body of India, 3 of the 10 failed to mention the abrasive present.

  18. Photosynthesis of ammonium uranous fluoride

    International Nuclear Information System (INIS)

    El-Fekey, S.A.; Zaki, M.R.; Farah, M.Y.


    This study pertains to utilisation of solar energy for ethanol photosynthesis of ammonium uranous fluoride, that satisfies nuclear specifications needed for calcio- or magnesiothermy. Insolation in autumn using 4-10% ethanol in 5-20 g uranium/litre at initial pH 3.25 gave practically 99.8% yield in two hours, independant of 1.0 to 2.0 stoichiometric NH 4 F. With ultraviolet light, the yield varied between 30 and 60%, even after four hours irradiation. Stirring and heating to 60 0 C raised the tap density of the dried double fluorides from 1.48 at 30 0 C, to 1.85 g/cm 3 at 60 0 C. The texture increased also in fineness to 100% 50μ aggregates. The powders satisfy nuclear purity specifications. Thermograms indicated preferential decomposition of double fluoride at 375 0 C in controlled atmosphere to obtain nuclear pure anhydrous uranium tetrafluoride

  19. Effect of exercise on fluoride metabolism in adult humans: a pilot study. (United States)

    V Zohoori, Fatemeh; Innerd, Alison; Azevedo, Liane B; Whitford, Gary M; Maguire, Anne


    An understanding of all aspects of fluoride metabolism is critical to identify its biological effects and avoid fluoride toxicity in humans. Fluoride metabolism and subsequently its body retention may be affected by physiological responses to acute exercise. This pilot study investigated the effect of exercise on plasma fluoride concentration, urinary fluoride excretion and fluoride renal clearance following no exercise and three exercise intensity conditions in nine healthy adults after taking a 1-mg Fluoride tablet. After no, light, moderate and vigorous exercise, respectively, the mean (SD) baseline-adjusted i) plasma fluoride concentration was 9.6(6.3), 11.4(6.3), 15.6(7.7) and 14.9(10.0) ng/ml; ii) rate of urinary fluoride excretion over 0-8 h was 46(15), 44(22), 34(17) and 36(17) μg/h; and iii) rate of fluoride renal clearance was 26.5(9.0), 27.2(30.4), 13.1(20.4) and 18.3(34.9) ml/min. The observed trend of a rise in plasma fluoride concentration and decline in rate of fluoride renal clearance with increasing exercise intensity needs to be investigated in a larger trial. This study, which provides the first data on the effect of exercise with different intensities on fluoride metabolism in humans, informs sample size planning for any subsequent definitive trial, by providing a robust estimate of the variability of the effect.

  20. Combinatorial effects of aromatic 1,3 – disubstituted ureas and fluoride on in vitro inhibition of Streptococcus mutans biofilm formation

    Directory of Open Access Journals (Sweden)

    Gurmeet eKaur


    Full Text Available Dental caries occurs as a result of disequilibrium between acid producing pathogenic bacteria and alkali generating commensal bacteria within a dental biofilm (dental plaque. S. mutans has been reported as a primary cariogenic pathogen associated with dental caries. Emergence of multidrug resistant as well as fluoride resistant strains of Streptococcus mutans due to over usage of various antibiotics is a rising problem and prompted the researchers worldwide to search for alternative therapies. In this perspective, the present study was aimed to screen selective inhibitors against ComA, a bacteriocin associated ABC transporter, involved in the quorum sensing of S. mutans. In light of our previous in silico findings, 1,3- disubstituted urea derivatives which had better affinity to ComA were chemically synthesized in the present study for in vitro evaluation of S. mutans biofilm inhibition. The results revealed that 1,3- disubstituted urea derivatives showed good biofilm inhibition. In addition, the synthesized compounds exhibited potent synergy with a very low concentration of fluoride (31.25 ppm to 62.5 ppm in inhibiting the biofilm formation of S. mutans without affecting the bacterial growth. Further, the results were confirmed by confocal laser scanning microscopy. On the whole, from our experimental results we conclude that the combinatorial application of fluoride and disubstituted ureas has a potential synergistic effect which has a promising approach in combating multidrug resistant and fluoride resistant S. mutans in dental caries management.

  1. An In-Vitro Study on the Release of Fluoride from Two Restorative Materials and Their Rechargeability after Exposure to Daily 1000 ppm Fluoride

    Directory of Open Access Journals (Sweden)

    A. Kowsari


    Full Text Available Statement of Problem: Since the fluoride releases from materials with the property of releasing fluoride are decreasing gradually, it seems that probably the material rechargeability is more important than their long-term fluoride release.Purpose: the objective of this study was to asses the fluoride release and rechargeability of 2 types of fluoride releasing restorative materials, a resin modified glass ionomer(Vitremer and a compomer (Compoglass F, after exposure to daily NaF solutionscontaining 1000 ppm F, for 1 minute.Materials and Methods: Twelve discs ( 8 mm ×2 mm of each of the materials were fabricated, and divided into 2 groups (test and control. All discs were stored in 4 mL artificial saliva at 37°C. In group 1 (N=6, the specimens were immersed in artificialsaliva which was changed daily for 25 days. In group 2 (N=6, in addition to receiving the same treatment as group 1, the specimens were immersed in NaF solution (1000ppm F, ph=6.9 for 1 minute before daily saliva change. A potentiometer was used to determine the amount of fluoride released on days 1, 2, 3, 5, 10, 15, 20 and 25, after the daily saliva change, in all study groups. Data were analyzed by the t-student test after confirmation of the equality of variances by Leven’s test.Results: Both materials continued releasing fluoride throughout the whole study period. For each material, the release was highest on day one. During the first 3 days,glass ionomer released significantly higher amounts of fluoride as compared to compomer (p0.05. After exposure to NaF solution, none of the materials showed statistically significant rechargeability (p>0.05 and the amount of fluoride-releasecontinued to drop during the study period in similar patterns for both the test and the control groups.Conclusion: It may be concluded that rechargeability of glass ionomer and compomer,using daily neutral fluoride mouth rinses and toothpastes does not occur in reliable amounts.

  2. A Comparison of Fluoride Uptake by Sound Enamel Following Application of Sodium Fluoride Mouthrinses and APF Gels Produced in Iran with Standardized Foreign Samples

    Directory of Open Access Journals (Sweden)

    A Kowsari


    Full Text Available The goal of this investigation is to compare the extent of fluoride uptake by sound enamel following application of two commercial mouthrinses containing sodium fluoride (0.2% and a topical gel containing APF (1.23% produced in Iran with those of foreign standardized ones. Sixty extracted premolars were used. Each tooth was divided into two lingual and buccal halves, one half as control, the other one as experimental. Enamel biopsy technique (two- step acid etching was used to determine the concentration of fluoride and calcium in each sample. For data comparison and fluoride uptake estimation, the depths of layers with the use of linear regression analysis were standardized to 25 and 50um. The analysis showed that in Iranian mouthrinse no. 1, there is linear correlation between fluoride concentration and enamel depth, in both control and experimental group at the first and second layers, while, in other groups, this correlation was observed just at the first layer (superficial enamel layer. The greatest fluoride uptake was seen at Iranian mouthrinse no.2 and the least was seen at foreign mouthrinse no. 3. From among two APF gels, the greatest uptake was observed at gel no. 1 (Iranian. The results showed that all three Iranian products increase fluoride content of enamel, moreover the level of fluoride uptake, while applying Iranian products, in comparison with foreign ones, shows considerable increase.

  3. Fluoride removal from diluted solutions by Donnan dialysis using full factorial design

    Energy Technology Data Exchange (ETDEWEB)

    Boubakri, Ali; Helali, Nawel; Tlili, Mohamed; Amor, Mohamed Ben [Center of Researches and Water Technologies, Soliman (Turkey)


    Excessive fluoride concentration in potable water can lead to fluorosis of teeth and bones. In the present study, Donnan dialysis (DD) is applied for the removal of fluoride ions from diluted sodium fluoride solutions. A four factor two level (2{sup 4}) full factorial design was used to investigate the influence of different physico-chemical parameters on fluoride removal efficiency (Y{sub F}) and fluoride flux (J{sub F}) through anion exchange membrane. The statistical design determines factors which have the important effects on Donnan dialysis performance and studies all interactions among the considered parameters. The four significant factors were initial fluoride concentration, feed flow rate, temperature and agitation speed. The experimental results and statistical analysis show that the temperature and agitation speed have positive effects on fluoride removal efficiency and the initial fluoride concentration has a negative effect. In the case of fluoride flux, feed flow rate and initial concentration are the main effect and all factors have a positive effect. The interaction between studied parameters was not negligible on two responses. A maximum fluoride removal of 75.52% was obtained under optimum conditions and the highest value of fluoride flux obtained was 2.4 mg/cm{sup 2}·h. Empirical regression models were also obtained and used to predict the flux and the fluoride removal profiles with satisfactory results.

  4. Performance of novel hydroxyapatite nanowires in treatment of fluoride contaminated water. (United States)

    He, Junyong; Zhang, Kaisheng; Wu, Shibiao; Cai, Xingguo; Chen, Kai; Li, Yulian; Sun, Bai; Jia, Yong; Meng, Fanli; Jin, Zhen; Kong, Lingtao; Liu, Jinhuai


    Novel ultralong hydroxyapatite (HAP) nanowires were successfully prepared for fluoride removal for the first time. The fluoride adsorption on the HAP nanowires was studied on a batch mode. The results revealed that the adsorption data could be well described by the Freundlich model, and the adsorption kinetic followed the pseudo-second-order model. The maximum of adsorption capacity was 40.65 mg/g at pH 7.0 when the fluoride concentration is 200mg/L. The thermodynamic parameters suggested that the adsorption of fluoride was a spontaneous endothermic process. The FT-IR, XPS and Zeta potential analysis revealed that both anion exchange and electrostatic interactions were involved in the adsorption of fluoride. Furthermore, the HAP nanowires were made into HAP membrane through a simple process of suction filtration. Membrane filtration experiments revealed that the fluoride removal capabilities depended on the membrane thickness, flow rate and initial concentration of fluoride. The as-prepared membrane could remove fluoride efficiently through continues filtration. The filtered water amount could reach 350, 192, and 64 L/m(2) when the fluoride concentrations were 4, 5 and 8 ppm, respectively, using the HAP membrane with only 150 μm thickness. The as-synthesized ultralong HAP nanowires were thus demonstrated to be very effective and biocompatible adsorbents for fluoride removal from contaminated water. Copyright © 2015 Elsevier B.V. All rights reserved.

  5. Solvents effects on electrochemical characteristics of graphite fluoride-lithium batteries

    Energy Technology Data Exchange (ETDEWEB)

    Nobuatsu, W.; Hidekazu, T.; Rika, H.; Tsuyoshi, N.


    A study was made of the electrochemical characteristics of graphite fluoride-lithium batteries in various non-aqueous solvents. Two types of graphite fluorides (C/sub 2/F) /SUB n/ and (CF) /SUB n/ were used as cathode materials. The discharge characteristics of graphite fluorides were better in dimethylsulfoxide, ..gamma..-butyrolactone, propylene carbonate and sulfolane in that order. The relation between electrod potential of graphite fluoride and solvation energy of lithium ion with each solvent indicates that solvated lithium ion is intercalated into graphite fluoride layers by the electrode reaction. Both the difference in the overpotentials and in the rates of OCV recovery among these solvents further supports the proposed reaction mechanism.

  6. Mie scattering in heavy-metal fluoride glasses

    International Nuclear Information System (INIS)

    Edgar, A.


    Heavy-metal fluoride glasses comprise mixtures of heavy-cation fluorides such as those of zirconium, barium, and lanthanum together with some stabilising fluorides such as AlF 3 . For particular relative proportions, the mixtures form a glass rather than a polycrystalline material when quenched from the melt. The particularly useful features of these glasses are the wide spectral region (∼200nm-8000nm) over which they are transparent, the low minimum attenuation at the centre of the spectral window, and the ease with which optically-active rare-earth ions can be incorporated, leading to potential applications in passive and active fibre optics. The minimal attenuation, which is potentially lower than for silica fibre, is generally limited by wavelength-independent scattering by particle and gas bubble inclusions. We have observed a new wavelength-dependent scattering effect in fluoride glass of the well-known composition ZLABN20. In this paper, we report on work in progress on the optical extinction and scattering spectrum of the fluoride glasses, and discuss the spectra in terms of Mie's scattering theory. The chemical nature of the scattering centres in these nominally 'pure' glasses is at present a puzzle, and relative merits of various possible models will be compared

  7. Fluoride levels in commercially available rice in Ethiopia | Tegegne ...

    African Journals Online (AJOL)

    Alkaline fusion was used for sample preparation of six varieties for both the raw rice and rice cooked with tap water and fluoridated water. Fluoride levels ranged from 0.1-5.5 mg/kg in raw rice sample. Rice which was cooked with different fluoride levels of water showed increment depending on the method of cooking.

  8. Effect of fluoride addition on the properties of dental alginate impression materials. (United States)

    Lee, Yong-Keun; Lim, Bum-Soon; Kim, Cheol-We


    Fluoride-containing dental alginate impression materials can exert a considerable reduction in enamel solubility. The objective was to evaluate the effects of fluoride addition in the alginate impression materials on the properties and subsequent release of fluoride. Four experimental alginate impression materials were studied. Materials were mixed with distilled water (control) or 100-ppm fluoride solution. One or two percent NaF, or 1% SnF2 was added to the materials, which were mixed with distilled water. Fluoride release, flexibility, recovery from deformation, setting time, compressive strength and elastic modulus were determined in accordance with the ISO 1563 and ANSI/ADA Spec. 18. Fluoride release increased after addition of fluoride, and the released amount was 0.762-14.761 ppm. Addition of NaF or SnF2 resulted in higher fluoride release than the control group (p alginate impression material may result in effective release of fluoride without deteriorating the properties of material itself.

  9. Sirtuin1 and autophagy protect cells from fluoride-induced cell stress (United States)

    Suzuki, Maiko; Bartlett, John D.


    Sirtuin1 (SIRT1) is an (NAD+)-dependent deacetylase functioning in the regulation of metabolism, cell survival and organismal lifespan. Active SIRT1 regulates autophagy during cell stress, including calorie restriction, endoplasmic reticulum stress and oxidative stress. Previously, we reported that fluoride induces endoplasmic reticulum (ER) stress in ameloblasts responsible for enamel formation, suggesting that ER-stress plays a role in dental fluorosis. However, the molecular mechanism of how cells respond to fluoride-induced cell stress is unclear. Here, we demonstrate that fluoride activates SIRT1 and initiates autophagy to protect cells from fluoride exposure. Fluoride treatment of ameloblast-derived cells (LS8) significantly increased Sirt1 expression and induced SIRT1 phosphorylation resulting in the augmentation of SIRT1 deacetylase activity. To demonstrate that fluoride exposure initiates autophagy, we characterized the expression of autophagy related genes (Atg); Atg5, Atg7 and Atg8/LC3 and showed that both their transcript and protein levels were significantly increased following fluoride treatment. To confirm that SIRT1 plays a protective role in fluoride toxicity, we used resveratrol (RES) to augmented SIRT1 activity in fluoride treated LS8 cells. RES increased autophagy, inhibited apoptosis, and decreased fluoride cytotoxicity. Rats treated with fluoride (0, 50 and 100 ppm) in drinking water for 6 weeks had significantly elevated expression levels of Sirt1, Atg5, Atg7 and Atg8/LC3 in their maturation stage enamel organs. Increased protein levels of p-SIRT1, ATG5 and ATG8/LC3 were present in fluoride-treated rat maturation stage ameloblasts. Therefore, the SIRT1/autophagy pathway may play a critical role as a protective response to help prevent dental fluorosis. PMID:24296261

  10. Sirtuin1 and autophagy protect cells from fluoride-induced cell stress. (United States)

    Suzuki, Maiko; Bartlett, John D


    Sirtuin1 (SIRT1) is a nicotinamide adenine dinucleotide (NAD(+))-dependent deacetylase functioning in the regulation of metabolism, cell survival and organismal lifespan. Active SIRT1 regulates autophagy during cell stress, including calorie restriction, endoplasmic reticulum (ER) stress and oxidative stress. Previously, we reported that fluoride induces ER-stress in ameloblasts responsible for enamel formation, suggesting that ER-stress plays a role in dental fluorosis. However, the molecular mechanism of how cells respond to fluoride-induced cell stress is unclear. Here, we demonstrate that fluoride activates SIRT1 and initiates autophagy to protect cells from fluoride exposure. Fluoride treatment of ameloblast-derived cells (LS8) significantly increased Sirt1 expression and induced SIRT1 phosphorylation resulting in the augmentation of SIRT1 deacetylase activity. To demonstrate that fluoride exposure initiates autophagy, we characterized the expression of autophagy related genes (Atg); Atg5, Atg7 and Atg8/LC3 and showed that both their transcript and protein levels were significantly increased following fluoride treatment. To confirm that SIRT1 plays a protective role in fluoride toxicity, we used resveratrol (RES) to augment SIRT1 activity in fluoride treated LS8 cells. RES increased autophagy, inhibited apoptosis, and decreased fluoride cytotoxicity. Rats treated with fluoride (0, 50, 100 and 125ppm) in drinking water for 6weeks had significantly elevated expression levels of Sirt1, Atg5, Atg7 and Atg8/LC3 in their maturation stage enamel organs. Increased protein levels of p-SIRT1, ATG5 and ATG8/LC3 were present in fluoride-treated rat maturation stage ameloblasts. Therefore, the SIRT1/autophagy pathway may play a critical role as a protective response to help prevent dental fluorosis. Copyright © 2013 Elsevier B.V. All rights reserved.

  11. Correlation among fluoride and metals in irrigation water and soils of ...

    African Journals Online (AJOL)

    Correlation among fluoride and metals in irrigation water and soils of Ethiopian Rift Valley. ... The fluoride concentrations in water samples were found in the range of 0.14-8.0 mg/L which is below the WHO limit of fluoride concentration for irrigation (less than 10 mg/L). ... KEY WORDS: Fluoride, Metals, Water, Soil, Ethiopia.

  12. Diffusion of fluoride in bovine enamel

    International Nuclear Information System (INIS)

    Flim, G.J.; Arends, J.; Kolar, Z.


    The uptake of 18 F and the penetration of both F and 18 F in bovine enamel was investigated. Sodium fluoride solutions buffered at pH 7 were employed. The uptake of 18 F was measured by a method described by R. Duckworth and M. Braden, Archs. Oral. Biol., 12(1967), pp. 217-230. The penetration concentration profiles of fluoride (F, 18 F) in the enamel were measured by a sectioning technique. The 18 F uptake in enamel was proportional to approximately tsup(3/4); t being the uptake time. The 18 F concentration as a function of the position in the enamel can be described by: c*(x,t) = c 0 *(t)exp[-α*(t)x]. After correction for the initial fluoride concentration in enamel, for unlabelled fluoride the same dependency is obtained. A model based on simultaneous diffusion and chemical reaction in the pores and diffusion into the hydroxyapatite crystallites will be presented. The results show that diffusion coefficients of the pores are approximately equal to 10 -10 cm 2 s -1 and in the apatite crystallites approximately equal to 10 -17 cm 2 s -1 . The limitations and the approximations of the model are discussed

  13. Chemico-therapeutic approach to prevention of dental caries. [using stannous fluoride gel (United States)

    Shannon, I. L.


    The program of chemical preventive dentistry is based primarily upon the development of a procedure for stabilizing stannous fluoride in solution by forcing it into glycerin. New topical fluoride treatment concentrates, fluoride containing gels and prophylaxis pastes, as well as a completely stable stannous fluoride dentifrice are made possible by the development of a rather complicated heat application method to force stannous fluoride into solution in glycerin. That the stannous fluoride is clinically effective in such a preparation is demonstrated briefly on orthodontic patients.

  14. Press forging and optical properties of lithium fluoride (United States)

    Ready, J. F.; Vora, H.


    Lithium fluoride is an important candidate material for windows on high power, short-pulse ultraviolet and visible lasers. Lithium fluoride crystals were press forged in one step over the temperature range 300 to 600 C to obtain fine grained polycrystalline material with improved mechanical properties. The deformation that can be given to a lithium fluoride crystal during forging is limited by the formation of internal cloudiness (veiling) with the deformation limit increasing with increasing forging temperature from about 40 percent at 400 C to 65 percent at 600 C. To suppress veiling, lithium fluoride crystals were forged in two steps over the temperature range 300 to 600 C, to total deformations of 69 to 76 percent, with intermediate annealing at 700 C. This technique yields a material which has lower scattering with more homogeneous microstructure than that obtained in one step forging. The results of characterization of various optical and mechanical properties of single crystal and forged lithium fluoride, including scattering, optical homogeneity, residual absorption, damage thresholds, environmental stability, and thresholds for microyield are described.

  15. Press forging and optical properties of lithium fluoride

    International Nuclear Information System (INIS)

    Ready, J.F.; Vora, H.


    Lithium fluoride is an important candidate material for windows on high-power, short-pulse ultraviolet and visible lasers. Lithium fluoride crystals have been press forged in one step over the temperature range 300 to 600 0 c to obtain fine-grained polycrystalline material with improved mechanical properties. The deformation that can be given to a lithium fluoride crystal during forging is limited by the formation of internal cloudiness (veiling) with the deformation limit increasing with increasing forging temperature from about 40% at 400 0 C to 65% at 600 0 C. To suppress veiling, lithium fluoride crystals were forged in two steps over the temperature range 300 to 600 0 C, to total deformations of 69-76%, with intermediate annealing at 700 0 C. This technique yields a material which has lower scattering with more homogeneous microstructure than that obtained in one-step forging. The results of characterization of various optical and mechanical properties of single-crystal and forged lithium fluoride, including scattering, optical homogeneity, residual absorption, damage thresholds, environmental stability, and thresholds for microyield are described

  16. Effects of fluorides on plants

    Energy Technology Data Exchange (ETDEWEB)

    Yamazoe, F


    Fluorine compounds known to be air pollutants, such as hydrogen fluoride and silicon tetrachloride, are highly poisonous to plants even at ppm - ppb levels. As solid microparticles, acidic sodium fluoride and cryolite cause problems by adhering to plant leaves and absorbing into plant bodies. Plants are classified by their susceptibility to hydrogen fluoride: gladiolus, apricot, buckwheat, turnip and Vaccinium vitis-idaea are most susceptible showing slight injury at less than 5 ppb for 7-9 days; maize, pepper, and dahlia are fairly susceptible, followed by azalea, rose, lilac, and alfalfa, then by oak and tomato. Gladiolus is used as an indicator plant. The exposure factor for one species was known. The symptoms of plants exposed to gaseous fluorine compounds are described in detail at various concentrations. The causal mechanism of the injuries due to fluorine compounds is described in detail, with the method of determining the fluorine content of plant parts. 7 references.

  17. SBIR-Long fluoride fiber (United States)

    Jaeger, Raymond E.; Vacha, Lubos J.


    This report summarizes results obtained under a program aimed at developing new techniques for fabricating long lengths of heavy metal fluoride glass (HMFG) optical fiber. A new method for overcladding conventional HMFG preforms with a low melting oxide glass was developed, and improvements in the rotational casting method were made to increase preform length. The resulting composite glass canes consist of a fluoride glass overcoat layer to enhance strength and chemical durability. To show feasibility, prototype optical fiber preforms up to 1.6 cm in diameter with lengths of 22 cm were fabricated. These were drawn into optical fibers with lengths up to 900 meters.


    Medjedovic, Eida; Medjedovic, Senad; Deljo, Dervis; Sukalo, Aziz


    Fluoride is natural element that strengthens teeth and prevents their decay. Experts believe that the best way to prevent cavities is the use of fluoride from multiple sources. Studies even show that in some cases, fluoride can stop already started damage of the teeth. In children younger than 6 years fluoride is incorporated into the enamel of permanent teeth, making the teeth more resistant to the action of bacterial and acids in food. The aim of this study is to determine the effects of improving the health status of teeth after six months treatment with the use of topical fluoridation 0.5% NaF, and the level and quality of the impact of treatment with chemical 0.5% NaF on the dental health of children at age from 8 to 15 years, in relation to gender and chronological age. This study included school children aged 8 to 15 years who visited health and dental services dependent in Mostar. It is obvious that after the implementation of treatment with 5% NaF by the method of topical fluoridation, health status of subjects from the experimental group significantly improved, so that at the final review 89.71% or 61 subjects of the experimental group had healthy (cured teeth), tooth with dental caries only 5.88% or 4 respondents tooth with dental caries and filling 4.41% or 3 respondents, extracted baby tooth 14.71% or 10 respondents, while for 13.24% of respondents was identified state with still unerupted teeth. Our findings are indirectly confirmed that the six-month treatment of fluoridation with 5% NaF, contributed to statistically significant improvement in overall oral health of the experimental group compared to the control group which was not treated by any dental treatment. It can be concluded that there is a statistically significant difference in the evaluated parameters of oral health of children in the control group compared to the studied parameters of oral health the experimental group of children at the final dental examination.

  19. Determination of zirconium by fluoride ion selective electrode

    International Nuclear Information System (INIS)

    Mahanty, B.N.; Sonar, V.R.; Gaikwad, R.; Raul, S.; Das, D.K.; Prakash, A.; Afzal, Md.; Panakkal, J.P.


    Full text: Zirconium is used in a wide range of applications including nuclear clad, catalytic converters, surgical appliances, metallurgical furnaces, superconductors, ceramics, lamp filaments, anti corrosive alloys and photographical purposes. Irradiation testing of U-Zr and U-Pu-Zr fuel pins has also demonstrated their feasibility as fuel in liquid metal reactors. Different methods that are employed for the determination of zirconium are spectrophotometry, potentiometry, neutron activation analysis and mass spectrometry. Ion-selective electrode (ISE), selective to zirconium ion has been studied for the direct potentiometric measurements of zirconium ions in various samples. In the present work, an indirect method has been employed for the determination of zirconium in zirconium nitrate sample using fluoride ion selective electrode. This method is based on the addition of known excess amount of fluoride ion to react with the zirconium ion to produce zirconium tetra fluoride at about pH 2-3, followed by determination of residual fluoride ion selective electrode. The residual fluoride ion concentrations were determined from the electrode potential data using calibration plot. Subsequently, zirconium ion concentrations were determined from the concentration of consumed fluoride ions. A precision of about 2% (RSD) with the mean recovery of more than 94% has been achieved for the determination of zirconium at the concentration of 4.40 X 10 -3 moles lit -1

  20. Fluoride caused thyroid endocrine disruption in male zebrafish (Danio rerio). (United States)

    Jianjie, Chen; Wenjuan, Xue; Jinling, Cao; Jie, Song; Ruhui, Jia; Meiyan, Li


    Excessive fluoride in natural water ecosystem has the potential to detrimentally affect thyroid endocrine system, but little is known of such effects or underlying mechanisms in fish. In the present study, we evaluated the effects of fluoride on growth performance, thyroid histopathology, thyroid hormone levels, and gene expressions in the HPT axis in male zebrafish (Danio rerio) exposed to different determined concentrations of 0.1, 0.9, 2.0 and 4.1 M of fluoride to investigate the effects of fluoride on thyroid endocrine system and the potential toxic mechanisms caused by fluoride. The results indicated that the growth of the male zebrafish used in the experiments was significantly inhibited, the thyroid microtrastructure was changed, and the levels of T3 and T4 were disturbed in fluoride-exposed male fish. In addition, the expressional profiles of genes in HPT axis displayed alteration. The expressions of all studied genes were significantly increased in all fluoride-exposed male fish after exposure for 45 days. The transcriptional levels of corticotrophin-releasing hormone (CRH), thyroid-stimulating hormone (TSH), thyroglobulin (TG), sodium iodide symporter (NIS), iodothyronine I (DIO1), and thyroid hormone receptor alpha (TRα) were also elevated in all fluoride-exposed male fish after 90 days of exposure, while the inconsistent expressions were found in the mRNA of iodothyronineⅡ (DIO2), UDP glucuronosyltransferase 1 family a, b (UGT1ab), transthyretin (TTR), and thyroid hormone receptor beta (TRβ). These results demonstrated that fluoride could notably inhibit the growth of zebrafish, and significantly affect thyroid endocrine system by changing the microtrastructure of thyroid, altering thyroid hormone levels and endocrine-related gene expressions in male zebrafish. All above indicated that fluoride could pose a great threat to thyroid endocrine system, thus detrimentally affected the normal function of thyroid of male zebrafish. Copyright © 2015

  1. Contribution of chloride channel permease to fluoride resistance in Streptococcus mutans. (United States)

    Murata, Takatoshi; Hanada, Nobuhiro


    Genes encoding fluoride transporters have been identified in bacterial and archaeal species. The genome sequence of the cariogenic Streptococcus mutans bacteria suggests the presence of a putative fluoride transporter, which is referred to as a chloride channel permease. Two homologues of this gene (GenBank locus tags SMU_1290c and SMU_1289c) reside in tandem in the genome of S. mutans The aim of this study was to determine whether the chloride channel permeases contribute to fluoride resistance. We constructed SMU_1290c- and SMU_1289c-knockout S. mutans UA159 strains. We also constructed a double-knockout strain lacking both genes. SMU_1290c or SMU_1289c was transformed into a fluoride transporter- disrupted Escherichia coli strain. All bacterial strains were cultured under appropriate conditions with or without sodium fluoride, and fluoride resistance was evaluated. All three gene-knockout S. mutans strains showed lower resistance to sodium fluoride than did the wild-type strain. No significant changes in resistance to other sodium halides were recognized between the wild-type and double-knockout strains. Both SMU_1290c and SMU_1289c transformation rescued fluoride transporter-disrupted E. coli cell from fluoride toxicity. We conclude that the chloride channel permeases contribute to fluoride resistance in S. mutans. © FEMS 2016. All rights reserved. For permissions, please e-mail:

  2. Influence of fluoride on aluminum toxicity to Atlantic salmon (Salmo salar) (United States)

    Hamilton, Steven J.; Haines, Terry A.


    Atlantic salmon (Salmo salar) alevins were exposed to various aluminum (0–4700 μg/L) and four fluoride (0–500 μg/L) concentrations at two pH values (5.5 and 6.5) for 4- and 30-d periods. In the 4-d tests, aluminum with fluoride was less toxic at pH 6.5 than at pH 5.5, whereas without fluoride, pH had no effect. In the 30-d test, mortality in all treatments was 17–21% at pH 5.5, but only 3–7% at pH 6.5. Fish length and weight after 30 d were reduced in all fluoride–aluminum treatments at pH 5.5, but only in the 200-μg/L aluminum without fluoride treatment at pH 6.5. At pH 5.5 and 6.5 without aluminum, histomorphological examinations revealed no abnormalities in gill tissue. However, in aluminum exposure with no fluoride, gill filaments and secondary lamellae were swollen and thickened. Addition of fluoride at pH 6.5 alleviated some gill damage. At pH 5.5 and 200 μg/L aluminum, addition of 100 μg/L fluoride reduced swelling of gill lamellae, but 200 μg/L fluoride did not reduce swelling. Low fluoride concentrations (fluoride concentrations (> 100 μg/L) may not reduce aluminum-induced effects.

  3. Histopathological Effects of Varied Fluoride Concentration on Cerebrum in Albino Rats

    Directory of Open Access Journals (Sweden)

    Sajad Hamid


    Full Text Available Fluorides have been a cause of concern for scientists and environmentalists for the long because of their harmful effects on the human and animal life but the problem was highlighted during the twentieth century because of great increase in the human population and industrialization. Since fluorides accumulate in calcified and hard tissues of the body such as bone and teeth and can be detected easily in these tissues, so most of the previous studies focused on the effects of fluorides on these tissues. However, during the past decade researchers all over the world have felt that there is a need to study the effects of fluorides on various other tissues of the body including CNS as fluoride intake for prolonged period is known to cause abnormal behavioural pattern, grave implications for Alzheimer’s Disease, Dementia, Attention deficit disorder and reduced I.Q in children as the fluorides are known to cross blood brain barrier. Hence the present study has thrown light on the involvement of brain in chronic fluoride toxicity. The target organ of studied was cerebrum. In the Study, albino rats were exposed to 30 or 100 ppm fluoride (asNaF in drinking water for 3 months. Rats exposed to 30 ppm fluoride did not show any notable alterations in brain histology, whereas rats exposed to 100 ppm fluoride showed significant neurodegenerative changes in lhe motor cortex.Changes included decrease in size and number of neurons in all the regions, signs of chromatolysis and gliosis in the motor cortex. These histological changes suggest a toxic effect of high-fluoride intake & on chronic use. [J Interdiscipl Histopathol 2012; 1(1.000: 30-34

  4. Association of Hypertension, Body Mass Index, and Waist Circumference with Fluoride Intake; Water Drinking in Residents of Fluoride Endemic Areas, Iran. (United States)

    Yousefi, Mahmood; Yaseri, Mehdi; Nabizadeh, Ramin; Hooshmand, Elham; Jalilzadeh, Mohsen; Mahvi, Amir Hossein; Mohammadi, Ali Akbar


    Hypertension is becoming a global epidemic for both rural and urban populations; it is a major public health challenge in Iran. Fluoride can be a risk factor for hypertension. Cross-sectional analysis was conducted in two study areas to assess the relation of fluoride with blood pressure prevalence, BMI, waist circumference, and waist-to-hip ratio (WHR) among different age groups in both sexes. The mean value of fluoride concentration in the drinking water from the four study villages varied from 0.68 to 10.30 mg/L. The overall prevalence of HTN and prehypertension in all subjects was 40.7%. The prevalence of isolated systolic hypertension, isolated diastolic hypertension, systolic-diastolic hypertension, and prehypertension in the total sample population was 1.15, 0.28, 9.53, and 29.76%, respectively. The odd ratio of hypertension in residents who drank water with high fluoride levels was higher than that in residents who drank water with lower level of fluoride (OR 2.3, 1.03-5.14). Logistic regression results showed that age (P water (P = 0.041) had a significant relationship with increased blood pressure. There were no statistically significant correlations between fluoride and BMI, hip circumference, and waist to hip ratio (WHR). The findings of this study are important for health care personnel and policymakers.

  5. Urinary fluoride as a monitoring tool for assessing successful intervention in the provision of safe drinking water supply in five fluoride-affected villages in Dhar district, Madhya Pradesh, India. (United States)

    Srikanth, R; Gautam, Anil; Jaiswal, Suresh Chandra; Singh, Pavitra


    Endemic fluorosis was detected in 31 villages in the Dhar district of Madhya Pradesh, Central India. Out of the 109 drinking water sources that were analyzed, about 67 % were found to contain high concentration of fluoride above the permissible level of 1.0 mg/l. Dental fluorosis among the primary school children in the age between 8 and 15 served as primary indicator for fluoride intoxication among the children. Urinary fluoride levels among the adults were found to be correlated with drinking water fluoride in 10 villages affected by fluoride. Intervention in the form of alternate safe water supply in five villages showed significant reduction in the urinary fluoride concentration when compared to the control village. Urinary fluoride serves as an excellent marker for assessing the effectiveness of intervention program in the fluoride-affected villages.

  6. Combinatorial effects of arginine and fluoride on oral bacteria. (United States)

    Zheng, X; Cheng, X; Wang, L; Qiu, W; Wang, S; Zhou, Y; Li, M; Li, Y; Cheng, L; Li, J; Zhou, X; Xu, X


    Dental caries is closely associated with the microbial disequilibrium between acidogenic/aciduric pathogens and alkali-generating commensal residents within the dental plaque. Fluoride is a widely used anticaries agent, which promotes tooth hard-tissue remineralization and suppresses bacterial activities. Recent clinical trials have shown that oral hygiene products containing both fluoride and arginine possess a greater anticaries effect compared with those containing fluoride alone, indicating synergy between fluoride and arginine in caries management. Here, we hypothesize that arginine may augment the ecological benefit of fluoride by enriching alkali-generating bacteria in the plaque biofilm and thus synergizes with fluoride in controlling dental caries. Specifically, we assessed the combinatory effects of NaF/arginine on planktonic and biofilm cultures of Streptococcus mutans, Streptococcus sanguinis, and Porphyromonas gingivalis with checkerboard microdilution assays. The optimal NaF/arginine combinations were selected, and their combinatory effects on microbial composition were further examined in single-, dual-, and 3-species biofilm using bacterial species-specific fluorescence in situ hybridization and quantitative polymerase chain reaction. We found that arginine synergized with fluoride in suppressing acidogenic S. mutans in both planktonic and biofilm cultures. In addition, the NaF/arginine combination synergistically reduced S. mutans but enriched S. sanguinis within the multispecies biofilms. More importantly, the optimal combination of NaF/arginine maintained a "streptococcal pressure" against the potential growth of oral anaerobe P. gingivalis within the alkalized biofilm. Taken together, we conclude that the combinatory application of fluoride and arginine has a potential synergistic effect in maintaining a healthy oral microbial equilibrium and thus represents a promising ecological approach to caries management. © International & American

  7. Haematological evaluation of sodium fluoride toxicity in oryctolagus cunniculus

    Directory of Open Access Journals (Sweden)

    Maryam Abbas

    Full Text Available Blood is promptly affected by environmental pollutants and toxicants that can cause many metabolic disorders. The high level of fluoride acts as a potential pollutant, insecticide and rodenticide with very high toxicity, associated with the hematological damage. This study aimed to determine the toxicity of Sodium Fluoride on hematological parameters in Oryctolagus cunniculus. Twenty rabbits were acclimatized and divided in to control group and three experimental groups.Experimental group-I, II and III were treated with 10, 30 and 50 mg/kg body weight doses of Sodium Fluoride orally. Various blood parameters such as TEC, Hb, HCT, MCV, MCH, MCHC, TLC and PLT count were investigated. Result findings showed that values of blood indices in experimental groups were significantly lower than the control group. Oneway ANOVA was applied for statistical analysis. The outcomes of the current studies indicated the reduction in RBC counts (anemia, leukocyte count (leukocytopenia, monocytosis, eosinopenia, neutrophilia and thrombocytosis on fluoride intoxication. Hematological disruptions like microcytic hypochromic anemia and decreased leukocyte count may be linked to the inflammatory effects of Sodium Fluoride on lymphatic organs. Keywords: Fluoride intoxication, Hypochromic anemia, Hematological, Parameters, Leukocyte alterations, Fluorosis

  8. Probability of foliar injury for Acer sp. based on foliar fluoride concentrations. (United States)

    McDonough, Andrew M; Dixon, Murray J; Terry, Debbie T; Todd, Aaron K; Luciani, Michael A; Williamson, Michele L; Roszak, Danuta S; Farias, Kim A


    Fluoride is considered one of the most phytotoxic elements to plants, and indicative fluoride injury has been associated over a wide range of foliar fluoride concentrations. The aim of this study was to determine the probability of indicative foliar fluoride injury based on Acer sp. foliar fluoride concentrations using a logistic regression model. Foliage from Acer nedundo, Acer saccharinum, Acer saccharum and Acer platanoides was collected along a distance gradient from three separate brick manufacturing facilities in southern Ontario as part of a long-term monitoring programme between 1995 and 2014. Hydrogen fluoride is the major emission source associated with the manufacturing facilities resulting with highly elevated foliar fluoride close to the facilities and decreasing with distance. Consistent with other studies, indicative fluoride injury was observed over a wide range of foliar concentrations (9.9-480.0 μg F -  g -1 ). The logistic regression model was statistically significant for the Acer sp. group, A. negundo and A. saccharinum; consequently, A. negundo being the most sensitive species among the group. In addition, A. saccharum and A. platanoides were not statistically significant within the model. We are unaware of published foliar fluoride values for Acer sp. within Canada, and this research provides policy maker and scientist with probabilities of indicative foliar injury for common urban Acer sp. trees that can help guide decisions about emissions controls. Further research should focus on mechanisms driving indicative fluoride injury over wide ranging foliar fluoride concentrations and help determine foliar fluoride thresholds for damage.

  9. Combinatorial Effects of Arginine and Fluoride on Oral Bacteria


    Zheng, X.; Cheng, X.; Wang, L.; Qiu, W.; Wang, S.; Zhou, Y.; Li, M.; Li, Y.; Cheng, L.; Li, J.; Zhou, X.; Xu, X.


    Dental caries is closely associated with the microbial disequilibrium between acidogenic/aciduric pathogens and alkali-generating commensal residents within the dental plaque. Fluoride is a widely used anticaries agent, which promotes tooth hard-tissue remineralization and suppresses bacterial activities. Recent clinical trials have shown that oral hygiene products containing both fluoride and arginine possess a greater anticaries effect compared with those containing fluoride alone, indicati...

  10. Profile of Fluoride Release from a Nanohybrid Composite Resin

    Directory of Open Access Journals (Sweden)

    Raquel Assed Bezerra Silva


    Full Text Available The aim of this study was to evaluate in vitro the amount and profile of fluoride release from a fluoride-containing nanohybrid composite resin (Tetric® N-Ceram by direct potentiometry. Thirty specimens (5 mm diameter x 3 mm high; n=10/material were made of Tetric® N-Ceram, Vitremer® resin-modified glass ionomer cement (RMGIC (positive control or Filtek® Z350 nanofill composite resin (negative control. The specimens were stored individually in plastic tubes containing 1 mL of artificial saliva at 37°C, which was daily renewed during 15 days. At each renewal of saliva, the amount of fluoride ions released in the solution was measured using a fluoride ion-selective electrode with ion analyzer, and the values obtained in mV were converted to ppm (µg/mL. Data were analyzed statistically by ANOVA and Tukey’s post-hoc test at a significance level of 5%. The results showed that the resins Tetric® N-Ceram and Filtek® Z350 did not release significant amounts of fluoride during the whole period of evaluation (p>0.05. Only Vitremer® released significant amounts of fluoride ions during the 15 days of the experiment, with greater release in first 2 days (p0.05. In conclusion, the nanohybrid composite resin Tetric® N-Ceram did not present in vitro fluoride-releasing capacity throughout the 15 days of study.

  11. Fluoride influences nickel-titanium orthodontic wires′ surface texture and friction resistance

    Directory of Open Access Journals (Sweden)

    Mona Aly Abbassy


    Full Text Available Objectives: The aim of this study was to investigate the effects exerted by the acidulated fluoride gel on stainless steel and nickel-titanium (Ni-Ti orthodontic wires. Materials and Methods: Sixty stainless steel and Ni-Ti orthodontic archwires were distributed into forty archwires used for in vitro study and twenty for in situ study. Fluoride was applied for 1 h in the in vitro experiment while it was applied for 5 min in the in situ experiment. The friction resistance of all wires with ceramic brackets before/after topical fluoride application was measured using a universal testing machine at 1 min intervals of moving wire. Moreover, surface properties of the tested wires before/after fluoride application and before/after friction test were examined by a scanning electron microscope (SEM. Dunnett′s t-test was used to compare frictional resistance of as-received stainless steel wires and Ni-Ti wires to the wires treated by fluoride in vitro and in situ (P < 0.05. Two-way ANOVA was used to compare the effect of fluoride application and type of wire on friction resistance in vitro and in situ (P < 0.05. Results: Ni-Ti wires recorded significantly high friction resistance after fluoride application when compared to stainless steel wires in vitro, P < 0.05. Fluoride application did not significantly affect the friction resistance of the tested wires in situ, P < 0.05. SEM observation revealed deterioration of the surface texture of the Ni-Ti wires after fluoride application in vitro and in situ. Conclusions: The in vitro fluoride application caused an increase in friction resistance of Ni-Ti wires when compared to stainless steel wires. In vitro and in situ fluoride application caused deterioration in surface properties of Ni-Ti wires.

  12. Effect of fluoride mouthwash on tensile strength of stainless steel orthodontic archwires (United States)

    Fatimah, D. I.; Anggani, H. S.; Ismah, N.


    Patients with orthodontic treatment are commonly recommended to use a fluoride mouthwash for maintaining their oral hygiene and preventing dental caries. However, fluoride may affect the characteristics of stainless steel orthodontic archwires used during treatment. The effect of fluoride mouthwash on the tensile strength of stainless steel orthodontic archwires is still unknown. The purpose of this study is to know the effect of fluoride mouthwash on the tensile strength of stainless steel orthodontic archwires. Examine the tensile strength of 0.016 inch stainless steel orthodontic archwires after immersion in 0.05%, 100 ml fluoride mouthwash for 30, 60, and 90 min. There is no statistically significant difference in the tensile strength of stainless steel orthodontic archwires after immersed in fluoride mouthwash. The p-values on immersion fluoride mouthwash for 30, 60, and 90 min consecutively are 0.790; 0.742; and 0.085 (p > 0.05). The use of fluoride mouthwash did not have an effect on the tensile strength of stainless Steel orthodontic archwires.

  13. Fluoride Consumption and Its Impact on Oral Health

    Directory of Open Access Journals (Sweden)

    Luis Fernando Jacinto-Alemán


    Full Text Available Objective. The purpose of this study was to evaluate caries and dental fluorosis among Mexican preschoolers and school-aged children in a non-endemic zone for fluorosis and to measure its biological indicators. Methods. DMFT, DMFS, dmft, dmfs, and CDI indexes were applied. Fluoride urinary excretion and fluoride concentrations in home water, table salt, bottled water, bottled drinks, and toothpaste were determined. Results. Schoolchildren presented fluorosis (CDI = 0.96 and dental caries (DMFT = 2.64 and DMFS = 3.97. Preschoolers presented dmft = 4.85 and dmfs = 8.80. DMFT and DMFS were lower in children with mild to moderate dental fluorosis (DF. Variable fluoride concentrations were found in the analyzed products (home water = 0.18–0.44 ppm F, table salt = 0–485 ppm F, bottled water = 0.18–0.47 ppm F, juices = 0.08–1.42 ppm F, nectars = 0.07–1.30 ppm F, bottled drinks = 0.10–1.70 ppm F, toothpaste = 0–2,053 ppm F. Mean daily fluoride excretion was 422 ± 176 µg/24 h for schoolchildren and 367 ± 150 µg/24 h for preschoolers. Conclusions. Data from our study show that, despite values of excretion within an optimal fluoride intake range, the prevalence of caries was significant in both groups, and 60% of the 11- to 12-year-old children presented with dental fluorosis. In addition, variable fluoride concentrations in products frequently consumed by children were found.

  14. Fluoride removal from aqueous solution by pumice: case study on ...

    African Journals Online (AJOL)

    The fluoride removal from synthetic water by pumice was studied at batch experiments in this study. The effect of pH, contact time, fluoride concentration and adsorbent dose on the fluoride sequestration was investigated. The optimum conditions were studied on Kuhbonan water as a case study. The results showed that ...

  15. The Impact of Selected Fluoridated Toothpastes on Dental Erosion in Profilometric Measurement. (United States)

    Fita, Katarzyna; Kaczmarek, Urszula


    Some fluoridated toothpastes, available commercially, are described to have a protective effect against dental erosion. To evaluate the influence of the selected marketed toothpastes on the human enamel exposed to acid beverages. Enamel specimens from extracted human teeth were prepared (n = 40). Specimens were randomly divided into 10 experimental groups, 4 specimens each, which were subjected to acid challenge for 10 min using orange juice (pH 3.79) or Pepsi Cola (pH 2.58) and then immersed for 2 min into a slurry of five marketed toothpastes with distilled water (1 : 3 w/w). The tested toothpastes contained 1450 or 5000 ppm fluoride, CPP-ACP with 900 ppm fluoride, 1450 ppm fluoride with potassium nitrate 5%, all of them as sodium fluoride, and 700 ppm fluoride as amine and sodium fluoride with 3500 ppm SnCl2. Enamel roughness (Ra parameter) by contact profilometer at baseline and after exposure onto soft drinks and slurry was measured. Exposure to both beverages caused a similar increase of enamel surface roughness. After the specimens immersion into slurries of toothpastes with 1450 or 5000 ppm fluoride, 1450 ppm fluoride with potassium nitrate 5% and CPP-ACP with 900 ppm fluoride the significant decrease of Ra values were found, reaching the baseline values. However, toothpaste with 700 ppm fluoride and 3500 ppm SnCl2 did not cause any fall in Ra value, probably due to other mechanism of action. Within the limitation of the study we can conclude that the sodium fluoride toothpastes are able to restore the surface profile of enamel exposed shortly to acidic soft drinks.

  16. Fluoride in dental biofilm and saliva

    DEFF Research Database (Denmark)

    Larsen, Line Staun

    Dette ph.d.-projekt bidrager med ny viden om fordelingen af fluorid i dental biofilm og saliva. For at udforske koncentrationen af fluorid i naturlig (in vivo) biofilmvæske, biofilmsediment og i saliva, blev der udført to meget forskellige kliniske studier. Resultaterne fra tværsnitsstudiet (Studie...... I), hos en stor gruppe mennesker (n=42) der konsulterede en tandklinik for behandling, bekræfter tidligere viden, at der findes en naturlig biologisk variation i fluoridkoncentrationerne i biofilm fra forskellige intra-orale regioner samt mellem biofilmvæske, biofilmsediment og saliva...... fluoridkoncentrationer i underkæbefronten, intermediære koncentrationer i alle tre overkæberegioner og de laveste koncentrationer i underkæbemolarregionerne. Begge studier viser at biofilmsedimentet indeholder størstedelen af fluorid i biofilm. Set i et bredere perspektiv viser fundene at der er et omvendt forhold...

  17. Level of Fluoride in Soil, Grain and Water in Jalgaon District, Maharashtra, India. (United States)

    Naik, Rahul Gaybarao; Dodamani, Arun Suresh; Vishwakarma, Prashanth; Jadhav, Harish Chaitram; Khairnar, Mahesh Ravindra; Deshmukh, Manjiri Abhay; Wadgave, Umesh


    Fluoride has an influence on both oral as well as systemic health. The major source of fluoride to body is through drinking water as well as through diet. Staple diet mainly depends on local environmental factors, food grains grown locally, its availability etc. Determination of fluoride level in these food grains is important. So, estimation of the amount of fluoride in grains and its relation to the sources of fluoride used for their cultivation viz., soil and water is important. To estimate the relation of fluoride concentration in grains (Jowar) with respect to that of soil and water used for their cultivation. Fifteen samples each of soil, water and grains were collected using standardized method from the same farm fields of randomly selected villages of Jalgaon district. Fluoride ion concentration was determined in laboratory using SPADNS technique. Mean difference in fluoride levels in between the groups were analyzed using ANOVA and Post-Hoc Tukey test. Linear regression method was applied to analyse the association of the fluoride content of grain with water and soil. There was a significant difference in between mean fluoride levels of soil and water (pwater and grain was found to be non significant (p=0.591). Also fluoride levels in all the three groups showed significant association with each other. Fluoride level of soil, grains and water should be adjusted to an optimum level. Soil has positive correlation with respect to uptake of fluoride by Jowar grains. So, Jowar grains with optimum fluoride content should be made available in the commercial markets so that oral and general health can be benefitted.

  18. Effect of atmospheric fluoride on plant metabolism

    Energy Technology Data Exchange (ETDEWEB)

    Suketa, Y; Yamamoto, T


    Studies on the relationship between the exposure factor and foliar deposition of fluoride, or foliar burn, are introduced. Photosynthesis is adversely affected by atmospheric fluoride. The photosynthesis of a strawberry deteriorated by 50% when the strawberry was exposed to 48 ppb hydrofluoric acid for one hour. The effect of fluoride on the respiratory organs of plants is also reported. Soy beans exposed to 0.03 ppm HF had metabolic abnormalities. The total sugar quantity of leaves decreased from 242-253 mg/100 g to 111-141 mg/100 g and the non-reduced sugar/reduced sugar ratio decreased from 4.6-8.7 to 0.8-1.6. 30 references, 3 figures, 14 tables.

  19. Modelling of fluoride removal via batch monopolar electrocoagulation process using aluminium electrodes (United States)

    Amri, N.; Hashim, M. I.; Ismail, N.; Rohman, F. S.; Bashah, N. A. A.


    Electrocoagulation (EC) is a promising technology that extensively used to remove fluoride ions efficiently from industrial wastewater. However, it has received very little consideration and understanding on mechanism and factors that affecting the fluoride removal process. In order to determine the efficiency of fluoride removal in EC process, the effect of operating parameters such as voltage and electrolysis time were investigated in this study. A batch experiment with monopolar aluminium electrodes was conducted to identify the model of fluoride removal using empirical model equation. The EC process was investigated using several parameters which include voltage (3 - 12 V) and electrolysis time (0 - 60 minutes) at a constant initial fluoride concentration of 25 mg/L. The result shows that the fluoride removal efficiency increased steadily with increasing voltage and electrolysis time. The best fluoride removal efficiency was obtained with 94.8 % removal at 25 mg/L initial fluoride concentration, voltage of 12 V and 60 minutes electrolysis time. The results indicated that the rate constant, k and number of order, n decreased as the voltage increased. The rate of fluoride removal model was developed based on the empirical model equation using the correlation of k and n. Overall, the result showed that EC process can be considered as a potential alternative technology for fluoride removal in wastewater.

  20. Prevention of dental caries through the effective use of fluoride

    DEFF Research Database (Denmark)

    Petersen, Poul Erik


    Background: The World Health Organization (WHO) emphasizes that dental caries is a severe public health problem across the world. The current global and regional patterns of dental caries reflect distinct risk profiles of countries which relate to the structure of the society, living conditions......, lifestyles, and the existence of preventive oral health programmes. Research conducted in high income countries documents that systematic use of fluoride reduces the burden of dental caries; such research is scarce in low and middle income countries. Objectives: This article reviews the evidence on effective...... use of fluoride, highlights the public health approach to fluoridation, and clarifies how automatic fluoridation contributes to breaking social inequities in dental caries. Data collection: Scientific publications on fluoride administration stored in PubMed/Medline and caries data from the WHO...

  1. Effect of various rinsing protocols after use of amine fluoride/stannous fluoride toothpaste on the bacterial composition of dental plaque

    NARCIS (Netherlands)

    van Loveren, C.; Gerardu, V.A.M.; Sissons, C.H.; van Bekkum, M.; ten Cate, J.M.


    This clinical study evaluated the effect of different oral hygiene protocols on the bacterial composition of dental plaque. After a 2-week period of using fluoride-free toothpaste, 30 participants followed three 1-week experimental protocols, each followed by 2-week fluoride-free washout periods in

  2. Effect of Enamel Caries Lesion Baseline Severity on Fluoride Dose-Response

    Directory of Open Access Journals (Sweden)

    Frank Lippert


    Full Text Available This study aimed to investigate the effect of enamel caries lesion baseline severity on fluoride dose-response under pH cycling conditions. Early caries lesions were created in human enamel specimens at four different severities (8, 16, 24, and 36 h. Lesions were allocated to treatment groups (0, 83, and 367 ppm fluoride as sodium fluoride based on Vickers surface microhardness (VHN and pH cycled for 5 d. The cycling model comprised 3 × 1 min fluoride treatments sandwiched between 2 × 60 min demineralization challenges with specimens stored in artificial saliva in between. VHN was measured again and changes versus lesion baseline were calculated (ΔVHN. Data were analyzed using two-way ANOVA (p<0.05. Increased demineralization times led to increased surface softening. The lesion severity×fluoride concentration interaction was significant (p<0.001. Fluoride dose-response was observed in all groups. Lesions initially demineralized for 16 and 8 h showed similar overall rehardening (ΔVHN and more than 24 and 36 h lesions, which were similar. The 8 h lesions showed the greatest fluoride response differential (367 versus 0 ppm F which diminished with increasing lesion baseline severity. The extent of rehardening as a result of the 0 ppm F treatment increased with increasing lesion baseline severity, whereas it decreased for the fluoride treatments. In conclusion, lesion baseline severity impacts the extent of the fluoride dose-response.


    African Journals Online (AJOL)

    Preferred Customer


    May 5, 2013 ... Rice is one of the commonly consumed cereals for more than half of the ... also used as flour, for making rice wine, as ingredient for beer and liquor, ... Fluoride is a necessary element to human health, and a moderate amount of fluoride intake ... For Ethiopian red rice (ERR) Fogera was selected to collect.

  4. Removal of Fluoride from Drinking Water Using Modified Immobilized Activated Alumina

    Directory of Open Access Journals (Sweden)

    Aneeza Rafique


    Full Text Available The study describes the removal of fluoride from drinking water using modified immobilized activated alumina (MIAA prepared by sol-gel method. The modification was done by adding a specific amount of alum during the sol formation step. The fluoride removal efficiency of MIAA was 1.35 times higher as compared to normal immobilized activated alumina. A batch adsorption study was performed as a function of adsorbent dose, contact time, stirring rate, and initial fluoride concentration. More than 90% removal of fluoride was achieved within 60 minutes of contact time. The adsorption potential of MIAA was compared with activated charcoal which showed that the removal efficiency was about 10% more than the activated charcoal. Both the Langmuir and Freundlich adsorption isotherms fitted well for the fluoride adsorption on MIAA with the regression coefficient R2 of 0.99 and 0.98, respectively. MIAA can both be regenerated thermally and chemically. Adsorption experiments using MIAA were employed on real drinking water samples from a fluoride affected area. The study showed that modified immobilized activated alumina is an effective adsorbent for fluoride removal.

  5. Risk assessment of fluoride exposure in drinking water of Tunisia. (United States)

    Guissouma, Wiem; Hakami, Othman; Al-Rajab, Abdul Jabbar; Tarhouni, Jamila


    The presence of fluoride in drinking water is known to reduce dental cavities among consumers, but an excessive intake of this anion might leads to dental and skeletal fluorosis. This study reports a complete survey of the fluoridated tap water taken from 100 water consumption points in Tunisia. The fluoride concentrations in tap water were between 0 and 2.4 mg L -1 . Risk assessment of Fluoride exposure was assessed depending on the age of consumers using a four-step method: hazard identification, toxicity reference values selection (TRVs), daily exposure assessment, and risk characterization. Our findings suggest that approximately 75% of the Tunisian population is at risk for dental decay, 25% have a potential dental fluorosis risk, and 20% might have a skeletal fluorosis risk according to the limits of fluoride in drinking water recommended by WHO. More investigations are recommended to assess the exposure risk of fluoride in other sources of drinking water such as bottled water. Copyright © 2017 Elsevier Ltd. All rights reserved.

  6. On the assessment of hydroxyapatite fluoridation by means of Raman scattering

    International Nuclear Information System (INIS)

    Campillo, M.; Valiente, M.; Lacharmoise, P. D.; Reparaz, J. S.; Goni, A. R.


    Hydroxyapatite is the main mineral component of bones and teeth. Fluorapatite, a bioceramic that can be obtained from hydroxyapatite by chemical substitution of the hydroxide ions with fluoride, exhibits lower mineral solubility and larger mechanical strength. Despite the widespread use of fluoride against caries, a reliable technique for unambiguous assessment of fluoridation in in vitro tests is still lacking. Here we present a method to probe fluorapatite formation in fluoridated hydroxyapatite by combining Raman scattering with thermal annealing. In synthetic minerals, we found that effectively fluoride substituted hydroxyapatite transforms into fluorapatite only after heat treatment, due to the high activation energy for this first order phase transition.

  7. On the assessment of hydroxyapatite fluoridation by means of Raman scattering (United States)

    Campillo, M.; Lacharmoise, P. D.; Reparaz, J. S.; Goñi, A. R.; Valiente, M.


    Hydroxyapatite is the main mineral component of bones and teeth. Fluorapatite, a bioceramic that can be obtained from hydroxyapatite by chemical substitution of the hydroxide ions with fluoride, exhibits lower mineral solubility and larger mechanical strength. Despite the widespread use of fluoride against caries, a reliable technique for unambiguous assessment of fluoridation in in vitro tests is still lacking. Here we present a method to probe fluorapatite formation in fluoridated hydroxyapatite by combining Raman scattering with thermal annealing. In synthetic minerals, we found that effectively fluoride substituted hydroxyapatite transforms into fluorapatite only after heat treatment, due to the high activation energy for this first order phase transition.

  8. Biosorption of fluoride ion from water using the seeds of the ...

    African Journals Online (AJOL)

    Biosorption of fluoride ion from water using the seeds of the cabbage tree ( Moringa ... The maximum fluoride sorption capacity was found to be 1.32 mg.g-1 of dry weight ... Key words: Biosorption, chemisorption, desorption, fluoride, isotherm, ...

  9. Health impact of supplying safe drinking water containing fluoride below permissible level on flourosis patients in a fluoride-endemic rural area of West Bengal. (United States)

    Majumdar, Kunal Kanti


    The problem of high fluoride concentration in groundwater resources has become one of the most important toxicological and geo-environmental issues in India. Excessive fluoride in drinking water causes dental and skeletal fluorosis, which is encountered in endemic proportions in several parts of the world. World Health Organization (WHO) guideline value and the permissible limit of fluoride as per Bureau of Indian Standard (BIS) is 1.5 mg/L. About 20 states of India, including 43 blocks of seven districts of West Bengal, were identified as endemic for fluorosis and about 66 million people in these regions are at risk of fluoride contamination. Studies showed that withdrawal of sources identified for fluoride often leads reduction of fluoride in the body fluids (re-testing urine and serum after a week or 10 days) and results in the disappearance of non-skeletal fluorosis within a short duration of 10-15 days. To determine the prevalence of signs and symptoms of suspected dental, skeletal, and non-skeletal fluorosis, along with food habits, addictions, and use of fluoride containing toothpaste among participants taking water with fluoride concentration above the permissible limit, and to assess the changes in clinical manifestations of the above participants after they started consuming safe drinking water. A longitudinal intervention study was conducted in three villages in Rampurhat Block I of Birbhum district of West Bengal to assess the occurrence of various dental, skeletal, and non-skeletal manifestations of fluorosis, along with food habits, addictions, and use of fluoride containing toothpaste among the study population and the impact of taking safe water from the supplied domestic and community filters on these clinical manifestations. The impact was studied by follow-up examination of the participants for 5 months to determine the changes in clinical manifestations of the above participants after they started consuming safe drinking water from supplied

  10. Studies on influence of zinc immersion and fluoride on nickel electroplating on magnesium alloy AZ91D

    International Nuclear Information System (INIS)

    Zhang Ziping; Yu Gang; Ouyang Yuejun; He Xiaomei; Hu Bonian; Zhang Jun; Wu Zhenjun


    The effect of zinc immersion and the role of fluoride in nickel plating bath were mainly investigated in nickel electroplating on magnesium alloy AZ91D. The state of zinc immersion, the composition of zinc film and the role of fluoride in nickel plating bath were explored from the curves of open circuit potential (OCP) and potentiodynamic polarization, the images of scanning electron microscopy (SEM) and the patterns of energy dispersive X-ray (EDX). Results show that the optimum zinc film mixing small amount of Mg(OH) 2 and MgF 2 is obtained by zinc immersion for 30-90 s. The corrosion potential of magnesium alloy substrate attached zinc film will be increased in nickel plating bath and the quantity of MgF 2 sandwiched between magnesium alloy substrate and nickel coating will be reduced, which contributed to produce nickel coating with good performance. Fluoride in nickel plating bath serves as an activator of nickel anodic dissolution and corrosion inhibitor of magnesium alloy substrate. 1.0-1.5 mol dm -3 of F - is the optimum concentration range for dissolving nickel anode and protecting magnesium alloy substrate from over-corrosion in nickel plating bath. The nickel coating with good adhesion and high corrosion resistance on magnesium alloy AZ91D is obtained by the developed process of nickel electroplating. This nickel layer can be used as the rendering coating for further plating on magnesium alloys.

  11. Advanced inorganic fluorides. Proceedings of the Second International Siberian workshop INTERSIBFLUORINE-2006

    International Nuclear Information System (INIS)

    Volkov, V.V.; Mit'kin, V.N.; Bujnovskij, A.S.; Sofronov, V.L.


    Proceedings of the Second International Siberian workshop ISIF-2006 on modern inorganic fluorides contain full author's texts of 82 plenary reports and posters on the main trends in chemistry and technology of inorganic fluorides and their various applications. The following new trends are reflected in the ISIF-2006 Proceedings versus the ISIF-2003 ones: production and use of of nano-sized systems and materials based on fluoride phases and fluorinating systems; chemistry of fluorofullerenes, fluorides of graphite and carbon materials; development of research and technical principles of economically viable process of depleted uranium hexafluoride conversion; vitrifying systems based on metal fluorides possessing valuable functional optical properties; mechanochemical processes and phenomena in chemistry of inorganic fluorides [ru

  12. Effect of fluoride in drinking water on children′s intelligence in high and low fluoride areas of Delhi

    Directory of Open Access Journals (Sweden)

    Hansa Kundu


    Full Text Available Introduction: Fluoride is one of the indispensable elements for the living being. However, the intake of F above the threshold level can affect the central nervous system even before causing dental or skeletal fluorosis. Aim: The aim was to assess the effect of fluoride in drinking water on the intelligence quotient (IQ of 8-12 years old school going children residing in high and low Fluoride (F areas of Delhi. Materials and Methods: A total of 200 school children were selected, 100 from low F area and 100 from high F area. The IQ of the children was assessed using Ravens Standardized Progressive Matrices Test. Information for each child′s sociodemographic data, mother′s diet during pregnancy, duration of residency in the village, source of drinking water, and duration of drinking water from the source was entered on a specially designed proforma from mothers of children. Height and weight were also recorded for each child to assess the nutritional status. Independent t-test and Chi-square test was used to compare mean IQ scores in high and low fluoridated areas. Pearson′s correlation and multivariate linear regression were used to appraise the issue of all the study variables on IQ. Results: Comparison of mean IQ of children in both high (76.20 ± 19.10 and low F (85.80 ± 18.85 areas showed a significant difference (P = 0.013. Multiple regression analysis between child IQ and all other independent variables revealed that mother′s diet during pregnancy (P = 0.001 along with F in drinking water (P = 0.017 were the independent variables with the greatest explanatory power for child IQ variance (r2 = 0.417 without interaction with other variables. Conclusion: Fluoride in the drinking water was significantly related with the IQ of children. Along with fluoride, mother′s diet during pregnancy was also found to be significantly related with IQ of children. Researches in the same field are further advocated with large sample size and over a

  13. Fluoride Removal From Drinking Water by Electrocoagulation Using Iron and Aluminum Electrodes

    Directory of Open Access Journals (Sweden)



    Full Text Available Background Existence of fluoride in drinking water above the permissible level causes human skeletal fluorosis. Objectives Electrocoagulation by iron and aluminum electrodes was proposed for removing fluoride from drinking water. Materials and Methods Effects of different operating conditions such as treatment time, initial pH, applied voltage, type and number of electrodes, the spaces between aluminum and iron electrodes, and energy consumption during electrocoagulation were investigated in the batch reactor. Variable concentrations of fluoride solution were prepared by mixing proper amounts of sodium fluoride with deionized water. Results Experimental results showed that aluminum electrode is more effective in fluoride removal than iron, as in 40 minutes and initial pH of 7.5 at 20 V, the fluoride removal process reached to 97.86%. The final recommendable limit of fluoride (1.5 mg/L was obtained in 10 minutes at 20 V with the aluminum electrode. Conclusions In electrocoagulation with iron and aluminum electrodes, increase of voltage, number of electrodes and reaction time as well as decrease of the spaces between electrodes, enhanced the fluoride removal efficiency from drinking water. In addition the effect of pH and initial concentration of fluoride varied with types of electrodes.



    Kanduti, Domen; Sterbenk, Petra; Artnik, Barbara


    Introduction: Appropriate oral health care is fundamental for any individual?s health. Dental caries is still one of the major public health problems. The most effective way of caries prevention is the use of fluoride. Aim: The aim of our research was to review the literature about fluoride toxicity and to inform physicians, dentists and public health specialists whether fluoride use is expedient and safe. Methods: Data we used in our review were systematically searched and collected from web...

  15. Modification of radiation effect by sodium fluoride in Tradescantia

    International Nuclear Information System (INIS)

    Cebulska-Wasilewska, A.; Guminska, M.; Huczkowski, J.; Kuternozinska, W.


    Frequency of somatic mutations in the Tradescantia stamen hairs served as a measure of biological effect of gamma irradiation with single and split doses and of modifications caused by sodium fluoride. It was found that treatment of plants with fluoride before irradiation affects considerably radiation-induced mutations. The changed peak mutation frequency in plants treated with fluoride suggests that it vitally influences the repair processes of DNA and possibly modifies the mutation spectrum. 14 refs., 3 figs. (author)

  16. Effect of high fluoride concentration in drinking water on children’s intelligence

    Directory of Open Access Journals (Sweden)

    Seraj B


    Full Text Available Background and Aim: Human and animal studies linking fluoride with diminished intelligence have been published. Although adverse effects of high intake of fluoride on intelligence and mental acuity continue to be reported, they are still controversial. The aim of this research was to investigate the relationship between fluoride in drinking water and children's intelligence. Materials and Methods: In this cross sectional study, 41 children were selected from the high fluoride area with 2.5mg/l (ppm fluoride in the drinking water and 85 children were selected from low fluoride area with 0.4mg/l (ppm fluoride in the drinking water. The intelligence quotient (IQ of each child was measured by the Raven's test. The history of illnesses affecting the nervous system, head trauma, birth weight (2.5kg or  2.5kg, residental history, age and sex of children were investigated by questionnaires completed by the children's parents. Data were analyzed by Chi-Square test with p<0.05 as the limit of significance. Results: In the high fluoride area the mean IQ of children (87.911 was significantly lower than in the low fluoride area (98.912.9 (P=0.025. Conclusion: Based on the findings of this study, exposure of children to high levels of fluoride may carry the risk of impaired development of intelligence.

  17. The effect of water purification systems on fluoride content of drinking water

    Directory of Open Access Journals (Sweden)

    Prabhakar A


    Full Text Available Objective: The purpose of the present study was to determine the effect of different water purification systems on the fluoride content of drinking water and to compare the efficacy of these water purification systems in reducing the fluoride content. Materials and Methods: Five different water purification systems were tested in this study. They were reverse osmosis, distillation, activated carbon, Reviva ® , and candle filter. The water samples in the study were of two types, viz, borewell water and tap water, these being commonly used by the people of Davangere City, Karnataka. The samples were collected before and after purification, and fluoride analysis was done using fluoride ion-specific electrode. Results: The results showed that the systems based on reverse osmosis, viz, reverse osmosis system and Reviva ® showed maximum reduction in fluoride levels, the former proving to be more effective than the latter; followed by distillation and the activated carbon system, with the least reduction being brought about by candle filter. The amount of fluoride removed by the purification system varied between the system and from one source of water to the other. Interpretation and Conclusion: Considering the beneficial effects of fluoride on caries prevention; when drinking water is subjected to water purification systems that reduce fluoride significantly below the optimal level, fluoride supplementation may be necessary. The efficacy of systems based on reverse osmosis in reducing the fluoride content of water indicates their potential for use as defluoridation devices.

  18. Nutritional and water effect on fluoride uptake and respiration of bean seedlings. [Phaseolus vulgaris

    Energy Technology Data Exchange (ETDEWEB)

    Applegate, H G; Adams, D F


    Bean plants (Phaseolus vulgaris) were grown in an atmosphere containing 2.0 +/- 0.21 g F /mT (1.6 ppb). The effect of N, P, K, Fe, and Ca deficiencies and the effect of osmotic pressures of 0, 1.5, 3.0, 4.5, 6.0 and 7.5 pounds on fluoride uptake and fluoride-mediated respiration were studied. The data showed that P deficient plants took up more fluoride than plants deficient in any of the other elements studied. Fluoride-mediated respiration was phosphorous dependent, however. Plants low in Fe or K showed increased uptake of fluoride. Nitrogen had no effect on fluoride uptake under the conditions of this experiment. Plants low in Fe showed inhibition of oxygen uptake. This inhibition was accentuated by fluoride. The interactions of N, K and Ca with fluoride on respiration were complex. Neither fluoride uptake nor fluoride-mediated respiration appeared to be linked directly to the water economy of the plants. 14 references, 6 tables.

  19. The Effects of Remineralization via Fluoride Versus Low-Level Laser IR810 and Fluoride Agents on the Mineralization and Microhardness of Bovine Dental Enamel

    Directory of Open Access Journals (Sweden)

    Edith Lara-Carrillo


    Full Text Available The objective of this study was to assess the mineralization and microhardness of bovine dental enamel surfaces treated with fluoride, tri-calcium phosphate, and infrared (IR 810 laser irradiation. The study used 210 bovine incisors, which were divided into six groups (n = 35 in each: Group A: Untreated (control, Group B: Fluoride (Durapath-Colgate, Group C: Fluoride+Tri-calcium phosphate (Clin-Pro White-3 M, Group D: Laser IR 810 (Quantum, Group E: Fluoride+laser, and Group F: Fluoride+tri-calcium phosphate+laser. Mineralization was measured via UV-Vis spectroscopy for phosphorus and via atomic absorption spectroscopy for calcium upon demineralization and remineralization with proven agents. Microhardness (SMH was measured after enamel remineralization. Mineral loss data showed differences between the groups before and after the mineralizing agents were placed (p < 0.05. Fluoride presented the highest remineralization tendency for both calcium and phosphate, with a Vickers microhardness of 329.8 HV0.1/11 (p < 0.05. It was observed that, if remineralization solution contained fewer minerals, the microhardness surface values were higher (r = −0.268 and −0.208; p < 0.05. This study shows that fluoride has a remineralizing effect compared with calcium triphosphate and laser IR810. This in vitro study imitated the application of different remineralizing agents and showed which one was the most efficient for treating non-cavitated injuries. This can prevent the progression of lesions in patients with white spot lesions.


    DEFF Research Database (Denmark)

    Nielsen, Joan Maj; Dahi, Elian


    Purification of fluoride contaminated magadi is studied using bone char sorption and calcium precipitation. The bone char treatment is found to be workable both in columns and in batches where the magadi is dissolved in water prior to treatment. The concentrations in the solutions were 89 g magadi....../L and 95 and 400 mg F/L respectively in natural and synthetic solutions. The fluoride removal capacities observed were 4.6 mg F/g bone char for the column system and 2.7 mg F/g bone char for the batch system in case of synthetic magadi solution. It is however concluded that the batch system is the best...... treatment method. A procedure for purification of fluoride contaminated magadi at household level is described....

  1. A Review on Adsorption of Fluoride from Aqueous Solution (United States)

    Habuda-Stanić, Mirna; Ergović Ravančić, Maja; Flanagan, Andrew


    Fluoride is one of the anionic contaminants which is found in excess in surface or groundwater because of geochemical reactions or anthropogenic activities such as the disposal of industrial wastewaters. Among various methods used for defluoridation of water such as coagulation, precipitation, membrane processes, electrolytic treatment, ion-exchange, the adsorption process is widely used. It offers satisfactory results and seems to be a more attractive method for the removal of fluoride in terms of cost, simplicity of design and operation. Various conventional and non-conventional adsorbents have been assessed for the removal of fluoride from water. In this review, a list of various adsorbents (oxides and hydroxides, biosorbents, geomaterials, carbonaceous materials and industrial products and by-products) and its modifications from literature are surveyed and their adsorption capacities under various conditions are compared. The effect of other impurities on fluoride removal has also been discussed. This survey showed that various adsorbents, especially binary and trimetal oxides and hydroxides, have good potential for the fluoride removal from aquatic environments. PMID:28788194

  2. Professionally applied fluoride gel in low-caries 10.5-year-olds.

    NARCIS (Netherlands)

    Truin, G.J.; Hof, M.A. van 't


    The question has been raised whether low-caries children regularly using fluoride toothpaste will benefit from the professional application of additional fluoride gel. To investigate the caries-reducing effect of semi-annually-applied neutral 1% sodium fluoride gel, we carried out a double-blind

  3. Sorption of fluoride using chemically modified Moringa oleifera leaves (United States)

    Dan, Shabnam; Chattree, Amit


    Contamination of drinking water due to fluoride is a severe health hazard problem. Excess of fluoride (> 1.5 mg/L) in drinking water is harmful to human health. Various treatment technologies for removing fluoride from groundwater have been investigated. The present study showed that the leaves of Moringa oleifera, a herbal plant is an effective adsorbent for the removal of fluoride from aqueous solution. Acid treated Moringa oleifera leaves powder showed good adsorption capacity than alkali treated Moringa oleifera leaves powder. Batch sorptive defluoridation was conducted under the variable experimental condition such as pH, contact time, adsorbent dose and initial fluoride ion concentration. Maximum defluoridation was achieved at pH 1. The percentage of fluoride removal increases with adsorbent dose. The equilibrium sorption data were fitted into Langmuir, Freundlich and Temkin isotherms. Of the three adsorption isotherms, the R 2 value of Langmuir isotherm model was the highest. The maximum monolayer coverage ( Q max) from Langmuir isotherm model was determined to be 1.1441 mg/g, the separation factor indicating a favorable sorption experiment is 0.035. It was also discovered that the adsorption did not conform to the Freundlich adsorption isotherm. The heat of sorption process was estimated from Temkin Isotherm model to be - 0.042 J/mol which vividly proved that the adsorption experiment followed a physical process.

  4. Mechanisms of action of fluoride for caries control

    NARCIS (Netherlands)

    Buzalaf, M.A.R.; Pessan, J.P.; Honório, H.M.; ten Cate, J.M.; Buzalaf, M.A.R.


    Fluoride was introduced into dentistry over 70 years ago, and it is now recognized as the main factor responsible for the dramatic decline in caries prevalence that has been observed worldwide. However, excessive fluoride intake during the period of tooth development can cause dental fluorosis. In

  5. Dental fluorosis and urinary fluoride in 10-12 years old adolescents of Bushehr port

    Directory of Open Access Journals (Sweden)

    Giti Javan


    Full Text Available Background: Fluoride increases tooth resistance to dental caries, but mild toxicity due to excessive ingestion of fluoride can cause dental fluorosis. Drinking water naturally contains fluoride and is a major source of fluoride. In Bushehr port, drinking water is supplied from limestone springs with normal fluoride levels but dental fluorosis is observed. Methods: A total of 95 native school children (between the ages of 10-12 years old were randomly selected from four Bushehr port regions. Dental fluorosis, height and weight were examined. Probable attributing factors of dental fluorosis were also questioned. A 16 to 18 hours urinary fluoride concentration was measured with a fluoride ion selective electrode. Results: Dental fluorosis in four upper incisors was apparent in 52.6 % of the subjects. The urinary fluoride concentration was 2.18 mg/lit. Fluoride concentration in drinking water of schools ranged from 0.41 to 0.58 mg/lit. Forty percent of subjects were caries free. Conclusion: In spite of the normal range of fluoride concentration in the drinking water of Bushehr, dental fluorosis and urinary fluoride concentration are higher than the recommended ranges. Therefore, it is necessary to further investigate the amount and effects of fluoride ingestion in residents of Bushehr province.


    Directory of Open Access Journals (Sweden)

    Lewis S. M.


    Full Text Available A study has been undertaken of the interaction of complexed fluoride extracted from glass-ionomer dental cements with synthetic hydroxyapatite powder. Extracts were prepared from two commercial glass-ionomers (Fuji IX and ChemFlex under both neutral and acidic conditions. They were analysed by ICP-OES and by fluoride-ion selective electrode with and without added TISAB to decomplex the fluoride. The pH of the acid extracts was 4, conditions under which fluoride complexes with protons as HF or HF2-, it also complexes with aluminium, which was found to be present in higher amounts in the acid extracts. Fluoride was found to be almost completely complexed in acid extracts, but not in neutral extracts, which contained free fluoride ions. Exposure of these extracts to synthetic hydroxyapatite powder showed that fluoride was taken up rapidly (within 5 minutes, whether or not it was complexed. SEM (EDAX study of recovered hydroxyapatite showed only minute traces of aluminium taken up under all conditions. This showed that aluminium interacts hardly at all with hydroxyapatite, and hence is probably not involved in the remineralisation process.

  7. Preparation of rare earth fluorides from apatite concentrate

    International Nuclear Information System (INIS)

    Mulyarchuk, I.F.; Voloshchenko, M.V.; Zen'kovich, E.G.; Sumenkova, V.V.; AN Ukrainskoj SSR, Kiev. Inst. Problem Lit'ya)


    The processes of preparation of the rare earths element sum from apatite concentrate of the Khibins, connected with preliminary extraction of rare earth phosphates from nitric acid extract using solvent extraction or direct precipitation from the extract by solution of potassium and ammonium fluorides. The sequence of the processes of the first variant is the following: solvent extraction of rare earths by tributylphosphate from clarified nitric acid extract of apatite with subsequent reextraction of rare earths with water and precipitation of rare earth phosphates from aqueous solution during neutralization by ammonia. In case of fluoride preparation from rare earth phosphate the main attention is paid to precipitation and filtration of fluorides. Technological scheme and cost price of industry for the production of 1800 t of rare earth trifluorides a year are calculated. When taking account of TBP losses according to its solubility the industry cost price is 1O times lower the modern cost of rare earth fluorides

  8. State and National Water Fluoridation System (Public Water Systems) (United States)

    U.S. Department of Health & Human Services — The Water Fluoridation Reporting System (WFRS) has been developed to provide tools to assist states in managing fluoridation programs. WFRS is designed to track all...

  9. In Vitro Inhibition of Enamel Demineralisation by Fluoride-releasing Restorative Materials and Dental Adhesives. (United States)

    Dionysopoulos, Dimitrios; Koliniotou-Koumpia, Eugenia; Helvatzoglou-Antoniades, Maria; Kotsanos, Nikolaos


    To determine the ability of 5 contemporary fluoride-releasing restoratives and 3 fluoride-releasing adhesives to inhibit enamel demineralisation surrounding restorations, and the associations between inhibition and the levels of fluoride released from these materials. Five fluoride-releasing restoratives (Fuji IX GP, Ketac N100, Dyract Extra, Beautifil II and Wave) and 3 fluoride-releasing adhesives (Stae, Prime & Bond NT and Fluoro Bond II) were investigated. Eight disks of each material were prepared. Fluoride release was measured daily using a fluoride-ion-selective electrode for 15 days. Twenty-four cavities for each group were restored with a restorative and an adhesive. Specimens were subjected to thermal stress and stored for 30 days in saline solution. After a 15-day pH-cycling regimen, two 150-μm-thick sections were derived from each specimen. Enamel lesion depth was measured at 0, 100, and 200 μm from each restoration's margin via polarised light microscopy. Of the restoratives investigated, Fuji IX GP released the most fluoride. The fluoride-releasing restoratives tested exhibited shallower enamel lesions than did the control group at all distances tested (p < 0.05). Fuji IX GP yielded significantly lower enamel lesion depth than did the other experimental materials. The depths of enamel lesions did not differ significantly when comparing restoratives applied with a fluoride-releasing adhesive with those applied with a non-fluoride-releasing adhesive. The fluoride-releasing materials tested reduced enamel demineralisation but to different extents, depending on their levels of fluoride release. Fluoride-releasing adhesives did not influence enamel lesion formation.

  10. Recovery of fluoride ion selective electrode

    International Nuclear Information System (INIS)

    Monteiro, R.P.G.


    A recovery procedure of fluoride ion selective electrode based upon the body radiography of inactive electrode and introduction of suitable internal regeneration solution, is developed. The recovered electrode was tested in standard solutions of fluoride ions (10 sup5) to 10 -1M showing as good performance as the new one. The fluor determination by potentiometric measurements with selective electrode is used in nuclear fuel cycle for quality control of thorium and uranium mixed oxide pellets and pellets of uranium dioxides. (author) [pt

  11. Lipopolysaccharide and Lipoteichoic Acid Virulence Deactivation by Stannous Fluoride. (United States)

    Haught, Chris; Xie, Sancai; Circello, Ben; Tansky, Cheryl S; Khambe, Deepa; Klukowska, Malgorzata; Huggins, Tom; White, Donald J


    Oral bacterial pathogens promote gingivitis and periodontal disease. Bacterial endotoxins, also known as lipopolysaccharides (LPSs) and lipoteichoic acids (LTAs), are known to enhance bacterial pathogenicity through binding with Toll-like receptors (TLRs), a group of pattern recognition receptors critical to the activation of innate immunity, that are expressed on host cells. Both LPS and LTA contain lipophilic domains and anionic charges that may be susceptible to reactivity with stannous fluoride, a commonly used ingredient clinically proven for the treatment and prevention of gingivitis. This study examined the effects of stannous fluoride on Toll-like receptor activation in response to bacterially derived LPS and LTA in select cell lines and secretion of inflammatory cytokines from human primary peripheral monocytes likewise exposed to LPS. TLR4 and TLR2 transfected HEK293 cells and THP1-Dual™ cells were exposed to bacterial LPS and LTA in the presence of increasing concentrations of stannous fluoride. Gene expression was assessed by measurement of secreted embryonic alkaline phosphatase (SEAP) reporter gene for HEK293 cells and SEAP and luciferase for THP-1 cells. Cell viability was confirmed using PrestoBlue. Human primary monocytes were treated with LPS with various concentrations of supplemented stannous fluoride, and cytokine expression was directly measured. Stannous fluoride inhibited gene expression response of TLR4 and TLR2 in HEK293 cells and THP1-Dual™ cells in a dose response fashion, producing complete inhibition at micromolar concentrations. The addition of stannous fluoride suppressed production of TNF-a, IFN-g, IL12p70, IL10, IL-1b, IL2, and IL-6, and also increased secretion of Il-8 in dose response fashion. Viability assays confirmed no effects of LPS or stannous fluoride on viability of HEK293, THP-1, and primary human monocytes. These results support the potential for stannous fluoride to provide clinical gingivitis benefits by directly

  12. Environmental monitoring of fluoride emissions using precipitation, dust, plant and soil samples

    International Nuclear Information System (INIS)

    Franzaring, J.; Hrenn, H.; Schumm, C.; Klumpp, A.; Fangmeier, A.


    A pollution gradient was observed in precipitation, plants and soils sampled at different locations around a fluoride producing chemical plant in Germany. In all samples the influence of emissions was discernible up to a distance of 500 m from the plant. However, fluoride concentrations in plant bioindicators (leaves of birch and black berry) and in bulk precipitation showed a more pronounced relationship with the distance from the source than fluoride concentrations in soil. Vegetables sampled in the vicinity of the plant also had elevated concentrations of fluoride, but only the consumption of larger quantities of this material would lead to exceedances of recommended daily F-intake. The present study did not indicate the existence of low phytotoxicity thresholds for fluoride in the plant species used in the study. Even at very high fluoride concentrations in leaf tissue (963 ppm) plants did not show injury due to HF. Dust sampling downwind of the chemical plant confirmed that particulate fluoride was of minor importance in the study area. - A pronounced pollution gradient was observed in precipitation, plants and soils sampled at different locations around a fluoride emitting chemical plant in Germany

  13. Opinion of residents from the Gold Coast, Queensland, on community water fluoridation. (United States)

    Kroon, Jeroen; Reid, Kate Emily; Cutting, Jenna Renae; Lalloo, Ratilal; Chiu, Kandy Chien


    To investigate opinions and concerns of Gold Coast residents regarding fluoridation of community water supplies. Anonymous data were collected in four major shopping centers from approximately 500 Gold Coast residents. Eighty-one percent of participants were aware of the addition of fluoride to the water supply. More than half obtained information on water fluoridation through the print and electronic media. Sixty percent of respondents supported water fluoridation. The majority preferred the public and/or health professionals to have made the decision on water fluoridation rather than the government. The percentage of residents supporting water fluoridation was lower than that found in other Queensland, Australian, and worldwide surveys. In this study, only age and the highest level of education attained were factors significantly related to levels of support for water fluoridation. The Queensland Government's decision to implement water fluoridation without a referendum caused disquiet amongst some Gold Coast residents. Future public health initiatives therefore may be assisted by more consultation with, and involvement from, health professionals in the relevant fields. Public health campaigns may benefit more from interaction with the community in order to address their specific concerns. © 2012 Wiley Publishing Asia Pty Ltd.

  14. Exposure to Fluoride in Smelter Workers in a Primary Aluminum Industry in India

    Directory of Open Access Journals (Sweden)

    AK Susheela


    Full Text Available Background: Fluoride is used increasingly in a variety of industries in India. Emission of fluoride dust and fumes from the smelters of primary aluminum producing industries is dissipated in the work environment and poses occupational health hazards. Objective: To study the prevalence of health complaints and its association with fluoride level in body fluids of smelter workers in a primary aluminum producing industry. Methods: In an aluminum industry, health status of 462 smelter workers, 60 supervisors working in the smelter unit, 62 non-smelter workers (control group 1 and 30 administration staff (control group 2 were assessed between 2007 and 2009. Their health complaints were recorded and categorized into 4 groups: 1 gastro-intestinal complaints; 2 non-skeletal manifestations; 3 skeletal symptoms; and (4 respiratory problems. Fluoride level in body fluids, nails, and drinking water was tested by an ion selective electrode; hemoglobin level was tested using HemoCue. Results: The total complaints reported by study groups were significantly higher than the control groups. Smelter workers had a significantly (p<0.001 higher urinary and serum fluoride level than non-smelter workers; the nail fluoride content was also higher in smelter workers than non-smelter workers (p<0.001. The smelter workers with higher hemoglobin level had a significantly (p<0.001 lower urinary fluoride concentration and complained less frequently of health problems. Only 1.4% of the smelter workers were consuming water with high fluoride concentrations. A high percentage of participants was using substances with high fluoride contents. Conclusions: Industrial emission of fluoride is not the only important sources of fluoride exposure—consumption of substance with high levels of fluoride is another important route of entry of fluoride into the body. Measurement of hemoglobin provides a reliable indicator for monitoring the health status of employees at risk of fluorosis.

  15. Preparation of bromine fluoride

    International Nuclear Information System (INIS)

    Domange, Pr; Duflo, J.


    This note addresses the preparation of bromine fluoride. It indicates the implemented process for the reaction, used products (fluorine and bromine), and column characteristics. It describes the operating mode. Apparatus drawing is provided

  16. Soil fluoride spiking effects on olive trees (Olea europaea L. cv. Chemlali). (United States)

    Zouari, M; Ben Ahmed, C; Fourati, R; Delmail, D; Ben Rouina, B; Labrousse, P; Ben Abdallah, F


    A pot experiment under open air conditions was carried out to investigate the uptake, accumulation and toxicity effects of fluoride in olive trees (Olea europaea L.) grown in a soil spiked with inorganic sodium fluoride (NaF). Six different levels (0, 20, 40, 60, 80 and 100mM NaF) of soil spiking were applied through NaF to irrigation water. At the end of the experiment, total fluoride content in soil was 20 and 1770mgFkg(-1) soil in control and 100mM NaF treatments, respectively. The comparative distribution of fluoride partitioning among the different olive tree parts showed that the roots accumulated the most fluoride and olive fruits were minimally affected by soil NaF spiking as they had the lowest fluoride content. In fact, total fluoride concentration varied between 12 and 1070µgFg(-1) in roots, between 9 and 570µgFg(-1) in shoots, between 12 and 290µgFg(-1) in leaves, and between 10 and 29µgFg(-1) in fruits, respectively for control and 100mM NaF treatments. Indeed, the fluoride accumulation pattern showed the following distribution: roots>shoots>leaves>fruits. On the other hand, fluoride toxicity symptoms such as leaf necrosis and leaf drop appeared only in highly spiked soils (60, 80 and 100mM NaF). Copyright © 2014 Elsevier Inc. All rights reserved.

  17. Preparation and Characterization of Rare Earth Doped Fluoride Nanoparticles

    Directory of Open Access Journals (Sweden)

    Timothy A. DeVol


    Full Text Available This paper reviews the synthesis, structure and applications of metal fluoride nanoparticles, with particular focus on rare earth (RE doped fluoride nanoparticles obtained by our research group. Nanoparticles were produced by precipitation methods using the ligand ammonium di-n-octadecyldithiophosphate (ADDP that allows the growth of shells around a core particle while simultaneously avoiding particle aggregation. Nanoparticles were characterized on their structure, morphology, and luminescent properties. We discuss the synthesis, properties, and application of heavy metal fluorides; specifically LaF3:RE and PbF2, and group IIA fluorides. Particular attention is given to the synthesis of core/shell nanoparticles, including selectively RE-doped LaF3/LaF3, and CaF2/CaF2 core/(multi-shell nanoparticles, and the CaF2-LaF3 system.

  18. Amelioration of Fluoride Toxicity with the Use of Indigenous Inputs

    Directory of Open Access Journals (Sweden)

    Maitra A.


    Full Text Available An assessment was undertaken to study the efficacy of bacterial consortia isolated from different sources viz. rhizosphere of rice plant, oil spill sites of a petrol pump and from the sludge of a pharmaceutical waste water drain against the impact of fluoride. The experiments were conducted with two crops. In this mung bean experiment Vigna radiata was selected as a test crop. The seeds were sown in the field with bacterial consortia, compost and reduced dose (25% less nitrogen than recommended dose of chemical fertilizer. After 30days of seed sowing (DAS, plants were collected from the field and dipped into the sodium fluoride solution with different concentrations for 48 hours. Thereafter, the impact of fluoride on chlorophyll, sugar, proline and relative water content (% were evaluated. Scanning electron microscopy (SEM of the stem section was performed. SEM studies revealed that anatomical structure deformed with 1.5 mg/l sodium fluoride solution. It was observed that such treatment combination during the sowing of crops leads to combat the impact of lower doses of sodium fluoride (0.2 mg/l. Another experiment was also conducted within plastic pots with and without bacterial consortia isolated from rhizosphere of rice plant and oil spilled soil of petrol pump with the same field soil. Each pot was filled with 5 kg of soil + 2lt of water (on the basis of soil saturation. Oryza sativa seedlings were transplanted with different strength of sodium fluoride solution (25 mgNaF/kg, 50 mgNaF/kg, 100 mgNaF/kg and 500mgNaF/kg within the above pots. In second experiment, rice plants dried in all pots after 500 mgNaF/kg concentration of sodium fluoride. In this pot experiment bacterial strain are capable of reducing fluoride content in soil as noted by measuring fluoride in the pot soil after the experiment.

  19. Sources of fluoride pollution in Kasur district, Pakistan

    International Nuclear Information System (INIS)

    Khan, I.H.; Haq, M.M.I.


    Serious bone problems were reported in certain localities in Pakistan due to contamination of drinking water by fluoride pollution. Against WHO recommended threshold limit of 0.7 mg/L, about 40 mg/L of fluoride is determined by ion chromatographic technique of HPLC. The compositions of pollutants were investigated in the present study by examination the chemical and mineralogical studies of water and soil samples. It is found that main problem in Manga Mandi area of District Kasur, was caused due to the decomposition of phosphorus containing minerals in soil under acidic conditions. The other sources of fluoride contamination in different areas of Pakistan is being investigated. (author)

  20. Short term serum pharmacokinetics of diammine silver fluoride after oral application. (United States)

    Vasquez, Elsa; Zegarra, Graciela; Chirinos, Edgar; Castillo, Jorge L; Taves, Donald R; Watson, Gene E; Dills, Russell; Mancl, Lloyd L; Milgrom, Peter


    There is growing interest in the use of diammine silver fluoride (DSF) as a topical agent to treat dentin hypersensitivity and dental caries as gauged by increasing published research from many parts of the world. While DSF has been available in various formulations for many years, most of its pharmacokinetic aspects within the therapeutic concentration range have never been fully characterized. This preliminary study determined the applied doses (3 teeth treated), maximum serum concentrations, and time to maximum serum concentration for fluoride and silver in 6 adults over 4 h. Fluoride was determined using the indirect diffusion method with a fluoride selective electrode, and silver was determined using inductively coupled plasma-mass spectrometry. The mean amount of DSF solution applied to the 3 teeth was 7.57 mg (6.04 μL). Over the 4 hour observation period, the mean maximum serum concentrations were 1.86 μmol/L for fluoride and 206 nmol/L for silver. These maximums were reached 3.0 h and 2.5 h for fluoride and silver, respectively. Fluoride exposure was below the U.S. Environmental Protection Agency (EPA) oral reference dose. Silver exposure exceeded the EPA oral reference dose for cumulative daily exposure over a lifetime, but for occasional use was well below concentrations associated with toxicity. This preliminary study suggests that serum concentrations of fluoride and silver after topical application of DSF should pose little toxicity risk when used in adults. NCT01664871.

  1. Fluor determination by alkaline hydrolysis of the uranium and thorium fluorides

    International Nuclear Information System (INIS)

    Barrachina Gomez, L.; Gasco Sanchez, L.


    The alkaline hydrolysis of the uranium and thorium fluorides is studded and a new method for the determination of the fluoride, on the basis of a indirect volumetric titration with standard soda, is proposed. The compounds that may influence the hydrolysis of the uranium fluoride and that may be occasionally found in it as impurities are also studied. the method can be applied to the uranium fluoride except when there is a great quantity of F 2 UO 2 or UO 3 present in the sample. (Author) 20 refs

  2. comparative study of fluoride in alcornea cordifolia and commercial

    African Journals Online (AJOL)



    Jul 31, 2013 ... fluoride than the tender stem. Hence, the hard stem is a cheap source of fluoride when compared to commercial ... The importance of addition of 10% zinc .... 1st edition, Prentice Hall, Education Limited, Publisher, Edinburgh.

  3. Fluoride varnish reduces white spot lesions during orthodontic treatment. (United States)

    Shafi, Imran


    This was a randomised controlled trial (RCT) set in a community dental practice. The test varnish was a commercially available product, Fluor Protector (Ivoclar Vivadent, Schaan, Liechtenstein), containing 0.1% fluoride as difluorosilane in a polyurethane varnish base. The placebo varnish applied had an identical composition but without fluoride. The incidence and prevalence of white spot lesions (WSL) on the upper incisors, cuspids and premolars were recorded, as scored from digital photographs by two independent examiners. In the case of disagreement, cases were re-examined until a consensus was achieved. The incidence of WSL during the treatment period was 7.4% in the fluoride varnish group compared with 25.3% placebo group (P <0.001). The mean progression score was significantly lower in the fluoride varnish group than in the placebo group, (0.8 +/- 2.0 vs 2.6 +/- 2.8; P <0.001). The absolute risk reduction was 18% and the number-needed-to-treat was calculated to be 5.5 (95% confidence interval, 3.7-10.9). The results strongly suggest that regular topical fluoride varnish applications may reduce the development of WSL adjacent to the bracket base during treatment with fixed appliances.

  4. Exposure to fluoride in smelter workers in a primary aluminum industry in India. (United States)

    Susheela, A K; Mondal, N K; Singh, A


    Fluoride is used increasingly in a variety of industries in India. Emission of fluoride dust and fumes from the smelters of primary aluminum producing industries is dissipated in the work environment and poses occupational health hazards. To study the prevalence of health complaints and its association with fluoride level in body fluids of smelter workers in a primary aluminum producing industry. In an aluminum industry, health status of 462 smelter workers, 60 supervisors working in the smelter unit, 62 non-smelter workers (control group 1) and 30 administration staff (control group 2) were assessed between 2007 and 2009. Their health complaints were recorded and categorized into 4 groups: 1) gastro-intestinal complaints; 2) non-skeletal manifestations; 3) skeletal symptoms; and (4) respiratory problems. Fluoride level in body fluids, nails, and drinking water was tested by an ion selective electrode; hemoglobin level was tested using HemoCue. The total complaints reported by study groups were significantly higher than the control groups. Smelter workers had a significantly (pworkers; the nail fluoride content was also higher in smelter workers than non-smelter workers (pworkers with higher hemoglobin level had a significantly (pworkers were consuming water with high fluoride concentrations. A high percentage of participants was using substances with high fluoride contents. Industrial emission of fluoride is not the only important sources of fluoride exposure--consumption of substance with high levels of fluoride is another important route of entry of fluoride into the body. Measurement of hemoglobin provides a reliable indicator for monitoring the health status of employees at risk of fluorosis.

  5. Fluoride method for silicon determination i silicovadium

    International Nuclear Information System (INIS)

    Komarnitskaya, N.N.; Sergeev, K.I.; Shamraj, Z.Ya.


    The method used was based on formation of a silicon-potassium fluoride-sodium sediment in strongly acid medium in the presence of excess potassium chloride which decreased the sediment solubility. The sediment was dissolved in hot water to titrate the resultant hydrofluoric acid with a caustic potash solution in the presence of phenolphthalein. Gravity hydrochloric and volumetric fluoride methods were used to compare the results of silicon estimation

  6. Comparison of the toxicity of fluoridation compounds in the nematode Caenorhabditis elegans. (United States)

    Rice, Julie R; Boyd, Windy A; Chandra, Dave; Smith, Marjolein V; Den Besten, Pamela K; Freedman, Jonathan H


    Fluorides are commonly added to drinking water in the United States to decrease the incidence of dental caries. Silicofluorides, such as sodium hexafluorosilicate (Na2 SiF6 ) and fluorosilicic acid (H2 SiF6 ), are mainly used for fluoridation, although fluoride salts such as sodium fluoride (NaF) are also used. Interestingly, only the toxicity of NaF has been examined and not that of the more often used silicofluorides. In the present study, the toxicities of NaF, Na2 SiF6 , and H2 SiF6 were compared. The toxicity of these fluorides on the growth, feeding, and reproduction in the alternative toxicological testing organism Caenorhabditis elegans was examined. Exposure to these compounds produced classic concentration-response toxicity profiles. Although the effects of the fluoride compounds varied among the 3 biological endpoints, no differences were found between the 3 compounds, relative to the fluoride ion concentration, in any of the assays. This suggests that silicofluorides have similar toxicity to NaF. © 2013 SETAC.

  7. [Public water supply fluoridation in Brazil according to health sector leaders]. (United States)

    Ferreira, Regina Glaucia Lucena Aguiar; Bógus, Cláudia Maria; Marques, Regina Auxiliadora de Amorim; Menezes, Léa Maria Bezerra de; Narvai, Paulo Capel


    Various groups have opposed water supply fluoridation in Brazil, while others have supported the measure based on scientific evidence. This article describes the perceptions of delegates to the 13th National Health Conference on mandatory fluoridation of the country's public water supply. Interviews were processed using collective subject discourse analysis. A certain degree of misinformation persists regarding basic characteristics of water fluoridation, which is frequently confused with chlorination. The delegates' discourses showed a continuing need for public awareness-raising regarding fluoridation and the delegates' desire that the National Congress not take measures impacting public health without consulting society's stakeholders. However, most of the interviewees agreed that to repeal mandatory water fluoridation or loosen the control of its implementation could increase the incidence of tooth decay in the population.

  8. Nitrogen Trifluoride-Based Fluoride- Volatility Separations Process: Initial Studies

    Energy Technology Data Exchange (ETDEWEB)

    McNamara, Bruce K.; Scheele, Randall D.; Casella, Andrew M.; Kozelisky, Anne E.


    This document describes the results of our investigations on the potential use of nitrogen trifluoride as the fluorinating and oxidizing agent in fluoride volatility-based used nuclear fuel reprocessing. The conceptual process uses differences in reaction temperatures between nitrogen trifluoride and fuel constituents that produce volatile fluorides to achieve separations and recover valuable constituents. We provide results from our thermodynamic evaluations, thermo-analytical experiments, kinetic models, and provide a preliminary process flowsheet. The evaluations found that nitrogen trifluoride can effectively produce volatile fluorides at different temperatures dependent on the fuel constituent.

  9. Spectrophotometric determination of fluorides in water with Hach equipment

    International Nuclear Information System (INIS)

    Acosta L, E.


    The spectrophotometric method for the determination of the fluoride ion in water, demineralized water, raw waters, laundry waters and waters treated with ion exchange resins , using the technique and the SPADNS coloring indicated in the operation manual of the Hach equipment is described. This method covers the determination of the fluoride ion in the range from 0 to 2 mg/l on 25 ml. of radioactive base sample. These limits can be variable if the size of the used aliquot one is changed for the final determination of the fluoride ion. (Author)

  10. The Role of Calcium in Ameliorating the Oxidative Stress of Fluoride in Rats. (United States)

    Mohamed, N E


    The present study was carried out to investigate the effects of fluoride toxicity on some biochemical, hormonal, and histological parameters of female rats and the protective role of calcium against such effects. Adult female albino rats were divided into five groups; control group received distilled water for 60 days, calcium group received calcium carbonate with dose of 50 mg/kg three times per week for 60 days, fluoride group received sodium fluoride with dose of 20 mg/kg three times per week for 60 days, calcium + fluoride group received calcium carbonate (50 mg/kg) then after 2 h received sodium fluoride (20 mg/kg) three times per week for 60 days, and fluoride + calcium group received sodium fluoride (20 mg/kg) three times per week for 30 days then received calcium carbonate (50 mg/kg) three times per week for another 30 days. The results showed that the levels of thiobarbituric acid reactive substances, urea, creatinine, alkaline phosphatase, triiodothyronine, thyroxine, parathormone, phosphorous, magnesium, alanine aminotransferase, aspartate aminotransferase, alkaline phosphatase, and gamma glutamyl transferase were significantly increased in rats treated with fluoride while serum estradiol, calcium, and organ glutathione were significantly decreased. The histological examination of the femur bone revealed that fluoride treatment induced thinning of bone trabeculae with wilding of marrow space, demineralization, and loss of trabeculae interconnections. Also, the histological examination of hepatic and renal tissues of fluoride-treated rats showed some damages in these tissues while administration of calcium carbonate for 30 or 60 days during fluoride treatment minimized such damages. It could be concluded that administration of calcium to female rats can ameliorate the hazardous effects of fluoride observed in the biochemical, hormonal, and histological parameters.

  11. Fluoride in weathered rock aquifers of southern India: Managed Aquifer Recharge for mitigation. (United States)

    Brindha, K; Jagadeshan, G; Kalpana, L; Elango, L


    Climatic condition, geology, and geochemical processes in an area play a major role on groundwater quality. Impact of these on the fluoride content of groundwater was studied in three regions-part of Nalgonda district in Telangana, Pambar River basin, and Vaniyar River basin in Tamil Nadu, southern India, which experience semi-arid climate and are predominantly made of Precambrian rocks. High concentration of fluoride in groundwater above 4 mg/l was recorded. Human exposure dose for fluoride through groundwater was higher in Nalgonda than the other areas. With evaporation and rainfall being one of the major contributors for high fluoride apart from the weathering of fluoride rich minerals from rocks, the effect of increase in groundwater level on fluoride concentration was studied. This study reveals that groundwater in shallow environment of all three regions shows dilution effect due to rainfall recharge. Suitable managed aquifer recharge (MAR) methods can be adopted to dilute the fluoride rich groundwater in such regions which is explained with two case studies. However, in deep groundwater, increase in fluoride concentration with increase in groundwater level due to leaching of fluoride rich salts from the unsaturated zone was observed. Occurrence of fluoride above 1.5 mg/l was more in areas with deeper groundwater environment. Hence, practicing MAR in these regions will increase the fluoride content in groundwater and so physical or chemical treatment has to be adopted. This study brought out the fact that MAR cannot be practiced in all regions for dilution of ions in groundwater and that it is essential to analyze the fluctuation in groundwater level and the fluoride content before suggesting it as a suitable solution. Also, this study emphasizes that long-term monitoring of these factors is an important criterion for choosing the recharge areas.

  12. Effect of Fluoride, Casein Phosphopeptide–Amorphous Calcium Phosphate and Casein Phosphopeptide–Amorphous Calcium Phosphate Fluoride on Enamel Surface Microhardness After Microabrasion: An In Vitro Study

    Directory of Open Access Journals (Sweden)

    Ghazaleh Ahmadi Zenouz


    Full Text Available Objectives: This study aimed to assess the effect of applying casein phosphopeptide–amorphous calcium phosphate (CPP-ACP paste, casein phosphopeptide–amorphous calcium phosphate fluoride (CPP-ACPF paste and sodium fluoride gel on surface microhardness of enamel after microabrasion.Materials and Methods: Thirty freshly extracted human premolars were selected. All samples were subjected to hardness indentations made with the Vickers hardness machine and the average value was recorded as the initial surface microhardness. The specimens were then randomly divided into three groups (n=10 of CPP-ACPF, fluoride and CPP-ACP. The teeth were micro-abraded with Opalustre. Microhardness test was performed to assess the post-abrasion hardness. Three remineralization modalities were performed on samples of each group. The enamel surface microhardness measurements were performed. To compare the difference between groups, the rehardening and softening values were defined. One-way ANOVA and Tukey’s post hoc test at a significance level of 5% were used for statistical analysis.Results: The mean microhardness value (MMV had a significant decrease after microabrasion from baseline. The MMV had a significant increase after remineralization in all groups. The MMV of CPP-ACPF group was significantly more than that of fluoride group (P=0.027. The rehardening value of fluoride group was significantly more than that of other groups (P<0.001.Conclusion: All the remineralizing agents were effective for rehardening the enamel after microabrasion. The CPP-ACP and CPP-ACPF pastes are effective, but to a lesser extent than neutral sodium fluoride gel in remineralizing enamel surface. Incorporation of fluoride to CPP-ACP formulation does not provide any additional remineralizing potential.Keywords: Casein phosphopeptide-amorphous calcium phosphate nanocomplex; Enamel Microabrasion; Hardness; Sodium Fluoride

  13. Identification of an operon involved in fluoride resistance in Enterobacter cloacae FRM


    Liu, Xiaoqing; Tian, Jian; Liu, Lihui; Zhu, Tao; Yu, Xiaoxia; Chu, Xiaoyu; Yao, Bin; Wu, Ningfeng; Fan, Yunliu


    Fluorine is ubiquitous and the most active non-metal element in nature. While many microorganisms have developed fluoride resistance as a result of the widespread and prolonged application of oral hygiene products, the mechanisms used by these organisms to overcome fluoride toxicity are incompletely understood. In this study, a fluoride-resistant strain, Enterobacter cloacae FRM, was identified which could grow well at a fluoride concentration of 4,000?mg/L. According to comparative genomics,...

  14. Proximal renal tubular injury in rats sub-chronically exposed to low fluoride concentrations

    Energy Technology Data Exchange (ETDEWEB)

    Cárdenas-González, Mariana C.; Del Razo, Luz M. [Departmento de Toxicología, Centro de Investigación y de Estudios Avanzados del Instituto Politécnico Nacional (CINVESTAV-IPN), México, D. F., México (Mexico); Barrera-Chimal, Jonatan [Unidad de Fisiología Molecular, Instituto de Investigaciones Biomédicas, Universidad Nacional Autónoma de México and Instituto Nacional de Ciencias Médicas y Nutrición Salvador Zubirán, México, D. F., México (Mexico); Jacobo-Estrada, Tania [Departmento de Toxicología, Centro de Investigación y de Estudios Avanzados del Instituto Politécnico Nacional (CINVESTAV-IPN), México, D. F., México (Mexico); López-Bayghen, Esther [Departamento de Genética y Biología Molecular, Centro de Investigación y de Estudios Avanzados del Instituto Politécnico Nacional (CINVESTAV-IPN), México, D. F., México (Mexico); and others


    Fluoride is usually found in groundwater at a very wide range of concentration between 0.5 and 25 ppm. At present, few studies have assessed the renal effects of fluoride at environmentally relevant concentrations. Furthermore, most of these studies have used insensitive and nonspecific biomarkers of kidney injury. The aim of this study was to use early and sensitive biomarkers to evaluate kidney injury after fluoride exposure to environmentally relevant concentrations. Recently weaned male Wistar rats were exposed to low (15 ppm) and high (50 ppm) fluoride concentrations in drinking water for a period of 40 days. At the end of the exposure period, kidney injury biomarkers were measured in urine and renal mRNA expression levels were assessed by real time RT-PCR. Our results showed that the urinary kidney injury molecule (Kim-1), clusterin (Clu), osteopontin (OPN) and heat shock protein 72 excretion rate significantly increased in the group exposed to the high fluoride concentration. Accordingly, fluoride exposure increased renal Kim-1, Clu and OPN mRNA expression levels. Moreover, there was a significant dose-dependent increase in urinary β-2-microglobulin and cystatin-C excretion rate. Additionally, a tendency towards a dose dependent increase of tubular damage in the histopathological light microscopy findings confirmed the preferential impact of fluoride on the tubular structure. All of these changes occurred at early stages in which, the renal function was not altered. In conclusion using early and sensitive biomarkers of kidney injury, we were able to found proximal tubular alterations in rats sub-chronically exposed to fluoride. - Highlights: • Exposure to low concentrations of fluoride induced proximal tubular injury • Increase in urinary Kim-1, Clu, OPN and Hsp72 in 50 ppm fluoride-exposed group • Increase in urinary B2M and CysC in 15 and 50 ppm fluoride-exposed groups • Fluoride exposure increased renal Kim, Clu and OPN mRNA expression levels.

  15. Fluoridated elastomers: effect on the microbiology of plaque. (United States)

    Benson, Philip E; Douglas, C W Ian; Martin, Michael V


    The objective of this study was to investigate the effect of fluoridated elastomeric ligatures on the microbiology of local dental plaque in vivo. This randomized, prospective, longitudinal, clinical trial had a split-mouth crossover design. The subjects were 30 patients at the beginning of their treatment with fixed orthodontic appliances in the orthodontic departments of the Liverpool and the Sheffield dental hospitals in the United Kingdom. The study consisted of 2 experimental periods of 6 weeks with a washout period between. Fluoridated elastomers were randomly allocated at the first visit to be placed around brackets on tooth numbers 12, 11, 33 or 22, 21, 43. Nonfluoridated elastomers were placed on the contralateral teeth. Standard nonantibacterial fluoridated toothpaste and mouthwash were supplied. After 6 weeks (visit 2), the elastomers were removed, placed in transport media, and plated on agar within 2 hours. Nonfluoridated elastomers were placed on all brackets for 1 visit to allow for a washout period. At visit 3, fluoridated elastomers were placed on the teeth contralateral to those that received them at visit 1. At visit 4, the procedures at visit 2 were repeated. Samples were collected on visits 2 and 4. A logistic regression was performed, with the presence or absence of streptococcal or anaerobic growth as the dependent variable. A mixed-effects analysis of variance was carried out with the percentage of streptococcal or anaerobic bacterial count as the dependent variable. The only significant independent variables were the subject variable (P =bacterial count and the visit variable for the percentage of streptococcal count (P =fluoridated or nonfluoridated elastomers was not significant for percentage of either streptococcal (P =.288) or anaerobic count (P =.230). Fluoridated elastomers are not effective at reducing local streptococcal or anaerobic bacterial growth after a clinically relevant time in the mouth.

  16. The influence of lifelong exposure to environmental fluoride on bone quality in humans (United States)

    Chachra, Debbie

    The objective of this study was to determine if lifelong exposure to environmental sources of fluoride (including fluoridated water) had an effect on bone quality in humans. Ninety-two femoral heads were obtained from individuals undergoing total hip arthroplasty in regions with and without fluoridated water (Toronto and Montreal, respectively), so that the donors would have had a wide range of fluoride exposure. As the samples were obtained at surgery, the femoral heads were affected by osteoarthritis (75), osteoporosis (9) and other diseases. The fluoride content of cancellous bone was assessed by instrumental neutron activation analysis. A number of contributors to bone quality were assessed. The compressive and torsional mechanical properties were measured for cancellous cores excised from the centre of the femoral head. The architecture was assessed by image analysis of an x-ray of a 5 mm thick coronal section of the femoral head, as well as of histological sections taken from the superior (weightbearing) and the inferior (nonweightbearing) surface of the femoral head. The degree of mineralization was measured using backscattered electron imaging and microhardness, again at the superior and the inferior surface. Femoral heads from Toronto donors had a greater mean fluoride content than those from Montreal donors (1033 +/- 438 ppm vs. 643 +/- 220 ppm). However, the fluoride content of the Toronto donors ranged approximately twelve-fold (192--2264 ppm) and entirely contained the range of Montreal donors. Therefore, fluoridated water exposure is not the only determinant of fluoride content. The logarithm of the bone fluoride content increased with age. No substantive effect of fluoride, independent of age, was observed for the mechanical properties. Similarly, at the inferior surface, the architecture was affected by age but not by fluoride incorporation but the degree of mineralization was not affected by either. However, the degree of mineralization (measured

  17. Short term serum pharmacokinetics of diammine silver fluoride after oral application

    Directory of Open Access Journals (Sweden)

    Vasquez Elsa


    Full Text Available Abstract Background There is growing interest in the use of diammine silver fluoride (DSF as a topical agent to treat dentin hypersensitivity and dental caries as gauged by increasing published research from many parts of the world. While DSF has been available in various formulations for many years, most of its pharmacokinetic aspects within the therapeutic concentration range have never been fully characterized. Methods This preliminary study determined the applied doses (3 teeth treated, maximum serum concentrations, and time to maximum serum concentration for fluoride and silver in 6 adults over 4 h. Fluoride was determined using the indirect diffusion method with a fluoride selective electrode, and silver was determined using inductively coupled plasma-mass spectrometry. The mean amount of DSF solution applied to the 3 teeth was 7.57 mg (6.04 μL. Results Over the 4 hour observation period, the mean maximum serum concentrations were 1.86 μmol/L for fluoride and 206 nmol/L for silver. These maximums were reached 3.0 h and 2.5 h for fluoride and silver, respectively. Conclusions Fluoride exposure was below the U.S. Environmental Protection Agency (EPA oral reference dose. Silver exposure exceeded the EPA oral reference dose for cumulative daily exposure over a lifetime, but for occasional use was well below concentrations associated with toxicity. This preliminary study suggests that serum concentrations of fluoride and silver after topical application of DSF should pose little toxicity risk when used in adults. Clinical trials registration NCT01664871.

  18. Effect of dog food containing 460 ppm fluoride on rat reproduction. (United States)

    Marks, T A; Schellenberg, D; Metzler, C M; Oostveen, J; Morey, M J


    A one-generation, two-litter rat reproduction study was done in a kennel in Allegan County, Michigan, as part of an investigation of reproductive problems in Shetland sheepdogs (shelties). Since 1970, at least 115 sheltie litters at this kennel have been grossly deformed and/or have died, generally within 3 d of birth. The causative factor(s) appears to be associated with the environment, as the shelties have had successful pregnancies elsewhere. There was some concern that a potential threat to human reproduction also might exist in this area. After it was discovered that fluoride in the dog food had apparently caused mottled teeth and bony exostoses in dogs at this and at least two other kennels, dog-food fluoride content and local well water were investigated as possible causes of the reproductive problems. A two-way factorial statistical design allowed assessment of dietary fluoride content and water source and interaction between the two. UPj:TUC(SD)spf rats, 9 males and 18 females in each group, were assigned to treatment with high-fluoride dog food (460 ppm) and well water; high-fluoride dog food and distilled water; low-fluoride dog food (56 ppm) and well water; and low-fluoride dog food and distilled water. After 60 d in the kennel, the rats were mated. Even after two litters, the only adverse effect was dental fluorosis in the high-fluoride groups. The results indicated that rats cannot be used in the search for the cause(s) of reproductive problems in dogs in this kennel.

  19. A role for PERK in the mechanism underlying fluoride-induced bone turnover

    International Nuclear Information System (INIS)

    Sun, Fei; Li, Xining; Yang, Chen; Lv, Peng; Li, Guangsheng; Xu, Hui


    While it has been well-documented that excessive fluoride exposure caused the skeletal disease and osteoblasts played a critical role in the advanced skeletal fluorosis, the underlying mechanism that mediated these effects remain poorly understood. The present study was undertaken to examine the effect of fluoride on bone of rats and MC3T3-E1 cells in vitro. Herein we found pathological features of high bone turnover in fluoride-treated rats, which was supported by an increase of osteogenic and osteoclastogenic genes expression in different stages of fluoride exposure. The skeletal toxicity of fluoride was accompanied by activation of endoplasmic reticulum (ER) stress and subsequent unfolded protein response (UPR). A novel finding of this study was that expression of PKR-like endoplasmic reticulum kinase (PERK) was the same trend with receptor activator for nuclear factor-κ B ligand (RANKL), and NF-E2 p45-related factor 2 (Nrf2) was the same trend with Runt-related transcription factor 2 (Runx2) in bones of rats exposed to varied fluoride condition. Based on these data, we hypothesized that up-regulation of PERK probably played a role in mediating bone turnover induced by fluoride. Action of fluoride on MC3T3-E1 cells differentiation was demonstrated through analysis of alkaline phosphatase (ALP) activity and mineralized nodules formation. Meantime, an increase of binding immunoglobulin protein (BiP) expression indicated the active ER stress in cells exposed to various dose of fluoride. Blocking PERK expression using siRNA showed the obvious decrease of osteogenic and osteoclastogenic factors expression in MC3T3-E1 cells exposed to certain dose of fluoride that could positively stimulate osteoblastic viability. In conclusion these findings underscore the importance of PERK in modulating fluoride induced bone formation and bone resorption. Understanding the link between PERK and bone turnover could probe into the mechanism underlying different bone lesion of

  20. An Overview of Liquid Fluoride Salt Heat Transport Systems

    Energy Technology Data Exchange (ETDEWEB)

    Holcomb, David Eugene [ORNL; Cetiner, Sacit M [ORNL


    Heat transport is central to all thermal-based forms of electricity generation. The ever increasing demand for higher thermal efficiency necessitates power generation cycles transitioning to progressively higher temperatures. Similarly, the desire to provide direct thermal coupling between heat sources and higher temperature chemical processes provides the underlying incentive to move toward higher temperature heat transfer loops. As the system temperature rises, the available materials and technology choices become progressively more limited. Superficially, fluoride salts at {approx}700 C resemble water at room temperature being optically transparent and having similar heat capacity, roughly three times the viscosity, and about twice the density. Fluoride salts are a leading candidate heat-transport material at high temperatures. Fluoride salts have been extensively used in specialized industrial processes for decades, yet they have not entered widespread deployment for general heat transport purposes. This report does not provide an exhaustive screening of potential heat transfer media and other high temperature liquids such as alkali metal carbonate eutectics or chloride salts may have economic or technological advantages. A particular advantage of fluoride salts is that the technology for their use is relatively mature as they were extensively studied during the 1940s-1970s as part of the U.S. Atomic Energy Commission's program to develop molten salt reactors (MSRs). However, the instrumentation, components, and practices for use of fluoride salts are not yet developed sufficiently for commercial implementation. This report provides an overview of the current understanding of the technologies involved in liquid salt heat transport (LSHT) along with providing references to the more detailed primary information resources. Much of the information presented here derives from the earlier MSR program. However, technology has evolved over the intervening years

  1. Parents' attitudes towards topical fluoride and vaccines for children: Are these distinct or overlapping phenomena?

    Directory of Open Access Journals (Sweden)

    Richard M. Carpiano


    Full Text Available Despite attention paid to parental refusal of child vaccines, the phenomenon of topical fluoride refusal is poorly understood. We examine the extent to which parent attitudes and Internet use regarding topical fluoride treatment and vaccines may overlap and, in turn, uniquely or distinctly correlate with fluoride and vaccine refusal for the child. In 2017, we analyzed data collected from 2011 to 12 for 361 children from three Washington state dental clinics. The instrument included analogous measures of topical fluoride and vaccine safety concerns, perceived severity of preventable cavities/disease, and Internet use for fluoride/vaccine information; and measures of non-fluoridated toothpaste use, attitudes towards dental x-rays and amalgam and composite fillings. We assessed dental chart-based topical fluoride refusal occurring in 2009 or 2010 and parent-reported vaccine refusal. All analogous fluoride and vaccine items were substantively correlated. However, in a series of adjusted models, none of these items were significantly associated with fluoride refusal. Multiple fluoride and vaccine items were associated with vaccine refusal in unadjusted models; but only vaccine safety concerns, perceived severity of a preventable cavity, and Internet use for vaccine information remained significant in adjusted models. Although there is concordance between the two refusal behaviors as well as analogous attitudes and Internet use, these findings challenge the idea that fluoride refusal should be addressed with interventions focusing on vaccine refusal. Further research is required on the factors underlying refusal of preventive dental care. Keywords: Vaccinations, Topical fluoride, Vaccination refusal, Fluoride refusal, Vaccine hesitancy, Fluoride hesitancy, Children, Adolescents, Preventive treatment, United States

  2. Inhibition of purified enolases from oral bacteria by fluoride. (United States)

    Guha-Chowdhury, N; Clark, A G; Sissons, C H


    Enolase activity in strains of oral streptococci previously has been found to be inhibited by 50% (Ki) by fluoride concentrations ranging from 50 to 300 microM or more in the presence of 0.5 to 1.0 mM inorganic phosphate ions. In this study, enolase was extracted and partly purified by a two-step process from five oral bacterial species and the effect of fluoride on the kinetics of enolase examined. The molecular weight of the putative enolase proteins was 46-48 kDa. The Vmax values ranged from 20 to 323 IU/mg and K(m) for glycerate-2-phosphate from 0.22 to 0.74 mM. Enolase activity was inhibited competitively by fluoride, with Ki values ranging from 16 to 54 microM in the presence of 5 mM inorganic phosphate ions. Ki values for phosphate ranged from 2 to 8 mM. The enolase from Streptococcus sanguis ATCC 10556 was more sensitive to fluoride (Ki = 16 +/- 2) than was enolase from Streptococcus salivarius ATCC 10575 (Ki = 19 +/- 2) or Streptococcus mutans NCTC 10449 (Ki = 40 +/- 4) and all three streptococcal strains were more sensitive to fluoride than either Actinomyces naeslundii WVU 627 (Ki = 46 +/- 6) or Lactobacillus rhamnosus ATCC 7469 (Ki = 54 +/- 6) enolases. The levels of fluoride found to inhibit the streptococcal enolases in this study are much lower than previously reported and are likely to be present in plaque, especially during acidogenesis, and could exert an anti-glycolytic effect.

  3. Root caries prevention via sodium fluoride, chlorhexidine and silver diamine fluoride in vitro. (United States)

    Göstemeyer, Gerd; Kohls, Anna; Paris, Sebastian; Schwendicke, Falk


    Uncertainty exists as to how to best prevent root caries development. The aim of the present study was to compare sodium fluoride (NaF), chlorhexidine (CHX) and silver diamine fluoride (SDF) varnishes (V) and rinses (R) regarding their caries preventive effect in an artificial caries biofilm model. 140 bovine root dentin samples were cut, polished and embedded. Samples were allocated to seven treatment groups (n = 20/group): Four varnishes (applied once prior biofilm challenge): 38% SDF (SDFV), 35% CHX-varnish (CHXV), 22,600 ppm NaF-varnish (NaFV), placebo-varnish (PV); two rinses (applied once daily during biofilm challenge): 500 ppm NaF solution (NaFR), 0.1% CHX solution (CHXR); one untreated group. Caries was induced in a multi-station, continuous-culture Lactobacillus rhamnosus GG (LGG) biofilm model. Bacteria were inoculated 1 × daily, while 2% sucrose was supplied 8 ×/day followed by artificial saliva for 10 min. After 12 days, mineral loss (ΔZ) was measured in the effect area and adjacent to the varnished areas. Bacterial counts were assessed on de-Man-Rogosa-Sharpe agar. ΔZ was significantly lower in the NaFR group compared with all other groups. Varnishes did not significantly prevent mineral loss in adjacent areas. None of the agents had a significant antimicrobial effect on LGG. Regular fluoride rinses showed highest root caries-preventive effect.

  4. Effects of fluoride residue on thermal stability in Cu/porous low-k interconnects

    Energy Technology Data Exchange (ETDEWEB)

    Kobayashi, Y.; Ozaki, S.; Nakamura, T. [FUJITSU LABORATORIES Ltd., 10-1 Morinosato-Wakamiya, Atsugi, Kanagawa 243-0197 (Japan)


    We have investigated the effects of fluoride residue on the thermal stability of a Cu/barrier metal (BM)/porous low-k film (k < 2.3) structure. We confirmed that the Cu agglomerated more on a BM/inter layer dielectric (ILD) with a fluoride residue. To consider the effect of fluoride residue on Cu agglomeration, the structural state at the Cu/BM interface was evaluated with a cross-section transmission electron microscope (TEM) and atomic force microscope (AFM). In addition, the chemical bonding state at the Cu/BM interface was evaluated with the interface peeling-off method and X-ray photoelectron spectroscopy (XPS). Moreover, we confirmed the ionization of fluoride residue and oxidation of Cu with fluoride and moisture to clarify the effect of fluoride residue on Cu. Our experimental results indicated that the thermal stability in Cu/porous low-k interconnects was degraded by enhancement of Cu oxidation with fluoride ions diffusion as an oxidizing catalyst.

  5. Organoboron compounds as Lewis acid receptors of fluoride ions in polymeric membranes. (United States)

    Jańczyk, Martyna; Adamczyk-Woźniak, Agnieszka; Sporzyński, Andrzej; Wróblewski, Wojciech


    Newly synthesized organoboron compounds - 4-octyloxyphenylboronic acid (OPBA) and pinacol ester of 2,4,6-trifluorophenylboronic acid (PE-PBA) - were applied as Lewis acid receptors of fluoride anions. Despite enhanced selectivity, the polymer membrane electrodes containing the lipophilic receptor OPBA exhibited non-Nernstian slopes of the responses toward fluoride ions in acidic conditions. Such behavior was explained by the lability of the B-O bond in the boronic acids, and the OH(-)/F(-) exchange at higher fluoride content in the sample solution. In consequence, the stoichiometry of the OPBA-fluoride complexes in the membrane could vary during the calibration, changing the equilibrium concentration of the primary anion in membrane and providing super-Nernstian responses. The proposed mechanism was supported by (19)F NMR studies, which indicated that the fluoride complexation proceeds more effectively in acidic solution leading mainly to PhBF(3)(-) species. Finally, the performances of the membranes based on the phenylboronic acid pinacol ester, with a more stable B-O bond, were tested. As it was expected, Nernstian fluoride responses were recorded for such membranes with worsened fluoride selectivity. Copyright © 2012 Elsevier B.V. All rights reserved.

  6. Effect of a 5000 ppm fluoride toothpaste and a 250 ppm fluoride mouth rinse on the demineralisation of dentin surfaces. (United States)

    Bizhang, Mozhgan; Chun, Yong-Hee P; Winterfeld, Mai-Trinh; Altenburger, Markus J; Raab, Wolfgang H M; Zimmer, Stefan


    The purpose of this study was to test the null hypothesis that there is no difference between the effect of (1) a 5000 ppm fluoride toothpaste, and (2) a 250 ppm fluoride mouth rinse on demineralized human dentin surfaces, against the alternative hypothesis of a difference. Dentin specimens were obtained from the cervical regions of 45 extracted human third molars. Half the surface of each specimen was sealed with a self-etching adhesive system and served as the reference surface. The dentin specimens were randomly assigned to one of the three groups, 5000 ppm fluoride toothpaste (Duraphat), 250 ppm fluoride mouth rinse (Meridol) and distilled water (negative control).An intraoral appliance was made for one volunteer. In each test cycle, 15 specimens were inserted in the appliance and worn for 24 hours a day, over a period of three weeks.Once daily, the appliance was immersed in the agent being tested; either toothpaste slurry, mouth rinse or distilled water for 60 seconds.Demineralization was assessed in terms of lesion depth (microm) and mineral loss (vol. % x microm) by transversal microradiography. Data analysis was accomplished using Kolmogorov-Smirnov test and ANOVA (SPSS 12.0).Statistically significant differences for mineral loss and lesion depth were found between the toothpaste and the mouth rinse as well as between the toothpaste and the control group, but not between the mouth rinse and the control group. Within the limitations of this study, the results suggest that treatment of demineralised dentin with a toothpaste containing 5000 ppm fluoride may considerably reduce mineral loss and lesion depth on exposed dentin.

  7. Effect of sodium fluoride in maternal and offspring rats and its amelioration

    Directory of Open Access Journals (Sweden)

    Sneha Panchal


    Full Text Available High fluoride content is known to cause dental and skeletal abnormalities. In addition, present review indicates that sodium fluoride consumption caused increased number of r=esorptions and dead foetuses. Various skeletal anomalies such as wavy ribs, presence of 14th ribs, lacking 6th sternebrae and incompete ossification of skull occur. All these changes could be due to oxidative stress caused by fluoride consumption. Fluoride-induced changes could be successfully ameliorated by cotreatment with vitamins and calcium.

  8. Thermal stability of homo- and copolymers of vinyl fluoride

    International Nuclear Information System (INIS)

    Raucher, D.; Levy, M.


    The thermal stability of poly(vinyl fluoride)(PVF) was studied by thermal gravimetry and mass spectrometry (TGA and TGA-MS). In low-molecular-weight polymers a two-step decomposition pattern was observed. It consisted of the dehydrofluorination to a polyene chain followed by decomposition of the resulting polyene at higher temperatures. Copolymers of vinyl fluoride-vinyl acetate (VF-VAc) and vinyl fluoride-vinyl chloride (VF-VCl) showed a simultaneous evolution of hydrofluoric acid and acetic acid and hydrofluoric acid and hydrochloric acid, respectively. This suggests that after the elimination of the weakest link a spontaneous elimination of neighboring HF molecules takes place

  9. Monitoring of fluoride and iodide levels in drinking water using ion selective electrodes

    International Nuclear Information System (INIS)

    Ahmed, R.; Viqar-Un-Nisa; Hussain, M.; Tanwir, R.; Qureshi, S.A.


    Fluoride and iodide, the most important constituents of drinking water are essential as well as toxic depending on their levels. For their analysis in water mostly ion-selective electrodes, spectrophotometry, titrimetry and coulometry etc; have been used and literature has been briefly reviewed. Ion-selective electrodes offer an efficient method for the measurement of the two halides and were mostly used during this work. Fabrication of these electrodes is briefly described. Comparison of results obtained by ion selective electrode and coulometry is given. Recoveries of the added fluoride ions from the samples were good. A large number of water samples from Rawalpindi-Islamabad area were analyzed for fluoride and iodide. Levels of fluoride and iodide from two main water reservoirs of Rawalpindi and Islamabad are reported before and after treatment. Both surface and ground water samples were analyzed and results are compared and discussed. Some samples from northern areas were also analyzed for iodide and fluoride and compared. Intake of fluoride and iodide from water of different areas is also compared. Water samples, which caused bone deformation in certain areas in Punjab due to excess fluoride, were also analyzed for fluoride and results are presented. (author)

  10. Effect of Resveratrol on Hematological and Biochemical Alterations in Rats Exposed to Fluoride

    Directory of Open Access Journals (Sweden)

    Nurgül Atmaca


    Full Text Available We investigated the protective effects of resveratrol on hematological and biochemical changes induced by fluoride in rats. A total of 28 rats were divided into 4 groups: control, resveratrol, fluoride, and fluoride/resveratrol (n=7 each, for a total of 21 days of treatment. Blood samples were taken and hematological and biochemical parameters were measured. Compared to the control group, the fluoride-treated group showed significant differences in several hematological parameters, including decreases in WBC, RBC, and PLT counts and neutrophil ratio. The group that received resveratrol alone showed a decrease in WBC count compared to the control group. Furthermore, in comparison to the control group, the fluoride group showed significantly increased ALT enzyme activity and decreased inorganic phosphorus level. The hematological and biochemical parameters in the fluoride + resveratrol treated group were similar to control group. In the fluoride + resveratrol group, resveratrol restored the changes observed following fluoride treatment, including decreased counts of WBC, RBC, and PLT, decreased neutrophil ratio and inorganic phosphorus levels, and elevated ALT enzyme activity. The present study showed that fluoride caused adverse effects in rats and that resveratrol reduced hematological and biochemical alterations produced by fluoride exposure.

  11. An in situ caries study on the interplay between fluoride dose and concentration in milk. (United States)

    Lippert, F; Martinez-Mier, E A; Zero, D T


    This randomized, cross-over in situ study investigated the impact of sodium fluoride dose and concentration in milk on caries lesion rehardening, fluoridation and acid resistance. Twenty-eight subjects wore two gauze-covered enamel specimens with preformed lesions placed buccally on their mandibular partial dentures for three weeks. Participants used fluoride-free dentifrice throughout the study and consumed once daily one of the five study treatments: no fluoride in 200 ml milk (0F-200), 1.5 or 3 mg fluoride in either 100 (1.5F-100; 3F-100) or 200 ml milk (1.5F-200; 3F-200). After three weeks, specimens were retrieved. Knoop hardness was used to determine rehardening and resistance to a secondary acid challenge. Enamel fluoride uptake (EFU) was determined using a microbiopsy technique. A linear fluoride dose-response was observed for all study variables which exhibited similar overall patterns. All the treatments resulted in rehardening, with 0F-200 inducing the least and 3F-100 the most. Apart from 1.5F-200, all the treatments resulted in statistically significantly more rehardening compared to 0F-200. The fluoride doses delivered in 100 ml provided directionally although not statistically significantly more rehardening than those delivered in 200 ml milk. EFU data exhibited better differentiation between treatments: all fluoridated milk treatments delivered more fluoride to lesions than 0F-200; fluoride in 100 ml demonstrated statistically significantly higher EFU than fluoride in 200 ml milk. Findings for acid resistance were also more discerning than rehardening data. The present study has provided further evidence for the anti-caries benefits of fluoridated milk. Both fluoride dose and concentration appear to impact the cariostatic properties of fluoride in milk. Copyright © 2014 Elsevier Ltd. All rights reserved.

  12. Western Australian schools access to dentally optimal fluoridated water. (United States)

    Desai, P; Kruger, E; Trolio, R; Tennant, M


    This study examined water fluoride levels at schools across Western Australia. The aim was to identify schools where levels of water fluoride appeared to be below dental health thresholds (0.5-1.0 mg/L) as recommended by the National Health and Medical Research Council (NHMRC). The objective is to provide health organizations with the knowledge for a more targeted approach to schools with greater risk of decay. Population data, school location, enrolment data and water quality data were integrated into geographic databases for analysis using Quantum GIS, Lisboa 1.8. The results indicated that 46% of school attendees in the northern half of Western Australia were at schools where there was the potential that the water was not dentally optimally fluoridated while in the southern half of Western Australia this was about 10%. Of these attendees (north and south), 45% were at primary school. Similarly, there was an association between socio-economic decile and proportion of school attendees in non-dentally optimally fluoridated schools. Lower deciles (i.e. poorer attendees) had a greater risk of being in schools outside dentally optimally fluoridated areas. This study clearly highlights areas where more prevention (and probably) treatment needs are present and provides a framework for targeted service planning. © 2015 Australian Dental Association.

  13. [In vivo retention of KOH soluble and firmly bound fluoride in demineralized dental enamel]. (United States)

    Hellwig, E; Klimek, J; Albert, G


    Cylindrical enamel blocks with initial carious lesions were treated for one hour with Duraphat or Fluor-Protector. After removal of the fluoride varnishes the enamel blocks were kept in the mouths of 3 probands for 5 days. Plaque was allowed to accumulate on half of the enamel cylinders, while the other half was kept clean. Part of the enamel cylinders were retained as fluoridated controls. Compared with Duraphat the application of Fluor-Protector resulted in a significantly higher uptake of KOH soluble and firmly bound fluoride. During the 5 days of the experiment the amount of KOH soluble fluorides decreased in both groups. In the presence of plaque the fluoride loss was higher. The amount of firmly bound fluoride increased both in the plaque covered and in the clean enamel. The durable cariostatic effect of fluoridated varnishes seems to be due to the slow dissolution of Ca F2-like precipitates on the enamel surface and the concomitant fluoride uptake in the underlying demineralized enamel.

  14. The effect of different fluoride application methods on the remineralization of initial carious lesions. (United States)

    Byeon, Seon Mi; Lee, Min Ho; Bae, Tae Sung


    The purpose of this study was to assess the effect of single and combined applications of fluoride on the amount of fluoride release, and the remineralization and physical properties of enamel. Each of four fluoride varnish and gel products (Fluor Protector, FP, Ivoclar Vivadent; Tooth Mousse Plus, TM, GC; 60 Second Gel, A, Germiphene; CavityShield, CS, 3M ESPE) and two fluoride solutions (2% sodium fluoride, N; 8% tin(ii) fluoride, S) were applied on bovine teeth using single and combined methods (10 per group), and then the amount of fluoride release was measured for 4 wk. The electron probe microanalysis and the Vickers microhardness measurements were conducted to assess the effect of fluoride application on the surface properties of bovine teeth. The amount of fluoride release was higher in combined applications than in single application (p < 0.05). Microhardness values were higher after combined applications of N with FP, TM, and CS than single application of them, and these values were also higher after combined applications of S than single application of A (p < 0.05). Ca and P values were higher in combined applications of N with TM and CS than single application of them (p < 0.05). They were also increased after combined applications of the S with A than after single application (p < 0.05). Combined applications of fluoride could be used as a basis to design more effective methods of fluoride application to provide enhanced remineralization.

  15. Fluoride-associated ultrastructural changes and apoptosis in human renal tubule: a pilot study. (United States)

    Quadri, J A; Sarwar, S; Sinha, A; Kalaivani, M; Dinda, A K; Bagga, A; Roy, T S; Das, T K; Shariff, A


    The susceptibility of the kidneys to fluoride toxicity can largely be attributed to its anatomy and function. As the filtrate moves along the complex tubular structure of each nephron, it is concentrated in the proximal and distal tubules and collecting duct. It has been frequently observed that the children suffering from renal impairments also have some symptoms of dental and skeletal fluorosis. The findings suggest that fluoride somehow interferes with renal anatomy and physiology, which may lead to renal pathogenesis. The aim of this study was to evaluate the fluoride-associated nephrotoxicity. A total of 156 patients with childhood nephrotic syndrome were screened and it was observed that 32 of them had significantly high levels ( p ≤ 0.05) of fluoride in urine (4.01 ± 1.83 ppm) and serum (0.1 ± 0.013 ppm). On the basis of urinary fluoride concentration, patients were divided into two groups, namely group 1 (G-1) ( n = 32) containing normal urine fluoride (0.61 ± 0.17 ppm) and group 2 (G-2) ( n = 32) having high urine fluoride concentration (4.01 ± 1.83 ppm). Age-matched healthy subjects ( n = 33) having normal levels of urinary fluoride (0.56 ± 0.15 ppm) were included in the study as control (group 0 (G-0)). Kidney biopsies were taken from G-1 and G-2 only, who were subjected to ultrastructural (transmission electron microscopy) and apoptotic (terminal deoxynucleotidyl transferase deoxyuridine triphosphate nick end labeling) analysis. Various subcellular ultrastructural changes including nuclear disintegration, chromosome condensation, cytoplasmic ground substance lysis, and endoplasmic reticulum blebbing were observed. Increased levels of apoptosis were observed in high fluoride group (G-2) compared to normal fluoride group (G-1). Various degrees of fluoride-associated damages to the architecture of tubular epithelia, such as cell swelling and lysis, cytoplasmic vacuolation, nuclear condensation, apoptosis, and necrosis, were observed.

  16. Combined electrocoagulation and electroflotation for removal of fluoride from drinking water. (United States)

    Zuo, Qianhai; Chen, Xueming; Li, Wei; Chen, Guohua


    A combined electrocoagulation (EC) and electroflotation (EF) process was proposed to remove fluoride from drinking water. Its efficacy was investigated under different conditions. Experimental results showed that the combined process could remove fluoride effectively. The total hydraulic retention time required was only 30 min. After treatment, the fluoride concentration was reduced from initial 4.0-6.0mg/L to lower than 1.0mg/L. The influent pH value was found to be a very important variable that affected fluoride removal significantly. The optimal influent pH range is 6.0-7.0 at which not only can effective defluoridation be achieved, but also no pH readjustment is needed after treatment. In addition, it was found that SO(4)(2-) had negative effect; Ca(2+) had positive effect; while Cl(-) had little effect on the fluoride removal. The EC charge loading, EF charge loading and energy consumption were 3.0 Faradays/m(3), 1.5 Faradays/m(3), and 1.2 kWh/m(3), respectively, under typical conditions where fluoride was reduced from initial 4.0 to 0.87 mg/L.

  17. A model to determine the economic viability of water fluoridation. (United States)

    Kroon, Jeroen; van Wyk, Philippus Johannes


    In view of concerns expressed by South African local authorities the aim of this study was to develop a model to determine whether water fluoridation is economically viable to reduce dental caries in South Africa. Microsoft Excel software was used to develop a model to determine economic viability of water fluoridation for 17 water providers from all nine South African provinces. Input variables for this model relate to chemical cost, labor cost, maintenance cost of infrastructure, opportunity cost, and capital depreciation. The following output variables were calculated to evaluate the cost of water fluoridation: per capita cost per year, cost-effectiveness and cost-benefit. In this model it is assumed that the introduction of community water fluoridation can reduce caries prevalence by an additional 15 percent and that the savings in cost of treatment will be equal to the average fee for a two surface restoration. Water providers included in the study serve 53.5 percent of the total population of South Africa. For all providers combined chemical cost contributes 64.5 percent to the total cost, per capita cost per year was $0.36, cost-effectiveness was calculated as $11.41 and cost-benefit of the implementation of water fluoridation was 0.34. This model confirmed that water fluoridation is an economically viable option to prevent dental caries in South African communities, as well as conclusions over the last 10 years that water fluoridation leads to significant cost savings and remains a cost-effective measure for reducing dental caries, even when the caries-preventive effectiveness is modest. © 2012 American Association of Public Health Dentistry.

  18. The uptake of hydrogen fluoride by a forest

    International Nuclear Information System (INIS)

    Murphy, C.E. Jr.


    A mathematical model of hydrogen fluoride (HF) deposition and accumulation of fluoride in a Eucalyptus rostrata forest has been developed. The model is based on tree physiology and meteorological principles. The data base for the model was derived from a literature survey of the physiological characteristics of E. rostrata and similar eucalyptus species and from current knowledge of meteorological processes in plant canopies

  19. Antimicrobial activity of fluoride and its in vivo importance: identification of research questions. (United States)

    Van Loveren, C


    This manuscript discusses the antimicrobial activity of fluoride and its in vivo importance in order to identify research questions. There is a lot of information on mechanisms by which fluoride may interfere with bacterial metabolism and dental plaque acidogenicity. The antimicrobial activity of fluoride products is enhanced when fluoride is associated with antimicrobial cations like Sn(2+) and amine. It is not clear whether the antimicrobial mechanisms of fluoride are operating in vivo or even to what extent antimicrobial activity can contribute to caries prevention. This latter question may be the most important one in research. Copyright 2001 S. Karger AG, Basel.

  20. The fluoride content of an anion exchange resin in the fluoride form

    International Nuclear Information System (INIS)

    Kleijn, J.P. de; Zanten, B. van


    The fluoride content of an anion exchange resin in the F - -form depends on the material of the equipment used for the preparation. If a glass equipment is used too much fluorine is introduced. The experimental results are explained by taking into account a competition of F - and SiF 6 2- for the hydroxyl positions of the resin (OH - ). Because SiF 6 2- is bivalent and has a lower hydration energy than F - , the resin has a much larger affinity for this species than for F - . If a higher concentration of SiF 6 2- is generated by an intensive contact of the HF solution with glass, two OH-groups may be replaced by one SiF 6 2- . This results in a resin with 3 times as much fluorine as calculated from the chloride capacity. If the formation of SiF 6 2- is impossible as for example in teflon equipment, the same capacity is obtained for chloride and fluoride. (T.G.)

  1. Preparation of uranium ingots from double fluorides

    International Nuclear Information System (INIS)

    Le Boulbin, E.


    A simple method has been developed for the preparation of uranium double fluorides and has given a new impetus to the study of the reduction of these compounds with a view to obtaining very pure uranium ingots. This reduction can be carried out using calcium or magnesium as the reducing agent, this latter metal being very interesting from the practical point of view. A comparative study of the heat balances of the reduction processes for the double fluorides and for uranium tetrafluoride has shown that reduction of the double fluorides is possible. The exact experimental conditions for these reductions have been determined. Our study has shown in particular that the reduction of the double salt UF 4 , CaF 2 by magnesium leads to the production of small (20 to 500 g) samples of high-purity uranium with a yield of 99 per cent. (author) [fr

  2. Uranyl fluoride luminescence in acidic aqueous solutions

    International Nuclear Information System (INIS)

    Beitz, J.V.; Williams, C.W.


    Luminescence emission spectra and decay rates are reported for uranyl species in acidic aqueous solutions containing HF or added NaF. The longest luminescence lifetime, 0.269 ± 0.006 ms, was observed from uranyl in 1 M HF + 1 M HClO 4 at 296 K and decreased with increasing temperature. Based on a luminescence dynamics model that assumes equilibrium among electronically excited uranyl fluoride species and free fluoride ion, this long lived uranyl luminescence in aqueous solution is attributed primarily to UO 2 F 2 . Studies on the effect of added LiNO 3 or Na 2 WO 4 ·2H 2 O showed relatively weak quenching of uranyl fluoride luminescence which suggests that high sensitivity determination of the UF 6 content of WF 6 gas should be feasible via uranyl luminescence analysis of hydrolyzed gas samples of impure WF 6

  3. Development of an empirical model for fluoride removal from photovoltaic wastewater by electrocoagulation process

    KAUST Repository

    Drouiche, Nadjib; Aoudj, Salaheddine; Lounici, Hakim; Mahmoudi, Hacè ne; Ghaffour, NorEddine; Goosen, Mattheus F A


    Electrocoagulation experiments were conducted with bipolar aluminium electrodes to determine the optimum conditions for the fluoride removal from synthetic photovoltaic wastewater. A high fluoride concentration in community water supplies can cause fluorosis which has a detrimental effect on human health in particular on teeth and bones. A full 23 factorial design of experiments was used to obtain the best conditions of fluoride removal from water solutions. The three factors considered were initial fluoride concentration, applied potential, and supporting electrolyte dosage. Two levels for each factor were used; supporting electrolyte (0 and 100), applied potential (10 and 30 V), and initial fluoride concentration (20 and 25 mg/L). Results showed that the optimum conditions for fluoride removal from photovoltaic wastewater containing an initial fluoride concentration of 20 mg/L were a supporting electrolyte dose of 100 mg/L and an applied potential of 30 V. These gave a residual fluoride concentration of 8.6 mg/L which was below the standard discharge limit. A mathematical equation showing the relation between residual fluoride concentration and the effective variables was also developed. © 2011 Desalination Publications. All rights reserved.

  4. Development of an empirical model for fluoride removal from photovoltaic wastewater by electrocoagulation process

    KAUST Repository

    Drouiche, Nadjib


    Electrocoagulation experiments were conducted with bipolar aluminium electrodes to determine the optimum conditions for the fluoride removal from synthetic photovoltaic wastewater. A high fluoride concentration in community water supplies can cause fluorosis which has a detrimental effect on human health in particular on teeth and bones. A full 23 factorial design of experiments was used to obtain the best conditions of fluoride removal from water solutions. The three factors considered were initial fluoride concentration, applied potential, and supporting electrolyte dosage. Two levels for each factor were used; supporting electrolyte (0 and 100), applied potential (10 and 30 V), and initial fluoride concentration (20 and 25 mg/L). Results showed that the optimum conditions for fluoride removal from photovoltaic wastewater containing an initial fluoride concentration of 20 mg/L were a supporting electrolyte dose of 100 mg/L and an applied potential of 30 V. These gave a residual fluoride concentration of 8.6 mg/L which was below the standard discharge limit. A mathematical equation showing the relation between residual fluoride concentration and the effective variables was also developed. © 2011 Desalination Publications. All rights reserved.

  5. Dental fluorosis and urinary fluoride in 10-12 years old adolescents of Bushehr port


    Giti Javan; Ehsan Mostaghni; Seyed Mojtaba Jafary; Batoul Amini; Bahram Hematinejad


    Background: Fluoride increases tooth resistance to dental caries, but mild toxicity due to excessive ingestion of fluoride can cause dental fluorosis. Drinking water naturally contains fluoride and is a major source of fluoride. In Bushehr port, drinking water is supplied from limestone springs with normal fluoride levels but dental fluorosis is observed. Methods: A total of 95 native school children (between the ages of 10-12 years old) were randomly selected from four Bushehr port regions. ...

  6. Structure-solubility relationships in fluoride-containing phosphate based bioactive glasses (United States)

    Shaharyar, Yaqoot

    The dissolution of fluoride-containing bioactive glasses critically affects their biomedical applications. Most commercial fluoride-releasing bioactive glasses have been designed in the soda-lime-silica system. However, their relatively slow chemical dissolution and the adverse effect of fluoride on their bioactivity are stimulating the study of novel biodegradable materials with higher bioactivity, such as biodegradable phosphate-based bioactive glasses, which can be a viable alternative for applications where a fast release of active ions is sought. In order to design new biomaterials with controlled degradability and high bioactivity, it is essential to understand the connection between chemical composition, molecular structure, and solubility in physiological fluids.Accordingly, in this work we have combined the strengths of various experimental techniques with Molecular Dynamics (MD) simulations, to elucidate the impact of fluoride ions on the structure and chemical dissolution of bioactive phosphate glasses in the system: 10Na2O - (45-x) CaO - 45P2O5 - xCaF2, where x varies between 0 -- 10 mol.%. NMR and MD data reveal that the medium-range atomic-scale structure of thse glasses is dominated by Q2 phosphate units followed by Q1 units, and the MD simulations further show that fluoride tends to associate with network modifier cations to form alkali/alkaline-earth rich ionic aggregates. On a macroscopic scale, we find that incorporating fluoride in phosphate glasses does not affect the rate of apatite formation on the glass surface in simulated body fluid (SBF). However, fluoride has a marked favorable impact on the glass dissolution in deionized water. Similarly, fluoride incorporation in the glasses results in significant weight gain due to adsorption of water (in the form of OH ions). These macroscopic trends are discussed on the basis of the F effect on the atomistic structure of the glasses, such as the F-induced phosphate network re-polymerization, in a

  7. [Study on ecological risk assessment technology of fluoride pollution from arid oasis soil]. (United States)

    Xue, Su-Yin; Li, Ping; Wang, Sheng-Li; Nan, Zhong-Ren


    According to translocation regulation of fluoride in the typical oasis soil-plant system under field, an ecological risk assessment model of fluoride was established, and this model was used to assess ecological risk to fluoride pollution from suburban oasis soils in Baiyin City, which was specifically expressed with the potential ecological risk of bioavailability (ER(bc)) model to assess ecological risk of fluoride pollution in oasis regions. Results showed that the ecological risk indices of fluoride pollution from this region were 1.37-24.81, the level of risk at most sites was high to very high, the average ecological risk index was 11.28, belonged to very high risk. This indicated that in the suburb soil of Baiyin City needs to be concerned about the remediation of fluoride pollution.

  8. Community-oriented administration of fluoride for the prevention of dental caries

    DEFF Research Database (Denmark)

    Petersen, P E; Baez, R J; Lennon, M A


    Dental caries is the most prevalent chronic disease affecting human populations around the world. It is recognized that fluoride plays a significant role in dental caries reduction. Meanwhile, several low- and middle-income countries of Asia have not yet implemented systematic fluoride programs...... coverage. Participants acknowledged that automatic fluoridation through water, salt, and milk is the most effective and equitable strategy for the prevention of dental caries. Concerns were expressed that government-subsidized community fluoride prevention programs may face privatization. In addition...... need further dissemination. The meeting was co-sponsored by the World Health Organization, the International Association for Dental Research, and the World Dental Federation....

  9. Toxic fluoride gas emissions from lithium-ion battery fires. (United States)

    Larsson, Fredrik; Andersson, Petra; Blomqvist, Per; Mellander, Bengt-Erik


    Lithium-ion battery fires generate intense heat and considerable amounts of gas and smoke. Although the emission of toxic gases can be a larger threat than the heat, the knowledge of such emissions is limited. This paper presents quantitative measurements of heat release and fluoride gas emissions during battery fires for seven different types of commercial lithium-ion batteries. The results have been validated using two independent measurement techniques and show that large amounts of hydrogen fluoride (HF) may be generated, ranging between 20 and 200 mg/Wh of nominal battery energy capacity. In addition, 15-22 mg/Wh of another potentially toxic gas, phosphoryl fluoride (POF 3 ), was measured in some of the fire tests. Gas emissions when using water mist as extinguishing agent were also investigated. Fluoride gas emission can pose a serious toxic threat and the results are crucial findings for risk assessment and management, especially for large Li-ion battery packs.

  10. The Effect of Adding Corrosion Inhibitors into an Electroless Nickel Plating Bath for Magnesium Alloys (United States)

    Hu, Rong; Su, Yongyao; Liu, Hongdong; Cheng, Jiang; Yang, Xin; Shao, Zhongcai


    In this work, corrosion inhibitors were added into an electroless nickel plating bath to realize nickel-phosphorus (Ni-P) coating deposition on magnesium alloy directly. The performance of five corrosion inhibitors was evaluated by inhibition efficiency. The results showed that only ammonium hydrogen fluoride (NH4HF2) and ammonium molybdate ((NH4)2MoO4) could be used as corrosion inhibitors for magnesium alloy in the bath. Moreover, compounding NH4HF2 and (NH4)2MoO4, the optimal concentrations were both at 1.5 ~ 2%. The deposition process of Ni-P coating was observed by using a scanning electron microscope (SEM). It showed corrosion inhibitors inhibited undesired dissolution of magnesium substrate during the electroless plating process. In addition, SEM observation indicated that the corrosion inhibition reaction and the Ni2+ replacement reaction were competitive at the initial deposition time. Both electrochemical analysis and thermal shock test revealed that the Ni-P coating exhibited excellent corrosion resistance and adhesion properties in protecting the magnesium alloy.

  11. Are there good reasons for fluoride labelling of food and drink? (United States)

    Zohoori, F V; Maguire, A


    This opinion piece highlights the importance of controlling systemic fluoride intake from food and drink in early childhood to minimise risk of dental fluorosis whilst maximising caries prevention; the wide range of fluoride contents found in a study of commercially-available food and drinks; and the need for comprehensive fluoride labelling on food and drink products in the UK, particularly those used by infants and young children.

  12. In vitro evaluation of fluoride products in the development of carious lesions in deciduous teeth. (United States)

    Santos, Lucineide de Melo; Reis, José Ivo Limeira dos; Medeiros, Maria Perolina de; Ramos, Sheyla Moreira; Araújo, Juliane Mendes de


    The purpose of this study was to evaluate the effect of the application of fluoride products on the development of enamel caries in deciduous teeth. A total of 108 deciduous teeth were chosen for the study. Acid-resistant varnish was applied on the teeth, leaving only one area of 5 mm x 1 mm of dental enamel exposed. The teeth were allocated randomly to one of the following groups: 1) control - toothpaste without fluoride; 2) 1.23% fluoride gel; 3) Duraflur fluoride varnish; 4) Duraphat fluoride varnish; 5) Fluorniz fluoride varnish; 6) Fluorphat fluoride varnish; 7) varnish with Duofluorid; 8) 12% silver fluoride diamine (Cariestop); 9) children's fluoride toothpaste (500 ppm). The tested products were applied on the teeth according to the manufacturer's recommendations and the teeth were stored in a moist environment for 24 hours. Each group of teeth was then subjected to a pH cycling model for 14 days, after which the teeth were cut through the center for an analysis of the depth of the carious lesion by polarized light microscopy. Comparisons were made between the treatments and the control group. The mean lesion depth values were 318 microm +/- 39 (control), 213 microm +/- 27 (fluoride gel), 203 microm +/- 34 (Duraflur), 133 microm +/- 25 (Duraphat), 207 microm +/- 27 (Fluor-niz), 212 microm +/- 27 (Fluorphat), 210 +/- 28 (Duofluorid), 146 +/- 31 (Cariestop) and 228 +/- 24 (fluoride toothpaste). None of the products used here was able to completely prevent the formation of lesions. The highest cariostatic effect was achieved by fluoride varnish Duraphat and the lowest by the fluoride toothpaste.

  13. A basic study on fluoride-based molten salt electrolysis technology

    Energy Technology Data Exchange (ETDEWEB)

    Hwang, Il Soon [Seoul National University, Seoul (Korea); Kim, Kwang Bum [Yonsei University, Seoul (Korea); Park, Byung Gi [Seoul National University, Seoul (Korea)


    The objective of this project is to study on the physicochemical properties of fluoride molten salt, to develop numerical model for simulation of molten salt electrolysis, and to establish experimental technique of fluoride molten salt. Physicochemical data of fluoride molten salt are investigated and summarized. The numerical model, designated as REFIN is developed with diffusion-layer theory and electrochemical reaction kinetics. REFIN is benchmarked with published experimental data. REFIN has a capability to simulate multicomponent electrochemical system at transient conditions. Experimental device is developed to measure electrochemical properties of structural material for fluoride molten salt. Ni electrode is measured with cyclic voltammogram in the conditions of 600 .deg. C LiF-BeF{sub 2} and 700 .deg. C LiF-BeF{sub 2}. 74 refs., 23 figs., 57 tabs. (Author)

  14. Effect of different frequencies of fluoride dentifrice and mouthrinse administration: an in situ study

    Directory of Open Access Journals (Sweden)

    Daniela Correia Cavalcante Souza


    Full Text Available The effect of a combination of topical fluoridation methods for inhibition of enamel demineralization in the face of a cariogenic challenge has not been clearly established. This in situ crossover study aimed to assess whether the addition of daily use of fluoride mouthrinse (FR to that of fluoride dentifrice (FD is equivalent to increasing the frequency of FD application in terms of the effect on enamel demineralization and fluoride content. Over 3 phases of 14 days each, 12 volunteers wore appliances containing enamel blocks exposed to a 20 % sucrose solution 8 times/day. During each phase the blocks underwent one of the following treatments: 2x/day FD, 2x/day FD + 1x/day FR, and 3x/day FD. The blocks were assessed for hardness and fluoride content. Three x/day FD did not differ from 2x/day + 1x/day FR, however it enhanced demineralization protection when compared to 2x/day FD. All treatments produced an increase in enamel fluoride content compared to no treatment (sound blocks (p < 0.05, but the differences between them were not significant. The results of this study suggest that the daily use of fluoride mouthrinse combined with that of fluoride dentifrice has similar effects on enamel demineralization and fluoride content when compared to increasing the frequency of fluoride dentifrice use.

  15. [Exposure to fluorides from drinking water in the city of Aguascalientes, Mexico]. (United States)

    Trejo-Vázquez, R; Bonilla-Petriciolet, A


    Determine the fluoride content in all the wells that supply drinking water to the city of Aguascalientes, Mexico, in order to establish the population's degree of exposure. The fluoride content of the 126 wells that supply drinking water to the city of Aguascalientes was determined, using the SPADNS method, in accordance with two Mexican regulations, NMX-AA-77-1982 and NMX-014-SSAI-1993. Using that data, we created fluoride isopleth maps showing the distribution of fluoride concentrations in the water supplies for the city of Aguascalientes. We also estimated exposure doses for the city's inhabitants. The mean analysis uncertainty was 3.9%. Seventy-three wells had a fluoride concentration of" 1.5 mg/L, which was the maximum permissible value set by the Mexican standards then in effect. All the maximum exposure doses surpassed the minimum risk level set by Agency for Toxic Substances and Disease Registry (ATSDR) of the Department of Health and Human Services of the United States of America. In the children under 1 year of age, even the minimum does was slightly higher than the ATSDR risk level. From estimating the fluoride exposure doses caused by water consumption in the city of Aguascalientes and comparing those doses with ones from other states in Mexico, we concluded that the fluoride intake in Aguascalientes represents a potential risk for inhabitants' health. The fluoride content of the city's drinking water should be reduced to 0.69 mg/L.

  16. Evaluation of exposure to fluoride in child population of North Argentina. (United States)

    Rocha, René Antonio; Calatayud, Marta; Devesa, Vicenta; Vélez, Dinoraz


    Fluoride is an important element for humans. It inhibits initiation and progression of dental caries and stimulates bone formation. However, excessive intake may lead to the appearance of dental and/or skeletal fluorosis and a decrease in intellectual coefficient in child populations. This study evaluates exposure to fluoride in the child population of Chaco province (Argentina) by analysis of drinking water, food and its bioaccessible fraction (quantity of fluoride solubilised by gastrointestinal digestion and available for intestinal absorption) and urine as a biomarker of internal dose. The concentration of fluoride in drinking water varied between 0.050 and 4.6 mg L -1 , and 80% of the samples exceeded the WHO drinking-water guideline value (1.5 mg L -1 ). Fluoride concentrations in food ranged between 0.80 and 3.0 mg kg -1 fresh weight (fw), being lower in bioaccessible fraction (0.43-1.9 mg kg -1 , fw). On the basis of the consumption data declared for the young child population, fluoride intake varies between 4.1 and 6.5 mg day -1 , greater than the level recommended for this age group. Moreover, in some cases, concentrations of fluoride found in urine (0.62-8.9 mg L -1 ) exceeded those reported in areas with declared fluorosis. All data obtained show the worrying situation of child population in this area of Argentina.

  17. Fluoride mouthrinses for preventing dental caries in children and adolescents. (United States)

    Marinho, Valeria C C; Chong, Lee Yee; Worthington, Helen V; Walsh, Tanya


    Fluoride mouthrinses have been used extensively as a caries-preventive intervention in school-based programmes and by individuals at home. This is an update of the Cochrane review of fluoride mouthrinses for preventing dental caries in children and adolescents that was first published in 2003. The primary objective is to determine the effectiveness and safety of fluoride mouthrinses in preventing dental caries in the child and adolescent population.The secondary objective is to examine whether the effect of fluoride rinses is influenced by:• initial level of caries severity;• background exposure to fluoride in water (or salt), toothpastes or reported fluoride sources other than the study option(s); or• fluoride concentration (ppm F) or frequency of use (times per year). We searched the following electronic databases: Cochrane Oral Health's Trials Register (whole database, to 22 April 2016), the Cochrane Central Register of Controlled Trials (CENTRAL) (the Cochrane Library, 2016, Issue 3), MEDLINE Ovid (1946 to 22 April 2016), Embase Ovid (1980 to 22 April 2016), CINAHL EBSCO (the Cumulative Index to Nursing and Allied Health Literature, 1937 to 22 April 2016), LILACS BIREME (Latin American and Caribbean Health Science Information Database, 1982 to 22 April 2016), BBO BIREME (Bibliografia Brasileira de Odontologia; from 1986 to 22 April 2016), Proquest Dissertations and Theses (1861 to 22 April 2016) and Web of Science Conference Proceedings (1990 to 22 April 2016). We undertook a search for ongoing trials on the US National Institutes of Health Trials Register ( and the World Health Organization International Clinical Trials Registry Platform. We placed no restrictions on language or date of publication when searching electronic databases. We also searched reference lists of articles and contacted selected authors and manufacturers. Randomised or quasi-randomised controlled trials where blind outcome assessment was stated or

  18. Estimation of fluoride levels in various commercially available carbonated soft drinks in Chandigarh city, India

    Directory of Open Access Journals (Sweden)

    Mohit Bansal


    Full Text Available Introduction: Fluoride has a preventive action on dental caries. However, Excessive ingestion of fluoride from different sources can lead to the development of dental fluorosis. Aim: To estimate fluoride levels in various commercially available carbonated soft drinks available in Chandigarh city. Materials and Methods: Twelve different brands of commercially available soft drinks were purchased from three different places and divided into three groups. Fluoride levels were estimated using fluoride test strips Quantofix 37211 Fluka; Sigma-Aldrich. Results: Fluoride levels ranged from 0.12 to 0.42 mg/dl F with the maximum level in Thumbs up and least in Diet Pepsi. Conclusion: The levels of fluoride varied in various carbonated soft drinks analyzed. This could contribute significantly to the total fluoride intake from all sources and thus be an important risk factor for the development of dental fluorosis.

  19. Purification and characterization of a new neutral metalloprotease from marine Exiguobacterium sp. SWJS2. (United States)

    Lei, Fenfen; Cui, Chun; Zhao, Haifeng; Tang, Xuelu; Zhao, Mouming


    Among the protease-producing bacterial strains isolated from deep-sea sediments, SWJS2 was finally selected and identified as genus Exiguobacterium. Plackett-Burman and orthogonal array designs were applied to optimize the fermentation conditions, and the results are as follows: Glucose 5g, yeast extract 15g, glycerin 2g and CaCl2 ⋅2H2 O 0.5 g dissolved in 1 L artificial seawater; temperature 25 °C, original pH 7, inoculum rate 2%, seed age 12 H, loading volume 25 mL (250-mL Erlenmeyer flask), shaking speed 150 rpm, and fermentation time 44 H. The protease activity production was improved from about 80 to 660 U/mL under the optimized parameters. The protease was purified fourfold with specificity activity of 30,654.1 U/mg protein and a total yield of 16.2%. The protease exhibited the maximum activity at 40-45 °C and pH 7. Moreover, the enzyme activity was found to be inhibited by Cu(2+) , Ba(2+) , Cd(2+) , Hg(2+) , and Al(3+) at 5 mM, whereas it can be increased by Mg(2+) , Mn(2+) , and Ca(2+) at 0.5-5 mM. The enzyme was totally inactivated by 1 or 5 mM ethylenediaminetetraacetic acid but not by phenylmethanesulfonyl fluoride, tyrpsin inhibitor from Glycine max (STI), benzamidine, 5,5'-dithio-bis-(2-nitro benzoic acid), or pepstatin A, suggesting that it belonged to metalloprotease. © 2015 International Union of Biochemistry and Molecular Biology, Inc.

  20. Development of chitosan supported zirconium(IV) tungstophosphate composite for fluoride removal

    Energy Technology Data Exchange (ETDEWEB)

    Viswanathan, Natrayasamy, E-mail: [Department of Chemistry, Anna University Tiruchirappalli - Dindigul Campus, Dindigul 624622, Tamil Nadu (India); Meenakshi, S., E-mail: [Department of Chemistry, Gandhigram Rural University, Gandhigram 624302, Tamil Nadu (India)


    A new biocomposite was prepared by incorporating inorganic ion exchanger namely zirconium(IV) tungstophosphate (ZrWP) into the chitosan biopolymeric matrix. The sorption behaviour of fluoride from aqueous solutions by this ZrWP/chitosan (ZrWPCs) composite has been investigated by batch technique. The fluoride sorption was studied as a function of contact time, pH, initial fluoride concentration, competing co-ions and temperature. The defluoridation capacity (DC) of the adsorbent was found to be 2025 mgF{sup -} kg{sup -1}. The composite was characterized using FTIR and SEM with EDAX analysis. The equilibrium sorption data were fitted to Freundlich and Langmuir isotherms. The kinetics of sorption was found to follow pseudo-second-order and intraparticle diffusion models. The values of thermodynamic parameters indicate the nature of sorption is spontaneous and endothermic. The biocomposite was successfully used for the removal of fluoride from the field water taken in a nearby fluoride endemic village.

  1. In vitro evaluation of fluoride products in the development of carious lesions in deciduous teeth

    Directory of Open Access Journals (Sweden)

    Lucineide de Melo Santos


    Full Text Available The purpose of this study was to evaluate the effect of the application of fluoride products on the development of enamel caries in deciduous teeth. A total of 108 deciduous teeth were chosen for the study. Acid-resistant varnish was applied on the teeth, leaving only one area of 5 mm x 1 mm of dental enamel exposed. The teeth were allocated randomly to one of the following groups: 1 control - toothpaste without fluoride; 2 1.23% fluoride gel; 3 Duraflur fluoride varnish; 4 Duraphat fluoride varnish; 5 Fluorniz fluoride varnish; 6 Fluorphat fluoride varnish; 7 varnish with Duofluorid; 8 12% silver fluoride diamine (Cariestop; 9 children's fluoride toothpaste (500 ppm. The tested products were applied on the teeth according to the manufacturer's recommendations and the teeth were stored in a moist environment for 24 hours. Each group of teeth was then subjected to a pH cycling model for 14 days, after which the teeth were cut through the center for an analysis of the depth of the carious lesion by polarized light microscopy. Comparisons were made between the treatments and the control group. The mean lesion depth values were 318 μm ± 39 (control, 213 μm ± 27 (fluoride gel, 203 μm ± 34 (Duraflur, 133 μm ± 25 (Duraphat, 207 μm ± 27 (Fluor-niz, 212 μm ± 27 (Fluorphat, 210 ± 28 (Duofluorid, 146 ± 31 (Cariestop and 228 ± 24 (fluoride toothpaste. None of the products used here was able to completely prevent the formation of lesions. The highest cariostatic effect was achieved by fluoride varnish Duraphat and the lowest by the fluoride toothpaste.

  2. Enamel-Caries Prevention Using Two Applications of Fluoride-Laser Sequence. (United States)

    Noureldin, Amal; Quintanilla, Ines; Kontogiorgos, Elias; Jones, Daniel


    Studies demonstrated a significant synergism between fluoride and laser in reduction of enamel solubility. However, minimal research has focused on testing the sequence of their application and no other research investigated the preventive effect of repeated applications of a combined treatment. This study investigated the effect of two applications of fluoride-laser sequence on the resistance of sound enamel to cariogenic challenge compared to one-time application. Sixty enamel slabs were cut from 10 human incisors, ground flat, polished and coated with nail varnish except a 2 x 2 mm window. Specimens were randomly assigned into five groups of 12 specimens; (CON-) negative-control received no treatment, (CON+) positive-control received pH challenge, (FV) treated with M fluoride varnish, (F-L1) one-application fluoride-varnish followed by CO2 laser-treatment (short-pulsed 10.6 µm, 2.4J/ cm2, 10HZ, 10sec), and (F-L2) two-applications of fluoride varnish-laser treatment. Specimens were left in distilled water for one day between applications. Except CON-, all groups were submitted to pH cycling for 9-days (8 demin/ remin + 1 day remineralisation bath) at 37°C. Enamel demineralization was quantitatively evaluated by measurement of Knoop surface-microhardness (SM H) (50-grams/10 seconds). Data were analyzed using one-way ANOVA (p ≤ 0.05) followed by Duncan's Multiple Range Test. Within the limitations of this study, it was found that one or two applications of fluoride-laser sequence significantly improved resistance of the sound enamel surface to acid attack compared to FV-treated group. Although the two applications of fluoride-laser sequence (F-L1 and F-L2) showed higher SMH values, significant resistance to demineralization was only obtained with repeated applications.

  3. Purification method for calcium fluoride containing uranium

    International Nuclear Information System (INIS)

    Ogami, Takeshi


    Calcium fluoride (CaF 2 ) containing uranium is heated in an electrolytic bath having a cathode and an anode to form a molten salt, and the molten salt is electrolytically reduced to form metal uranium deposited on the surface of the cathode. The calcium fluoride molten salt separated by the deposition of generated metal uranium on the surface of the cathode is solidified by cooling. The solidified calcium fluoride is recovered. When metal uranium is deposited on the surface of the cathode by the electrolytic reduction of the molten salt, impurities such as plutonium and neptunium are also deposited on the surface of the anodes entrained by the metal uranium. Impurities having high vapor pressures such as americium and strontium are evaporated and removed from the molten salts. Then, nuclides such as uranium can thus be separated and recovered, and residual CaF 2 can be recovered in a state easily storable and reutilizable. (T.M.)

  4. Use of fluoride systems for some fission product separation from residues of fast reactor spent fuel fluorination

    International Nuclear Information System (INIS)

    Shishkov, Yu.D.; Khomyakov, V.I.


    Investigated has been a possibility of the use of fluoride systems (acid nitrozyl fluoride and molten salts) for americium extraction from residues of fluorination of irradiated fuel containing mainly fluorides of rare earth compounds, alkali and alkaline earth elements. At treatment of fission product fluorides by acid nitrozyl fluoride only cesium and uranium fluorides dissolve, while americium and rare earth fluorides are practically non-soluble in it. The solubility of cesium, strontium, barium and fluorides of some other rare earth elements in molten cryolite at the temperature of 1000 deg C, Li-NaF and LiF-CaF 2 of eutectic content at 750 and 800 deg C are respectively 15-77 %. Cerium fluoride presents an exception, its solubility in cryolite being only 0.73%. At treatment of mixture of americium and lanthanum fluorides by molten salts in the weight ratio of 1:1, approximately 50% of lanthanum and 65-70% of americium turn into melt independent of the type of melt. The maximum melt output of americium is obtained at treatment of lanthanum and americium fluoride mixture by cryolite melt at the temperature of 1000 deg C. It is shown that the presence of rare earth of fluorides, except lanthanum fluoride, effect significantly of americium distribution over phases in the process of fluoride processing by the fluoride molten salts

  5. Technologies for Decentralized Fluoride Removal: Testing Metallic Iron-based Filters

    Directory of Open Access Journals (Sweden)

    Arnaud Igor Ndé-Tchoupé


    Full Text Available Since the realization in the 1930s that elevated fluoride concentrations in drinking water can have detrimental effects on human health, new methods have been progressively developed in order to reduce fluoride to acceptable levels. In the developing world the necessity for filtration media that are both low-cost and sourced from locally available materials has resulted in the widespread use of bone char. Since the early 1990s metallic iron (Fe0 has received widespread use as both an adsorbent and a reducing agent for the removal of a wide range of contaminant species from water. The ion-selectivity of Fe0 is dictated by the positively charged surface of iron (hydroxides at circumneutral pH. This suggests that Fe0 could potentially be applied as suitable filter media for the negatively charged fluoride ion. This communication seeks to demonstrate from a theoretical basis and using empirical data from the literature the suitability of Fe0 filters for fluoride removal. The work concludes that Fe0-bearing materials, such as steel wool, hold good promise as low-cost, readily available and highly effective decentralized fluoride treatment materials.

  6. Potential of quixaba (Sideroxylon obtusifolium latex as a milk-clotting agent

    Directory of Open Access Journals (Sweden)

    Anna Carolina da Silva


    Full Text Available There are several obstacles to the use of chymosin in cheese production. Consequently, plant proteases have been studied as possible rennet substitutes, but most of these enzymes are unsuitable for the manufacture of cheese. The aim of this study was to evaluate the potential of latex from Sideroxylon obtusifolium as a source of milk-clotting proteases and to partially characterize the enzyme. The enzyme extract showed high protease and coagulant activities, with an optimal pH of 8.0 and temperature of 55 °C. The enzyme was stable in wide ranges of temperature and pH. Its activity was not affected by any metal ions tested; but was inhibited by phenylmethanesulfonyl fluoride and pepstatin. For the coagulant activity, the optimal concentration of CaCl2 was 10 µmol L- 1. Polyacrylamide gel electrophoresis showed four bands, with molecular weights between 17 and 64 kDa. These results indicate that the enzyme can be applied to the cheese industry.

  7. Evaluation and comparison of four protein extraction protocols for mono- and two-dimensional electrophoresis in Mytilus galloprovincialis

    Directory of Open Access Journals (Sweden)

    Marina Ceruso


    Full Text Available In this study, four protein extraction protocols from Mytilus galloprovincialis were evaluated with the aim to identify the most practical, efficient and reproducible method. Four extraction protocols frequently used for mussels and organic matrices were selected and compared. The methods were based on the use of: i TRIzol reagent; ii Lysis buffer; iii phenylmethanesulfonyl fluoride; iv trichloroacetic acid-acetone. Protein concentration was measured by the Bradford method. Three specimens of mussels were studied and the analysis was conducted in triplicate for each of the four protocols. Results indicated that the four methods could extract significantly different protein profiles. The highest number of protein spots resolved in 2DE gels and the best reproducibility was obtained using trichloroacetic acid-acetone protocol. Results afforded the selection of a suitable extraction protocol to be used for ecotoxicoproteomics studies from mussels and for other proteomic studies conducted by particularly complex tissues such as Mytilus galloprovincialis.

  8. Readying Community Water Fluoridation Advocates through Training, Surveillance, and Empowerment. (United States)

    Veschusio, C; Jones, M K; Mercer, J; Martin, A B


    This paper describes the Community Water Fluoridation Advocacy Training Project that was designed to develop networks of community water fluoridation advocates in rural communities. The South Carolina (SC) Department of Health and Environmental Control Division of Oral Health staff and the SC Dental Association were responsible for developing and facilitating the training sessions for key policy influencers, which included medical and dental providers, early childhood educators, and water system operators and managers. Findings from the post-training survey indicate that participants increased their knowledge and skills to discuss the impact of water fluoridation on the dental health of community residents. Participants identified a need for online access to water fluoridation education and advocacy materials. Dental public health competencies illustrated: communication and collaboration with groups and individuals, and advocate, implement and evaluate public health policy, legislation and regulations. Copyright© 2018 Dennis Barber Ltd.

  9. Fluoride in the drinking water of Pakistan and the possible risk of crippling fluorosis

    Directory of Open Access Journals (Sweden)

    M. A. Tahir


    Full Text Available To explore the possibility of fluoride toxicity, 747 water samples were collected from surface water and groundwater sources of 16 major cities of Pakistan, adopting a uniform sampling design with distribution of samples: Lahore (79, Kasur (46, Faisalabad (30, Khushab (50, Chakwal (51, Mianwali (30, Jhelum (53, Bahawalpur (60, Karachi (60, Mirpur Khas (55, Peshawar (38, Risalpur (35, Quetta (81, Ziarat (21, Loralai (21, and Mastung (37. Comparison of analytical findings with WHO Guidelines of Drinking Water for Fluoride (i.e., 1.5 ppm has concluded that 16% of the monitored water sources have fluoride concentration beyond the permissible safe limit of 1.5 mg L−1 falling in the concentration range of 1.6–25 mg L−1. The highest fluoride contamination (22% is detected in the Balochistan province followed by 19% in Punjab province. Comparatively higher fluoride levels of > 20% in the groundwater sources like hand pumps supported the possibility of increased groundwater contamination as excessive fluoride concentrations are expected to come from calcium-poor aquifers and in areas where fluoride-bearing minerals are common or where cation exchange of sodium for calcium occurs. Field observations have also indicated the prevalence of fluoride-associated health implications in the study areas with excessive fluoride in water sources. Findings of this study have provided bidirectional vision for the epidemiological investigations as well as to mitigate the issues in the affected vicinities of fluoride-rich areas.

  10. Experimental facilities for research of properties and behaviour of fluoride salts

    International Nuclear Information System (INIS)

    Hosnedl, P.; Jilek, M.; Kroc, V.; Pedal, L.; Valenta, V.; Vodicka, J.


    SKODA JS s.r.o. (Czech leading nuclear technology manufacturer) prepared and manufactured experimental loops for research and verification of properties and behaviour of fluoride salts for primary and secondary circuit, construction materials and ADTT systems technological components for the operation in the Nuclear Research Institute Rez plc fluorine chemistry laboratory. This paper presents charts and experimental program for molten fluoride salts experimental loops with natural circulation. Further on, the paper describes extension of the loops for research with forced circulation and next works for steam generator model verification and connection with the loop of Energovyzkum Brno. The loops are designed and constructed to obtain a sufficient amount of experience on ADTT technology. The research and utilisation program covers questions of corrosion and intergranular corrosion of structural materials, research of material properties and welding, research of fluoride fluid properties, measuring of thermo-hydraulic properties of molten salt fluoride fluids, heat transfer and hydraulics, development and tests of some plant components (steam generators, heat exchangers, pumps, valves) and other engineering issues. Two electrolyzers have been manufactured for the research of fuel/coolant fluoride salts mixture purification. One for the production of hydrogen fluoride, and the other for the research of salts purification. (author)

  11. Geochemical evaluation of fluoride contamination of groundwater in the Thoothukudi District of Tamilnadu, India (United States)

    Singaraja, C.; Chidambaram, S.; Anandhan, P.; Prasanna, M. V.; Thivya, C.; Thilagavathi, R.; Sarathidasan, J.


    Fluoride is a chemical element that has been shown to cause significant effects on human health through drinking water. Different forms of fluoride exposure are of importance and have shown to affect the body's fluoride content and thus increasing the risks of fluoride-prone diseases. Fluoride has beneficial effects on teeth; however, low concentrations of fluoride intensify the risk of tooth decay. Fluoride can also be quite detrimental at higher concentrations at skeletal fluorosis. The Thoothukudi District is a hard rock and alluvial plain marked as one of the Fluoride-increase area in Tamilnadu due to occurrence of various rock types including fluoride-bearing minerals. The F- content of groundwater can thus originate from the dissolution of Fluoride-bearing minerals in the bed rock. Hundred representative groundwater samples from Thoothukudi District were collected during two different seasons. Samples were analysed for F-, other major cations and anions. The study area is chiefly composed of hornblende biotite gneiss, charnockite, alluvio marine, fluvial marine and granite with small patches of quartzite and sandstone. Higher concentration of fluoride is observed during pre-monsoon (3.3 mg l-1) compared to the post-monsoon (2.4 mg l-1) due to the dilution effect. Spatial distribution and factor score show that higher concentrations of F- are noted in the north and central part of the study area owing to lithology. Bicarbonate is well correlated with F- which explains that both ions were derived from the weathering. While F- has a very weak correlation with pH which may be due to the increase of alkalinity resulting from the increase of carbonate and bicarbonate ions.

  12. Implementing a geographical information system to assess endemic fluoride areas in Lamphun, Thailand. (United States)

    Theerawasttanasiri, Nonthaphat; Taneepanichskul, Surasak; Pingchai, Wichain; Nimchareon, Yuwaree; Sriwichai, Sangworn


    Many studies have shown that fluoride can cross the placenta and that exposure to high fluoride during pregnancy may result in premature birth and/or a low birth weight. Lamphun is one of six provinces in Thailand where natural water fluoride (WF) concentrations >10.0 mg/L were found, and it was also found that >50% of households used water with high fluoride levels. Nevertheless, geographical information system (GIS) and maps of endemic fluoride areas are lacking. We aimed to measure the fluoride level of village water supplies to assess endemic fluoride areas and present GIS with maps in Google Maps. A cross-sectional survey was conducted from July 2016 to January 2017. Purpose sampling was used to identify villages of districts with WF >10.0 mg/L in the Mueang Lamphun, Pasang, and Ban Thi districts. Water samples were collected with the geolocation measured by Smart System Info. Fluoride was analyzed with an ion-selective electrode instrument using a total ionic strength adjustment buffer. WF >0.70 mg/L was used to identify unsafe drinking water and areas with high endemic fluoride levels. Descriptive statistics were used to describe the findings, and MS Excel was used to create the GIS database. Maps were created in Google Earth and presented in Google Maps. We found that WF concentrations ranged between 0.10-13.60 mg/L. Forty-four percent (n=439) of samples were at unsafe levels (>0.70 mg/L), and. 54% (n=303) of villages and 46% (n=79,807) of households used the unsafe drinking water. Fifty percent (n=26) of subdistricts were classified as being endemic fluoride areas. Five subdistricts were endemic fluoride areas, and in those, there were two subdistricts in which every household used unsafe drinking water. These findings show the distribution of endemic fluoride areas and unsafe drinking water in Lamphun. This is useful for health policy authorities, local governments, and villagers and enables collaboration to resolve these issues. The GIS data are

  13. Fluoride removal studies in water using natural materials : technical ...

    African Journals Online (AJOL)

    Excess fluoride in water causes health hazards to the natural environment. The removal of fluoride was attempted using natural materials such as red soil, charcoal, brick, fly-ash and serpentine. Each material was set up in a column for a known volume and the defluoridation capacities of these materials were studied with ...

  14. Fabrication of dense panels in lithium fluoride

    International Nuclear Information System (INIS)

    Farcy, P.; Roger, J.; Pointud, R.


    The authors report a study aimed at the fabrication of large and dense lithium fluoride panels. This sintered lithium fluoride is then supposed to be used for the construction of barriers of protection against a flow of thermal neutrons. They briefly present the raw material which is used under the form of chamotte obtained through a pre-sintering process which is also described. Grain size measurements and sample preparation are indicated. Shaping, drying, and thermal treatment are briefly described, and characteristics of the sintered product are indicated

  15. Application of a new adsorbent for fluoride removal from aqueous solutions

    International Nuclear Information System (INIS)

    Srivastav, Arun Lal; Singh, Prabhat K.; Srivastava, Varsha; Sharma, Yogesh C.


    Highlights: • A new adsorbent has been prepared. • The adsorbent is non-toxic and easy to synthesize. • HBO 1 has displayed best capacity for the removal of fluoride. • Unlike most adsorbents, HBO 1 is suitable for the removal of fluoride from water. • The process of removal has been optimized. -- Abstract: Hydrous bismuth oxides (HBOs) have been investigated as a possible adsorbent for fluoride removal from water. Apart from bismuth trioxide (Bi 2 O 3 ) compound, three additional HBOs, named as HBO 1 , HBO 2 , and HBO 3 were synthesized in the laboratory and examined for their relative potentials for fluoride removal from aqueous solutions. HBO 1 was observed to have highest fluoride removal at 10 mg/L initial concentration in aqueous environment. Among competitive anions, sulfate and chloride affect the fluoride removal by HBO 1 more adversely than bicarbonate. Characterization of HBOs using X-ray diffraction (XRD) pattern analyses indicated crystalline structures, and the broad chemical composition of materials showed successive increase of Bi(OH) 3 from HBO 1 to HBO 3 , with decrease of BiOCl in the same order. Fourier Transform Infrared (FTIR) spectroscopy analyses indicated presence of Bi-O bond and successively increasing number of peaks corresponding to OH ion from HBO 1 to HBO 3 . Scanning Electron Microscopic (SEM) images of HBOs show rough and porous structure of the materials. Presence of higher proportion of chloride compound in HBO 1 with respect to others appears to be the factor responsible for its better performance in fluoride removal from aqueous solutions

  16. Community water fluoridation online: an analysis of the digital media ecosystem. (United States)

    Helmi, Mohammad; Spinella, Mary Kate; Seymour, Brittany


    Research demonstrates the safety and efficacy of community water fluoridation (CWF). Yet, the digitization of communication has triggered the spread of inaccurate information online. The purpose of this study was to analyze patterns of CWF information dissemination by a network of sources on the web. We used Media Cloud, a searchable big data platform of over 550 million stories from 50 thousand sources, along with tools to analyze that archive. We generated a network of fluoridation publishers using Media Cloud's keyword identification from August 1, 2015 to July 31, 2016. We defined the media type and sentiment toward CWF for each source and generated a network map of the most influential sources during our study period based on hyperlinking activity. Media Cloud detected a total of 980 stories from 325 different sources related to water fluoridation. We identified nine different media types participating in the dissemination of information: academic, government, scientific group, natural medicine, blogs, mainstream media, advocacy groups, user-generated (e.g., YouTube), and "other." We detected five sub-networks within the overall fluoridation network map, each with its own characteristics. Twenty-one percent of sources were pro-fluoridation, receiving 57 percent of all inlinks, 22 percent of sources were anti-fluoridation, and the rest were neutral (54 percent). The dominant neutral sentiment of the network may signify that anti- and pro-sides of the debate are viewed as balanced, not just in number but also in quality of information. Despite high inlinks to pro-sources, anti-fluoridation sentiment maintains influence online. © 2018 American Association of Public Health Dentistry.

  17. Barium fluoride surface preparation, analysis and UV reflective coatings at Lawrence Livermore National Laboratory

    International Nuclear Information System (INIS)

    Wuest, C.R.


    Lawrence Livermore National Laboratory (LLNL) has begun a program of study on barium fluoride scintillating crystals for the Barium Fluoride Electromagnetic Calorimeter Collaboration. This program has resulted in a number of significant improvements in the mechanical processing, polishing and coating of barium fluoride crystals. Techniques have been developed using diamond-loaded pitch lapping that can produce 15 angstrom RMS surface finishes over large areas. These lapped surfaces have been shown to be crystalline using Rutherford Back-scattering (RBS). Also, special polishing fixtures have been designed based on mounting technology developed for the 1.1 m diameter optics used in LLNL's Nova Laser. These fixtures allow as many as five 25--50 cm long barium fluoride crystals to be polished and lapped at a time with the necessary tolerances for the 16,000 crystal Barium Fluoride Calorimeter. In addition, results will be presented on coating barium fluoride with UV reflective layers of magnesium fluoride and aluminum

  18. Equilibrium Studies of Fluoride Adsorption onto a Ferric Poly ...

    African Journals Online (AJOL)

    African countries along the Great Rift Valley are among areas of the world where excess fluoride in water sources is a major public health problem. In this work, the removal of fluoride (F) from water solutions using a ferric poly-mineral (FPM) from Kenya was therefore studied using batch adsorption experiments. The effect of ...

  19. Beryllium production using beryllium fluoride

    International Nuclear Information System (INIS)

    Hubler, Carlos Henrique


    This work presents the beryllium production by thermal decomposition of the ammonium beryllium fluoride, followed by magnesium reduction, obtained in the small pilot plant of the Brazilian National Nuclear Energy Commission - Nuclear Engineering Institute

  20. Fluoride Intake through Consumption of Tap Water and Bottled Water in Belgium

    Directory of Open Access Journals (Sweden)

    Herman van Oyen


    Full Text Available There is a tendency to align higher levels of fluoride in natural mineral water with the existing higher levels in tap water. Treatment of natural mineral waters could harm the preservation of their natural character. In this study fluoride intake through bottled and tap water consumption in the Belgian adult population was assessed, taking into account regional differences. A deterministic approach was used whereby consumption quantities of tap water and different brands of bottled water were linked with their respective fluoride concentrations. Data from the national food consumption survey (2004 were used and the Nusser methodology was applied to obtain usual intake estimates. Mean intake of fluoride through total water consumption in Flanders was 1.4±0.7 mg/day (97.5th percentile: 3.1 mg/day, while in the Walloon region it was on average 0.9±0.6 mg/day (97.5th percentile: 2.4 mg/day. The probability of exceeding the UL of 7 mg per day via a normal diet was estimated to be low. Consequently, there is no need to revise the existing norms, but higher fluoride concentrations should be more clearly indicated on the labels. Reliable data about total dietary fluoride intake in children, including intake of fluoride via tooth paste and food supplements, are needed.

  1. Groundwater fluoride contamination: A reappraisal

    Directory of Open Access Journals (Sweden)

    Amlan Banerjee


    Full Text Available Dissolution of fluorite (CaF2 and/or fluorapatite (FAP [Ca5(PO43F], pulled by calcite precipitation, is thought to be the dominant mechanism responsible for groundwater fluoride (F− contamination. Here, one dimensional reactive–transport models are developed to test this mechanism using the published dissolution and precipitation rate kinetics for the mineral pair FAP and calcite. Simulation results correctly show positive correlation between the aqueous concentrations of F− and CO32− and negative correlation between F− and Ca2+. Results also show that precipitation of calcite, contrary to the present understanding, slows down the FAP dissolution by 106 orders of magnitude compared to the FAP dissolution by hydrolysis. For appreciable amount of fluoride contamination rock–water interaction time must be long and of order 106 years.

  2. Computational investigation of the role of fluoride in Tamao oxidations

    DEFF Research Database (Denmark)

    Mader, Mary M.; Norrby, Per-Ola


    The Tamao oxidation of alkoxysilanes was investigated computationally to determine the role of fluoride. a key additive. in this reaction. A sequence of fluoride equilibria as well as possible transition states. mediated by basic and neutral peroxide, respectively, were examined, and a potential ...

  3. [Fluoride intake through consumption of water from municipal network in the INMA-Gipuzkoa cohort]. (United States)

    Jiménez-Zabala, Ana; Santa-Marina, Loreto; Otazua, Mónica; Ayerdi, Mikel; Galarza, Ane; Gallastegi, Mara; Ulibarrena, Enrique; Molinuevo, Amaia; Anabitarte, Asier; Ibarluzea, Jesús


    To estimate fluoride intake through consumption of water from the municipal network in pregnant women and their children from the INMA-Gipuzkoa cohort and to compare these intakes with recommended levels. In Euskadi (Spain), fluoridation of drinking water is compulsory in water supplies for more than 30,000 inhabitants. 575 pregnant women (recruitment, 2006-2008) and 424 4-year-old children (follow-up, 2010-2012) have been included. Fluoride levels in drinking water were obtained from the water consumption information system of the Basque Country (EKUIS). Water consumption habits and socioeconomic variables were obtained by questionnaire. 74.9% and 87.7% of women and children consumed water from the municipal network. Average fluoride levels in fluoridated water were 0.805 (SD: 0.194) mg/L during baseline recruitment and 0.843 (SD: 0.080) mg/L during follow up, at 4 years old of the children. Average and 95th percentile of fluoride intake were 0.015 and 0.026mg/kg per day in women and 0.033 and 0.059mg/kg per day in children. Considering only fluoride provided by drinking water, 8.71% of children living in fluoridated areas exceeded intake level recommended by the European Food Safety Authority, consisting in 0.05mg/kg per day. The results show that ingested levels of fluoride through consumption of municipal water can exceed the recommended levels in children and encourages further studies that will help in fluoridation policies of drinking water in the future. Copyright © 2017 SESPAS. Publicado por Elsevier España, S.L.U. All rights reserved.

  4. Fluoride and Oral Health

    DEFF Research Database (Denmark)

    O'Mullane, D M; Baez, R J; Jones, S


    and strategies is noteworthy. This updated version of ‘Fluoride and Oral Health’ has adopted an evidence-based approach to its commentary on the different fl uoride vehicles and strategies and also to its recommendations. In this regard, full account is taken of the many recent systematic reviews published...

  5. Metal Fluorides, Metal Chlorides and Halogenated Metal Oxides as Lewis Acidic Heterogeneous Catalysts. Providing Some Context for Nanostructured Metal Fluorides. (United States)

    Lennon, David; Winfield, John M


    Aspects of the chemistry of selected metal fluorides, which are pertinent to their real or potential use as Lewis acidic, heterogeneous catalysts, are reviewed. Particular attention is paid to β-aluminum trifluoride, aluminum chlorofluoride and aluminas γ and η, whose surfaces become partially fluorinated or chlorinated, through pre-treatment with halogenating reagents or during a catalytic reaction. In these cases, direct comparisons with nanostructured metal fluorides are possible. In the second part of the review, attention is directed to iron(III) and copper(II) metal chlorides, whose Lewis acidity and potential redox function have had important catalytic implications in large-scale chlorohydrocarbons chemistry. Recent work, which highlights the complexity of reactions that can occur in the presence of supported copper(II) chloride as an oxychlorination catalyst, is featured. Although direct comparisons with nanostructured fluorides are not currently possible, the work could be relevant to possible future catalytic developments in nanostructured materials.

  6. Fluoride concentration level in rural area in Poldasht city and daily fluoride intake based on drinking water consumption with temperature. (United States)

    Mohammadi, Ali Akbar; Yousefi, Mahmood; Mahvi, Amir Hossein


    Long-term exposure to high level of fluoride can caused several adverse effects on human health including dental and skeletal fluorosis. We investigated all the drinking water source located in rural areas of Poldasht city, west Azerbaijan Province, North West Iran between 2014 and 2015. Fluoride concentration of water samples was measured by SPADNS method. We found that in the villages of Poldasht the average of fluoride concentration in drinking water sources (well, and the river) was in the range mg/l 0.28-10.23. The average daily received per 2 l of drinking water is in the range mg/l 0.7-16.6 per day per person. Drinking water demands cause fluorosis in the villages around the area residents and based on the findings of this study writers are announced suggestions below in order to take care of the health of area residents.

  7. Application of Electrocoagulation Process Using Iron and Aluminum Electrodes for Fluoride Removal from Aqueous Environment

    Directory of Open Access Journals (Sweden)

    Edris Bazrafshan


    Full Text Available Fluoride in drinking water above permissible level is responsible for human being affected by skeletal fluorosis. The present study was carried out to assess the ability of electrocoagulation process with iron and aluminum electrodes in order to removal of fluoride from aqueous solutions. Several working parameters, such as fluoride concentration, pH, applied voltage and reaction time were studied to achieve a higher removal capacity. Variable concentrations (1, 5 and 10 mg L-1 of fluoride solutions were prepared by mixing proper amount of sodium fluoride with deionized water. The varying pH of the initial solution (3, 7 and 10 was also studied to measure their effects on the fluoride removal efficiency. Results obtained with synthetic solution revealed that the most effective removal capacities of fluoride could be achieved at 40 V electrical potential. In addition, the increase of electrical potential, in the range of 10-40 V, enhanced the treatment rate. Also comparison of fluoride removal efficiency showed that removal efficiency is similar with iron and aluminum electrodes. Finally it can be concluded that the electrocoagulation process has the potential to be utilized for the cost-effective removal of fluoride from water and wastewater.

  8. Role of polyphenols and nonpolyphenols against toxicity induced by fluoride: a comprehensive review. (United States)

    Claudio, Samuel R; Handan, Bianca A; Gomes de Moura, Carolina F; Viana, Milena de Barros; Yamauchi, Liria Y; Aguiar, Odair; Oshima, Celina T F; Ribeiro, Daniel A


    Since its discovery as an antimicrobial agent, fluoride has been used in the control of dental caries. Many studies have shown that the chronic exposure of fluoride in high concentrations causes adverse effects in multiple organs; the use of bioactive compounds present in foods as a tool to mitigate the effects of fluoride could potentially be useful for populations in different parts of the world are exposed to fluoride in a chronic and systemic way. Thus, the aim of this comprehensive review is to present and discuss the published papers that focused on the use of polyphenols and nonpolyphenols that can mitigate the harmful activities promoted by fluoride exposure. Certainly, these data will contribute toward a better understanding of the role of food compounds in the pathological outcomes induced by fluoride. The new information will be added to that already available for regulatory purposes as a safe way to promote oral healthcare and prevent oral carcinogenesis.

  9. Effect of inhibitors on acid production by baker's yeast. (United States)

    Sigler, K; Knotková, A; Kotyk, A


    Glucose-induced acid extrusion, respiration and anaerobic fermentation in baker's yeast was studied with the aid of sixteen inhibitors. Uranyl(2+) nitrate affected the acid extrusion more anaerobically than aerobically; the complexing of Mg2+ and Ca2+ by EDTA at the membrane had no effect. Inhibitors of glycolysis (iodoacetamide, N-ethylmaleimide, fluoride) suppressed acid production markedly, and so did the phosphorylation-blocking arsenate. Fluoroacetate, inhibiting the citric-acid cycle, had no effect. Inhibition by uncouplers depended on their pKa values: 2,4,6-trinitrophenol (pKa 0.4) less than 2,4-dinitrophenol (4.1) less than azide (4.7) less than 3-chlorophenylhydrazonomalononitrile (6.0). Inhibition by trinitrophenol was only slightly increased by its acetylation. Cyanide and nonpermeant oligomycin showed practically no effect; inhibition by dicyclohexylcarbodiimide was delayed but potent. The concentration profiles of inhibition of acid production differed from those of respiration and fermentation. Thus, though the acid production is a metabolically dependent process, it does not reflect the intensity of metabolism, except partly in the first half of glycolysis.

  10. Fluoride ions sorption of the water using natural and modified hematite with aluminium hydroxide

    International Nuclear Information System (INIS)

    Teutli S, E. A.


    Fluorine is a mineral known for its dental benefits, but fluoride ions can cause fluoro sis in excessive quantities. There are many epidemiological studies on possible adverse effects resulting from prolonged ingestion of fluoride through drinking water. These studies demonstrate that fluoride mainly affects the bone tissue (bones and teeth), may produce an adverse effect on tooth enamel and can cause mild dental fluoro sis at concentrations from 0.9 to 1.2 mg/L in drinking water. In several states of Mexico, water contaminated with fluoride ions can be found, such as Aguascalientes, Chihuahua, Coahuila, Durango, Guanajuato, Sonora, Zacatecas, San Luis Potosi and Jalisco, where the fluoride ions levels are higher than 1.5 mg/L, established by the Mexican Official Standard (NOM-127-Ssa-2000) which sets the permissible limits of water for human use and consumption. Currently, several technologies have been proposed to remove fluoride ions from water such as precipitation methods which are based on the addition of chemicals to water and sorption methods to removed fluoride ions by sorption or ion exchange reactions by some suitable substrate capable of regenerate and reuse. In this work, the sorption of fluoride ions using unmodified and modified hematite with aluminum hydroxide to remove fluoride ions from water by bath experiments was studied. The hematite was modified by treating it with aluminum hydroxide, NaOH and Al 2 (SO 4 ) 3 solutions. The characterization of hematite before and after modification with aluminum hydroxide was studied by X-ray diffraction, scanning electron microscopy, EDS and Bet. The effect of ph, contact time, concentration of fluoride ions, and the dose of sorbent on the sorption of fluoride ions by the modified hematite were studied. Equilibrium was reached within 48 hours of contact time and the maximum sorption of fluoride ions were in the range pH eq between 2.3 and 6.2. Sorption capacities of fluoride ions as a function of dose of

  11. Antibacterial Properties of Calcium Fluoride-Based Composite Materials: In Vitro Study (United States)

    Zarzycka, Beata; Grzegorczyk, Janina; Sokołowski, Krzysztof; Półtorak, Konrad; Sokołowski, Jerzy


    The aim of the study was to evaluate antibacterial activity of composite materials modified with calcium fluoride against cariogenic bacteria S. mutans and L. acidophilus. One commercially available conventional light-curing composite material containing fluoride ions (F2) and two commercially available flowable light-curing composite materials (Flow Art and X-Flow) modified with 1.5, 2.5, and 5.0 wt% anhydrous calcium fluoride addition were used in the study. Composite material samples were incubated in 0.95% NaCl at 35°C for 3 days; then dilution series of S. mutans and L. acidophilus strains were made from the eluates. Bacteria dilutions were cultivated on media afterwards. Colony-forming unit per 1 mL of solution (CFU/mL) was calculated. Composite materials modified with calcium fluoride highly reduced (p composite materials containing fluoride compounds. The greatest reduction in bacteria growth was observed for composite materials modified with 1.5% wt. CaF2. All three tested composite materials showed statistically greater antibacterial activity against L. acidophilus than against S. mutans. PMID:28053976

  12. Stabilization of fluoroindate glasses by magnesium fluoride and other heavy metal fluorides

    Directory of Open Access Journals (Sweden)

    B. J. Costa


    Full Text Available Their extended transparency in the IR makes them attractive for use as optical fibers for CO laser power delivery and optical amplification. This paper firstly describes the spectacular stabilizing effect of MgF2 on the binary system InF3-BaF2. The investigation of the InF3-BaF2-MgF2 system led to samples up to 5mm in thickness. Further optimization of this system was achieved by incorporation of limited amounts of other fluorides and resulted in increased resistence to devitrification. The second approach of this work was concerned to the investigation of the pseudo-ternary system InF3-GdF3-GaF3 at constant concentrations of ZnF2-SrF2-BaF2-NaF. Several compositions were studied in this system. The samples presented a better thermal stability when compared to other families of fluoride glasses. Therefore, these glasses seem to be very promising for the fabrication of special optical fibers. Thermal data are reported.


    African Journals Online (AJOL)

    31 déc. 2010 ... by fluoride ions in the waters of the region (Fluorosis Dental and skeletal). This study proposes, the estimated daily intake of fluoride from its water .... Le fluor est dosé par la méthode potentiométrique (NF T 90-004) grâce à une électrode spécifique aux ions fluorures. La mesure du potentiel a été effectuée ...

  14. Fluoride in the prevention and treatment of glucocorticoid-induced osteoporosis

    NARCIS (Netherlands)

    Lems, WF; Jacobs, JWG; Bijlsma, JWJ


    Since the use of fluoride has been shown to stimulate bone formation and since decreased bone formation is a key feature in the pathogenesis of corticosteroid-induced osteoporosis (CIOP), fluoride is, at least theoretically, attractive for the prevention and treatment of CIOP. In postmenopausal

  15. Molten fluoride mixtures as possible fission reactor fuels

    International Nuclear Information System (INIS)

    Grimes, W.R.


    Molten mixtures of fluorides with UF 4 as a component have been used as combined fuel and primary heat transfer agent in experimental high-temperature reactors and have been proposed for use in breeders or converters of 233 U from thorium. Such use places stringent and diverse demands upon the fluid fuel. A brief review of chemical behavior of molten fluorides is given to show some of their strengths and weaknesses for such service

  16. The occurrence and geochemistry of fluoride in some natural waters of Kenya (United States)

    Gaciri, S. J.; Davies, T. C.


    In recent years the acquisition of considerable additional data on the hydrogeochemical behaviour of fluoride in natural waters of Kenya has been made possible by extensive surface-water and groundwater sampling campaigns as well as by improvements in analytical techniques. Ultimately, the principal source of fluoride relates to emissions from volcanic activity associated with the East African Rift System. Through various intermediate steps, but also directly, fluoride passes into the natural water system and components of the food chain. Ingestion by man is mainly through drinking water and other beverages. River waters in Kenya generally have a fluoride concentration lower than the recommended level (1.3 ppm) for potable water, thus promoting susceptibility to dental caries. Groundwaters and lake waters show considerably higher fluoride contents, resulting in the widespread incidence of fluorosis in areas where groundwater is the major source of drinking water, and lake fish is a regular component of the diet. This paper presents a synthesis of the data so far obtained on the sources and distribution of fluoride in the hydrological system of Kenya, examines the extent of fluorine toxicity and puts forward recommendations to combat or minimise the problem.

  17. Slow-release fluoride devices for the control of dental decay. (United States)

    Chong, Lee-Yee; Clarkson, Jan E; Dobbyn-Ross, Lorna; Bhakta, Smriti


    Slow-release fluoride devices have been investigated as a potentially cost-effective method of reducing dental caries in people with high risk of disease. This is the second update of the Cochrane Review first published in 2006 and previously updated in 2014. To evaluate the effectiveness and safety of different types of slow-release fluoride devices on preventing, arresting, or reversing the progression of carious lesions on all surface types of primary (deciduous) and permanent teeth. Cochrane Oral Health's Information Specialist searched the following electronic databases: Cochrane Oral Health's Trials Register (to 23 January 2018); the Cochrane Central Register of Controlled Trials (CENTRAL; 2017, Issue 12) in the Cochrane Library (searched 23 January 2018); MEDLINE Ovid (1946 to 23 January 2018); and Embase Ovid (1980 to 23 January 2018). The US National Institutes of Health Ongoing Trials Register, and the World Health Organization International Clinical Trials Registry Platform were searched for ongoing trials (23 January 2018). We placed no restrictions on the language or date of publication when searching the electronic databases. Parallel randomised controlled trials (RCTs) comparing slow-release fluoride devices with an alternative fluoride treatment, placebo, or no intervention in all age groups. The main outcome measures sought were changes in numbers of decayed, missing, and filled teeth or surfaces (DMFT/DMFS in permanent teeth or dmft/dmfs in primary teeth), and progression of carious lesions through enamel and into dentine. We conducted data collection and analysis using standard Cochrane review methods. At least two review authors independently performed all the key steps in the review such as screening of abstracts, application of inclusion criteria, data extraction, and risk of bias assessment. We resolved discrepancies through discussions or arbitration by a third or fourth review author. We found no evidence comparing slow

  18. Determination of fluoride in drainage by ion electrode method

    International Nuclear Information System (INIS)

    Terakado, Shigeru; Ochiai, Ken-ichi; Motoyama, Shigeji; Tsutsumi, Ken-ichi


    The fluoride ion selective electrode method for rapidly and precisely determining fluoride in drainage was studied. This method enables the analysis of the samples with fluoride concentration above 0.1 mg/l in about five minutes. Six buffer solutions were selected to compare the masking effect against aluminum. Solution A is TISAB made by dissolving 57 ml of gracial acetic acid and 10 g of sodium chloride in 500 ml of water, thereafter adjusting pH to 5.5 and diluting to 1 liter with water. Solution B is phosphoric acid solution (17 M/L). Solution C is 3 M ammonium phosphate dibasic aqueous solution. Solution D is 1 M sodium citrate aqueous solution adjusted to pH 6 with hydrochloric acid. Solution E is 0.5 M sodium phosphate dibasic aqueous solution. Solution F is 2 M ammonium phosphate monobasic aqueous solution. As a result of studying the effect of coexisting elements, the buffer solutions A,B,E and F were greatly influenced by the coexistence of aluminum, while C and D show remarkable masking effect against aluminum. The amount of interfering ions in normal drainage is so small that no problem is anticipated for D. When fluoride recovery treatment is performed, it is important in dilution measurement to confirm whether the measured values are accurate or not, because there are high and low concentrations of fluoride at the same potential. (Iwakiri, K.)

  19. γ-Aminobutyric acid ameliorates fluoride-induced hypothyroidism in male Kunming mice. (United States)

    Yang, Haoyue; Xing, Ronge; Liu, Song; Yu, Huahua; Li, Pengcheng


    This study evaluated the protective effects of γ-aminobutyric acid (GABA), a non-protein amino acid and anti-oxidant, against fluoride-induced hypothyroidism in mice. Light microscope sample preparation technique and TEM sample preparation technique were used to assay thyroid microstructure and ultrastructure; enzyme immunoassay method was used to assay hormone and protein levels; immunohistochemical staining method was used to assay apoptosis of thyroid follicular epithelium cells. Subacute injection of sodium fluoride (NaF) decreased blood T4, T3 and thyroid hormone-binding globulin (TBG) levels to 33.98 μg/l, 3 2.8 ng/ml and 11.67 ng/ml, respectively. In addition, fluoride intoxication induced structural abnormalities in thyroid follicles. Our results showed that treatment of fluoride-exposed mice with GABA appreciably decreased metabolic toxicity induced by fluoride and restored the microstructural and ultrastructural organisation of the thyroid gland towards normalcy. Compared with the negative control group, GABA treatment groups showed significantly upregulated T4, T3 and TBG levels (42.34 μg/l, 6.54 ng/ml and 18.78 ng/ml, respectively; Plevel and apoptosis inhibition in thyroid follicular epithelial cells. To the best of our knowledge, this is the first study to establish the therapeutic efficacy of GABA as a natural antioxidant in inducing thyroprotection against fluoride-induced toxicity. Copyright © 2015 Elsevier Inc. All rights reserved.

  20. Effect of various rinsing protocols after use of amine fluoride/stannous fluoride toothpaste on the bacterial composition of dental plaque. (United States)

    van Loveren, C; Gerardu, V A M; Sissons, C H; van Bekkum, M; ten Cate, J M


    This clinical study evaluated the effect of different oral hygiene protocols on the bacterial composition of dental plaque. After a 2-week period of using fluoride-free toothpaste, 30 participants followed three 1-week experimental protocols, each followed by 2-week fluoride-free washout periods in a randomized crossover examiner-blind controlled trial. The 1-week experimental protocols comprised the use of AmF/SnF(2) toothpaste twice daily, after which participants either (1) rinsed with tap water, (2) did not rinse but only spat out the toothpaste, or (3) rinsed with an AmF/SnF(2) mouthwash. In the fluoride-free washout periods, the participants brushed their teeth with fluoride-free toothpaste without further instructions. Six hours after the last brushing (+/- rinsing) of each period, buccal plaque samples in the upper molar region were taken. The microbiota composition of the plaque samples was analyzed by checkerboard DNA:DNA hybridization. A statistically significant reduction was found in the total amount of DNA of the 39 major plaque species measured, and in the proportions of some acid-producing bacterial strains after the period having used the AmF/SnF(2) toothpaste + AmF/SnF(2) mouthrinsing. The results indicate that using the AmF/SnF(2) toothpaste and rinse combination could result in plaque of lower cariogenicity. Copyright 2009 S. Karger AG, Basel.

  1. Implementing a geographical information system to assess endemic fluoride areas in Lamphun, Thailand

    Directory of Open Access Journals (Sweden)

    Theerawasttanasiri N


    Full Text Available Nonthaphat Theerawasttanasiri,1,2 Surasak Taneepanichskul,1 Wichain Pingchai,3 Yuwaree Nimchareon,4 Sangworn Sriwichai5 1College of Public Health Sciences, Chulalongkorn University, Bangkok, Thailand; 2Department of Health, Health Promotion Center Region 1, Chiang Mai, Thailand; 3Mueang Lamphun District Public Health Office, 4Pasang District Public Health Office, 5Ban Thi District Public Health Office, Lamphun, Thailand Introduction: Many studies have shown that fluoride can cross the placenta and that exposure to high fluoride during pregnancy may result in premature birth and/or a low birth weight. Lamphun is one of six provinces in Thailand where natural water fluoride (WF concentrations >10.0 mg/L were found, and it was also found that >50% of households used water with high fluoride levels. Nevertheless, geographical information system (GIS and maps of endemic fluoride areas are lacking. We aimed to measure the fluoride level of village water supplies to assess endemic fluoride areas and present GIS with maps in Google Maps.Methods: A cross-sectional survey was conducted from July 2016 to January 2017. Purpose sampling was used to identify villages of districts with WF >10.0 mg/L in the Mueang Lamphun, Pasang, and Ban Thi districts. Water samples were collected with the geolocation measured by Smart System Info. Fluoride was analyzed with an ion-selective electrode instrument using a total ionic strength adjustment buffer. WF >0.70 mg/L was used to identify unsafe drinking water and areas with high endemic fluoride levels. Descriptive statistics were used to describe the findings, and MS Excel was used to create the GIS database. Maps were created in Google Earth and presented in Google Maps.Results: We found that WF concentrations ranged between 0.10–13.60 mg/L. Forty-four percent (n=439 of samples were at unsafe levels (>0.70 mg/L, and. 54% (n=303 of villages and 46% (n=79,807 of households used the unsafe drinking water. Fifty percent

  2. Behaviour of fluoride and dissolved silicon in Gouthami Godavari estuarine environment

    Digital Repository Service at National Institute of Oceanography (India)

    Sarma, V.V.; Sudhakar, U.; Varaprasad, S.J.D.

    The concentrations of fluoride and dissolved silicon in Gouthami-Godavari estuarine region (Andhra Pradesh, India) have been measured as a function of chlorinity during different seasons. Fluoride and dissolved silicon behave conservatively during...

  3. Lithological Influences on Occurrence of High-Fluoride Waters in The Central Kenya Rift (United States)

    Olaka, L. A.; Musolff, A.; Mulch, A.; Olago, D.; Odada, E. O.


    Within the East African rift, groundwater recharge results from the complex interplay of geology, land cover, geomorphology, climate and on going volcano-tectonic processes across a broad range of spatial and temporal scales. The interrelationships between these factors create complex patterns of water availability, reliability and quality. The hydrochemical evolution of the waters is further complex due to the different climatic regimes and geothermal processes going on in this area. High fluoridic waters within the rift have been reported by few studies, while dental fluorosis is high among the inhabitants of the rift. The natural sources of fluoride in waters can be from weathering of fluorine bearing minerals in rocks, volcanic or fumarolic activities. Fluoride concentration in water depends on a number of factors including pH, temperature, time of water-rock formation contact and geochemical processes. Knowledge of the sources and dispersion of fluoride in both surface and groundwaters within the central Kenya rift and seasonal variations between wet and dry seasons is still poor. The Central Kenya rift is marked by active tectonics, volcanic activity and fumarolic activity, the rocks are majorly volcanics: rhyolites, tuffs, basalts, phonolites, ashes and agglomerates some are highly fractured. Major NW-SE faults bound the rift escarpment while the rift floor is marked by N-S striking faults We combine petrographic, hydrochemistry and structural information to determine the sources and enrichment pathways of high fluoridic waters within the Naivasha catchment. A total of 120 water samples for both the dry season (January-February2012) and after wet season (June-July 2013) from springs, rivers, lakes, hand dug wells, fumaroles and boreholes within the Naivasha catchment are collected and analysed for fluoride, physicochemical parameters and stable isotopes (δ2 H, δ18 O) in order to determine the origin and evolution of the waters. Additionally, 30 soil and

  4. Effects of atmospheric hydrogen fluoride upon Drosophila melanogaster. I. Differential genotyptic response

    Energy Technology Data Exchange (ETDEWEB)

    Gerdes, R A; Smith, J D; Applegate, H G


    Four inbred lines of Drosophila melanogaster were exposed to various concentrations of gaseous hydrogen fluoride for a period of six weeks. The effects upon the viability of these populations were predominantly linear with respect to fluoride concentration over the range tested. Differential responses of the inbred lines were interpreted to mean that tolerance to fluoride contamination is influenced by genotype. 4 references, 1 figure, 1 table.

  5. The efficacy of amine fluoride/stannous fluoride in the suppression of morning breath odour. (United States)

    Quirynen, Marc; Avontroodt, Pieter; Soers, Catherine; Zhao, Hong; Pauwels, Martine; Coucke, Wim; van Steenberghe, Daniel


    Breath odour is a complaint encountered worldwide, often linked to microbial overload in the oral cavity. This double blind, crossover, randomised study assessed the efficacy of several antiseptic mouthrinses or slurry vs. a control solution in the prevention of morning bad breath during an experimental period of 7 days without mechanical plaque control. Sixteen dental students with a healthy periodontium abolished, after a thorough professional cleaning, all means of mechanical plaque control during five experimental periods of 7 days, interleaved by washout periods of at least 3 weeks. During each experimental period, as the only oral hygiene measure, the students rinsed twice a day with one of the following formulations (in a randomised order): a 0.2% chlorhexidine-alcohol mouthrinse (CHX-Alc), a 0.05% CHX + 0.05% cetylpyridinium chloride + 0.14% zinc lactate mouthrinse (CHX-CPC-Zn), an amine fluoride/stannous fluoride (125 ppm F-/125 ppm F-) containing mouthrinse (AmF/SnF2Mr), a slurry of a tooth paste (AmF/SnF2Sl) containing amine fluoride (350 ppm F-) and stannous fluoride (1050 ppm F-) and a placebo solution (placebo). At days 0, 3 and 7, morning breath was scored via VSC level measurements of the mouth air, and organoleptic ratings of the mouth air and tongue coating. At the same visits both the degree of gingival inflammation and the de novo plaque formation were rated. At the end of each period a questionnaire for subjective ratings was completed and microbiological samples were taken from the tongue dorsum, the saliva and the supragingival plaque for anaerobic and aerobic culturing. Although oral hygiene during the experimental periods was limited to rinsing, bad breath parameters systematically improved (P bacterial load (aerobic & anaerobic) in the saliva (>or= 0.5 log reduction with a superiority (P bacterial load on the tongue dorsum could only be detected for the CHX-Alc solution (0.5 log). The antibacterial effect of the placebo solution and the

  6. Biochemical studies on the effect of fluoride on higher plants. 3. The effect of fluoride on dark carbon dioxide fixation

    Energy Technology Data Exchange (ETDEWEB)

    Yang, S F; Miller, G W


    Dark CO/sub 2/ fixation and phosphoenolpyruvate-carboxylase activity were studied in fluoride-necrotic and control soya-bean leaves. Necrotic leaves had a higher rate of dark CO/sub 2/ fixation than control leaves both in vivo and in vitro (phosphoenolpyruvate carboxylase). Results suggested that the accumulation of organic acids and amino acids in necrotic leaves resulted from an increased rate of dark CO/sub 2/ fixation. The possible role of fluoride in stimulating the carboxylation and its implication to necrosis are discussed.

  7. Studies on the comparative effect of sodium fluoride on collagen ...

    African Journals Online (AJOL)



    Dec 12, 2011 ... (p < 0.05) higher collagen in the kidneys followed by lungs and liver. 5, 10 and 20 mg/kg .... the type of enzyme that is affected (Adamek et al., 2005). Fluoride at ... content of a diet may influence the food fluoride absorp- tion.

  8. Trend Analysis of Studies on Water Fluoridation Related to Dental Caries in PubMed. (United States)

    Oh, Hyo-Jung; Choi, Hyeon-Mi; Kim, Chonghyuck; Jeon, Jae-Gyu


    Water fluoridation has been cited as one of the top 10 public health achievements of the 20th century. Herein, we analyzed water fluoridation articles related to dental caries published in PubMed between 1950 and 2016 using informetrics and linguistic methods to investigate trends in the studies. To this aim, queries such as "dental caries and (water fluoridation or fluoridated water)," "dental caries and (fluoride or fluoridation)," and "dental caries" were submitted to PubMed to retrieve information about articles on water fluoridation within the area of dental caries and fluoride - their titles, abstracts, publication dates, author affiliations, and publication journals. This article information was then collected by an automatic web crawler and examined through informetrics and linguistic analyses. It was found that the number of articles concerned with water fluoridation and dental caries was 3,381 and declined over time after 1970. The articles were published by 750 journals - most notably, Community Dentistry and Oral Epidemiology and Caries Research. With regard to the geographic distribution of the authors, Europe and North America, especially the USA and UK, accounted for 59.9% of the articles published during the years 1987 to 2015, though there was a sharp increase in the number of authors in Oceania and Asia in recent years. In the titles and abstracts of the articles, "community" and "fluorosis" were mentioned more frequently than the other key terms selected in this study, regardless of the period examined. Our findings may allow one to assess how the research on water fluoridation has evolved over the past several decades. © 2018 S. Karger AG, Basel.

  9. Groundwater fluoride contamination and its possible health implications in Indi taluk of Vijayapura District (Karnataka State), India. (United States)

    Ugran, Vidyavati; Desai, Naveen N; Chakraborti, Dipankar; Masali, Kallappa A; Mantur, Prakash; Kulkarni, Shreepad; Deshmukh, Niranjan; Chadchan, Kailash S; Das, Swastika N; Tanksali, Anuradha S; Arwikar, Asha S; Guggarigoudar, Suresh P; Vallabha, Tejaswini; Patil, Shailaja S; Das, Kusal K


    Groundwater fluoride concentration and fluoride-related health problems were studied in twenty-two villages of Indi taluk of Vijayapura district, Karnataka, India. Present study (2015) was also used to compare groundwater fluoride concentration in same 22 villages with previous government report (2000). Groundwater fluoride concentrations of 62 bore wells of 22 villages were analyzed by using an ion-sensitive electrode. A total of 660 adults and 600 children were screened for fluorosis symptoms and signs. Sixty clinically suspected fluorosis patients' urine samples were further analyzed for fluoride. The mean value (1.22 ± 0.75 mg/L) of fluoride concentration of 62 bore wells and 54.83 % bore wells with ≥1.0 mg/L of fluoride concentrations in Indi taluk indicates higher than the permissible limit of drinking water fluoride concentration recommended for India. Clinical symptoms like arthritis, joint pains, gastrointestinal discomfort and lower limb deformities with high urinary fluoride concentrations in some subjects suggest fluorosis. Results also showed an increase in groundwater fluoride concentration of the same 22 villages between previous and present study. Preliminary arthritis symptom of the villagers could be due to drinking fluoride-contaminated water. Increase in fluoride concentration with time to the bore wells definitely indicates future danger.

  10. Effects of Fluoride on NiTi Orthodontic Archwires: An X-ray Diffraction Study

    Directory of Open Access Journals (Sweden)

    Sumit Kumar Yadav


    Results: Unloading force values of NiTi orthodontic wires were significantly decreased after exposure to both fluoride solutions (p < 0.001. Corrosive changes in surface topography were observed for both fluoride solutions. Wires exposed to acidic fluoride appeared as more severely affected. X-ray diffraction analysis showed no change in crystal lattice of NiTi wires in both solutions. Conclusion: The results suggest that using topical fluoride agents with NiTi wire could decrease the functional unloading mechanical properties of the wire and contribute to prolonged orthodontic treatment.

  11. Grout formulation for disposal of low-level and hazardous waste streams containing fluoride (United States)

    McDaniel, E.W.; Sams, T.L.; Tallent, O.K.


    A composition and related process for disposal of hazardous waste streams containing fluoride in cement-based materials is disclosed. the presence of fluoride in cement-based materials is disclosed. The presence of fluoride in waste materials acts as a set retarder and as a result, prevents cement-based grouts from setting. This problem is overcome by the present invention wherein calcium hydroxide is incorporated into the dry-solid portion of the grout mix. The calcium hydroxide renders the fluoride insoluble, allowing the grout to set up and immobilize all hazardous constituents of concern. 4 tabs.

  12. Evaluation and modeling of the parameters affecting fluoride toxicity level in aquatic environments by bioassay method

    Directory of Open Access Journals (Sweden)

    Hamid Reza Shamsollahi


    Full Text Available Background: Fluoride exists in various forms in nature and water resources. , The rising level of fluoride in water resources due to discharge of industrial effluents can cause toxicity in aquatic organisms. To prevent toxicity, it is necessary to determine maximum fluoride toxicity as well as effluent discharge limits. The aim of this study was to determine the maximum fluoride toxicity and the factors affecting fluoride toxicity to provide a model in order to determine the effluent discharge limits. Methods: Daphnia magna bioassay in the absence of confounding factors was used to determine the maximum level of fluoride toxicity. Then, bioassay was repeated in the presence of the confounding factors (hardness, temperature and exposure time to determine their effects. Results: In the absence of intervening factors, fluoride LC50 levels determined after 24, 48 and 72 hours exposure were 4.9, 46.5 and 38.7 mg/l, respectively.. Also, the influence of confounding factors on LC50 values was reported significant by Minitab software. Conclusion: Increasing the water hardness reduced fluoride toxicity, and increasing the water temperature and exposure time increased fluoride toxicity in aquatic environments. Therefore, while determining the wastewater discharge limit in terms of fluoride concentration, it is essential to take the effect of confounding factors on fluoride toxicity into account in order to prevent toxicity in the open water resources.

  13. The impact of aluminium smelter shut-down on the concentration of fluoride in vegetation and soils

    International Nuclear Information System (INIS)

    Brougham, Kate M.; Roberts, Stephen R.; Davison, Alan W.; Port, Gordon R.


    Although a great deal is known about the deposition of fluoride on vegetation, and the hazards associated with uptake by grazing herbivores, little is known about what happens to the concentration of fluoride in vegetation and soil at polluted sites once deposition ceases. The closure of Anglesey Aluminium Metals Ltd smelter, in September 2009, provided a unique opportunity to study fluoride loading once deposition stopped. Fluoride was monitored in plants and soil within 1 km of the former emission source. Fluoride concentrations in a range of plant material had decreased to background levels of 10 mg F kg −1 after 36 weeks. Concentrations of fluoride in mineral-rich soils decreased steadily demonstrating their limited potential to act as contaminating sources of fluoride for forage uptake. There were significant differences in the rate of decline of fluoride concentrations between plant species. -- Highlights: •The impact of aluminium smelter closure on fluoride concentrations was investigated. •Concentrations in forage decreased rapidly to safe levels for livestock grazing. •The concentrations in some species declined to background levels within a year. •Significant interspecies differences in fluoride decline are described. •Mineral-rich soils have limited potential as contaminating sources for forage. -- Fluoride is hazardous to grazing herbivores, but when deposition stops, F-levels in plants and soil fall rapidly, some returning to background concentrations within a year

  14. Biological effects data: Fluoride and sulfur dioxide

    Energy Technology Data Exchange (ETDEWEB)

    McMechan, K.J. (ed.); Holton, R.L.; Ulbricht, R.J.; Morgan , J.B.


    The Alumax Pacific Aluminum Corporation has proposed construction of an aluminum reduction facility near Youngs Bay at Warrenton, Oregon. This report comprises one part of the final report to Alumax on a research project entitled, Physical, Chemical and Biological Studies of Youngs Bay.'' It presents data pertaining to the potential biological effects of fluoride and sulfur dioxide, two potentially hazardous plant-stack emissions, on selected aquatic species of the area. Companion volumes provide a description of the physical characteristics the geochemistry, and the aquatic animals present in Youngs Bay and adjacent ecosystems. An introductory volume provides general information and maps of the area, and summarizes the conclusions of all four studies. The data from the two phases of the experimental program are included in this report: lethal studies on the effects of selected levels of fluoride and sulfur dioxide on the survival rate of eleven Youngs Bay faunal species from four phyla, and sublethal studies on the effects of fluoride and sulfur dioxide on the rate of primary production of phytoplankton. 44 refs., 18 figs., 38 tabs.

  15. Enhancement of Saharan groundwater quality by reducing its fluoride concentration using different materials

    KAUST Repository

    Ramdani, Amina


    According to the environmental protection regulations, fluoride concentration is considered as a substance of priority for assessment of drinking water quality to determine their impacts on the environment and public health. Saharan groundwater (Algeria) contains an excess of fluoride ions. Regular consumption of this water by the population of the region may cause endemic fluorosis. To solve this problem, we propose to treat this water by adsorption on different materials, such as activated alumina (AA), sodium clay (SC), and hydroxyapatite (HAP) in order to enhance its quality by reducing its fluoride concentration. The maximum adsorption is achieved with an adsorption capacity of the order of 0.9, 0.667, and 0.370 mg/g and with a percentage of 90, 83.4, and 73.95% for AA, HAP, and SC, respectively. Indeed, the acidity and alkalinity of the medium significantly affect the adsorption of fluoride ions. Results deduced from the curves of adsorption isotherms of fluoride ions showed that the retention is predictable from these isotherms in agreement with the Langmuir model. The low removal of fluoride ions was observed in presence of (Formula presented.), (Formula presented.), and (Formula presented.) ions. Finally, AA material proved to be the best adsorbent for fluoride ions removal. © 2014 © 2014 Balaban Desalination Publications. All rights reserved.

  16. Giant Faraday Rotation in Metal-Fluoride Nanogranular Films. (United States)

    Kobayashi, N; Ikeda, K; Gu, Bo; Takahashi, S; Masumoto, H; Maekawa, S


    Magneto-optical Faraday effect is widely applied in optical devices and is indispensable for optical communications and advanced information technology. However, the bismuth garnet Bi-YIG is only the Faraday material since 1972. Here we introduce (Fe, FeCo)-(Al-,Y-fluoride) nanogranular films exhibiting giant Faraday effect, 40 times larger than Bi-YIG. These films have a nanocomposite structure, in which nanometer-sized Fe, FeCo ferromagnetic granules are dispersed in a Al,Y-fluoride matrix.


    Fries, B.A.


    A plutonium separatory ore concentration procedure involving the use of a fluoride type of carrier is presented. An improvement is given in the derivation step in the process for plutonium recovery by carrier precipitation of plutonium values from solution with a lanthanum fluoride carrier precipitate and subsequent derivation from the resulting plutonium bearing carrier precipitate of an aqueous acidic plutonium-containing solution. The carrier precipitate is contacted with a concentrated aqueous solution of potassium carbonate to effect dissolution therein of at least a part of the precipitate, including the plutonium values. Any remaining precipitate is separated from the resulting solution and dissolves in an aqueous solution containing at least 20% by weight of potassium carbonate. The reacting solutions are combined, and an alkali metal hydroxide added to a concentration of at least 2N to precipitate lanthanum hydroxide concomitantly carrying plutonium values.

  18. Development of multifunctional chitosan beads for fluoride removal

    Energy Technology Data Exchange (ETDEWEB)

    Viswanathan, Natrayasamy [Department of Chemistry, Gandhigram Rural University, Gandhigram 624 302, Tamilnadu (India); Sairam Sundaram, C. [Department of Science and Humanities, Karaikal Polytechnic College, Karaikal 609 609, Puducherry (India); Meenakshi, S., E-mail: [Department of Chemistry, Gandhigram Rural University, Gandhigram 624 302, Tamilnadu (India)


    Chitosan beads (CB) which have negligible defluoridation capacity (DC) have been chemically modified by introducing multifunctional groups, viz., NH{sub 3}{sup +} and COOH groups by means of protonation and carboxylation in order to utilize both amine and hydroxyl groups for fluoride removal. The protonated cum carboxylated chitosan beads (PCCB) showed a maximum DC of 1800 mg F{sup -}/kg whereas raw chitosan beads displayed only 52 mg F{sup -}/kg. Sorption process was found to be independent of pH and slightly influenced in the presence of other common anions. The fluoride sorption on modified forms was reasonably explained by Freundlich and Langmuir isotherms. The sorbents were characterised by FTIR and SEM with EDAX analysis. The sorption process follows pseudo-second-order and intraparticle diffusion kinetic models. The suitability of PCCB has been tested with field sample collected from a nearby fluoride endemic area.

  19. The occurrence of fluoride in South African groundwater: A water ...

    African Journals Online (AJOL)

    The fluoride data were obtained by extracting fluoride groundwater quality data from DWAF's Water Management Systems (WMS) database. STATISTICA and ARCVIEW were used to process the data. The dental fluorosis data were obtained from a field study conducted by the Department of Health. The degree of dental ...

  20. Method for routine determination of fluoride in urine by selective ion- electrode

    International Nuclear Information System (INIS)

    Pires, M.A.F.; Bellintani, S.A.


    A simple, fast and sensitive method is outlined for determining fluoride in urine of workers who handle fluoride compounds. The determination is based on the measurement of fluoride by ion selective electrode. Cationic interferents like Ca ++ , Mg ++ , Fe +++ and Al +++ are complexed by EDTA and citric acid. Common anions present in urine, such as Cl - , PO --- 4 and SO -- 4 do not interfere in the method. (Author) [pt

  1. Parental preference for fluoride varnish: a new concept in a rapidly developing nation. (United States)

    Hendaus, Mohamed A; Jama, Hibaq A; Siddiqui, Faisal J; Elsiddig, Sohair A; Alhammadi, Ahmed H


    The objective of this study was to investigate parental preference for fluoride varnish in a country where the average percentage of dental caries in young children is up to ~73%. Consequently, the aim of this study, despite being a pilot, was to create a nationwide project in the State of Qatar to promote oral health in children. A cross-sectional perspective study was conducted at Hamad Medical Corporation in Qatar. Parents of children aged ≤5 years were offered an interview survey. A total of 200 questionnaires were completed (response rate =100%). The study was conducted between December 1, 2014 and March 30, 2015, and included all children aged >1 year and parents' knowledge and awareness of dental health, we found that >90% of families were aware that dental health affects the health of the whole body. The study showed that ~70% of parents were not aware of the existence of fluoride varnish, but would allow a health provider to apply fluoride varnish. Furthermore, ~80% of parents would not stop brushing their child's teeth and would not skip dentist appointments if varnish was to be applied. Approximately 40% of parents conveyed some concerns regarding the safety of fluoride varnish, despite being considered as a new concept. The main concern was that the child might swallow some of the fluoride. Another important concern expressed by parents was the availability of the fluoride varnish in all clinics. The robust positive attitude of parents in this sample suggests that introducing fluoride varnish is feasible and acceptable in our community. Actions to augment fluoride varnish acceptability in the developing world, such as focusing on safety, could be important in the disseminated implementation of fluoride varnish.

  2. The effects of water filtration systems on fluoride: Washington, D.C. metropolitan area. (United States)

    Jobson, M D; Grimm, S E; Banks, K; Henley, G


    According to the U.S. Environmental Protection Agency (EPA), approximately one in eight Americans is exposed to potentially harmful microbes, pesticides, lead, or radioactive radon whenever they drink a glass of tap water or take a shower. One reason for this exposure is that the water plants are aging or ill equipped to process the huge amounts of raw sewage and agricultural pollutants that are still being discharged into our drinking-water sources. Other compounds such as fluoride and chloride have been added to the community water supplies for health benefits. Water filtration systems are becoming more popular as people become concerned with pollutants in the public water supply and questions are being raised as to whether fluoride is affected by these filters. The aim of this pilot study was to assess the efficacy of three types of water filtration systems and to determine their impact on fluoride content of the water in the Washington, D.C. metropolitan area. One sample of water was collected daily for fourteen days, from one location. The sample was divided to use as a control and the test samples which were processed through various filter systems. With the use of a fluoride ion specific electrode, the fluoride concentration level was tested in all samples in order to determine the percentage of fluoride removed. This study was intended to prove that the water filtration systems did not affect the advantage offered by optimum water fluoride levels. The experimental samples were ascertained and compared to the control group, resulting in three of the four carbon filters showing statistically significant amounts of fluoride removed from the water. Both Reverse Osmosis and Distillation, as expected, removed the fluoride at a high rate.

  3. Matrix supported tailored polymer for solid phase extraction of fluoride from variety of aqueous streams

    International Nuclear Information System (INIS)

    Thakur, Neha; Kumar, Sanjukta A.; Wagh, D.N.; Das, Sadananda; Pandey, Ashok K.; Kumar, Sangita D.; Reddy, A.V.R.


    Highlights: ► Th complexed with poly (bis[2-(methacryloyloxy)-ethyl]phosphate) as tailored polymer membranes. ► Membranes offered high capacity and selectivity for fluoride in aqueous media. ► Quantitative uptake (80 ± 5%) of fluoride. ► Fast sorption kinetics. ► Reusability of polymer membranes. - Abstract: Fluoride related health hazards (fluorosis) are a major environmental problem in many regions of the world. It affects teeth; skeleton and its accumulation over a long period can lead to changes in the DNA structure. It is thus absolutely essential to bring down the fluoride levels to acceptable limits. Here, we present a new inorganic–organic hybrid polymer sorbent having tailored fixed-sites for fluoride sorption. The matrix supported poly (bis[2-(methacryloyloxy)-ethyl]phosphate) was prepared by photo-initiator induced graft-polymerization in fibrous and microporous (sheet) host poly(propylene) substrates. These substrates were conditioned for selective fluoride sorption by forming thorium complex with phosphate groups on bis[2-methacryloyloxy)-ethyl] phosphate (MEP). These tailored sorbents were studied for their selectivity towards fluoride in aqueous media having different chemical conditions. The fibrous sorbent was found to take up fluoride with a faster rate (15 min for ≈76% sorption) than the sheet sorbent. But, the fluoride loading capacity of sheet sorbent (4320 mg kg −1 ), was higher than fibrous and any other sorbent reported in the literature so far. The sorbent developed in the present work was found to be reusable after desorption of fluoride using NaOH solution. It was tested for solid phase extraction of fluoride from natural water samples.

  4. Terrestrial bryophytes as indicators of fluoride emission from a phosphorus plant, Long Harbour, Newfoundland, Canada

    Energy Technology Data Exchange (ETDEWEB)

    Roberts, B.A.; Thompson, L.K.; Sidhu, S.S.


    A study of the effects of fluoride emissions (HF, SiF/sub 4/) on certain species of bryophytes was carried out in the vicinity of an industrial palnt producing elemental phosphorus at Long Harbour, Nfld. Damage symptoms varied from mild phyllid chlorosis (yellowing) to severe browning of up to 95% of the phyllids. Polytrichum commune Hedw. was the main bryophyte species used in the survey. Random collections from 45 sample sites were analysed for total fluoride. The fluoride concentrations in phyllid tissue ranged from a high of 6066 ppm (dry weight) at a distance of 1 km northeast of the emission source to 44 ppm (dry weight) 11.7 km northeast of the emission source in the direction of the prevailing wind. Control samples were obtained from similar sites in areas far removed from the industrial plant and contained, on average, 11.3 ppm (dry weight). The concentration of fluoride in the bryophyte phyllid tissue was inversely correlated with distance from the emission source, in the direction of the prevailing wind. The severity of acropetal scorching was found to be correlated with the concentration of fluoride in the bryophyte phyllid tissue, and in addition, samples high in fluoride had fewer sporophytes. Fluoride concentrations in bryophyte tissue are compared with concentrations of fluoride in the needles of balsam fir, Abies Balsamea I., in four damage zones, and also with available and total fluoride in soil humus and concentrations of fluoride in air. The total area affected by fluoride emissions was increased using bryophytes as the pollution indicator species, especially in areas far from the industrial plant.

  5. Antidotal activity of Averrhoa carambola (Star fruit on fluoride induced toxicity in rats

    Directory of Open Access Journals (Sweden)

    Vasant Rupal A.


    Full Text Available Consumption of fluoride leads to several physiological disturbances in carbohydrate, lipid and antioxidant metabolisms. Averrhoa carambola L. fruit (Star fruit is a commonly consumed fruit in tropical countries and is an ingredient in folklore medicines. As the fruits have high polyphenolic and antioxidant contents, the present study was undertaken to investigate the potential of star fruit as a dietary supplement in attenuating the fluoride induced hyperglycemia, hypercholesterolemia and oxidative stress in laboratory rats. A four-week exposure to fluoride caused sustained hyperglycemia, hyperlipidemia and oxidative stress and, when the diet was supplemented with star fruit powder, carbohydrate, lipid and antioxidant profiles were restored significantly. It is surmised that the antihyperglycemic, antihypercholesterolemic and antioxidant activities of star fruit in fluoride exposed rats could be due to the presence of polyphenols, flavonoids, saponins, phytosterols, ascorbic acid and fibers in the fruit, which are all well known regulators of carbohydrate, lipid and antioxidant metabolisms. These findings suggest that star fruit can be used as a dietary supplement in fluoride endemic regions to contain fluoride induced hyperglycemia, hyperlipidemia and oxidative stress

  6. Antidotal activity of Averrhoa carambola (Star fruit) on fluoride induced toxicity in rats. (United States)

    Vasant, Rupal A; Narasimhacharya, A V R L


    Consumption of fluoride leads to several physiological disturbances in carbohydrate, lipid and antioxidant metabolisms. Averrhoa carambola L. fruit (Star fruit) is a commonly consumed fruit in tropical countries and is an ingredient in folklore medicines. As the fruits have high polyphenolic and antioxidant contents, the present study was undertaken to investigate the potential of star fruit as a dietary supplement in attenuating the fluoride induced hyperglycemia, hypercholesterolemia and oxidative stress in laboratory rats. A four-week exposure to fluoride caused sustained hyperglycemia, hyperlipidemia and oxidative stress and, when the diet was supplemented with star fruit powder, carbohydrate, lipid and antioxidant profiles were restored significantly. It is surmised that the antihyperglycemic, antihypercholesterolemic and antioxidant activities of star fruit in fluoride exposed rats could be due to the presence of polyphenols, flavonoids, saponins, phytosterols, ascorbic acid and fibers in the fruit, which are all well known regulators of carbohydrate, lipid and antioxidant metabolisms. These findings suggest that star fruit can be used as a dietary supplement in fluoride endemic regions to contain fluoride induced hyperglycemia, hyperlipidemia and oxidative stress.

  7. Tissue distributions of fluoride and its toxicity in the gills of a freshwater teleost, Cyprinus carpio. (United States)

    Cao, Jinling; Chen, Jianjie; Wang, Jundong; Wu, Xiangtian; Li, Yundong; Xie, Lingtian


    Fish take up fluoride directly from water and are susceptible to fluoride contamination of their environment. In this study, we examined the tissue distributions of fluoride and its toxicity in the gills of the common carp (Cyprinus carpio) chronically exposed to fluoride. Carp were exposed to a range of aqueous fluoride (35-124 mg/L) and sampled at 30, 60 and 90 days. The accumulation of fluoride in the tissues increased with the level and duration of exposure. Steady state was not achieved under the experimental conditions. The gills accumulated the highest levels of fluoride followed by the liver>brain>kidney>muscle>intestine. A dose-dependent inhibition was observed for the enzyme activities of Na(+)-K(+)-ATPase and Ca(2+)-ATPase in the gills after the fish were exposed for 90 days. Also, accumulation of fluoride was associated with the inhibition of superoxide dismutase (SOD) activities and a dose-dependent stimulation of malondialdehyde (MDA) levels in the gill tissues, suggesting that fluoride promoted oxidative stress in the fish. Microscopic examinations revealed injuries to gill tissues and chloride cells, with the severity of injury increasing with exposure concentration. These results suggest that chronic exposure to elevated concentrations of fluoride may induce toxicity in the common carp. Copyright © 2012 Elsevier B.V. All rights reserved.

  8. The Anticaries Efficacy of a 1.5% Arginine and Fluoride Toothpaste. (United States)

    Wolff, M S; Schenkel, A B


    Dental caries remains a world-wide disease despite the global distribution of fluoride. It has become apparent that the introduction of significant levels of sugar (fermentable carbohydrate) into the diet has resulted in a change in the biofilm, encouraging acid formation. Further, there has been a shift in the microbiota in the biofilm to a flora that produces acid, and thrives and reproduces in an acidic environment. The management of caries activity under these conditions has focused on brushing to remove the biofilm with fluoride pastes, and high-dose fluoride treatments. Kleinberg, in the 1970s, identified an arginine-containing compound in saliva that several oral biofilm bacterial species metabolize to produce base. Multiple in situ and in vivo studies have been conducted, and have discussed the ability of multiple bacteria to increase the resting pH of the biofilm and even reduce the decrease in pH when the biofilm is challenged with glucose. This shift in resting pH can shift the level of caries formation by the biofilm. Here, we present 8 clinical studies, with different clinical designs, measuring different clinical outcomes, for a diverse, world-wide population. Each of these studies demonstrates reductions in caries formation beyond that seen with fluoride alone and several demonstrate the reversal of early caries lesions. Significant clinical research has been shown that 1.5% arginine combined with fluoride toothpaste has superior anti-caries efficacy to toothpaste containing fluoride alone.

  9. Automatic photometric titration of fluoride with thorium nitrate and alizarin S as indicator

    International Nuclear Information System (INIS)

    Bliefert, C.; Sobek, M.


    The photometric titration of fluoride with thorium nitrate and Alizarin S as indicator has been automated and optimized for fluoride levels between 1 and 20mg/85ml solution. The interference of several ions has been investigated. This procedure is particularly useful for the determination of fluoride after fusion with peroxides as fluxing agents. (orig.) [de

  10. Crevice corrosion of alloy 22 in fluoride and chloride containing solutions

    International Nuclear Information System (INIS)

    Carranza, Ricardo M.; Rodriguez, Martin A.


    Alloy 22 (N06022) is highly resistant to localized corrosion. Alloy 22 may be susceptible to crevice corrosion in pure chloride (Cl - ) solutions under aggressive environmental conditions. The effect of the fluoride (F - ) on the susceptibility to crevice corrosion induced by chloride ions is still not well established. The objective of the present work was to explore the crevice corrosion resistance of this alloy to different mixtures of fluorides and chlorides. Cyclic potentiodynamic polarization (CPP) tests were conducted in deaerated aqueous solutions of pure halide ions and also in different mixtures of chloride and fluoride at 90 C degrees and pH 6. The range of chloride concentration [Cl - ] was 0.001 M ≤ [Cl - ] ≤ 1 M and the range of molar fluoride to chloride ratio [F - ]/[Cl - ] was 0.1≤ [F - ]/[Cl - ] ≤ 10. Results showed that Alloy 22 was susceptible to crevice corrosion in all the pure chloride solutions but not in the pure fluoride solutions. A molar ratio [F - ]/[Cl - ] ranging from 5 to 10 was required for the inhibition of crevice corrosion to be complete in the halide mixtures. A moderate or nil inhibitive effect was observed for molar ratios [F - ]/[Cl - ] [es

  11. Thermodynamics of the conversion of calcium and magnesium fluorides to the parent metal oxides and hydrogen fluoride

    International Nuclear Information System (INIS)

    West, M.H.; Axler, K.M.


    The authors have used thermodynamic modeling to examine the reaction of calcium fluoride (CaF 2 ) and magnesium fluoride (MgF 2 ) with water (H 2 O) at elevated temperatures. The calculated, equilibrium composition corresponds to the global free-energy minimum for the system. Optimum, predicted reaction temperatures and reactant mole ratios are reported for the recovery of hydrogen fluoride (HF), a valuable industrial feedstock. Complete conversion of MgF 2 is found at 1,000 C and a ratio of 40 moles of H 2 O per 1 mole of MgF 2 . For CaF 2 , temperatures as high as 1,400 C are required for complete conversion at a corresponding mole ratio of 40 moles of H 2 O per 1 mole of CaF 2 . The authors discuss the presence of minor chemical constituents as well as the stability of various potential container materials for the pyrohydrolysis reactions at elevated temperatures. CaF 2 and MgF 2 slags are available as wastes at former uranium production facilities within the Department of Energy Complex and other facilities regulated by the Nuclear Regulatory Commission. Recovery of HF from these wastes is an example of environmental remediation at such facilities

  12. Taurine Ameliorates Renal Oxidative Damage and Thyroid Dysfunction in Rats Chronically Exposed to Fluoride. (United States)

    Adedara, Isaac A; Ojuade, Temini Jesu D; Olabiyi, Bolanle F; Idris, Umar F; Onibiyo, Esther M; Ajeigbe, Olufunke F; Farombi, Ebenezer O


    Excessive exposure to fluoride poses several detrimental effects to human health particularly the kidney which is a major organ involved in its elimination from the body. The influence of taurine on fluoride-induced renal toxicity was investigated in a co-exposure paradigm for 45 days using five groups of eight rats each. Group I rats received normal drinking water alone, group II rats were exposed to sodium fluoride (NaF) in drinking water at 15 mg/L alone, group III received taurine alone at a dose of 200 mg/kg group IV rats were co-administered with NaF and taurine (100 mg/kg), while group V rats were co-administered with NaF and taurine (200 mg/kg). Administration of taurine significantly reversed the fluoride-mediated decrease in absolute weight and organo-somatic index of the kidney in the exposed rats. Taurine significantly prevented fluoride-induced elevation in plasma urea and creatinine levels in the exposed rats. Moreover, taurine restored fluoride-mediated decrease in the circulatory concentrations of triiodothyronine, thyroxine, and the ratio of triiodothyronine to thyroxine. Taurine ameliorated fluoride-mediated decrease in renal antioxidant status by significantly enhancing the antioxidant enzyme activities as well as glutathione level in the exposed rats. Additionally, taurine inhibited fluoride-induced renal oxidative damage by markedly decreasing the hydrogen peroxide and malondialdehyde levels as well as improved the kidney architecture in the treated rats. Collectively, taurine protected against fluoride-induced renal toxicity via enhancement of thyroid gland function, renal antioxidant status, and histology in rats.

  13. Determination of fluoride in spices using microwave induced oxygen combustion

    Directory of Open Access Journals (Sweden)

    Emanuel Šucman


    Full Text Available Fluorine is essential in human and/or animal nutrition; therefore, so it is important to know its concentration in a diet. One of the possible sources of fluorine for humans is spice, containing various amounts of this trace element. This work describes the method for fluoride determination in various kinds ofspices using microwave-supported sample preparation in high pressure oxygen atmosphere followed by potentiometry with a fluoride ion-selective electrode. Parameters of the microwave device for combustion procedure were checked and optimized in order to find settings ensuring complete sample combustion and/or absorption of the analyte in the absorption solution. For the ion-selective electrode measurement, the technique of standard straight line was chosen. Concentrations of fluorides in spices and spice blends under investigation ranged from 3.15 mg·kg-1 to 26.08 mg·kg-1. In order to check the accuracy of the method Certified Reference Material Fluoride in Vegetation NIST 2695 was used and a good agreement between certified and found values was found. The precision expressed as the relative standard deviation ranged from 0.6% to 5.0%. The method is fast, accurate and reliable for this kind of analysis. In recent literature data on fluoride concentrations in spices and/or spice blends have not been found.

  14. Uptake Fluoride from Water by Starch Stabilized Layered Double Hydroxides

    Directory of Open Access Journals (Sweden)

    Jiming Liu


    Full Text Available A novel starch stabilized Mg/Al layered Double hydroxides (S-LDHs was prepared in a facile approach and its fluoride ion removal performance was developed. Characterization of S-LDHs was employed by using X-ray diffraction (XRD, Fourier-transform infrared spectroscopy (FTIR, and particle size distribution. The adsorption property was studied through the assessment of the adsorption isotherms, kinetic models, thermal dynamics, and pH influence. The result shows that a low loading of starch of 10 mg onto layered double hydroxides (LDHs could obviously improve the fluoride removal rate. The S-LDHs had three times higher the adsorption capacity to fluoride than that of Mg/Al LDHs to fluoride. The particle size was smaller and the particle size distribution was narrower for S-LDHs than that for Mg/Al LDHs. The Langmuir adsorption isotherm model and pseudo-second-order kinetic model fitted well with the experimental data. In thermodynamic parameters, the enthalpy (ΔH0 value was 35.63 kJ·mol−1 and the entropy (ΔS0 value was 0.0806 kJ·mol−1K−1. The values of ΔG0 were negative, implying the adsorption process is spontaneous. S-LDHs reveals stable adsorption property in a wide pH range from 3 to 9. The mechanism for fluoride adsorption on S-LDHs included surface adsorption and interaction ion exchange.

  15. Removal of fluoride ions from aqueous solution by waste mud

    International Nuclear Information System (INIS)

    Kemer, Baris; Ozdes, Duygu; Gundogdu, Ali; Bulut, Volkan N.; Duran, Celal; Soylak, Mustafa


    The present study was carried out to assess the ability of original waste mud (o-WM) and different types of activated waste mud which are acid-activated (a-WM) and precipitated waste mud (p-WM), in order to remove excess of fluoride from aqueous solution by using batch technique. The p-WM exhibited greater performance than the others. Adsorption studies were conducted as a function of pH, contact time, initial fluoride concentration, adsorbent concentration, temperature, etc. Studies were also performed to understand the effect of some co-existing ions present in aqueous solutions. Adsorption process was found to be almost independent of pH for all types of waste mud. Among the kinetic models tested for p-WM, pseudo-second-order model fitted the kinetic data well with a perfect correlation coefficient value of 1.00. It was found that the adequate time for the adsorption equilibrium of fluoride was only 1 h. Thermodynamic parameters including the Gibbs free energy (ΔG o ), enthalpy (ΔH o ), and entropy (ΔS o ) revealed that adsorption of fluoride ions on the p-WM was feasible, spontaneous and endothermic in the temperature range of 0-40 deg. C. Experimental data showed a good fit with the Langmuir and Freundlich adsorption isotherm models. Results of this study demonstrated the effectiveness and feasibility of WM for removal of fluoride ions from aqueous solution.

  16. Lichens as indicators of fluoride emission from a phosphorus plant, Long Harbour, Newfoundland, Canada

    Energy Technology Data Exchange (ETDEWEB)

    Roberts, B.A.; Thompson, L.K.


    Fluoride concentrations in the terrestrial lichens Cladina rangiferina (L.) Harm. and Cladina stellaris (Opiz.) Brodo. were correlated inversely with distance from an industrial plant producing elemental phosphorus at Long Harbour, Nfld., in the direction (NE) of the prevailing wind. The fluoride concentrations ranged from 2830 ppm dry weight in a severely damaged area close to the emission source to 15.5 ppm (dry weight) 12 km NE of the industrial plant. Control samples from unpolluted areas had an average fluoride content of 6.4 ppm dry weight. The minimum observed damage symptoms occurred when these lichens had a fluoride content of 25 ppm dry weight. Damage symptoms included discolouration and structure loss. Discolouration effects were not as pronounced as observed on Abies balsamea (L.) Mill. or on Polytrichum commune (Hedw.) but combined with structure loss allowed the degree of damage to be readily identified in the field. Fluoride concentrations in these terrestrial lichens are compared with levels in soil humus, A. balsamea and some terrestrial bryophytes in four damage zones. The lichen tissue had, on average, twice as much fluoride as occurred in soil humus from the same site and about one half the amount of fluoride found in the terrestrial bryophyte P. commune. The effects of fluoride emissions on the epiphytic lichens Hypogymnia physodes (L.) W. Wats. and Alectoria sarmentosa (Ach.) Ach. in this area are also discussed.

  17. Association between water fluoride and the level of children's intelligence: a dose-response meta-analysis. (United States)

    Duan, Q; Jiao, J; Chen, X; Wang, X


    Higher fluoride concentrations in water have inconsistently been associated with the levels of intelligence in children. The following study summarizes the available evidence regarding the strength of association between fluoridated water and children's intelligence. Meta-analysis. PubMed, Embase, and Cochrane Library databases were systematically analyzed from November 2016. Observational studies that have reported on intelligence levels in relation to high and low water fluoride contents, with 95% confidence intervals (CIs) were included. Further, the results were pooled using inverse variance methods. The correlation between water fluoride concentration and intelligence level was assessed by a dose-response meta-analysis. Twenty-six studies reporting data on 7258 children were included. The summary results indicated that high water fluoride exposure was associated with lower intelligence levels (standardized mean difference : -0.52; 95% CI: -0.62 to -0.42; P intelligence (P intelligence levels. Greater exposure to high levels of fluoride in water was significantly associated with reduced levels of intelligence in children. Therefore, water quality and exposure to fluoride in water should be controlled in areas with high fluoride levels in water. Copyright © 2017. Published by Elsevier Ltd.

  18. Stimulated Raman scattering in soft glass fluoride fibers

    DEFF Research Database (Denmark)

    Petersen, Christian; Dupont, Sune; Agger, Christian


    We have measured the absolute Raman gain spectrum in short fluoride soft glass fibers with a pump wavelength of 1650nm. We found a peak gain of gR ¼ 4:0 2 × 10−14mW−1.......We have measured the absolute Raman gain spectrum in short fluoride soft glass fibers with a pump wavelength of 1650nm. We found a peak gain of gR ¼ 4:0 2 × 10−14mW−1....

  19. Risk Assessment Study of Fluoride Salts: Probability-Impact Matrix of Renal and Hepatic Toxicity Markers. (United States)

    Usuda, Kan; Ueno, Takaaki; Ito, Yuichi; Dote, Tomotaro; Yokoyama, Hirotaka; Kono, Koichi; Tamaki, Junko


    The present risk assessment study of fluoride salts was conducted by oral administration of three different doses of sodium and potassium fluorides (NaF, KF) and zinc fluoride tetrahydrate (ZnF2 •4H2O) to male Wistar rats. The rats were divided into control and nine experimental groups, to which oral injections of 0.5 mL distilled water and 0.5 mL of fluoride solutions, respectively, were given. The dosage of fluoride compounds was adjusted to contain 2.1 mg (low-dose group, LG), 4.3 mg (mid-dose group, MG), and 5.4 mg fluoride per 200 g rat body weight (high-dose group, HG) corresponding to 5, 10, and 12.5 % of LD50 values for NaF. The 24-h urine volume, N-acetyl-β-D-glucosaminidase (NAG) and creatinine clearance (Ccr) were measured as markers of possible acute renal impact. The levels of alanine aminotransferase (ALT) and aspartate aminotransferase (AST) were determined in serum samples as markers of acute hepatic impact. The levels of serum and urinary fluoride were determined to evaluate fluoride bioavailability. The results reveal that higher doses of NaF, KF, and ZnF2 induced renal damage as indicated by higher urinary NAG (p fluoride is a potential, dose-dependent risk factor of renal tubular damage.

  20. Evaluation and modeling of the parameters affecting fluoride toxicity level in aquatic environments by bioassay method


    Hamid Reza Shamsollahi; Hadi asady; Amir Hossein Mahvi; Zahra zolghadr


    Background: Fluoride exists in various forms in nature and water resources. , The rising level of fluoride in water resources due to discharge of industrial effluents can cause toxicity in aquatic organisms. To prevent toxicity, it is necessary to determine maximum fluoride toxicity as well as effluent discharge limits. The aim of this study was to determine the maximum fluoride toxicity and the factors affecting fluoride toxicity to provide a model in order to determine the effluent discha...

  1. Salivary Fluoride level in preschool children after toothbrushing with standard and low fluoride content dentifrice, using the transversal dentifrice application technique: pilot study

    Directory of Open Access Journals (Sweden)

    Fabiana Jandre Melo


    Full Text Available Objective: To investigate the salivary fluoride concentration in pre-school children after toothbrushing with dentifrice containing standard (1100ppmF/NaF and low (500ppmF/NaF fluoride concentration, using the transversal technique of placing the product on the toothbrush. Methods: Eight children of both sexes, ranging from 4 to 9 years, and 5 years and 6 months of age, participated in the study. The experiment was divided into two phases with a weekly interval. In the first stage, the children used the standard concentration dentifrice for one week, and in the second, the low concentration product. Samples were collected at the end of each experimental stage, at the following times: Before brushing, immediately afterwards, and after 15, 30 and 45 minutes. The fluoride contents were analyzed by the microdiffusion technique. Statistical analysis was done by the analysis of variance ANOVA and Student’s-t test (p<0.05. Results: The salivary fluoride concentration was significantly higher at all times, when the standard concentration product was used. The comparison between the Halogen concentration found before bushing and immediately afterwards, showed that there was a 6.8 times increase in the standard dentifrice (0.19 x 1.29μgF/ml and in the low concentration product, an increase of 20.5 times (0.02 x 0.41μgF/ml. Conclusion: Toothbrushing with both products promoted relevant increases in the salivary fluoride concentration; however, longitudinal studies are necessary to verify the clinical result of this measurement.

  2. Fluoridation: a violation of medical ethics and human rights. (United States)

    Cross, Douglas W; Carton, Robert J


    Silicofluorides, widely used in water fluoridation, are unlicensed medicinal substances, administered to large populations without informed consent or supervision by a qualified medical practitioner. Fluoridation fails the test of reliability and specificity, and, lacking toxicity testing of silicofluorides, constitutes unlawful medical research. It is banned in most of Europe; European Union human rights legislation makes it illegal. Silicofluorides have never been submitted to the U.S. FDA for approval as medicines. The ethical validity of fluoridation policy does not stand up to scrutiny relative to the Nuremberg Code and other codes of medical ethics, including the Council of Europe's Biomedical Convention of 1999. The police power of the State has been used in the United States to override health concerns, with the support of the courts, which have given deference to health authorities.

  3. Fluoride sorption using Cynodon dactylon based activated carbon

    Directory of Open Access Journals (Sweden)

    Alagumuthu G.


    Full Text Available This study deals the application of Cynodon dactylon based thermally activated carbon for fluoride toxicity. The batch adsorption techniques was followed at neutral pH as the functions of contact time, adsorbent dose, adsorbate concentration, temperature and the effect of co-anions. The data indicate that the prepared adsorbent surface sites are heterogeneous in nature and that fits into a heterogeneous site-binding model. The present system followed the Redlich-Peterson isotherm as well as Langmuir adsorption isotherm model. Lagergren pseudo-first-order, pseudo-second-order, intra particle diffusion and Elovich kinetics were modeled to describe the adsorption rate of fluoride and determined as this scheme followed pseudo-second-order kinetics. The calculated enthalpy change, ΔH°, and entropy change, ΔS°, for the adsorption process are +8.725 kJ/mol and +0.033 J/mol K respectively and shows endothermic experience. Instrumental analysis of XRD, FTIR and SEM gives the idea about the fluoride binding ability of adsorbent.

  4. Groundwater fluoride enrichment in an active rift setting: Central Kenya Rift case study

    Energy Technology Data Exchange (ETDEWEB)

    Olaka, Lydia A., E-mail: [Department of Geology, University of Nairobi, P.O Box 30197, Nairobi (Kenya); Wilke, Franziska D.H. [Geoforschungs Zentrum, Telegrafenberg, 14473 Potsdam (Germany); Olago, Daniel O.; Odada, Eric O. [Department of Geology, University of Nairobi, P.O Box 30197, Nairobi (Kenya); Mulch, Andreas [Senckenberg Biodiversity and Climate Research Centre, Senckenberganlage 25, 60325 Frankfurt (Germany); Institut für Geowissenschaften, Goethe Universität Frankfurt, Altenhöferallee 1, 60438 Frankfurt (Germany); Musolff, Andreas [UFZ-Helmholtz-Centre for Environmental Research, Department of Hydrogeology, Permoserstr. 15, 04318 Leipzig (Germany)


    Groundwater is used extensively in the Central Kenya Rift for domestic and agricultural demands. In these active rift settings groundwater can exhibit high fluoride levels. In order to address water security and reduce human exposure to high fluoride in drinking water, knowledge of the source and geochemical processes of enrichment are required. A study was therefore carried out within the Naivasha catchment (Kenya) to understand the genesis, enrichment and seasonal variations of fluoride in the groundwater. Rocks, rain, surface and groundwater sources were sampled for hydrogeochemical and isotopic investigations, the data was statistically and geospatially analyzed. Water sources have variable fluoride concentrations between 0.02–75 mg/L. 73% exceed the health limit (1.5 mg/L) in both dry and wet seasons. F{sup −} concentrations in rivers are lower (0.2–9.2 mg/L) than groundwater (0.09 to 43.6 mg/L) while saline lake waters have the highest concentrations (0.27–75 mg/L). The higher values are confined to elevations below 2000 masl. Oxygen (δ{sup 18}O) and hydrogen (δD) isotopic values range from − 6.2 to + 5.8‰ and − 31.3 to + 33.3‰, respectively, they are also highly variable in the rift floor where they attain maximum values. Fluoride base levels in the precursor vitreous volcanic rocks are higher (between 3750–6000 ppm) in minerals such as cordierite and muscovite while secondary minerals like illite and kaolinite have lower remnant fluoride (< 1000 ppm). Thus, geochemical F{sup −} enrichment in regional groundwater is mainly due to a) rock alteration, i.e. through long residence times and natural discharge and/or enhanced leakages of deep seated geothermal water reservoirs, b) secondary concentration fortification of natural reservoirs through evaporation, through reduced recharge and/or enhanced abstraction and c) through additional enrichment of fluoride after volcanic emissions. The findings are useful to help improve water management

  5. Fluoride content in water in and around heavy water plant Manuguru colony

    International Nuclear Information System (INIS)

    Mohapatra, C.; Dubey, S.K.; Reddy, A.R.; Ravi Kumar, T.S.P.; Selvaraj, S.


    Fluoride concentration in water used for human consumption has significant importance with respect to its toxic effects. Hence there was a need for analysing fluoride concentration in drinking water primarily used at Heavy water Plant, Manuguru (HWP (M)) colony and its nearby villages. We found that at HWP (M) colony there is not much variation in the fluoride concentration. However, nearby villages are having wide variation from 0.79 to 5.1 ppm. (author). 5 refs., 1 tab

  6. 4-phenylbutyrate Mitigates Fluoride-Induced Cytotoxicity in ALC Cells


    Suzuki, Maiko; Everett, Eric T.; Whitford, Gary M.; Bartlett, John D.


    Chronic fluoride over-exposure during pre-eruptive enamel development can cause dental fluorosis. Severe dental fluorosis is characterized by porous, soft enamel that is vulnerable to erosion and decay. The prevalence of dental fluorosis among the population in the USA, India and China is increasing. Other than avoiding excessive intake, treatments to prevent dental fluorosis remain unknown. We previously reported that high-dose fluoride induces endoplasmic reticulum (ER) stress and oxidative...


    Directory of Open Access Journals (Sweden)

    Matheus Melo Pithon


    Full Text Available Objective: To evaluate of fluoride release from Jeltrate alginate®. Materials and Methods: Four Trademarks of alginate were divided in four groups: conventional Jeltrate®, Plus Jeltrate®, Chromatic Jeltrate® and Chromatic Ortho Jeltrate®. The alginates were handled following the guidelines of the manufacturers. After this was followed by the construction of evidence bodies using silicone molds of the dimensions of 4 mm in diameter and 4mm in height. After take prey, the evidence bodies were removed from the molds and placed in container with 10 ml of ultra purified water, for 2 min. The fluoride release was measured by selective ion electrode connected to an analyzer of ions. Results: The Plus Jeltrate® showed a higher releasing fluoride 247.85 µg/cm2 followed by Chromatic Ortho Jeltrate® (217.83 µg/cm2, Chromatic Jeltrate ® (138.21 µg/cm2 and Jeltrate® (79.61 µg/cm2. Conclusion: Plus Jeltrate® had the best performance in releasing fluoride, followed by Chromatic Ortho Jeltrate®, Chromatic Jeltrate® and conventional Jeltrate®..


    Directory of Open Access Journals (Sweden)

    Gunka Yonkova


    Full Text Available The present work aims to study the quality of wort produced using fluoride containing mineral water. The results show that the mineral water has a negative impact on the enzymatic destruction of starch, proteins, color intensity and pH of the wort. The changes of pH during mashing process using tap and mineral water was studied. The lower acidity of wort obtained using mineral water didn’t change during the brewing process. The fluoride content of beer is lower than 5 mg.L-1 when wort is produced using mineral and tap water in 1:1 ratio and citric acid for pH correction. At the same time, the final degree of fermentation, α-amine nitrogen content and the intensity of color of produced wort are close to the control sample. The changes in fluoride ion concentration are monitored using ion-selective potentiometry. The fluoride content is decreased from 5.7 to 4.75 mg.L-1, the most intense change is observed during the mashing process.

  9. The Fitness Cost of Fluoride Resistance for Different Streptococcus mutans Strains in Biofilms

    Directory of Open Access Journals (Sweden)

    Yanling Cai


    Full Text Available The cariogenic bacterium Streptococcus mutans can develop stable resistance to fluoride through chromosomal mutations in vitro. Fluoride-resistant S. mutans has seldom been isolated in clinical settings, despite the wide application of fluoride in oral-care products. One explanation is that the fluoride-resistant S. mutans strains have decreased fitness. However, so far, there has been no conclusive evidence to support this idea. The aim of this study was to investigate the fitness cost of 48-h biofilms of two fluoride-resistant S. mutans strains, UF35 and UA159-FR (UAFR, using the wild-type fluoride-sensitive strain UA159 as a reference. The engineered UF35 strain contains one point mutation, whereas UAFR, selected from NaF-containing agar plates, has multiple chromosomal mutations. All biofilms were formed for 48 h under a constantly neutral pH or a pH-cycling (8 h of neutral pH and 16 h of pH 5.5 condition in the absence of fluoride. The biomass of the biofilms was quantified with a crystal violet assay. The biofilms were also treated with chlorhexidine or solutions at pH 3.0, after which their lactic acid production was quantified. Compared to the UF35 and UA159 biofilms, the biomass of UAFR biofilms was two–four fold higher, and the UAFR biofilms were more resistant to chlorhexidine and low pH in terms of lactic acid production. No difference in biomass and lactic acid production was detected between UF35 and UA159 biofilms. The fluoride resistance of UAFR and UF35 strains in biofilms was further confirmed by treating the biofilms with NaF solutions. The level of NaF resistance of the three biofilms is generally ranked as follows: UAFR > UF35 > UA159. In conclusion, there is indeed a fitness consequence in UAFR, but surprisingly, this fluoride-resistant strain performs better than UF35 and UA159 under the described conditions. In addition, UF35 did not display a reduced fitness; it performed as well as the wild-type fluoride

  10. Flavonoids as Inhibitors of Human Butyrylcholinesterase Variants

    Directory of Open Access Journals (Sweden)

    Maja Katalinić


    Full Text Available The inhibition of butyrylcholinesterase (BChE, EC appears to be of interest in treating diseases with symptoms of reduced neurotransmitter levels, such as Alzheimer’s disease. However, BCHE gene polymorphism should not be neglected in research since it could have an effect on the expected outcome. Several well-known cholinergic drugs (e.g. galantamine, huperzine and rivastigmine originating from plants, or synthesised as derivatives of plant compounds, have shown that herbs could serve as a source of novel target-directed compounds. We focused our research on flavonoids, biologically active polyphenolic compounds found in many plants and plant-derived products, as BChE inhibitors. All of the tested flavonoids: galangin, quercetin, fisetin and luteolin reversibly inhibited usual, atypical, and fluoride-resistant variants of human BChE. The inhibition potency increased in the following order, identically for all three BChE variants: luteolininhibitor dissociation constants (Ki ranged from 10 to 170 mmol/L. We showed that no significant change in the inhibition potency of selected flavonoids exists in view of BChE polymorphism. Our results suggested that flavonoids could assist the further development of new BChE-targeted drugs for treating symptoms of neurodegenerative diseases and dementia.

  11. Urinary fluoride excretion by children 4-6 years old in a south Texas community

    Directory of Open Access Journals (Sweden)

    Ramon J. Baez


    Full Text Available This study evaluated urinary fluoride excretion by school children 4-6 years old who were living in a south Texas rural community that had concentrations of fluoride in drinking water supplies generally around the optimal level. We took supervised collections of urine samples in the morning and afternoon at school, and parents of the participating students collected nocturnal samples. We recorded the beginning and end times of the three collection periods and then determined the urinary volume and urinary flow for each of the periods. We measured urinary fluoride concentrations and calculated the urinary excretion rate per hour. The children had breakfast and lunch provided at the school, where the drinking water contained 1.0-1.3 milligrams/liter (mg/L fluoride. Fluoride concentrations in the tested household water supplies, from wells, ranged from 0.1 to 3.2 mg/L fluoride. The children's average urinary fluoride concentrations found for the day were similar to those for the night, with means ranging from 1.26 mg/L to 1.42 mg/L. Average excretion was 36.4 µg/h in the morning, 45.6 µg/h in the afternoon, and 17.5 µg/h at night. The lower nocturnal excretion rates are easily explained by low urinary flow at night. Based on the 15 hours of urine collected, the extrapolated 24-hour fluoride excretion was 749 µg. In conjunction with similar studies, the data from this study will help in developing upper limits for urinary fluoride excretion that are appropriate for avoiding unsightly fluorosis while providing optimal protection against dental decay.

  12. Development of technology and equipment for manufacturing fluorides rare-earths via non-aqueous method

    International Nuclear Information System (INIS)

    Chatalov, V.V.; Kozlov, O.I.; Machirev, V.P.; Zvonarev, E.N.


    Full text: The works on technology and equipment for rare earths (RE) fluorides are very scarce. Presently RE-fluorides are manufactured by various methods. Conventionally they can be divided into two main groups. The first group comprises methods based on precipitation of fluorides from soluble salts of corresponding metals by fluohydric acid (aqueous methods) with following thermal decomposition of aquatic fluorides obtained until anhydric state is reached. The second group (called dry, gaseous or non-aqueous) comprises methods based on direct fluorizating (by fluorine hydride, fluor or other fluorating agents) have several important advantages compared to the aqueous methods: the fluorides obtained are anhydrous; the operations of fluoride precipitation, washing, decantation, filtration are excluded as well as their drying and calcination. The process of calcination is, as a rule, accompanied by pyrohydrolysis. The products manufactured by precipitation are inferior to those obtained by the non-aqueous technique. The world production practice uses both groups of methods. Nevertheless, the method of gaseous hydrofluorination is preferable. In all non-aqueous processes the initial materials are oxides RE which interact with gaseous fluorine hydride. The initial materials - oxides are obtained by thermal decomposition of carbonates, hydroxides, oxalates and so on. One of the best type of apparatus for thermal decomposition processes is a horizontal ring shaped vibrating apparatus with direct heating. The RE - fluorides is synthesized by way of RE-oxide interacting with hydrogen fluoride at 200-550 deg C in single continuous operation: (RE) 2 O 3 + 6 HF → 2 (RE)F 3 + 3 H 2 0 The apparatus consists of a nickel horizontal two tube screw. Reaction time is varied from 2 to 6 hours; the productivity of reactor is defined by feed screw rotation and initial material bulk density. Hydrogen fluoride was passing the reactor opposite to the solid phase. The degree

  13. Fluoride absorption from the rat urinary bladder: a pH-dependent event

    International Nuclear Information System (INIS)

    Whitford, G.M.; Pashley, D.H.; Reynolds, K.E.


    Urinary bladder absorption of stable and radiofluoride was studied as a function of pH in anesthetized rats to further evaluate the influence of pH gradients on fluoride transport. Buffered pH values and stable fluoride concentrations ranged from 1.85 to 7.90 and from 0.012 to 8.81 mM, respectively. [ 14 C]inulin served as a marker for solute concentration changes due to water migration or dilution. The results indicate that bladder fluoride absorption is inversely related to pH over the 1.85 to 5.50 range. Mean, 15-min radiofluoride absorption values of 70 percent at pH 1.85, 37 percent at pH 3.95, and 5 percent at pH 5.50 were observed. These fractional absorption values were not significantly influenced by carrier fluoride concentration, the buffers used, or the presence of urine. Above pH 5.50, pH-independent absorption occurs to a slight extent. The results are consistent with a first-order absorptive process which occurs by the nonionic diffusion of hydrogen fluoride

  14. Exposure to High Fluoride Drinking Water and Risk of Dental Fluorosis in Estonia

    Directory of Open Access Journals (Sweden)

    Ene Indermitte


    Full Text Available The purpose of this study was to assess exposure to drinking water fluoride and evaluate the risk of dental fluorosis among the Estonian population. The study covered all 15 counties in Estonia and 93.7% of population that has access to public water supplies. In Estonia groundwater is the main source for public water supply systems in most towns and rural settlements. The content of natural fluoride in water ranges from 0.01 to 7.20 mg/L. The exposure to different fluoride levels was assessed by linking data from previous studies on drinking water quality with databases of the Health Protection Inspectorate on water suppliers and the number of water consumers in water supply systems. Exposure assessment showed that 4% of the study population had excessive exposure to fluoride, mainly in small public water supplies in western and central Estonia, where the Silurian-Ordovician aquifer system is the only source of drinking water. There is a strong correlation between natural fluoride levels and the prevalence of dental fluorosis. Risk of dental fluorosis was calculated to different fluoride exposure levels over 1.5 mg/L.

  15. Mitigation of non-point source of fluoride on groundwater by dug well recharge (United States)

    Ganesan, G.; Lakshmanan, E.


    Groundwater used for drinking purpose is affected in many regions due to the presence of excess fluoride. The excess intake of fluoride through drinking water causes fluorosis to human in many states of India, including Tamil Nadu. The present study was carried out with the objective of assessing hydrogeochemistry of groundwater and the feasibility of dug well recharge to reduce the fluoride concentration in Vaniyar river basin, Tamil Nadu, India. The major source for fluoride in groundwater of this area is the epidote hornblende gneissic and charnockite which are the major rocks occurring in this region. As a pilot study a cost effective induced recharge structure was constructed at Papichettipatty village in the study region. The study shows that the groundwater level around the recharge site raised up to 2 m from 14.5 m (bgl) and fluoride concentration has decreased from 3.8 mg/l to 0.9 mg/l due to dilution. The advantage of this induced recharge structure is of its low cost, the ease of implementation, improved groundwater recharge and dilution of fluoride in groundwater. An area of about 1.5 km2 has benefited due to this dug well recharge system.

  16. Evaluation of the precision in fluoride determination in uranium concentrate

    International Nuclear Information System (INIS)

    Palmieri, Helena E. Leonhardt; Rocha, Zildete; Mata, Maria Olivia Cintra


    The fluoride in uranium concentrate is previously separated by steam distillation and then determined by direct potentiometric with an ion-select electrode. The potential of all ion-specific electrodes is a logarithmic function of the concentration of the ion to which the electrode in question responds. This relationship is expressed by the Nernst equation. A calibration curve, potential (mV) versus standard fluoride concentration is established and then the sample concentration is determined by interpolation. A least squares curve-fitting procedure has been used to determine the parameters of this calibration curve equation. Using these parameters are determined the standard deviation, the confidence limits and the precision of the fluoride concentrations. (author). 3 refs., 2 figs., 1 tab

  17. pH and the cytotoxicity of fluoride in an animal cell culture system

    International Nuclear Information System (INIS)

    Helgeland, K.; Leirskar, J.


    To investigate the mechanism for the toxicity of silicate cement as observed in a cell culture system, the effects of pH and fluoride were tested on human epithelial cells (NCTC 2544). At pH 7.3, fluoride concentrations from 15 to 25 μg/ml (0.79 to 1.3 mM) had a growth inhibitory effect. When the pH of the incubation medium was lowered to the range 7.0 to 6.4, an enhanced cytotoxic effect of fluoride was found, and even at 5 to 10 μg/ml growth inhibition occurred. Concomitant with the enhanced cytotoxicity of fluoride at low pH, there was an increased utilization of glucose and formation of lactate. Upon lowering the pH of the incubation medium from 7.4 to 6.7, a twofold increase in the intracellular concentration of fluoride was found. (author)

  18. Assessment of fluoride contaminations in groundwater of hard rock aquifers in Madurai district, Tamil Nadu (India) (United States)

    Thivya, C.; Chidambaram, S.; Rao, M. S.; Thilagavathi, R.; Prasanna, M. V.; Manikandan, S.


    The fluoride contamination in drinking water is already gone to the alarming level and it needs the immediate involvement and attention of all people to solve this problem. Fluoride problem is higher in hard rock terrains in worldwide and Madurai is such type of hard rock region. Totally 54 samples were collected from the Madurai district of Tamilnadu with respect to lithology. The samples collected were analysed for major cations and anions using standard procedures. The higher concentration of fluoride is noted in the Charnockite rock types of northern part of the study area. 20 % of samples are below 0.5 ppm and 6 % of samples are above 1.5 ppm exceeding the permissible limit. The affinity between the pH and fluoride ions in groundwater suggests that dissolution of fluoride bearing minerals in groundwater. The higher concentration of fluoride ions are observed in the lower EC concentration. The isotopic study suggests that fluoride is geogenic in nature. In factor scores, fluoride is noted in association with pH which indicates the dissolution process.

  19. 1-Bromoethene-1-sulfonyl fluoride (BESF) is another good connective hub for SuFEx click chemistry. (United States)

    Smedley, Christopher J; Giel, Marie-Claire; Molino, Andrew; Barrow, Andrew S; Wilson, David J D; Moses, John E


    We demonstrate 1,2-dibromoethane-1-sulfonyl fluoride (DESF) as a bench-stable and readily accessible precursor to the robust SuFEx connector, 1-bromoethene-1-sulfonyl fluoride (BESF). The in situ generation of BESF from DESF opens up several new reaction profiles, including application in the syntheses of unprecedented 3-substituted isoxazole-5-sulfonyl fluorides, 1-substituted-1H-1,2,3-triazole-4-sulfonyl fluorides, 2-amino-1-bromoethane-1-sulfonyl fluorides and 4-bromo-β-sultams in good to excellent yields. These new modules comprise a pendant sulfonyl fluoride handle, which further undergoes facile and selective SuFEx reactions with a selection of aryl silyl ethers to generate stable and useful sulfonate connections.

  20. Enriched fluoride sorption using alumina/chitosan composite

    Energy Technology Data Exchange (ETDEWEB)

    Viswanathan, Natrayasamy, E-mail: [Department of Chemistry, Anna University Tiruchirappalli - Dindigul Campus, Dindigul 624 622, Tamil Nadu (India); Meenakshi, S., E-mail: [Department of Chemistry, Gandhigram Rural University, Gandhigram 624 302, Tamil Nadu (India)


    Alumina possesses an appreciable defluoridation capacity (DC) of 1566 mg F{sup -}/kg. In order to improve its DC, it is aimed to prepare alumina polymeric composites using the chitosan. Alumina/chitosan (AlCs) composite was prepared by incorporating alumina particles in the chitosan polymeric matrix, which can be made into any desired form viz., beads, candles and membranes. AlCs composite displayed a maximum DC of 3809 mg F{sup -}/kg than the alumina and chitosan (52 mg F{sup -}/kg). The fluoride removal studies were carried out in batch mode to optimize the equilibrium parameters viz., contact time, pH, co-anions and temperature. The equilibrium data was fitted with Freundlich and Langmuir isotherms to find the best fit for the sorption process. The calculated values of thermodynamic parameters indicate the nature of sorption. The surface characterisation of the sorbent was performed by FTIR, AFM and SEM with EDAX analysis. A possible mechanism of fluoride sorption by AlCs composite has been proposed. Suitability of AlCs composite at field conditions was tested with a field sample taken from a nearby fluoride-endemic village. This work provides a potential platform for the development of defluoridation technology.

  1. Fluoride Sorption Efficiency of Vermiculite Functionalised with Cationic Surfactant: Isotherm and Kinetics

    Directory of Open Access Journals (Sweden)

    Tayo Oladipo Ologundudu


    Full Text Available Groundwater is a major source of water, especially in rural communities. The presence of excess fluoride in groundwater has been a health concern for many decades because it causes fluorosis. The persistence of this problem led to the development of several approaches for reducing fluoride in groundwater to ≤1.5 mg/L, which is the World Health Organization’s (WHO permissible limit. Despite recorded success in fluoride reduction, drawbacks such as cost and efficiency have remained apparent, thus necessitating further research on defluoridation. This paper aims at assessing the defluoridation capacity of a clay mineral, vermiculite, when modified with the cationic surfactant hexadecyltrimethylammonium bromide. The effects of experimental parameters such as pH, agitation time, mass of adsorbent, and temperature were examined to determine the most favourable adsorption conditions. Using batch technique, the results showed a fluoride sorption of 51% from an 8 mg/L fluoride solution. The adsorption conformed more to Freundlich than Langmuir isotherm with an adsorption capacity of 2.36 mg/g, while the kinetics conformed to a pseudo-second-order reaction. pH emerged as the most influential factor in optimisation. The findings of this study indicated that modified vermiculite could be efficient in reducing fluoride in groundwater to more tolerable limits, but requires adequate pH control.

  2. Streptococcus mutans adhesion to titanium after brushing with fluoride and fluoride-free toothpaste simulating 10 years of use. (United States)

    Fais, Laiza M G; Carmello, Juliana C; Spolidorio, Denise M P; Adabo, Gelson L


    To assess the influence of fluoride on the adhesion of Streptococcus mutans to titanium using an experimental paradigm simulating 10 years of brushing. Commercially pure titanium (cpTi) and titanium alloy (Ti-6Al-4V) disks (6 mm in diameter and 4 mm thick) were mirror-polished and randomly assigned to one of the following six groups (n = 6): immersion (I) or brushing (B) in deionized water (groups IW [control] and BW), fluoride-free toothpaste (groups IT and BT), or fluoridated toothpaste (groups IFT and BFT). Specimens subjected to immersion were statically submerged into the solutions without brushing. For the brushed specimens, a linear brushing machine with a soft-bristled toothbrush was used. The experiments lasted a total of 244 hours. Before and after treatment, the specimens were analyzed under an atomic force microscope to determine the mean roughness (Ra) and the mean of the maximum peak-to-valley heights of the profile (Rtm). The disks were contaminated with standard strains of S mutans in well plates with brain-heart infusion broth. Adhesion was analyzed based on the numbers of colony-forming units (CFU/mL) of adhered viable cells using scanning electronic microscopy. Differences in CFU/mL between the groups were analyzed by one-way analysis of variance. Immersion did not affect either surface. As suggested by Ra and Rtm, BW, BT, and BFT induced changes on the surface of cpTi, whereas only BT and BTF induced changes on the surface of Ti-6Al-4V. No significant differences were observed regarding CFU/mL among the cpTi or Ti-6Al-4V groups. S mutans adhesion was similar for all surfaces. The changes in titanium induced by 10 years of simulated brushing with fluoride toothpaste did not increase the adhesion of S mutans.

  3. some factors influencing the free fluoride content in black tea

    African Journals Online (AJOL)


    Fluoride is an essential micro-nutrient owing to its role in the prevention of dental caries. Chronic exposure to high levels of the ion (F-) results in both dental and skeletal fluorosis. A study was carried out to determine free fluoride content in tea (Camellia sinensis) infusions of different grades of black Cut, Tear and Curl ...

  4. Drinking water fluoridation: bone mineral density and hip fracture incidence. (United States)

    Lehmann, R; Wapniarz, M; Hofmann, B; Pieper, B; Haubitz, I; Allolio, B


    The role of drinking water fluoride content for prevention of osteoporosis remains controversial. Therefore, we analyzed the influence of drinking water fluoridation on the incidence of osteoporotic hip fractures and bone mineral density (BMD) in two different communities in eastern Germany: in Chemnitz, drinking water was fluoridated (1 mg/L) over a period of 30 years; in Halle, the water was not fluoridated. BMD was measured in healthy hospital employees aged 20-60 years (Halle: 214 women, 98 men; Chemnitz: 201 women, 43 men, respectively) using dual-energy X-ray absorptiometry. Hip fractures in patients > or = 35 years admitted to the local hospitals in the years 1987-1989 were collected from the clinic registers. There was no difference in age, anthropometric, hormonal, or lifestyle variables between the two groups. Mean fluoride exposure in Chemnitz was 25.2 +/- 7.3 years. No correlation was found between fluoride exposure and age-adjusted BMD. We found no significant difference in spinal or femoral BMD between subjects living in Halle and Chemnitz [lumbar spine: 0.997 +/- 0.129 (g/cm2) vs. 1.045 + 0.171 (g/cm2), p = 0.08, for men; 1.055 +/- 0.112 (g/cm2) vs. 1.046 +/- 0.117 (g/cm2), p = 0.47, for women]. The fracture incidence showed an exponential increase with aging in men and women with an incidence about 3.5 times higher for women. In Chemnitz, we calculated an age-adjusted annual incidence of 142.2 per 100,000 for women and 72.5 per 100,000 for men, respectively. In Halle, the incidences were 178.5 per 100,000 for women and 89.2 per 100,000 for men. There was a lower hip fracture incidence after the age of 85 in women in Chemnitz (1391 per 100,000 in Chemnitz vs. 1957 per 100,000) in Halle, p = 0.006). Using the age-adjusted incidences, significantly fewer hip fractures occurred in Chemnitz in both men and women. In conclusion, our study suggests that optimal drinking water fluoridation (1 mg/L), which is advocated for prevention of dental caries, does

  5. Dentifrice fluoride and abrasivity interplay on artificial caries lesions. (United States)

    Nassar, Hani M; Lippert, Frank; Eckert, George J; Hara, Anderson T


    Incipient caries lesions on smooth surfaces may be subjected to toothbrushing, potentially leading to remineralization and/or abrasive wear. The interplay of dentifrice abrasivity and fluoride on this process is largely unknown and was investigated on three artificially created lesions with different mineral content/distribution. 120 bovine enamel specimens were randomly allocated to 12 groups (n = 10), resulting from the association of (1) lesion type [methylcellulose acid gel (MeC); carboxymethylcellulose solution (CMC); hydroxyethylcellulose gel (HEC)], (2) slurry abrasive level [low (REA 4/ RDA 69); high (REA 7/RDA 208)], and (3) fluoride concentration [0/275 ppm (14.5 mM) F as NaF]. After lesion creation, specimens were brushed in an automated brushing machine with the test slurries (50 strokes 2×/day). Specimens were kept in artificial saliva in between brushings and overnight. Enamel surface loss (SL) was determined by optical profilometry after lesion creation, 1, 3 and 5 days. Two enamel sections (from baseline and post-brushing areas) were obtained and analyzed microradiographically. Data were analyzed by analysis of variance and Tukey's tests (α = 5%). Brushing with high-abrasive slurry caused more SL than brushing with low-abrasive slurry. For MeC and CMC lesions, fluoride had a protective effect on SL from day 3 on. Furthermore, for MeC and CMC, there was a significant mineral gain in the remaining lesions except when brushed with high-abrasive slurries and 0 ppm F. For HEC, a significant mineral gain took place when low-abrasive slurry was used with fluoride. The tested lesions responded differently to the toothbrushing procedures. Both slurry fluoride content and abrasivity directly impacted SL and mineral gain of enamel caries lesions.

  6. Indices of atmospheric purity and fluoride pollution pattern in Arvida, Quebec

    Energy Technology Data Exchange (ETDEWEB)

    LeBlanc, F; Rao, D N; Comeau, G


    Indices of atmospheric purity (IAP) of 42 sites located in all directions from the aluminum factory at Arvida and spread out in about 250-km/sup 2/ area, were determined on the basis of phytosociology of epiphytes of Populus balsamifera. These index values ranging from 0 to 103 were arranged into six groups and the investigated area was accordingly delineated into six IAP zones to represent areas with different levels of fluoride pollution. A relative picture of the approximate limits of fluoride contamination in different zones is obtained by the fluoride accumulation in Parmelia sulcata thalli transplanted at various sites in the area.

  7. Seasonal Variation in Fluoride Content in Groundwaters of Langtang Area, Northcentral Nigeria (United States)

    Dibal, H. U.; Dajilak, W. N.; Lekmang, I. C.; Nimze, L. W.; Yenne, E. Y.


    Thirty groundwater samples were collected at the peak of the rainy season and analysed for fluoride and other cations and anions in drinking water sources of Langtang area. For comparative purposes, thirty seven groundwater samples were collected in the dry season. The aim of the study was to determine variation in fluoride content with respect to the seasons. Fluoride in water was determined by the Ion Selective Electrode (ISE) and the cations by the Inductively Coupled Plasma Atomic Emission Spectrometry (ICP-AES). The anion (sulphate) was determined by Multi - Ion Colorimeter, bicarbonate and chloride by titration method. In addition fluorine content in aquifer materials from a borehole section were determined by Fusion method. The two seasons show variation in content of fluoride in groundwater. Fluoride content in groundwater is higher in the dry season ranging from 0.13 - 10.3 mg/l compared to the 0.06 - 4.60 mg/l values in the rainy season. Content of fluorine (0.01 wt %) in the aquifer materials (sands) is low from depth of 0 to 7.95 m. However, fluorine content increases with depth, from 7.95 to 10.60 m with concentration of 0.04 wt %, 0.05 wt % from 10.60 to 13.25m, and 0.07 wt % from 13.25 to 15.70 m, the content of fluorine however, decreased at depth 15.70 to18.55m with concentration of 0.02 wt % even with fluorite mineral in the aquifer material at this depth. Dilution of fluoride ion as a result of rain input which recharges the aquifer may be the main reason for lower values recorded in the rainy season. Over fifty and sixty percent of waters in both dry and rainy season have fluoride concentration above the WHO upper limit of 1.5 mg/l. Consumption of these elevated values of fluoride in groundwater of the study area, clearly manifests as symptoms of dental fluorosis.

  8. Seasonal Variation in Fluoride Content in Groundwaters of Langtang Area, Northcentral Nigeria

    Directory of Open Access Journals (Sweden)

    Dibal H.U.


    Full Text Available Thirty groundwater samples were collected at the peak of the rainy season and analysed for fluoride and other cations and anions in drinking water sources of Langtang area. For comparative purposes, thirty seven groundwater samples were collected in the dry season. The aim of the study was to determine variation in fluoride content with respect to the seasons. Fluoride in water was determined by the Ion Selective Electrode (ISE and the cations by the Inductively Coupled Plasma Atomic Emission Spectrometry (ICP-AES. The anion (sulphate was determined by Multi – Ion Colorimeter, bicarbonate and chloride by titration method. In addition fluorine content in aquifer materials from a borehole section were determined by Fusion method. The two seasons show variation in content of fluoride in groundwater. Fluoride content in groundwater is higher in the dry season ranging from 0.13 – 10.3 mg/l compared to the 0.06 – 4.60 mg/l values in the rainy season. Content of fluorine (0.01 wt % in the aquifer materials (sands is low from depth of 0 to 7.95 m. However, fluorine content increases with depth, from 7.95 to 10.60 m with concentration of 0.04 wt %, 0.05 wt % from 10.60 to 13.25m, and 0.07 wt % from 13.25 to 15.70 m, the content of fluorine however, decreased at depth 15.70 to18.55m with concentration of 0.02 wt % even with fluorite mineral in the aquifer material at this depth. Dilution of fluoride ion as a result of rain input which recharges the aquifer may be the main reason for lower values recorded in the rainy season. Over fifty and sixty percent of waters in both dry and rainy season have fluoride concentration above the WHO upper limit of 1.5 mg/l. Consumption of these elevated values of fluoride in groundwater of the study area, clearly manifests as symptoms of dental fluorosis.

  9. Artificial caries formation around fluoride-releasing restorations in roots. (United States)

    Dionysopoulos, P; Kotsanos, N; Papadogiannis, Y; Konstantinidis, A


    Secondary caries is one of the most important factors leading to replacement of dental restorations. This investigation assessed the capacity of fluoride-releasing restorative materials to resist caries in vitro when used in roots. Class 5 cavities were prepared in the buccal and lingual surfaces of 30 extracted premolars. The six materials used were: glass-ionomer cement (Fuji), glass-ionomer cement with silver particles added (Ketac-silver), fluoride-containing composite resin (Tetric), composite resin (Silux plus), fluoride-containing amalgam (Fluor-Alloy) and high-copper amalgam (Dispersalloy). After 5 weeks in an acid gel for caries-like lesion formation, the teeth were sectioned longitudinally and examined with polarized light. The results showed that repair with glass-ionomer materials of a carious lesion may be of great importance in the prevention of secondary caries around the restorations in roots.

  10. Removal of fluoride ions from aqueous solution by waste mud

    Energy Technology Data Exchange (ETDEWEB)

    Kemer, Baris; Ozdes, Duygu; Gundogdu, Ali; Bulut, Volkan N.; Duran, Celal [Karadeniz Technical University, Faculty of Arts and Sciences, Department of Chemistry, 61080 Trabzon (Turkey); Soylak, Mustafa, E-mail: [Erciyes University, Faculty of Arts and Sciences, Department of Chemistry, 38039 Kayseri (Turkey)


    The present study was carried out to assess the ability of original waste mud (o-WM) and different types of activated waste mud which are acid-activated (a-WM) and precipitated waste mud (p-WM), in order to remove excess of fluoride from aqueous solution by using batch technique. The p-WM exhibited greater performance than the others. Adsorption studies were conducted as a function of pH, contact time, initial fluoride concentration, adsorbent concentration, temperature, etc. Studies were also performed to understand the effect of some co-existing ions present in aqueous solutions. Adsorption process was found to be almost independent of pH for all types of waste mud. Among the kinetic models tested for p-WM, pseudo-second-order model fitted the kinetic data well with a perfect correlation coefficient value of 1.00. It was found that the adequate time for the adsorption equilibrium of fluoride was only 1 h. Thermodynamic parameters including the Gibbs free energy ({Delta}G{sup o}), enthalpy ({Delta}H{sup o}), and entropy ({Delta}S{sup o}) revealed that adsorption of fluoride ions on the p-WM was feasible, spontaneous and endothermic in the temperature range of 0-40 deg. C. Experimental data showed a good fit with the Langmuir and Freundlich adsorption isotherm models. Results of this study demonstrated the effectiveness and feasibility of WM for removal of fluoride ions from aqueous solution.

  11. An In Vitro Study of the Effect of Fluoridated Milk on Oral Bacterial Biofilms (United States)

    Pratten, J.; Bedi, R.; Wilson, M.


    Microcosmic dental plaques were grown in artificial saliva and supplemented with either milk or fluoridated milk. The presence of fluoride in the milk increased the pH of the biofilms and reduced the proportions of streptococci, demonstrating that in this model, fluoridation of milk produces biofilms with reduced cariogenic potential. PMID:10742268

  12. In Vivo Remineralization of Artificial Carious Lesions using Calcifying Solution and Fluoride Solution

    Directory of Open Access Journals (Sweden)

    Els Sunarsih Budipramana


    Full Text Available The remineralization potential of fluoride and calcifying solution was studiedas in situ model. Matched enamel discs of artifically demineralized human enamel were attached to an acrylic mandibular removable appliance of 6 adult volunteers who rinsed their mouth with a solution containing either 50 ppm F-, 200 ppm F- in amine fluoride, calcifying solution (formula BR21 or placebo as a control. The volunteers were asked to rinse 3 times a day for 3 minutes with 15 ml of the solution for 6 days (18 times. On the 7th day enamel discs were taken out from the partial denture. Three kinds of measurements were done: enamel permeability testing, depth lesion testing and fluoride retention testing. New demineralized enamel discs were attached to the partial dentures and the volunteers were asked to start rinsing with other solutions using the same protocols. The purpose of this study was to answer the question why the calcifying solutions were no more used as a remineralizing solution. The data ws analyzed using SPSS/PC for two factors Anova and one way Anova for enamel permeability and Kruskal Wallis for studying enamel depth lesion and fluoride retention. There was no significant difference after rinsing with calcifying solution and placebo in enamel permeability, depth lesions, and fluoride retention when compared to fluoride solution. To get a better result in remineralizing carious teeth fluoride contents in solution must be higher than 50 ppm F-.

  13. Fluoride Alteration of [3H]Glucose Uptake in Wistar Rat Brain and Peripheral Tissues. (United States)

    Rogalska, Anna; Kuter, Katarzyna; Żelazko, Aleksandra; Głogowska-Gruszka, Anna; Świętochowska, Elżbieta; Nowak, Przemysław


    The present study was designed to investigate the role of postnatal fluoride intake on [3H]glucose uptake and transport in rat brain and peripheral tissues. Sodium fluoride (NaF) in a concentration of 10 or 50 ppm was added to the drinking water of adult Wistar rats. The control group received distilled water. After 4 weeks, respective plasma fluoride levels were 0.0541 ± 0.0135 μg/ml (control), 0.0596 ± 0.0202 μg/ml (10 ppm), and 0.0823 ± 0.0199 μg/ml (50 ppm). Although plasma glucose levels were not altered in any group, the plasma insulin level in the fluoride (50 ppm) group was elevated (0.72 ± 0.13 μg/ml) versus the control group (0.48 ± 0.24 μg/ml) and fluoride (10 ppm) group. In rats receiving fluoride for 4 weeks at 10 ppm in drinking water, [3H]glucose uptake was unaltered in all tested parts of the brain. However, in rats receiving fluoride at 50 ppm, [3H]glucose uptake in cerebral cortex, hippocampus, and thalamus with hypothalamus was elevated, versus the saline group. Fluoride intake had a negligible effect on [3H]glucose uptake by peripheral tissues (liver, pancreas, stomach, small intestine, atrium, aorta, kidney, visceral tissue, lung, skin, oral mucosa, tongue, salivary gland, incisor, molars, and jawbone). In neither fluoride group was glucose transporter proteins 1 (GLUT 1) or 3 (GLUT 3) altered in frontal cortex and striatum versus control. On the assumption that increased glucose uptake (by neural tissue) reasonably reflects neuronal activity, it appears that fluoride damage to the brain results in a compensatory increase in glucose uptake and utilization without changes in GLUT 1 and GLUT 3 expression.

  14. Advantages of liquid fluoride thorium reactor in comparison with light water reactor

    Energy Technology Data Exchange (ETDEWEB)

    Bahri, Che Nor Aniza Che Zainul, E-mail:; Majid, Amran Ab.; Al-Areqi, Wadeeah M. [Nuclear Science Program, School of Applied Physics, Faculty of Science and Technology, Universiti Kebangsaan Malaysia, 43600 UKM Bangi, Selangor (Malaysia)


    Liquid Fluoride Thorium Reactor (LFTR) is an innovative design for the thermal breeder reactor that has important potential benefits over the traditional reactor design. LFTR is fluoride based liquid fuel, that use the thorium dissolved in salt mixture of lithium fluoride and beryllium fluoride. Therefore, LFTR technology is fundamentally different from the solid fuel technology currently in use. Although the traditional nuclear reactor technology has been proven, it has perceptual problems with safety and nuclear waste products. The aim of this paper is to discuss the potential advantages of LFTR in three aspects such as safety, fuel efficiency and nuclear waste as an alternative energy generator in the future. Comparisons between LFTR and Light Water Reactor (LWR), on general principles of fuel cycle, resource availability, radiotoxicity and nuclear weapon proliferation shall be elaborated.

  15. Fluoride, boron and nitrate toxicity in ground water of northwest Rajasthan, India. (United States)

    Chaudhary, Veena; Kumar, Mukesh; Sharma, Mukesh; Yadav, B S


    The study was carried out to access the fluoride, boron, and nitrate concentrations in ground water samples of different villages in Indira Gandhi, Bhakra, and Gang canal catchment area of northwest Rajasthan, India. Rural population, in the study site, is using groundwater for drinking and irrigation purposes, without any quality test of water. All water samples (including canal water) were contaminated with fluoride. Fluoride, boron, and nitrate were observed in the ranges of 0.50-8.50, 0.0-7.73, and 0.0-278.68 mg/l, respectively. Most of the water samples were in the categories of fluoride 1.50 mg/l, of boron 2.0-4.0 mg/l, and of nitrate availability of these compounds in groundwater was due to natural reasons and by the use of chemical fertilizers.

  16. Selective decreases of nicotinic acetylcholine receptors in PC12 cells exposed to fluoride

    International Nuclear Information System (INIS)

    Chen Jia; Shan, K.-R.; Long, Y.-G.; Wang, Y.-N.; Nordberg, Agneta; Guan, Z.-Z.


    In an attempt to elucidate the mechanism by which excessive fluoride damages the central nervous system, the effects of exposure of PC12 cells to different concentrations of fluoride for 48 h on nicotinic acetylcholine receptors (nAChRs) were characterized here. Significant reductions in the number of binding sites for both [ 3 H]epibatidine and [ 125 I]α-bungarotoxin, as well as a significant decrease in the B max value for the high-affinity of epibatidine binding site were observed in PC12 cells subjected to high levels of fluoride. On the protein level, the α3 and α7 subunits of nAChRs were also significantly decreased in the cells exposed to high concentrations of fluoride. In contrast, such exposure had no significant effect on the level of the β2 subunit. These findings suggest that selective decreases in the number of nAChRs may play an important role in the mechanism(s) by which fluoride causes dysfunction of the central nervous system

  17. Treatability study of arsenic, fluoride and nitrate from drinking water by adsorption process

    International Nuclear Information System (INIS)

    Abbas, N.; Irfan, M.; Butt, M.T.


    Natural contamination of nitrate, fluoride, arsenic and dissolved salts in ground water sources is the main health menace at present in different parts of Pakistan. The metalloids especially arsenic, fluoride and nitrate pose severe health hazards to human being. The present research work investigated the removal techniques for arsenic, fluoride and nitrate from drinking water by adsorption process. Ion exchange resins, activated carbon and activated alumina were used for removal of selected contaminants. These adsorbents were evaluated by comparing their removal efficiency as well as requisite operator skills. The result of activated alumina was found good as compared to activated carbon, mix bed resins and ion exchange resins (IRA-400) for maximum removal of arsenic, nitrate and fluoride. The removal efficiency of arsenic, fluoride and nitrate were found 96%, 99%, 98% respectively in case of activated alumina. The advantage of adsorption process is easy to use and relatively cheaper as compared to other treatment methodologies. (author)

  18. Preparation of fly ash based zeolite for removal of fluoride from drinking water (United States)

    Panda, Laxmidhar; Kar, Biswabandita; Dash, Subhakanta


    Fluoride contamination of drinking water is a worldwide phenomenon and scientists are working relentlessly to find ways to remove fluoride from drinking water. Out of the different methods employed for removal fluoride from drinking water adsorption process is the most suitable because in this process the adsorbent is regenerated and the process is cost effective. In the present study fly ash is used as the raw material, which is treated with alkali (NaOH) to form NaP1 zeolite. This zeolite is then subjected to characterization by standard procedures. It is found that the synthesized zeolite has more crystalline character than the raw fly ash and has also more voids and channels on its surface. The surface of the synthesized zeolite is modified with calcium chloride and the same is employed for removal of fluoride under varying pH, contact time, initial concentration of fluoride, temperature and adsorbent dose etc so as to assess the suitably or otherwise of the synthesized product.

  19. Amla as an antihyperglycemic and hepato-renal protective agent in fluoride induced toxicity

    Directory of Open Access Journals (Sweden)

    Rupal A Vasant


    Full Text Available Purpose of the study was to examine the antihyperglycemic and hepato-renal protective effects of Emblica officinalis (Eo fruit as a food supplement in fluoride induced toxicity. Eo fruit powder was incorporated into the diet (2.5, 5 and 10 gm % of fluoride exposed animals for a duration of 30 days. Fluoride exposure caused significant elevation in plasma glucose, serum glutamate oxaloacetate transaminase (SGOT, serum glutamate pyruvate transaminase (SGPT, acid phosphatase (ACP, alkaline phosphatase (ALP activities, hepatic glucose-6-phosphatase (G-6-Pase and decreased hepatic glycogen content, hexokinase activity and antioxidant profiles (hepatic and renal. An inclusion of Eo fruit powder significantly reduced plasma glucose levels, SGOT, SGPT, ACP and ALP activities, hepatic G-6-Pase activity and increased hepatic glycogen content and hexokinase activity. Hepatic and renal antioxidant status of fluoride exposed animals improved upon feeding Eo fruit powder. We, therefore, conclude that E. officinalis fruit could be useful in regulating hyperglycemia and enhances antioxidant status of fluoride exposed animals.

  20. Determination of the stability constants of a number of metal fluoride complexes and their rates of formation

    International Nuclear Information System (INIS)

    Hammer, R.R.


    The stability constants of the fluoride complexes of Al +3 , H 3 BO 3 , Cr +3 , Cr +6 , Fe +3 , Gd +3 , Nb +5 , UO 2 +2 , and Zr +4 were determined in 0.96 and 2.88 M HNO 3 solutions in the temperature range 25 to 60 0 C with a fluoride specific ion electrode. These data can be used to calculate the concentration of chemical species in solution and will be used to correlate solution properties with solution composition. The solubilities of some fluoride precipitates were also measured in nitric acid solutions. The rates of formation of the fluoborates, aluminum fluoride, and zirconium fluoride complexes were measured with a fluoride specific ion electrode at 25, 35, and 45 0 C. The rates of formation of all complexes, except BF 4 - , AlF +2 , and a fluoride complex with aluminum containing more than three fluorides associated with it, were too fast to measure with the instrumentation used

  1. Caries prevalence and fluoride use in low SES children in Clermont-Ferrand (France). (United States)

    Tubert-Jeannin, S; Riordan, P J; Manevy, R; Lecuyer, M M; Pegon-Machat, E


    To evaluate the association between dental caries experience and preventive behaviours of children residing in a deprived area in Clermont-Ferrand (France). All 4-5 yr-olds attending nine schools in deprived areas of the city were invited to participate and 81% (n=282) consented and were examined. Dental caries was recorded at the dentine threshold. Parents completed a questionnaire concerning family demographics and the child's use of fluoride. Non-parametric tests and logistic regression assessed the relative importance of SES and fluoride variables on dental status (dt>1). Fifty four (19%) of the examined children were living in families with an immigrant background, 33% were fully covered by the national health insurance programme for deprived families. Caries experience was high; mean dft was 1.94 (3.31) and 30% of the children had >1 carious teeth. Thirty percent of the families reported using fluoridated salt. Tooth brushing once daily was reported for 39% and twice daily for 26%. Parents declared supervising tooth brushing for 60%. Two thirds of the children, according to their parents, used fluoride supplement between birth and two years. Supervised tooth brushing was significantly correlated with lower mean dt scores. Systemic fluoride use was poorly related to dental caries Immigrant background, family size, type of health insurance and mother's unemployment were significantly correlated with caries prevalence. In multivariate analysis, immigrant status, supervised tooth brushing and parental knowledge about fluoride in toothpastes were significant caries predictors. The majority of low SES children did not practice effective caries prevention; few reported twice daily brushing with fluoride toothpaste. Caries experience was very high and much was untreated. Immigrant status, supervised tooth brushing and parental knowledge about fluoride in toothpastes were significant caries predictors.

  2. Cell cycle arrest and gene expression profiling of testis in mice exposed to fluoride. (United States)

    Su, Kai; Sun, Zilong; Niu, Ruiyan; Lei, Ying; Cheng, Jing; Wang, Jundong


    Exposure to fluoride results in low reproductive capacity; however, the mechanism underlying the impact of fluoride on male productive system still remains obscure. To assess the potential toxicity in testis of mice administrated with fluoride, global genome microarray and real-time PCR were performed to detect and identify the altered transcriptions. The results revealed that 763 differentially expressed genes were identified, including 330 up-regulated and 433 down-regulated genes, which were involved in spermatogenesis, apoptosis, DNA damage, DNA replication, and cell differentiation. Twelve differential expressed genes were selected to confirm the microarray results using real-time PCR, and the result kept the same tendency with that of microarray. Furthermore, compared with the control group, more apoptotic spermatogenic cells were observed in the fluoride group, and the spermatogonium were markedly increased in S phase and decreased in G2/M phase by fluoride. Our findings suggested global genome microarray provides an insight into the reproductive toxicity induced by fluoride, and several important biological clues for further investigations. © 2016 Wiley Periodicals, Inc. Environ Toxicol 32: 1558-1565, 2017. © 2016 Wiley Periodicals, Inc.

  3. A Survey of Fluoride Dosage in Driniking Water and DMF Index in Damghan City

    Directory of Open Access Journals (Sweden)

    Hamid Reza Nasehi nia


    Full Text Available Fluoride is one of the important elements. There are so many controversial scientific points of view regarding fluoride and its presence in food chain. Water fluoridation is the best and most reliable method for the control of dental caries. In this research, the presence and concentration of fluoride in drinking water resources in the city of Damghan and DMF index (decayed, missed, filled between 560 school students (12-15 was investigated. The mean concentration of fluoride in water supplies of Damaghan city was measured in low rain seasons 0.37 mg/l and high rain seasons 0.6 mg/l the DMF index for 12 year sold student was equal 2.00 that comparing these data with the WHO classify cation for DMF index, showed them to be considered in the second surface (low classificatino. For conclusion, based on the mentioned data, a significant correlation may be found between the two parameters in different communities, and the most logic solution for the control of dental cavities in these communities, is the adjusment of fluoride concentration in drinking water.

  4. Efficiency Comparison of Modified-Clay and Lime-Marlin the Adsorption of Fluoride from Aqueous Solution

    Directory of Open Access Journals (Sweden)

    Mohammad Taghi Samadi


    Full Text Available Background and purpose: Fluoride is one of the common anion in water that its concentration varies in different water supplies. Most of the body's requirement for fluoride is supplied through drinking water. Fluoride in low concentration is essential for human health but in high concentration is very hazardous for human health. The efficiency of modified-clay and lime-marl were investigated in this research as an adsorbent for the elimination of fluoride from aqueou solution.  Methods: In this study, the capability of modified-clay and lime-marl to adsorb fluoride ions was conducted using a series of batch tests in a shaker-incubator instrument. The effect of experimental parameters such as pH (4,7,10,  adsorbent dosage (1,5,10 g/L, initial fluoride concentration  (5,10,15 mg/L andcontact time (15-120 min were evaluated. The morphological and micro-structural character of  modified-clay and lime-marl have performed by using X-ray diffraction (XRD. The formation of the carboxylic functional groups was verified by Fourier transform infrared spectra (FT-IR.  Findings: results well demonstrate higher removal efficiency of fluoride was 95.23% and 28.71 by clay-modified and lime-marl, respectively; at 10 mg/L of fluoride concentration and 60 min contact time. The adsorption kinetics fitted well using the pseudo second-order kinetic model; however, equlibrium data were best fitted onto Langmiur isotherm model. The maximum adsorption capacities of modified-clay and lime-marl for fluoride were found to be 4.43 mg/g and 1.32 mg/g, respectively. Conclusion: According to our finding, it proposed that adsorption process by using modified clay is very efficient and economic process for fluoride removal from aqueous solution.

  5. Arsenic may be involved in fluoride-induced bone toxicity through PTH/PKA/AP1 signaling pathway. (United States)

    Zeng, Qi-bing; Xu, Yu-yan; Yu, Xian; Yang, Jun; Hong, Feng; Zhang, Ai-hua


    Chronic exposure to combined fluoride and arsenic continues to be a major public health problem worldwide, affecting thousands of people. In recent years, more and more researchers began to focus on the interaction between the fluorine and the arsenic. In this study, the selected investigation site was located in China. The study group was selected from people living in fluoride-arsenic polluted areas due to burning coal. The total number of participants was 196; including the fluoride-arsenic anomaly group (130) and the fluoride-arsenic normal group (63). By observing the changes in gene and protein expression of PTH/PKA/AP1 signaling pathway, the results show that fluoride can increase the expression levels of PTH, PKA, and AP1, but arsenic can only affect the expression of AP1; fluoride and arsenic have an interaction on the expression of AP1. Further study found that fluoride and arsenic can affect the mRNA expression level of c-fos gene (AP1 family members), and have an interaction on the expression of c-fos, but not c-jun. The results indicate that PTH/PKA/AP1 signaling pathway may play an important role in bone toxicity of fluoride. Arsenic can affect the expression of c-fos, thereby affecting the expression of transcription factor AP1, indirectly involved in fluoride-induced bone toxicity. Copyright © 2013. Published by Elsevier B.V.

  6. Investigation of Fluoride Removal Efficiency from Aqueous Solution by Pistachio and Almonds Crust

    Directory of Open Access Journals (Sweden)

    Maryam Khodadadi


    Full Text Available Introduction: Fluoride and its compounds are widely used in industries and then through effluent are released into the environment. The purpose of this study was to evaluate Efficiency of low cost adsorbents (pistachios coal in the removal of fluoride from aqueous solutions.  Methods: For the preparation of adsorbent, crust of pistachios deride, then washed with distilled water, then powder in the furnace for burning for 2 hours at temperatures of 500, 600, and 700 °C. The effect of changing pH, burning temperature of adsorbent, stirring speed, initial concentration of fluoride, retention time and adsorbent dose was studied. Concentration of fluoride measured according to standard method using spectrophotometer the data were analyzed using Excel software. Results: The results of these experiments showed that the burning adsorbent, temperature 500 ° C, PH of solution in the neutral range (pH = 7, adsorbent dose of 2 g/L for absorbing almonds and adsorbent dose of 3 g pistachio, contact time of 40 minutes for both adsorbent, initial fluoride concentration (5ppm for both absorbent without mixing, the optimal conditions for the efficiency of the absorber is as much as 90-80 percent. Discussion: According to the results, pistachio coal can be used with high efficiency for fluoride removal. 

  7. Parental preference for fluoride varnish: a new concept in a rapidly developing nation

    Directory of Open Access Journals (Sweden)

    Hendaus MA


    Full Text Available Mohamed A Hendaus,1,2 Hibaq A Jama,1 Faisal J Siddiqui,1,3 Sohair A Elsiddig,1 Ahmed H Alhammadi1,2 1Department of Pediatrics, General Academic Pediatrics Section, Hamad Medical Corporation, Doha, 2Department of Clinical Pediatrics, Weill Cornell Medical College, 3Pediatric Residency Program, Hamad Medical Corporation, Doha, Qatar Objective: The objective of this study was to investigate parental preference for fluoride varnish in a country where the average percentage of dental caries in young children is up to ~73%. Consequently, the aim of this study, despite being a pilot, was to create a nationwide project in the State of Qatar to promote oral health in children. Methods: A cross-sectional perspective study was conducted at Hamad Medical Corporation in Qatar. Parents of children aged ≤5 years were offered an interview survey. A total of 200 questionnaires were completed (response rate =100%. The study was conducted between December 1, 2014 and March 30, 2015, and included all children aged >1 year and <5 years who came to the outpatient clinics for well-child and sick visits. We also included children who were admitted to the inpatient wards. Results: The mean age of participant children was 2.8±1.1 years. When inquiring regarding parents’ knowledge and awareness of dental health, we found that >90% of families were aware that dental health affects the health of the whole body. The study showed that ~70% of parents were not aware of the existence of fluoride varnish, but would allow a health provider to apply fluoride varnish. Furthermore, ~80% of parents would not stop brushing their child’s teeth and would not skip dentist appointments if varnish was to be applied. Approximately 40% of parents conveyed some concerns regarding the safety of fluoride varnish, despite being considered as a new concept. The main concern was that the child might swallow some of the fluoride. Another important concern expressed by parents was the

  8. Discrimination of fluoride and phosphate contamination in central Florida for analyses of environmental effects (United States)

    Coker, A. E.; Marshall, R.; Thomson, F.


    A study was made of the spatial registration of fluoride and phosphate pollution parameters in central Florida by utilizing remote sensing techniques. Multispectral remote sensing data were collected over the area and processed to produce multispectral recognition maps. These processed data were used to map land areas and waters containing concentrations of fluoride and phosphate. Maps showing distribution of affected and unaffected vegetation were produced. In addition, the multispectral data were processed by single band radiometric slicing to produce radiometric maps used to delineate areas of high ultraviolet radiance, which indicates high fluoride concentrations. The multispectral parameter maps and radiometric maps in combination showed distinctive patterns, which are correlated with areas known to be affected by fluoride and phosphate contamination. These remote sensing techniques have the potential for regional use to assess the environmental impact of fluoride and phosphate wastes in central Florida.

  9. A rapid method for the determination on fluoride in geological samples

    International Nuclear Information System (INIS)

    Josephson, M.; Cook, E.B.T.; Dixon, K.


    An account is given of a rapid procedure for the determination by use of the specific-ion electrode of fluoride in geological samples. The sample is fused with sodium hydroxide in a nickel crucible in a muffle furnace. The melt is leached with water, a buffer solution of ammonium citrate is added, and the fluoride activity is measured with a specific-ion electrode. All operations are carried out in the crucible, making possible approximately 100 determinations a day. The precision of the method is approximately 10 per cent at a fluoride concentration of 500 p.p.m., which is acceptable for geological-survey work [af

  10. Structural stability, acidity, and halide selectivity of the fluoride riboswitch recognition site

    KAUST Repository

    Chawla, Mohit


    Using static and dynamics DFT methods we show that the Mg2+/F-/phosphate/water cluster at the center of the fluoride riboswitch is stable by its own and, once assembled, does not rely on any additional factor from the overall RNA fold. Further, we predict that the pKa of the water molecule bridging two Mg cations is around 8.4. We also demonstrate that the halide selectivity of the fluoride riboswitch is determined by the stronger Mg-F bond, which is capable of keeping together the cluster. Replacing F- with Cl- results in a cluster that is unstable under dynamic conditions. Similar conclusions on the structure and energetics of the cluster in the binding pocket of fluoride-inhibited pyrophosphatase suggest that the peculiarity of fluoride is in its ability to establish much stronger metal-halide bonds.

  11. Structural stability, acidity, and halide selectivity of the fluoride riboswitch recognition site

    KAUST Repository

    Chawla, Mohit; Credendino, Raffaele; Poater, Albert; Oliva, Romina M.; Cavallo, Luigi


    Using static and dynamics DFT methods we show that the Mg2+/F-/phosphate/water cluster at the center of the fluoride riboswitch is stable by its own and, once assembled, does not rely on any additional factor from the overall RNA fold. Further, we predict that the pKa of the water molecule bridging two Mg cations is around 8.4. We also demonstrate that the halide selectivity of the fluoride riboswitch is determined by the stronger Mg-F bond, which is capable of keeping together the cluster. Replacing F- with Cl- results in a cluster that is unstable under dynamic conditions. Similar conclusions on the structure and energetics of the cluster in the binding pocket of fluoride-inhibited pyrophosphatase suggest that the peculiarity of fluoride is in its ability to establish much stronger metal-halide bonds.

  12. Titanium surface topography after brushing with fluoride and fluoride-free toothpaste simulating 10 years of use. (United States)

    Fais, Laiza M G; Fernandes-Filho, Romeu B; Pereira-da-Silva, Marcelo A; Vaz, Luis G; Adabo, Gelson L


    To conduct a controlled study contrasting titanium surface topography after procedures that simulated 10 years of brushing using toothpastes with or without fluoride. Commercially pure titanium (cp Ti) and Ti-6Al-4V disks (6 mm Ø×4 mm) were mirror-polished and treated according to 6 groups (n=6) as a function of immersion (I) or brushing (B) using deionised water (W), fluoride-free toothpaste (T) and fluoride toothpaste (FT). Surface topography was evaluated at baseline (pretreatment) and post-treatment, using atomic force microscope in order to obtain three-dimensional images and mean roughness. Specimens submitted to immersion were submerged in the vehicles without brushing. For brushed specimens, procedures were conducted using a linear brushing machine with a soft-bristled toothbrush. Immersion and brushing were performed for 244 h. IFT and BFT samples were analysed under scanning electron microscope with Energy-Dispersive X-ray Spectroscopy (EDS). Pre and post-treatment values were compared using the paired Student T-test (α=.05). Intergroup comparisons were conducted using one-way ANOVA with Tukey post-test (α=.05). cp Ti mean roughness (in nanometers) comparing pre and post-treatment were: IW, 2.29±0.55/2.33±0.17; IT, 2.24±0.46/2.02±0.38; IFT, 2.22±0.53/1.95±0.36; BW, 2.22±0.42/3.76±0.45; BT, 2.27±0.55/16.05±3.25; BFT, 2.27±0.51/22.39±5.07. Mean roughness (in nanometers) measured in Ti-6Al-4V disks (pre/post-treatment) were: IW, 1.79±0.25/2.01±0.25; IT, 1.61±0.13/1.74±0.19; IFT, 1.92±0.39/2.29±0.51; BW, 2.00±0.71/2.05±0.43; BT, 2.37±0.86/11.17±2.29; BFT, 1.83±0.50/15.73±1.78. No significant differences were seen after immersions (p>.05). Brushing increased the roughness of cp Ti and of Ti-6Al-4V (p<.01); cp Ti had topographic changes after BW, BT and BFT treatments whilst Ti-6Al-4V was significantly different only after BT and BTF. EDS has not detected fluoride or sodium ions on metal surfaces. Exposure to toothpastes (immersion

  13. Investigating the Intercalation Chemistry of Alkali Ions in Fluoride Perovskites

    Energy Technology Data Exchange (ETDEWEB)

    Yi, Tanghong; Chen, Wei; Cheng, Lei; Bayliss, Ryan D.; Lin, Feng; Plews, Michael R.; Nordlund, Dennis; Doeff, Marca M.; Persson, Kristin A.; Cabana, Jordi (LBNL); (SLAC); (UIC); (UCB)


    Reversible intercalation reactions provide the basis for modern battery electrodes. Despite decades of exploration of electrode materials, the potential for materials in the nonoxide chemical space with regards to intercalation chemistry is vast and rather untested. Transition metal fluorides stand out as an obvious target. To this end, we report herein a new family of iron fluoride-based perovskite cathode materials AxK1–xFeF3 (A = Li, Na). By starting with KFeF3, approximately 75% of K+ ions were subsequently replaced by Li+ and Na+ through electrochemical means. X-ray diffraction and Fe X-ray absorption spectroscopy confirmed the existence of intercalation of alkali metal ions in the perovskite structure, which is associated with the Fe2+/3+ redox couple. A computational study by density functional theory showed agreement with the structural and electrochemical data obtained experimentally, which suggested the possibility of fluoride-based materials as potential intercalation electrodes. This study increases our understanding of the intercalation chemistry of ternary fluorides, which could inform efforts toward the exploration of new electrode materials.

  14. Fluoride release and surface roughness of a new glass ionomer cement: glass carbomer

    Directory of Open Access Journals (Sweden)

    Célia Maria Condeixa de França LOPES


    Full Text Available Abstract Objective This study analyzed the fluoride release/recharge and surface roughness of glass carbomer compared to other encapsulated glass ionomer cements (GICs. Material and method The GICs tested were Glass Fill® (GC-GCP Dental, Riva Self Cure® (RS-SDI, Riva Light Cure® (RL-SDI, Equia Fil® (EF-GC Europe. The composite resin Luna® (LU-SDI was used as control. Five samples of each material were prepared and kept in a humidifier for 24 hours (37 °C, 100% relative humidity. Fluoride release was measured in two times: before (T1: days 1, 2, 7, 14 and after topical application of fluoride (T2: days 15, 16, 21 and 28. The surface roughness was also measured in both times (T1: days 1 and 14; T2: days 15 and 28. All samples were submitted to a single topical application of acidulated fluoride phosphate (Fluor Care - FGM. Two-way ANOVA with repeated measures and Tukey's post-test (p <0.05 were used in the statistical analysis. Result Equia Fil presented the highest fluoride release in both evaluation periods, with a higher release in T1 (p <0.05. The other materials tested, including glass carbomer presented similar release in both periods (T1 and T2. Regarding surface roughness, no significant differences were observed in the interaction between the material × time factors (T1 and T2 (p=0.966. Conclusion The GICs tested presented fluoride release and recharge ability and showed no surface roughness increase by topical application of fluoride.

  15. Molecular Fluoride-Bridged 3d-4f Complexes and Their Magnetic Properties

    DEFF Research Database (Denmark)

    Pedersen, K. S.; Bendix, J.


    trifluorides with very high lattice enthalpies, building block approaches are not limited to robust systems and use of labile transition metal fluoride complexes has met with unexpected success. The physical properties of fluoride-bridged 3d-4f systems are crucially dependent on coordination geometries, which...... be utilized efficiently in tailored synthesis of polynuclear complexes and extended structures. In particular, the strong affinity of the lanthanides for fluoride makes it a good choice for directed synthesis of mixed lanthanide-transition metal complexes. Despite the competition from formation of lanthanide...

  16. Fluoride therapy for osteoporosis: characterization of the skeletal response by serial measurements of serum alkaline phosphatase activity. (United States)

    Farley, S M; Wergedal, J E; Smith, L C; Lundy, M W; Farley, J R; Baylink, D J


    Optimum use of fluoride therapy for osteoporosis requires a sensitive and convenient index of the skeletal response to fluoride. Since previous studies had shown that serum alkaline phosphatase activity (SALP) was increased in response to fluoride therapy, we examined serial measurements of SALP in 53 osteoporotics treated with 66 to 110 mg of sodium fluoride (NaF) for 12 to 91 months. SALP was increased in 87% of the subjects during therapy with fluoride. The increase in SALP was thought to reflect the osteogenic action of fluoride based on the findings that SALP correlated with both trabecular bone area (r = .81, P less than .001) and osteoid length (r = .67, P less than .01) in iliac crest biopsies, predicted increased bone density on spinal radiographs in response to fluoride therapy with an 87% accuracy, and predicted decreased back pain in response to fluoride with a 91% accuracy. In addition, the SALP response to fluoride was seen earlier than other therapeutic responses as indicated by the findings that the tau 1/2 for the SALP response (ie, time for 1/2 of the patients to show a significant response) was significantly less (1.2 +/- 0.3 yr) than that for the pain response (1.6 +/- 0.3 yr, P less than .05) or that for the radiographic response (3.7 +/- 0.5 yr, P less than .001). Although most patients responded to fluoride with an increase in SALP, evaluation of the kinetics of the SALP response to fluoride revealed marked interpatient variation.(ABSTRACT TRUNCATED AT 250 WORDS)

  17. Removal of Fluoride Ion from Aqueous Solution by Nanocomposite Hydrogel Based on Starch/Sodium Acrylate/Nano Aluminum Oxide

    Directory of Open Access Journals (Sweden)

    Aboulfazl Barati


    Full Text Available Determination of fluoride in drinking water has received increasing interest, due to its beneficial and detrimental effects on health. Contamination of drinking water by fluoride can cause potential hazards to human health. In recent years, considerable attention has been given to different methods for the removal of fluoride from drinking and waste waters. The aim of this research was to investigate the effect of nano composite hydrogel based on starch/sodium acrylate/aluminum oxide in reduction of fluoride concentration in drinking water and industrial waste water. In a batch system, the dynamic and equilibrium adsorption of fluoride ions were studied with respect to changes in determining parameters such as pH, contact time, initial fluoride concentration, starch/acrylic acid weight ratio and weight percent of nano aluminum oxide. The obtained equilibrium adsorption data were fitted with Langmuir and Freundlich models, as well as the kinetic data with pseudo-first order and pseudo- second order models. The results showed that optimum pH was found to be in the range of 5 to 7. Removal efficiency of fluoride was increased with decreases in initial concentration of fluoride. Sixty percent of initial value of fluoride solution was removed by nano composite hydrogel (4 wt% of nano aluminum oxide at 240 min (initial fluoride concentration = 5 ppm, pH 6.8 and temperature = 25ºC. Under the same condition, the equilibrium adsorption of fluoride ions was 85% and 68% for initial solution concentration of 5 and 10 ppm, respectively. Adsorption isotherm data showed that the fluoride sorption followed the Langmuir model. Kinetics of sorption of fluoride onto nano composite hydrogel was described by pseudo-first order model.

  18. Production of sintered porous metal fluoride pellets (United States)

    Anderson, L.W.; Stephenson, M.J.


    Porous pellets characterized by a moderately reactive crust and a softer core of higher reactivity are produced by forming agglomerates containing a metal fluoride powder and a selected amount ofwater. The metal fluoride is selected to be sinterable and essentially non-reactive with gaseous fluorinating agents. The agglomerates are contacted with a gaseous fluorinating agent under controlled conditions whereby the heat generated by localized reaction of the agent and water is limited to values effccting bonding by localized sintering. Porous pellets composed of cryolite (Na/sub 3/AlF/sub 6/) can be used to selectively remove trace quantities of niobium pentafluoride from a feed gas consisting predominantly of uranium hexafluoride. (Official Gazette)

  19. Hydrothermal synthesis and formation mechanism of hexagonal yttrium hydroxide fluoride nanobundles

    International Nuclear Information System (INIS)

    Tian, Li; Sun, QiLiang; Zhao, RuiNi; He, HuiLin; Xue, JianRong; Lin, Jun


    Graphical abstract: The formation of yttrium hydroxide fluorides nanobundles can be expressed as a precipitation transformation from cubic NaYF 4 to hexagonal NaYF 4 and to hexagonal Y(OH) 2.02 F 0.98 owing to ion exch