Intergranular stresses in Incoloy-800
International Nuclear Information System (INIS)
Holden, T.M.; Holt, R.A.; Clarke, A.P.
1997-01-01
The generation of intergranular residual strains under uniaxial loading conditions in the plastic regime has been measured in detail by neutron diffraction in Incoloy-800. A relatively simple theory, based on the Taylor model, gives a good semiquantitative account of the magnitudes of the strains. The results clarify the interpretation of measurements made earlier on Incoloy-800 steam generator tubes. (author)
Some observations about the Incoloy 800 corrosion
International Nuclear Information System (INIS)
Baptista, W.; Sathler, L.; Mattos, O.R.
1985-01-01
The chemical and electrochemical characteristics of synthetic solutions similar to those inside the occluded cell corrosion - OCC (pitting, cracks from stress corrosion) of incoloy 800, 25 0 C are studied. (E.G.) [pt
Tritium Permeability of Incoloy 800H and Inconel 617
Energy Technology Data Exchange (ETDEWEB)
Philip Winston; Pattrick Calderoni; Paul Humrickhouse
2012-07-01
Design of the Next Generation Nuclear Plant (NGNP) reactor and its high-temperature components requires information regarding the permeation of fission generated tritium and hydrogen product through candidate heat exchanger alloys. Release of fission-generated tritium to the environment and the potential contamination of the helium coolant by permeation of product hydrogen into the coolant system represent safety basis and product contamination issues. Of the three potential candidates for high-temperature components of the NGNP reactor design, only permeability for Incoloy 800H has been well documented. Hydrogen permeability data have been published for Inconel 617, but only in two literature reports and for partial pressures of hydrogen greater than one atmosphere, far higher than anticipated in the NGNP reactor. To support engineering design of the NGNP reactor components, the tritium permeability of Inconel 617 and Incoloy 800H was determined using a measurement system designed and fabricated at Idaho National Laboratory. The tritium permeability of Incoloy 800H and Inconel 617, was measured in the temperature range 650 to 950°C and at primary concentrations of 1.5 to 6 parts per million volume tritium in helium. (partial pressures of 10-6 atm)—three orders of magnitude lower partial pressures than used in the hydrogen permeation testing. The measured tritium permeability of Incoloy 800H and Inconel 617 deviated substantially from the values measured for hydrogen. This may be due to instrument offset, system absorption, presence of competing quantities of hydrogen, surface oxides, or other phenomena. Due to the challenge of determining the chemical composition of a mixture with such a low hydrogen isotope concentration, no categorical explanation of this offset has been developed.
Tritium Permeability of Incoloy 800H and Inconel 617
Energy Technology Data Exchange (ETDEWEB)
Philip Winston; Pattrick Calderoni; Paul Humrickhouse
2011-09-01
Design of the Next Generation Nuclear Plant (NGNP) reactor and its high-temperature components requires information regarding the permeation of fission generated tritium and hydrogen product through candidate heat exchanger alloys. Release of fission-generated tritium to the environment and the potential contamination of the helium coolant by permeation of product hydrogen into the coolant system represent safety basis and product contamination issues. Of the three potential candidates for high-temperature components of the NGNP reactor design, only permeability for Incoloy 800H has been well documented. Hydrogen permeability data have been published for Inconel 617, but only in two literature reports and for partial pressures of hydrogen greater than one atmosphere, far higher than anticipated in the NGNP reactor. To support engineering design of the NGNP reactor components, the tritium permeability of Inconel 617 and Incoloy 800H was determined using a measurement system designed and fabricated at Idaho National Laboratory. The tritium permeability of Incoloy 800H and Inconel 617, was measured in the temperature range 650 to 950 C and at primary concentrations of 1.5 to 6 parts per million volume tritium in helium. (partial pressures of 10-6 atm) - three orders of magnitude lower partial pressures than used in the hydrogen permeation testing. The measured tritium permeability of Incoloy 800H and Inconel 617 deviated substantially from the values measured for hydrogen. This may be due to instrument offset, system absorption, presence of competing quantities of hydrogen, surface oxides, or other phenomena. Due to the challenge of determining the chemical composition of a mixture with such a low hydrogen isotope concentration, no categorical explanation of this offset has been developed.
Incoloy 800 anodic behavior in sulfate and chloride solutions at high temperature
International Nuclear Information System (INIS)
Lafont, C.; Alvarez, M.G.
1992-01-01
The anodic behavior and pitting corrosion resistance of Incoloy 800 in concentrated aqueous chloride and sulphate solutions has been studied by means of electrochemical techniques. The effect of different environmental variables, such as temperature (in the 100 0 C to 280 0 C range) and sulphate ion concentration (0.02 M to 2 M), was evaluated. In another set of experiments, the influence of sulphate ions additions on the pitting resistance and pitting morphology of Incoloy 800 in chloride solutions at high temperature was also examined. (author)
Effects of PbO on the oxide films of incoloy 800HT in simulated primary circuit of PWR
International Nuclear Information System (INIS)
Tan, Yu; Yang, Junhan; Wang, Wanwan; Shi, Rongxue; Liang, Kexin; Zhang, Shenghan
2016-01-01
Effects of trace PbO on oxide films of Incoloy 800HT were investigated in simulated primary circuit water chemistry of PWR, also with proper Co addition. The trace PbO addition in high temperature water blocked the protective spinel oxides formation of the oxide films of Incoloy 800HT. XPS results indicated that the lead, added as PbO into the high temperature water, shows not only +2 valance but also +4 and 0 valances in the oxide film of 800HT co-operated with Fe, Cr and Ni to form oxides films. Potentiodynamic polarization results indicated that as PbO concentration increased, the current densities of the less protective oxide films of Incoloy 800HT decreased in a buffer solution tested at room temperature. The capacitance results indicated that the donor densities of oxidation film of Incoloy 800HT decreased as trace PbO addition into the high temperature water. - Highlights: • Trace PbO addition into the high temperature water block the formation of spinel oxides on Incoloy 800HT. • The donor density of oxide film decreases with trace PbO addition. • The current density of potentiodynamic polarization decreases of oxide film with trace PbO addition.
Thomas, Kiran; Vincent, S.; Barbadikar, Dipika; Kumar, Shresh; Anwar, Rebin; Fernandes, Nevil
2018-04-01
Incoloy 925 is an age hardenable Nickel-Iron-Chromium alloy with the addition of Molybdenum, Copper, Titanium and Aluminium used in many applications in oil and gas industry. Nickel alloys are preferred mostly in corrosive environments where there is high concentration of H2S, CO2, chlorides and free Sulphur as sufficient nickel content provides protection against chloride-ion stress-corrosion cracking. But unfortunately, Nickel alloys are very expensive. Plating an alloy steel part with nickel would cost much lesser than a part make of nickel alloy for large quantities. A brief study will be carried out to compare the performance of nickel plated alloy steel with that of an Incoloy 925 part by conducting corrosion tests. Tests will be carried out using different coating thicknesses of Nickel on low alloy steel in 0.1 M NaCl solution and results will be verified. From the test results we can confirm that Nickel plated low alloy steel is found to exhibit fairly good corrosion in comparison with Incoloy 925 and thus can be an excellent candidate to replace Incoloy materials.
Study of Incoloy 800HT alloy tested by heat-cycling
International Nuclear Information System (INIS)
Velciu, L.; Meleg, T.; Pantiru, M.; Petrescu, D.; Voicu, F.
2016-01-01
This paper investigated Incoloy 800HT (UNS N08811) alloy after some heat-cycling tests. The study continues prior tests realized in INR Pitesti concerning utilization of some nickel-based alloys in the heat exchangers and steam generators construction. The thermal-cycling consist in a successive series of heating and cooling with some rates in a range temperature. Technical parameters of thermal cycling: 50 & 200 cycles, 25 °C/minute heating-cooling rate, temperature range 450-1000°C, and argon working medium. The analysis consisted in metallographic examination (microstructure), Vickers microhardness, and traction tests. The average grain size was determined by linear interception method (ASTM E-112). The micro hardness was calculated by the relationship of the device technical book. On the Strength-Deformation diagrams were obtained: tensile strength and elongation. The tested samples were compared with the ''as received'' material. The results showed a good metallographic and mechanical behaviour of Incoloy 800HT at these thermal-cycling tests. (authors)
Energy Technology Data Exchange (ETDEWEB)
Sayiram, G., E-mail: sayiram.g@vit.ac.in; Arivazhagan, N.
2015-04-15
In this work, the microstructural character of dissimilar welds between Incoloy 800H and 321 Stainless Steel has been discussed. The microscopic examination of the base metals, fusion zones and interfaces was characterized using an optical microscope and scanning electron microscopy. The results revealed precipitates of Ti (C, N) in the austenitic matrix along the grain boundaries of the base metals. Migration of grain boundaries in the Inconel 82 weld metal was very extensive when compared to Inconel 617 weldment. Epitaxial growth was observed in the 617 weldment which increases the strength and ductility of the weld metal. Unmixed zone near the fusion line between 321 Stainless Steel and Inconel 82 weld metal was identified. From the results, it has been concluded that Inconel 617 filler metal is a preferable choice for the joint between Incoloy 800H and 321 Stainless Steel. - Highlights: • Failure mechanisms produced by dissimilar welding of Incoloy 800H to AISI 321SS • Influence of filler wire on microstructure properties • Contemplative comparisons of metallurgical aspects of these weldments • Microstructure and chemical studies including metallography, SEM–EDS • EDS-line scan study at interface.
Polman, E.A.; Fransen, T.; Gellings, P.J.
1990-01-01
Coatings, obtained by preoxidation of Incoloy 800H at low PO2 show good sulphidation resistance due to the higher chromia content in the oxide scale. Yttrium-ion implantation of Incoloy 800H has also a beneficial effect on sulphidation, if preoxidation is applied. The reason for this is presumably
Pitting of Incoloy 800 in presence of CuII
International Nuclear Information System (INIS)
Bianchi, G.L.; Alvarez, M.G.
1993-01-01
The pitting behaviour of Incoloy 800 in presence of Cu II ions, at 60 degrees C and 280 degrees C was studied by long term exposition of specimens in aqueous cupric chloride solutions. At 60 degrees C experiments were performed in aerated (7 ppm O 2 ) and deaerated solutions containing 500, 1000, 2000, 10000 and 20000 ppm CuCl 2 . At 280 degrees C experiments were performed in deaerated 20 ppm, 50 ppm and 100 ppm CuCl 2 solutions. During each experiment the open circuit potential of the alloy was measured as a function of time. After corrosion test the specimens were examined by Scanning Electron Microscopy for the presence of pits. In another set of experiments potentiodynamic anodic polarization curves were used to determine the pitting potential of Incoloy 800 in deaerated NaCl solutions at chloride concentrations and pH values corresponding to those possessed by solutions containing 20 ppm to 20000 ppm CuCl 2 . At 60 degrees C pitting was observed in those solutions where the CuCl 2 concentration is higher than 1000 ppm. At 280 degrees C pitting was found in the specimens exposed to those solutions where the CuCl 2 concentration was higher than 20 ppm. (author). 3 refs
International Nuclear Information System (INIS)
Zhang Weiguo; Lin Fangliang; Gao Fengqin; Zhou Hongyi; Cao Xiaoning
1992-03-01
The stress corrosion cracking (SCC) susceptibility of 316 stainless steel (SS) which was welded for primary pipe and Incoloy-800 (shot peening) for steam generator (SG) tube have been investigated by a slow strain rate test (SSRT) at a strain rate of 4.2 x 10 -6 /s. Tests were conducted at 315 C degree for 316 SS and 270 C degree for In-800 in the oxygenated simulated resin intrusion environment (acidic sulfate). Tests of the effect of combination of SO 4 2- and Cl - on SCC of Incoloy-800 were also carried out. The results indicate that Incoloy-800 is unsusceptible to SCC either in the environment with SO 4 2- (from a few ppm to 1000 ppm, pH 3 ∼ 4) or in the environment of combination of SO 4 2- (1000 ppm) and Cl - (from 2 to 1000 ppm). The 316 NG SS is susceptible to transgranular stress corrosion cracking (TGSCC) in the resin intrusion environment with SO 4 2- in high temperature water
Caustic stress corrosion cracking of Inconel-600, Incoloy-800, and Type 304 stainless steel
International Nuclear Information System (INIS)
Theus, G.J.
1976-01-01
High-temperature electrochemical tests have resulted in the stress corrosion cracking of Inconel-600 and Incoloy-800 (registered trademarks, International Nickel Company), and Type 304 stainless steel in caustic solutions. Results show that stress corrosion cracking of these alloys can be prevented or accelerated by varying their electrochemical potential. To a certain extent, the same effect can be achieved by altering the gas atmosphere above the test solution from a pure nitrogen cover gas to a mixture of 5 percent H 2 and 95 percent N 2 . The effect of the cover gas can then be negated by adjusting the specimen's electrochemical potential either to cause or to inhibit stress corrosion cracking. Some specifics of the test results reveal that in deoxygenated caustic solutions, Inconel-600 cracks intergranularly at mildly anodic potentials; Incoloy-800 cracks transgranularly at reduced potentials (at or near the open circuit potential) and intergranularly at highly oxidizing potentials; and cracking is mixed (transgranular/intergranular) for Type 304 stainless steel at or near the open circuit potential. The severity of cracking for both Inconel-600 and Incoloy-800 in deoxygenated caustic solutions is reduced by giving the materials a simulated post-weld heat treatment (1150 0 F for 18 h). Test results on Inconel-600 show that high-carbon (0.06 percent) material cracks less severely than low-carbon (0.02 percent) material, in both the simulated post-weld heat-treated condition and the mill-annealed condition
Tangential turning of Incoloy alloy 925 using abrasive water jet technology
Czech Academy of Sciences Publication Activity Database
Cárach, J.; Hloch, S.; Hlaváček, Petr; Ščučka, Jiří; Martinec, Petr; Petrů, J.; Zlámal, T.; Zeleňák, Michal; Monka, P.
-, 11 July 2015 (2015), s. 1-6 ISSN 0268-3768 R&D Projects: GA MŠk ED2.1.00/03.0082; GA MŠk(CZ) LO1406 Institutional support: RVO:68145535 Keywords : incoloy alloy 925 * abrasivewater jet turning * traverse speed * surface roughness Subject RIV: JQ - Machines ; Tools Impact factor: 1.568, year: 2015 http://link.springer.com/article/10.1007/s00170-015-7489-0
Energy Technology Data Exchange (ETDEWEB)
Bergant, Marcos A., E-mail: marcos.bergant@cab.cnea.gov.ar [Gerencia CAREM, Centro Atómico Bariloche (CNEA), Av. Bustillo 9500, San Carlos de Bariloche 8400 (Argentina); Yawny, Alejandro A., E-mail: yawny@cab.cnea.gov.ar [División Física de Metales, Centro Atómico Bariloche (CNEA) / CONICET, Av. Bustillo 9500, San Carlos de Bariloche 8400 (Argentina); Perez Ipiña, Juan E., E-mail: juan.perezipina@fain.uncoma.edu.ar [Grupo Mecánica de Fractura, Universidad Nacional del Comahue / CONICET, Buenos Aires 1400, Neuquén 8300 (Argentina)
2017-04-01
The structural integrity of steam generator tubes is a relevant issue concerning nuclear plant safety. In the present work, J-resistance curves of Inconel 690 and Incoloy 800 nuclear steam generator tubes with circumferential and longitudinal through wall cracks were obtained at room temperature and 300 °C using recently developed non-standard specimens' geometries. It was found that Incoloy 800 tubes exhibited higher J-resistance curves than Inconel 690 for both crack orientations. For both materials, circumferential cracks resulted into higher fracture resistance than longitudinal cracks, indicating a certain degree of texture anisotropy introduced by the tube fabrication process. From a practical point of view, temperature effects have found to be negligible in all cases. The results obtained in the present work provide a general framework for further application to structural integrity assessments of cracked tubes in a variety of nuclear steam generator designs. - Highlights: •Non-standard fracture specimens were obtained from nuclear steam generator tubes. •Specimens with circumferential and longitudinal through-wall cracks were used. •Inconel 690 and Incoloy 800 steam generator tubes were tested at 24 and 300 °C. •Fracture toughness for circumferential cracks was higher than for longitudinal cracks. •Incoloy 800 showed higher fracture toughness than Inconel 690 steam generator tubes.
Tangential turning of Incoloy alloy 925 using abrasive water jet technology
Czech Academy of Sciences Publication Activity Database
Cárach, J.; Hloch, S.; Hlaváček, Petr; Ščučka, Jiří; Martinec, Petr; Petrů, J.; Zlámal, T.; Zeleňák, Michal; Monka, P.; Lehocká, D.; Krolczyk, J.
2016-01-01
Roč. 82, č. 9 (2016), s. 1747-1752 ISSN 0268-3768 R&D Projects: GA MŠk ED2.1.00/03.0082; GA MŠk(CZ) LO1406 Institutional support: RVO:68145535 Keywords : incoloy alloy 925 * abrasive water jet turning * traverse speed Subject RIV: JQ - Machines ; Tools Impact factor: 2.209, year: 2016 http://link.springer.com/article/10.1007%2Fs00170-015-7489-0
International Nuclear Information System (INIS)
Mansur, Fabio Abud; Schvartzman, Monica Maria de Abreu Mendonca; Campos, Wagner Reis da Costa; Aguiar, Antonio Eugenio de; Chaim, Marcos Souza
2011-01-01
Corrosion has been the major cause of tube failures in steam generators (SG) tubes in nuclear power plants. Problems have resulted from impurities in the secondary water systems which are originated from leaks of cooling water. It is important to understand the compatibility of steam generator tube materials with the environment. This study presents the microstructural characterization and electrochemical behavior of the Incoloy 800 in sodium chloride and sodium sulphate aqueous solutions at 80 degree C. Potentiodynamic anodic polarization, cyclic polarization and open circuit potential (OCP) measurements were the electrochemical techniques applied in this work. The pitting resistance of Incoloy 800 in chloride plus sulphate mixtures were also examined. Experiments performed in solutions with different concentrations of Cl- and SO 4 2- ions in solution (200 ppb, 500 ppb, 1ppm, 5 ppm, 50 ppm and 100 ppm) showed that this concentrations range had no substantial effect on the anodic behavior of the alloy. After polarization no localized corrosion was found on the samples. (author)
The crystallography of fatigue crack initiation in Incoloy-908 and A-286 steel
International Nuclear Information System (INIS)
Krenn, C.R.
1996-12-01
Fatigue crack initiation in the austenitic Fe-Ni superalloys Incoloy-908 and A-286 is examined using local crystallographic orientation measurements. Results are consistent with sharp transgranular initiation and propagation occurring almost exclusively on {111} planes in Incoloy-908 but on a variety of low index planes in A-286. This difference is attributed to the influence of the semicoherent grain boundary η phase in A-286. Initiation in each alloy occurred both intergranularly and transgranularly and was often associated with blocky surface oxide and carbide inclusions. Taylor factor and resolved shear stress and strain crack initiation hypotheses were tested, but despite an inconclusive suggestion of a minimum required {111} shear stress, none of the hypotheses were found to convincingly describe preferred initiation sites, even within the subsets of transgranular cracks apparently free from the influence of surface inclusions. Subsurface inclusions are thought to play a significant role in crack initiation. These materials have applications for use in structural conduit for high field superconducting magnets designed for fusion energy use
International Nuclear Information System (INIS)
Garcia-Mazario, M.; Lancha, A.M.; Hernandez, M.; Maffiotte, C.
1996-01-01
The existence of lead in steam generators, detected during the analysis of deposits in the damaged areas of tubing, supports the hypothesis that lead may contribute to the cracking problems experienced in steam generator tubes. In addition, the harmful effect of lead on Inconel 600 is known not only through laboratory tests but also as a result of operating experience. Operating experience of Incoloy 800 is, however, much more limited and there are very few laboratory studies in this area. Taking into account that thin films formed on metals reflect the interaction between such metals and the aqueous environment and also that incoloy 800 is considered to be a suitable material for new steam generators as a substitute for Inconel 600, attempts to determine the effect of lead on corrosion films are considered useful with a view to better understanding the stress-corrosion-cracking behaviour of these materials. For these reasons the objective of this paper is to gain some insights into the effect of lead on the oxide layers forming on Inconel 600 and Incoloy 800 tested in the laboratory in various aggressive lead-containing environments. Auger electron spectroscopy (AES) and electron spectroscopy for chemical analysis (ESCA) have been used to study the composition of these oxide layers. (orig.)
Directory of Open Access Journals (Sweden)
K. Anand
2015-09-01
Full Text Available The present study focuses on friction welding process parameter optimization using a hybrid technique of ANN and different optimization algorithms. This optimization techniques are not only for the effective process modelling, but also to illustrate the correlation between the input and output responses of the friction welding of Incoloy 800H. In addition the focus is also to obtain optimal strength and hardness of joints with minimum burn off length. ANN based approaches could model this welding process of INCOLOY 800H in both forward and reverse directions efficiently, which are required for the automation of the same. Five different training algorithms were used to train ANN for both forward and reverse mapping and ANN tuned force approach was used for optimization. The paper makes a robust comparison of the performances of the five algorithms employing standard statistical indices. The results showed that GANN with 4-9-3 for forward and 4-7-3 for reverse mapping arrangement could outperform the other four approaches in most of the cases but not in all. Experiments on tensile strength (TS, microhardness (H and burn off length (BOL of the joints were performed with optimised parameter. It is concluded that this ANN model with genetic algorithm may provide good ability to predict the friction welding process parameters to weld Incoloy 800H.
2010-07-01
... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Options. 8.25 Section 8.25 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS NATIONAL SERVICE LIFE INSURANCE Optional Settlements § 8.25 Options. Insurance will be paid in a lump sum only when selected by...
Directory of Open Access Journals (Sweden)
Dinu Alice
2005-01-01
Full Text Available Many non-volatile impurities accidentally introduced into the steam generator tend to Concentrate on its surface in restricted flow areas. In this way these impurities can lead to stress corrosion cracking (SCC on stressed tubes of the steam generator. Such impurities can be strong alkaline or acid solutions. To evaluate the effect of alkaline concentrated environments on SCC of steam generator tubes, the tests were con ducted on stressed samples of Incoloy-800 in 10% NaOH solution. To accelerate the SCC process, stressed specimens were anodically polarised in a caustic solution in an electro chemical cell. The method of stressing of Incoloy-800 tubes used in our experiments was the C-ring. Using the cathodic zone of the potentiodynamic curves it was possible to calculate the most important electrochemical parameters: the corrosion current, the corrosion rate, and the polarization resistance. We found that the value of the corrosion potential to initiate the SCC microcracks was -100 mV. The tested samples were examined using the metallographic method. The main experimental results showed that the in crease of the stress state promoted the in crease of the SCC susceptibility of Incoloy-800 samples tested under the same conditions, and that the length of the SCC-type microcracks in creased with the growth of the stress value.
29 CFR 825.114 - Inpatient care.
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Inpatient care. 825.114 Section 825.114 Labor Regulations... LEAVE ACT OF 1993 Coverage Under the Family and Medical Leave Act § 825.114 Inpatient care. Inpatient care means an overnight stay in a hospital, hospice, or residential medical care facility, including...
Incoloy 800 stands up to radiation and corrosion in high temperature gas cooled reactors
International Nuclear Information System (INIS)
Anon.
1975-01-01
Incoloy 800 has been selected for heat exchangers in helium cooled nuclear reactor prototypes for exposure to 350 to 800 0 C helium and high temperature high purity water and steam. 304H stainless steel used in heat exchangers in original design cracked in the superheater area, bellows and tubing after static pressure tests but before exposure to steam. Residual stress, chlorides, and oxygen were deduced to have caused the failures
International Nuclear Information System (INIS)
Ullrich, G.; Krompholz, K.
1993-01-01
The influence of cold working and subsequent ageing at operational temperatures on the long-term and short-term mechanical properties of components made from the iron-nickel-chromium base alloy Incoloy 800 are discussed. Long-term properties are time-to-rupture strengths, which are included in the design code, over a lifetime of 300,000 hours. For LWR operating temperatures of 350 o C, this is of minor importance. An operating temperature of 550 o C is possible for Incoloy 800 with up to 25% cold working and a subsequent solution annealing at 950 o C, without loss of time-to-rupture strength compared with the 'as received' state. The short-term mechanical properties are strongly influenced by cold working, in the form of increasing yield strength and rupture strength, and decreasing ductility and consequently loss in impact energies. A subsequent ageing at 550 o C leads to a decrease of the yield strength and rupture strength, and an increase of ductility as well as the impact energies. The environmental influence are discussed. (author) 3 figs., 1 tab., 8 refs
Niu, Dongdong; Xia, Jing; Jiang, Chunhao; Qi, Beibei; Ling, Xiaoyu; Lin, Siyuan; Zhang, Weixiong; Guo, Jianhua; Jin, Hailing; Zhao, Hongwei
2016-04-01
Small RNAs play an important role in plant immune responses. However, their regulatory function in induced systemic resistance (ISR) is nascent. Bacillus cereus AR156 is a plant growth-promoting rhizobacterium that induces ISR in Arabidopsis against bacterial infection. Here, by comparing small RNA profiles of Pseudomonas syringae pv. tomato (Pst) DC3000-infected Arabidopsis with and without AR156 pretreatment, we identified a group of Arabidopsis microRNAs (miRNAs) that are differentially regulated by AR156 pretreatment. miR825 and miR825* are two miRNA generated from a single miRNA gene. Northern blot analysis indicated that they were significantly downregulated in Pst DC3000-infected plants pretreated with AR156, in contrast to the plants without AR156 pretreatment. miR825 targets two ubiquitin-protein ligases, while miR825* targets toll-interleukin-like receptor (TIR)-nucleotide binding site (NBS) and leucine-rich repeat (LRR) type resistance (R) genes. The expression of these target genes negatively correlated with the expression of miR825 and miR825*. Moreover, transgenic plants showing reduced expression of miR825 and miR825* displayed enhanced resistance to Pst DC3000 infection, whereas transgenic plants overexpressing miR825 and miR825* were more susceptible. Taken together, our data indicates that Bacillus cereus AR156 pretreatment primes ISR to Pst infection by suppressing miR825 and miR825* and activating the defense related genes they targeted. © 2015 Institute of Botany, Chinese Academy of Sciences.
2010-10-01
... article is likely to affect future acquisitions, include a recommendation that a copy of the determination... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Exceptions. 825.103 Section 825.103 Federal Acquisition Regulations System DEPARTMENT OF VETERANS AFFAIRS SOCIOECONOMIC...
The microstructure of Incoloy 800 H after long-time creep
International Nuclear Information System (INIS)
Sheng Zhongqi; Katerbau, K.
1993-01-01
The microstructural change of Incoloy 800 H after creep tests with low loads and long rupture time has been investigated. Cavities nucleate at one side of M 23 C 6 carbide particles on grain boundaries. Microcrack propagate by passing through a string of these cavities, M 23 C 6 carbide particles on grain boundaries have a coherent relationship with one of both neighbouring grains, so grain boundaries are strengthened, and the strengthening effect can be estimated for enhanced activation energy. G phase precipitation can be observed on grain boundaries, but no γ' phase particles can be found. Dislocation substructure is different from the typical recovery creep. Dislocation piles appear near M 23 C 6 carbide particles on grain boundaries. Subgrain structure poorly develop and network distribution of dislocation can remain after relative long creep
48 CFR 825.104 - Nonavailable articles.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Nonavailable articles. 825... SOCIOECONOMIC PROGRAMS FOREIGN ACQUISITION Buy American Act-Supplies 825.104 Nonavailable articles. The following items are added to the list of nonavailable articles contained in FAR 25.104: Glass, lead Insulin...
29 CFR 825.701 - Interaction with State laws.
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Interaction with State laws. 825.701 Section 825.701 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR OTHER LAWS THE FAMILY... Agreements on Employee Rights Under FMLA § 825.701 Interaction with State laws. (a) Nothing in FMLA...
40 CFR 1042.825 - Baseline determination.
2010-07-01
... 40 Protection of Environment 32 2010-07-01 2010-07-01 false Baseline determination. 1042.825... Provisions for Remanufactured Marine Engines § 1042.825 Baseline determination. (a) For the purpose of this... not valid. (f) Use good engineering judgment for all aspects of the baseline determination. We may...
33 CFR 117.825 - Newport River.
2010-07-01
... the Atlantic and East Carolina Railway bridge, mile 13.0 at Newport, need not be opened for the... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Newport River. 117.825 Section 117.825 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES...
Stress corrosion cracking of candidate materials for nuclear waste containers
International Nuclear Information System (INIS)
Maiya, P.S.; Shack, W.J.; Kassner, T.F.
1989-09-01
Types 304L and 316L stainless steel (SS), Incoloy 825, Cu, Cu-30%Ni, and Cu-7%Al have been selected as candidate materials for the containment of high-level nuclear waste at the proposed Yucca Mountain Site in Nevada. The susceptibility of these materials to stress corrosion cracking has been investigated by slow-strain-rate tests (SSRTs) in water which simulates that from well J-13 (J-13 water) and is representative of the groundwater present at the Yucca Mountain site. The SSRTs were performed on specimens exposed to simulated J-13 water at 93 degree C and at a strain rate 10 -7 s -1 under crevice conditions and at a strain rate of 10 -8 s -1 under both crevice and noncrevice conditions. All the tests were interrupted after nominal elongation strains of 1--4%. Examination by scanning electron microscopy showed some crack initiation in virtually all specimens. Optical microscopy of metallographically prepared transverse sections of Type 304L SS suggests that the crack depths are small (<10 μm). Preliminary results suggest that a lower strain rate increases the severity of cracking of Types 304L and 316L SS, Incoloy 825, and Cu but has virtually no effect on Cu-30%Ni and Cu-7%Al. Differences in susceptibility to cracking were evaluated in terms of a stress ratio, which is defined as the ratio of the increase in stress after local yielding in the environment to the corresponding stress increase in an identical test in air, both computed at the same strain. On the basis of this stress ratio, the ranking of materials in order of increasing resistance to cracking is: Types 304L SS < 316L SS < Incoloy 825 congruent Cu-30%Ni < Cu congruent Cu-7%Al. 9 refs., 12 figs., 7 tabs
29 CFR 825.110 - Eligible employee.
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Eligible employee. 825.110 Section 825.110 Labor... employee. (a) An “eligible employee” is an employee of a covered employer who: (1) Has been employed by the... worksite where 50 or more employees are employed by the employer within 75 miles of that worksite. (See...
29 CFR 825.119 - Leave for treatment of substance abuse.
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Leave for treatment of substance abuse. 825.119 Section 825... Leave for treatment of substance abuse. (a) Substance abuse may be a serious health condition if the conditions of §§ 825.113 through 825.115 are met. However, FMLA leave may only be taken for treatment for...
29 CFR 825.402 - Violations of the posting requirement.
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Violations of the posting requirement. 825.402 Section 825.402 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR OTHER LAWS THE FAMILY AND MEDICAL LEAVE ACT OF 1993 Enforcement Mechanisms § 825.402 Violations of the...
J-integral flaw resistance curves of Incoloy 800H at room temperature
International Nuclear Information System (INIS)
Krompholz, K.; Ullrich, G.
1985-08-01
J-integral experiments at room temperature were performed on three point bend type specimens of the iron-nickel base alloy Incoloy 800H with a/w-ratios of 0.3 and 0.5. These experiments are performed within the frame of a round robin test in cooperation with German- and US-partners. The tests were performed in stroke control as well as in load control. Three different evaluation procedures were applied: -The signal of the dc potential drop technique -The partial unloading procedure and -The multiple specimen technique. Evaluating the dc potential drop technique and the multiple specimen method delivered reasonable results while the partial unloading procedure failed. The different methods are discussed and fractographic results support these results under discussion. (author)
27 CFR 19.825 - Construction and equipment.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Construction and equipment. 19.825 Section 19.825 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS DISTILLED SPIRITS PLANTS Production of Vinegar by the Vaporizing Process...
Haanappel, V.A.C.; Fransen, T.; Geerdink, Bert; Gellings, P.J.
1988-01-01
The mechanical properties of ceramic coatings containing cerium oxide, prepared by the sol-gel method and used to protect Incoloy 800H against aggressive environments, are reported. Deformation and cracking behavior in oxidizing and sulfidizing environments has been investigated by
Directory of Open Access Journals (Sweden)
Arun Kumar Srirangan
2016-06-01
Full Text Available Incoloy 800HT which was selected as one of the prominent material for fourth generation power plant can exhibit appreciable strength, good resistance to corrosion and oxidation in high temperature environment. This study focuses on the multi-objective optimization using grey relational analysis for Incoloy 800HT welded with tungsten inert arc welding process with N82 filler wire of diameter 1.2 mm. The welding input parameters play a vital role in determining desired weld quality. The experiments were conducted according to L9 orthogonal array. The input parameter chosen were the welding current, Voltage and welding speed. The output response for quality targets chosen were the ultimate tensile strength and yield strength (at room temperature, 750 °C and impact toughness. Grey relational analysis was applied to optimize the input parameters simultaneously considering multiple output variables. The optimal parameters combination was determined as A2B1C2 i.e. welding current at 110 A, voltage at 10 V and welding speed at 1.5 mm/s. ANOVA method was used to assess the significance of factors on the overall quality of the weldment. The output of the mechanical properties for best and least grey relational grade was validated by the metallurgical characteristics:
29 CFR 825.400 - Enforcement, general rules.
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Enforcement, general rules. 825.400 Section 825.400 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR OTHER LAWS THE FAMILY... with the Secretary of Labor, or (2) Filing a private lawsuit pursuant to section 107 of FMLA. (b) If...
49 CFR 236.825 - System, automatic train control.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false System, automatic train control. 236.825 Section..., INSPECTION, MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.825 System, automatic train control. A system so arranged that its operation will automatically...
29 CFR Appendix F to Part 825 - [Reserved
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false [Reserved] F Appendix F to Part 825 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR OTHER LAWS THE FAMILY AND MEDICAL LEAVE ACT OF 1993 Appendix F to Part 825 [Reserved] ...
Corrosion of heat exchanger materials under heat transfer conditions
International Nuclear Information System (INIS)
Tapping, R.L.; Lavoie, P.A.; Disney, D.J.
1987-01-01
Severe pitting has occurred in moderator heat exchangers tubed with Incoloy-800 in Pickering Nuclear Generating Station. The pitting originated on the cooling side (outside) of the tubes and perforation occurred in less than two years. It was known from corrosion testing at CRNL that Incoloy-800 was not susceptible to pitting in Lake Ontario water under isothermal conditions. Corrosion testing with heat transfer across the tube wall was carried out, and it was noted that severe pitting could occur under deposits formed on the tubes in silty Lake Ontario water. Subsequent testing, carried out in co-operation with Ontario Hydro Research Division, investigated the pitting resistance of other candidate tubing alloys: Incoloy-825, 904 L stainless steel, AL-6X, Inconel-625, 70:30 Cu:Ni, titanium, Sanicro-30 and Sanicro-28 1 . Of these, only titanium and Sanicro-28 have not suffered some degree of pitting attack in silt-containing Lake Ontario Water. In the absence of silt, and hence deposits, no pitting took place on any of the alloys tested
Resistance of Incoloy 800 steam generator tube to pitting corrosion in PWR secondary water at 250°C
International Nuclear Information System (INIS)
Schvartzman, Mônica M.A.M.; Albuquerque, Adriana Silva de; Esteves, Luiza; Rabello, Emerson G.; Mansur, Fábio Abud
2017-01-01
The steam generator (SG) is one of the main components of a PWR, so the performance of this type of nuclear power plant depends to a large extent on the trouble-free operation of SGs. Its degradation significantly affects the overall plant performance. Alloy 800NG (Incoloy® 800) is a nickel-iron-chromium alloy used for steam generator tubes in PWRs due to their high strength, good workability and resistance to corrosion. This behavior is attributed to the protective oxide film formed on the metal surface by contact with the high temperature pressurized water. However, chloride is one of major SG impurities that cause the breakdown of the passive film and initiate localized corrosion in passive metals as Alloy 800NG. The aim of this study is to provide information about the pitting corrosion behavior of the Incoloy® 800 steam generator tube under normal secondary circuit parameters (250 deg C and 5 MPa) and abnormal conditions of operation (presence of chloride ions in the secondary water). For this, optical microscopy, XRD and EDS analysis and electrochemical tests have been carried out under simulated PWR secondary water operating conditions. The susceptibility to pitting corrosion was evaluated using electrochemical tests and the oxide layer formed on material was examined by means of scanning electron microscopy (SEM) and energy dispersive X-ray spectrometer (EDS) analyses. (author)
Resistance of Incoloy 800 steam generator tube to pitting corrosion in PWR secondary water at 250°C
Energy Technology Data Exchange (ETDEWEB)
Schvartzman, Mônica M.A.M. [Pontifícia Universidade Católica de Minas Gerais (PUC-Minas), Belo Horizonte, MG (Brazil); Albuquerque, Adriana Silva de; Esteves, Luiza; Rabello, Emerson G.; Mansur, Fábio Abud, E-mail: monicacdtn@gmail.com, E-mail: asa@cdtn.br, E-mail: luiza.esteves@cdtn.br, E-mail: egr@cdtn.br, E-mail: fametalurgica@gmail.com [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)
2017-07-01
The steam generator (SG) is one of the main components of a PWR, so the performance of this type of nuclear power plant depends to a large extent on the trouble-free operation of SGs. Its degradation significantly affects the overall plant performance. Alloy 800NG (Incoloy® 800) is a nickel-iron-chromium alloy used for steam generator tubes in PWRs due to their high strength, good workability and resistance to corrosion. This behavior is attributed to the protective oxide film formed on the metal surface by contact with the high temperature pressurized water. However, chloride is one of major SG impurities that cause the breakdown of the passive film and initiate localized corrosion in passive metals as Alloy 800NG. The aim of this study is to provide information about the pitting corrosion behavior of the Incoloy® 800 steam generator tube under normal secondary circuit parameters (250 deg C and 5 MPa) and abnormal conditions of operation (presence of chloride ions in the secondary water). For this, optical microscopy, XRD and EDS analysis and electrochemical tests have been carried out under simulated PWR secondary water operating conditions. The susceptibility to pitting corrosion was evaluated using electrochemical tests and the oxide layer formed on material was examined by means of scanning electron microscopy (SEM) and energy dispersive X-ray spectrometer (EDS) analyses. (author)
29 CFR 825.100 - The Family and Medical Leave Act.
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false The Family and Medical Leave Act. 825.100 Section 825.100... THE FAMILY AND MEDICAL LEAVE ACT OF 1993 Coverage Under the Family and Medical Leave Act § 825.100 The Family and Medical Leave Act. (a) The Family and Medical Leave Act of 1993, as amended, (FMLA or Act...
29 CFR 825.700 - Interaction with employer's policies.
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Interaction with employer's policies. 825.700 Section 825.700 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR OTHER LAWS THE FAMILY AND MEDICAL LEAVE ACT OF 1993 Effect of Other Laws, Employer Practices, and Collective...
Analysis of incoloy 800ht alloy tested in thermal transient conditions
International Nuclear Information System (INIS)
Velciu, L.; Meleg, T.; Nitu, A.; Popa, L.
2015-01-01
This paper investigated Incoloy 800 HT alloy after following thermal transient tests: fast heating rates (50° and 90°C/minute) up to 1,000°C, maintaining this temperature level (0 and 60 minutes), furnace-cooling until 220°C, and then air-cooling. This alloy is one of the candidate materials for construction of the steam generators of the future NPP reactors. The analysis consisted in metallographic examination and traction tests. The samples were investigated using the Olympus GX 71 optical microscope, the OPL microdurometer with automatic cycle and WALTER BAI traction device. The average grain size was determined by linear interception method. The micro hardness was calculated by the relationship from the device technical book. On the traction diagrams were obtained: strength resistance (Rm), elongation at rupture (A) and elastic modulus (E). The tested alloy was compared with the ''as received'' material, and the results showed a good behavior of this alloy in the presented conditions. (authors)
International Nuclear Information System (INIS)
Navin Vinayak, S.; Sunitha, Y.; Rangarajan, S.; Narasimhan, S.V.
2008-01-01
Nano materials have different properties from the corresponding bulk materials because of fine grain size, large fraction of surface atoms, high surface energy and high grain boundary volume fraction. For similar reasons, the nano-alloy coatings show superior high-temperature corrosion resistance and are generally more resistant to stress corrosion cracking. Hence, it is of interest to know the materials performance, if the structural materials used in nuclear reactors are made of nano-grains. In Indian PHWRs, Incoloy-800 is being used as the steam generator tubing material. It's corrosion resistance property is very important as it forms not only the pressure boundary between the radioactive primary water and non-active secondary water but also from the view point of loss of heavy water, in case of any corrosion damage. In this paper, the corrosion resistance of the oxide films formed on nano-grain nickel film electrodeposited on Incoloy-800 (a) in the presence of saccharine (WS) and (b) in the absence of saccharine (WOS) were compared with that formed on Commercial Ni foil, using electrochemical dc polarization and ac impedance techniques. The surface morphology, elemental analysis and grain size were studied with SEM, EDX and XRD techniques respectively. The nano-grain nickel films were prepared on Incoloy-800 by electrodeposition using Watt's Bath with saccharine sodium as a surfactant. The oxide films were developed by exposing them to LiOH solution (pH-10.0) at 245 deg C for 3 days (A-group) and 7 days (B-group). XRD results showed that the grain size of Ni formed in the absence of saccharine (WOS) was ∼ 60 nm and did not change after being autoclaved. But, for Ni formed in the presence of saccharine (WS), the grain size was ∼ 16 nm which increased to 40-50 nm after being autoclaved. With both A and B-group specimens, the PDAP curves showed an active-passive transition, a passive region and a transpassive region in 2N H 2 SO 4 . However, the critical
International Nuclear Information System (INIS)
Rangarajan, S.; Sinu, C.; Balaji, V.; Narasimhan, S.V.
2010-01-01
The water chemistry in the Steam Generator (SG) Circuits of Indian Pressurized Heavy Water Reactors (PHWRs) is controlled by the all volatile treatment (AVT) procedure, wherein volatile amines are used to maintain the alkaline pH required for minimizing the corrosion of the structural materials. Earlier, Monel and morpholine were used as the Steam Generator material and the alkalizing agent respectively. However, currently they are replaced by Incoloy-800 and Ethanolamine (ETA). ETA was chosen because of its beneficial effects due to low pK b and K d values, loading behaviour on condensate polishing unit (CPU) and also on cost comparison with other amines. Since we have Incoloy-800 on the tube side and Carbon steel(CS) on the shell side in the SG circuits, efforts were taken to study the nature of the oxide films formed on these surfaces and to evaluate the corrosion resistance and electrochemical properties of the same, under simulated secondary water chemistry conditions of PHWRs containing different dissolved oxygen (DO) concentration. In this context, experiments were carried out by exposing finely polished CS and Incoloy -800 coupons to ETA based medium in the presence and absence of Hydrazine (pH: 9.2) at 240 o C under two different DO conditions (< 10 ppb and 200 ppb) for 24 hours. Oxide films formed under these conditions were characterized using SEM, Raman spectroscopy, electrochemical impedance, polarization and Mott-Schottky techniques. Further, studies at a controlled DO level ( < 10 ppb) were carried out for different time durations viz., 7- and 30- days. The composition, surface morphology, oxide thickness, resistance, type of semi-conductivity and defect density of the oxide films were evaluated and correlated with the DO levels and discussed elaborately in this paper. (author)
29 CFR 825.206 - Interaction with the FLSA.
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Interaction with the FLSA. 825.206 Section 825.206 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR OTHER LAWS THE FAMILY....206 Interaction with the FLSA. (a) Leave taken under FMLA may be unpaid. If an employee is otherwise...
29 CFR 825.401 - Filing a complaint with the Federal Government.
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Filing a complaint with the Federal Government. 825.401 Section 825.401 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR OTHER LAWS THE FAMILY AND MEDICAL LEAVE ACT OF 1993 Enforcement Mechanisms § 825.401 Filing a...
2010-10-01
... PROGRAMS FOREIGN ACQUISITION Buy American Act-Construction Materials 825.202 Exceptions. (a) When a... HCA believes that the non-availability of an article is likely to affect future acquisitions, include...
29 CFR Appendix A to Part 825-Index - [Reserved
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false [Reserved] A Appendix A to Part 825-Index Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR OTHER LAWS THE FAMILY AND MEDICAL LEAVE ACT OF 1993 Appendix A to Part 825—Index [Reserved] ...
21 CFR 82.5 - General specifications for straight colors.
2010-04-01
... 21 Food and Drugs 1 2010-04-01 2010-04-01 false General specifications for straight colors. 82.5... LISTING OF CERTIFIED PROVISIONALLY LISTED COLORS AND SPECIFICATIONS General Provisions § 82.5 General specifications for straight colors. No batch of a straight color listed in subpart B, C, or D shall be certified...
Energy Technology Data Exchange (ETDEWEB)
Kontrik, M.; Pavlik, V.; Simko, F. [Slovenska Akademia Vied, Ustav Anorganickej Chemie, Oddelenie Taveninovych Sustav, 84636 Bratislava (Slovakia)
2013-04-16
Thesis deals with investigating the addition of chromium trifluoride to eutectic mixture of LiF-NaF-KF (46.5 - 11.5 - 42 mol %) on the corrosion of superalloy Incoloy 800H/HT with static tests. The corrosion losses of the alloy and type of corrosion attack was observed. It was found that the addition of chromium fluoride into the mixture generally increases of corrosion of the material. Several types of corrosion attacks were observed. On the surface of the samples the spotted, pitting and transgranular corrosions were found. On the cross-sections of the samples the subsurface and lamellar corrosions were detected. (authors)
40 CFR 63.825 - Standards: Product and packaging rotogravure and wide-web flexographic printing.
2010-07-01
... POLLUTANTS FOR SOURCE CATEGORIES (CONTINUED) National Emission Standards for the Printing and Publishing Industry § 63.825 Standards: Product and packaging rotogravure and wide-web flexographic printing. (a) Each... rotogravure and wide-web flexographic printing. 63.825 Section 63.825 Protection of Environment ENVIRONMENTAL...
24 CFR 8.25 - Public housing and multi-family Indian housing.
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Public housing and multi-family Indian housing. 8.25 Section 8.25 Housing and Urban Development Office of the Secretary, Department of Housing and Urban Development NONDISCRIMINATION BASED ON HANDICAP IN FEDERALLY ASSISTED PROGRAMS AND...
47 CFR 73.825 - Protection to reception of TV channel 6.
2010-10-01
... 47 Telecommunication 4 2010-10-01 2010-10-01 false Protection to reception of TV channel 6. 73.825... RADIO BROADCAST SERVICES Low Power FM Broadcast Stations (LPFM) § 73.825 Protection to reception of TV... separation distances in the following table are met with respect to all full power TV Channel 6 stations. FM...
29 CFR 825.215 - Equivalent position.
2010-07-01
... family or dependent coverages). For example, if an employee was covered by a life insurance policy before... AND MEDICAL LEAVE ACT OF 1993 Employee Leave Entitlements Under the Family and Medical Leave Act § 825... group life insurance, health insurance, disability insurance, sick leave, annual leave, educational...
A comparative study of the corrosion resistance of incoloy MA 956 and PM 2000 superalloys
Directory of Open Access Journals (Sweden)
Maysa Terada
2010-12-01
Full Text Available Austenitic stainless steels, titanium and cobalt alloys are widely used as biomaterials. However, new medical devices require innovative materials with specific properties, depending on their application. The magnetic properties are among the properties of interest for some biomedical applications. However, due to the interaction of magnetic materials with Magnetic Resonance Image equipments they might used only as not fixed implants or for medical devices. The ferromagnetic superalloys, Incoloy MA 956 and PM 2000, produced by mechanical alloying, have similar chemical composition, high corrosion resistance and are used in high temperature applications. In this study, the corrosion resistance of these two ferritic superalloys was compared in a phosphate buffer solution. The electrochemical results showed that both superalloys are passive in this solution and the PM 2000 present a more protective passive film on it associated to higher impedances than the MA 956.
International Nuclear Information System (INIS)
Travalloni, A.M.; Sathler, L.; Mattos, O.R.
1985-01-01
Polarization curves for the Incoloy 800 and for the stainless stell AISI 304 were obtained with static and rotational electrodes. The electrolytes employed showed growing concentrations of mixtures as Iron, Nickel and Chromium Chlorides their proportion being the same as the content of these elements in the respective alloys. The alloys under investigation exhibited a continuous transition behaviour from the passive to the active-passive and to the active conditions. Also, the pH was found the main parameter controlling the anodic behaviour of the alloy. (Author) [pt
International Nuclear Information System (INIS)
Gokhale, B.K.; Keny, S.J.; Kumbhar, A.G.; Rangarajan, S.; Bera, S.; Nuwad Jitendra; Kumar, Sanjukta A.; Wagh, D. N.; Pradhan, S.
2012-09-01
For their use in future PWR applications, the general corrosion behaviors of two modified alloys of titanium and Incoloy were studied at high temperature and high pressure (290 deg. C, 7400 Kpa) under ammoniated atmosphere and compared. Coupons were exposed to solutions of varying ammonia concentrations of (10, 50 and 100 ppm ) at 290 deg. C under non-deaerated conditions in a static autoclave for 20 days. Surface characteristics of exposed coupons were studied using XRF, SEM, EDAX and XPS. The solution in the autoclave was analyzed for its specific conductivity, pH and for the elemental concentrations leached from alloy. The exposed titanium based alloy showed deposition of white crystalline material (300-1000 nm size) on the surface. Depletion of Ti and increase in the oxygen concentration on the exposed surface was observed. This indicated dissolution of Ti in solution from surface at high temperature and pressure and its reaction with oxygen in solution to form oxide and its redeposition on surface. The oxide film compositions were found to change drastically between 10 and 50 ppm ammoniated solution. Ti was found to be enriched in the oxide film when the solution contained 50 ppm of ammonia whereas the opposite effect was observed at 10 ppm of ammonia. The presence Ti 4+ in oxide environment and traces of Cr 3+ were observed but no nitrogen or Zr was detected. Specific conductivity of the exposed solution was found to increase by 30 μS/cm and pH to decrease by 1.5 units. Slight leaching of Ti was observed in solution. No Zr was found in the leached solution. Presence of other elements like Al, Cr, Ni in the exposed solution indicated leaching of autoclave construction material (hastelloy). This alloy showed good resistance for corrosion under the experimental conditions. The exposed surface of Incoloy based alloy showed Ni, Cr, Cu and Mn on the surface with deposition of crystalline particles (200-300 nm size). The exposed surface also showed a decrease in Cr
International Nuclear Information System (INIS)
McCright, R.D.; Fleming, D.L.
1991-10-01
Alloy 825 contains approximately 40% Ni, 30% Fe, 20% Cr, 3.5% Mo, 2% Cu, and 1% Ti. Alloy 825 has a number of performance features that make it attractive as a candidate material for nuclear waste containers. However, under certain environmental conditions Alloy 825 is susceptible to localized forms of corrosion, and the focus of this paper is determination of those conditions. Electrochemical polarization was used to determine the critical potential for passive film breakdown, a process which leads to localized corrosion attack. Results indicated that quite high levels of chloride ion concentrations coupled with low pH are required to lower the critical potential to approach the corrosion potential
29 CFR 825.123 - Unable to perform the functions of the position.
2010-07-01
... position within the meaning of the Americans with Disabilities Act (ADA), as amended, 42 U.S.C. 12101 et... 29 Labor 3 2010-07-01 2010-07-01 false Unable to perform the functions of the position. 825.123... Act § 825.123 Unable to perform the functions of the position. (a) Definition. An employee is “unable...
Fatigue tests and life estimation of Incoloy alloy 908
International Nuclear Information System (INIS)
Feng, J.; Toma, L.S.; Jang, C.H.; Steeves, M.M.
1997-01-01
Incoloy reg-sign alloy 908* is a candidate conduit material for Nb 3 Sn cable-in-conduit superconductors. The conduit is expected to experience cyclic loads at 4 K. Fatigue fracture of the conduit is one possible failure mode. So far, fatigue life has been estimated from fatigue crack growth data, which provide conservative results. The more traditional practice of life estimation using S-N curves has not been done for alloy 908 due to a lack of data at room and cryogenic temperatures. This paper presents a series of fatigue test results in response to this need. Tests were performed in reversed bending, rotating bending, and uniaxial fatigue machines. The test matrix included different heat treatments, two load ratios (R=-1 and 0.1), two temperatures (298 and 77 K), and two orientations (longitudinal and transverse). As expected, there is a semi-log linear relation between the applied stress and fatigue life above an applied stress (e.g., 310 MPa for tests at 298 K and R=-1). Below this stress the curves show an endurance limit. The aged and cold-worked materials have longer fatigue lives and higher endurance limits than the others. Different orientations have no apparent effect on life. Cryogenic temperature results in a much high fatigue life than room temperature. A higher tensile mean stress gives shorter fatigue life. It was also found that the fatigue lives of the reversed bending specimens were of the same order as those of the uniaxial test specimens, but were only half the lives of the rotating bending specimens for given stresses. A sample application of the S-N data is discussed
29 CFR 825.106 - Joint employer coverage.
2010-07-01
... facts and circumstances. A PEO does not enter into a joint employment relationship with the employees of... Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR OTHER LAWS THE FAMILY AND MEDICAL LEAVE ACT OF 1993 Coverage Under the Family and Medical Leave Act § 825.106 Joint employer...
International Nuclear Information System (INIS)
Febriyanto; Sriyono; Satmoko, Ari
1998-01-01
Determination of corrosion rate of steam generator materials (SS 321 and incoloy 800) in chloride containing solution using potentiodynamic method from CMS 100. NaCl 1%, 3% and 5% solution using is used as tested solution. A tested material is grounded by grinding paper on grade 400 600, 800 and 1000, then polished by METADI 1/4 microns paste to get homogeneity. Furthermore, the tested materials is mounted by epoxide resin, so only the surface which contacts to tested solution is open. From the result obtained that borate and phosphate inhibitor can reduce corrosion rate and aggressiveness of chloride ion
Directory of Open Access Journals (Sweden)
Kumar S. Arun
2017-09-01
Full Text Available This study focuses on the effect of heat input on the quality characteristics of tungsten inert arc gas welded incoloy 800HT joints using inconel-82 filler wire. Butt welding was done on specimens with four different heat inputs by varying the process parameters like welding current and speed. The result indicated that higher heat input levels has led to the formation of coarser grain structure, reduced mechanical properties and sensitization issues on the weldments. The formation of titanium nitrides provided resistance to fracture and increased the tensile strength of the joints at high temperatures. Further aging was done on the welded sample at a temperature of 750°C for 500 hours and the metallographic result showed formation of carbides along the grain boundaries in a chain of discrete and globular form which increased the hardness of the material. The formation of spinel NiCr2O4 provided oxidation resistance to the material during elevated temperature service.
24 CFR 891.825 - Mixed-finance closing documents.
2010-04-01
... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Mixed-finance closing documents...-Profit Limited Partnerships and Mixed-Finance Development for Supportive Housing for the Elderly or Persons with Disabilities § 891.825 Mixed-finance closing documents. The mixed-finance owner must submit...
Superalloy applications in the nuclear field
International Nuclear Information System (INIS)
Ramanathan, L.V.; Padilha, A.F.
1984-01-01
The process conditions in the areas of nuclear fuel processing, fabrication, utilization, reprocessing and disposal are severe, demanding therefore the use of materials with high temperature mechanical strength and corrosion resistance. A number of refractory metal containing superalloys have found application in the diferrent areas of the nuclear field. The main aspects of the microstructure, strengthening mechanisms and corrosion resistance of 3 superalloys, namely Incoloy 825, Inconel 718 and Hastelloy C have been discussed. The role of the refractory metal elements in influencing the mechanical strength and corrosion resistance of superalloys has been emphasised. (Author) [pt
International Nuclear Information System (INIS)
Chow, J.G.Y.; Soo, P.; Epel, L.
1978-01-01
A mechanical test program to assess the effects of a simulated HTGR helium environment on the fatigue and creep properties of Incoloy 800H and other primary-circuit metals is described. The emphasis and the objectives of this work are directed toward obtaining information to assess the integrity and safety of an HTGR throughout its service life. The helium test environment selected for study contained 40 μ atm H 2 O, 200 μ atm H 2 , 40 μ atm CO, 10 μ atm CO 2 , and 20 μ atm CH 4 . It is believed that this ''wet'' environment simulates that which could exist in a steam-cycle HTGR containing some leaking steam-generator tubes. A recirculating helium loop operating at about 4 psi in which impurities can be maintained at a constant level, has been constructed to supply the desired environment for fatigue and creep testing
Why incoloy 800 was selected as tube material for the new steam generators of Doel 3
International Nuclear Information System (INIS)
Stubbe, J.; Wolters, F.; Somville, P.; De Ranter, K.
1990-01-01
Incoloy 800 or Inconel 690. This was the basic question for the SG of DOEL 3, to be replaced in 1993. A comparative evaluation was made, focused on the service behaviour, more particularly the corrosion resistance. It was concluded that both materials may be considered for SG replacement. They are indeed substantially superior to alloy 600, but none of them is really better than the other one: - they are both nearly completely immune to primary water stress corrosion cracking; - they are both susceptible to some types of attack from the secondary side. To the 690 credit are the globally better performances in the secondary side corrosion tests. However if the aggressive environments which are unlikely to occur at DOEL 3 are discarded, it appears that the margin between 690 and 800 is small. To the 800 credit is the favourable service experience except the secondary side wastage due to phosphate conditioning. 800 was finally selected not only because of favourable economic arguments, but also because of the important weight attributed to the service behaviour by the Belgian Utilities [fr
Temperature dependence of the dynamic fracture toughness of the alloy Incoloy 800 after cold work
International Nuclear Information System (INIS)
Krompholz, K.; Ullrich, G.
1991-02-01
Precracked charpy-V-notch specimens of the iron-nickel base alloy Incoloy 800 in the as-received condition and after cold work have been tested using an instrumented impact tester (hammer) in the temperature range 293 ≤ T/K ≤ 1223. The specific impact energies were determined by dial readings, from the integration of the load versus time and the load versus load point displacement diagrams; in all cases the agreement was excellent. The specific impact energies and the impulses are correlated with the test temperature and with the degree of cold work, respectively. The dynamic fracture toughness values were determined following the equivalent energy approach. In all cases a distinct decrease of the mechanical properties in the range between the as-received state and after 5 % cold work was found. The temperature behaviour of the impact energies clearly reveals an increase of its value between room temperature and 673 K. This increase is distinctly reduced after cold work. The dynamic fracture toughness decreases with increasing temperature. The fracture surfaces clearly show elasto-plastic fracture behaviour of the material in the temperature regime investigated. (author) 19 figs., 3 tabs., 7 refs
IS GNB3 C825T POLYMORPHISM ASSOCIATED WITH ELITE STATUS OF POLISH ATHLETES?
Directory of Open Access Journals (Sweden)
M. Sawczuk
2014-07-01
Full Text Available The GNB3 gene encodes the beta 3 subunit of heterotrimeric G-proteins that are key components of intracellular signal transduction between G protein-coupled receptors (GPCR and intracellular effectors and might be considered as a potential candidate gene for physical performance. Objectives: The aim of this study was to compare frequency distribution of the common C to T polymorphism at position 825 (C825T of the GNB3 gene between athletes and nonathletic controls of the Polish population as well as to compare the genotype distribution and allele frequency of C825T variants within a group of athletes, i.e. between athletes of sports of different metabolic demands and competitive levels. Methods: The study was performed in a group of 223 Polish athletes of the highest nationally competitive standard (123 endurance-oriented athletes and 100 strength/power athletes. Control samples were prepared from 354 unrelated, sedentary volunteers. Results: The χ2 test revealed no statistical differences between the endurance-oriented athletes and the control group or between sprint/strength athletes and the control group across the GNB3 825C/T genotypes. There were no male-female genotype or allele frequency differences in controls or in either strength/power or endurance-oriented athletes. No statistically significant differences in either allele frequencies or genotype distribution were noted between the top-elite, elite or sub-elite of endurance-oriented and strength/power athletes and the control group. Conclusions: No association between elite status of Polish athletes and the GNB3 C825T polymorphic site has been found.
Cady, Roger
2015-01-01
Oral triptans have dominated the prescription market for acute treatment of migraine for nearly 25 years. Today, patients often express dissatisfaction with prescribed acute treatment in part because they do not have confidence that the therapy will provide consistent efficacy over time. Major limitations to sustained successful use of oral triptans are their relatively slow onset of meaningful clinical benefit and variable absorption/efficacy due to impaired gastrointestinal function during migraine. AVP-825, a new intranasal delivery system for sumatriptan , may be an effective alternative to oral triptans. This article reviews AVP-825, which deposits low-dose sumatriptan powder deep into the vascular mucosa of the posterior nose, allowing rapid absorption of drug into the systemic circulation. Studies suggest that AVP-825 is a highly effective, well-tolerated acute treatment for episodic migraine. Oral triptans are limited in providing effective patient-centered outcomes to migraine patients. Failed or suboptimal abortive treatment of migraine is a major driver of migraine chronification and increases in healthcare costs. AVP-825 is an easy to use, novel, breath-powered intranasal delivery system that provides early onset of efficacy with low systemic drug exposure and few triptan-associated adverse events. AVP-825 will be a welcomed therapeutic tool for the acute treatment of migraine.
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Certification for Serious Injury or Illness of Covered Servicemenber for Military Family Leave (Form WH-385) H Appendix H to Part 825 Labor Regulations Relating to... ACT OF 1993 Pt. 825, App. H Appendix H to Part 825—Certification for Serious Injury or Illness of...
29 CFR Appendix D to Part 825 - Notice of Eligibility and Rights & Responsibilities (Form WH-381)
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Notice of Eligibility and Rights & Responsibilities (Form WH-381) D Appendix D to Part 825 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR OTHER LAWS THE FAMILY AND MEDICAL LEAVE ACT OF 1993 Pt. 825, App. D Appendix...
29 CFR 825.105 - Counting employees for determining coverage.
2010-07-01
... limitations of the employer-employee relationship under the Act; and that determination of the relation cannot... later return to active employment. If there is no employer/employee relationship (as when an employee is... 29 Labor 3 2010-07-01 2010-07-01 false Counting employees for determining coverage. 825.105...
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Appealing the assessment of a penalty for willful violation of the posting requirement. 825.403 Section 825.403 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR OTHER LAWS THE FAMILY AND MEDICAL LEAVE ACT OF 1993...
29 CFR 825.120 - Leave for pregnancy or birth.
2010-07-01
... Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR OTHER LAWS THE FAMILY AND MEDICAL LEAVE ACT OF 1993 Coverage Under the Family and Medical Leave Act § 825.120 Leave for... of a child as follows: (1) Both the mother and father are entitled to FMLA leave for the birth of...
29 CFR Appendix E to Part 825 - Designation Notice to Employee of FMLA Leave (Form WH-382)
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Designation Notice to Employee of FMLA Leave (Form WH-382) E Appendix E to Part 825 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR OTHER LAWS THE FAMILY AND MEDICAL LEAVE ACT OF 1993 Pt. 825, App. E Appendix E to Part...
29 CFR Appendix C to Part 825 - Notice to Employees Of Rights Under FMLA (WH Publication 1420)
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Notice to Employees Of Rights Under FMLA (WH Publication 1420) C Appendix C to Part 825 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR OTHER LAWS THE FAMILY AND MEDICAL LEAVE ACT OF 1993 Pt. 825, App. C Appendix C to Part...
Optimization of process parameters for WEDM of Inconel 825 using grey relational analysis
Directory of Open Access Journals (Sweden)
Pawan Kuma
2018-09-01
Full Text Available Inconel 825 is high nickel-chromium-based superalloy which retains its mechanical properties and exhibits good corrosion and oxidation resistance at elevated temperature. Inconel 825 is extensively used for making aircraft engine parts like combustor casing and turbine blades in aero space industry. This research proposed the Response Surface Methodology with GRA to optimize multiple responses during Wire-cut EDM of Inconel 825. At optimum combination of input parameters i.e. A4B1C1D5E4F2, increase in MRR from 36.13 mm2/min to 41.822 mm2/min, decrease in SR from 2.842μm to 2.445μm and decrease in WWR from 0.01832 to 0.01758 was obtained. Experimental results showed that pulse-on time, wire feed, pulse-off time, and peak current significantly affected the MRR, and surface integrity of specimen and electrode with the formation of craters, pockmarks, debris, micro cracks, and recast layer. The optimal parametric combination obtained from the present study will be advantageous for working on high strength; high thermal conductivity and low melting point materials like nickel alloys.
Directory of Open Access Journals (Sweden)
Dinu Alice
2006-01-01
Full Text Available Stress corrosion cracking (SCC in a caustic medium may affect the secondary circuit tubing of a CANDU NPP cooled with river water, due to an accidental formation of a concentrated alkaline environment in the areas with restricted circulation, as a result of a leakage of cooling water from the condenser. To evaluate the susceptibility of Incoloy-800 (used to manufacture steam generator tubes for CANDU NPP to SCC, some accelerated corrosion tests were conducted in an alkaline solution (10% NaOH, pH = 13. These experiments were performed at ambient temperature and 85 °C. We used the potentiodynamic method and the potentiostatic method, simultaneously monitoring the variation of the open circuit potential during a time period (E corr/time curve. The C-ring method was used to stress the samples. In order to create stress concentrations, mechanical precracks with a depth of 100 or 250 μm were made on the outer side of the C-rings. Experimental results showed that the stressed samples were more susceptible to SCC than the unstressed samples whereas the increase in temperature and crack depth lead to an increase in SCC susceptibility. Incipient micro cracks of a depth of 30 μm were detected in the area of the highest peak of the mechanical precrack.
24 CFR 232.825 - Pro rata refund of insurance premium.
2010-04-01
... ASSISTED LIVING FACILITIES Contract Rights and Obligations Premiums § 232.825 Pro rata refund of insurance premium. Upon termination of a loan insurance contract by a payment in full or by a voluntary termination... rata portion of the current annual loan insurance premium theretofore paid which is applicable to the...
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Certification of Qualifying Exigency for Military Family Leave (Form WH-384) G Appendix G to Part 825 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR OTHER LAWS THE FAMILY AND MEDICAL LEAVE ACT OF 1993 Pt. 825, App. G...
24 CFR 241.825 - Pro rata refund of insurance premium.
2010-04-01
... Projects Without a HUD-Insured or HUD-Held Mortgage Premiums § 241.825 Pro rata refund of insurance premium... of the current annual loan insurance premium theretofore paid which is applicable to the portion of... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Pro rata refund of insurance...
International Nuclear Information System (INIS)
Abraham, T.; Jain, H.; Soo, P.
1986-06-01
Types 304L, 316L, and 321 austenitic stainless steel and Incoloy 825 are being considered as candidate container materials for emplacing high-level waste in a tuff repository. The stress corrosion cracking susceptibility of these materials under simulated tuff repository conditions was evaluated by using the notched C-ring method. The tests were conducted in boiling synthetic groundwater as well as in the steam/air phase above the boiling solutions. All specimens were in contact with crushed Topopah Spring tuff. The investigation showed that microcracks are frequently observed after testing as a result of stress corrosion cracking or intergranular attack. Results showing changes in water chemistry during test are also presented
29 CFR 825.202 - Intermittent leave or reduced leave schedule.
2010-07-01
... leave schedule is a leave schedule that reduces an employee's usual number of working hours per workweek, or hours per workday. A reduced leave schedule is a change in the employee's schedule for a period of... 29 Labor 3 2010-07-01 2010-07-01 false Intermittent leave or reduced leave schedule. 825.202...
Cady, Roger
2015-01-01
AVP-825, formerly 'OptiNose Sumatriptan,' is an investigational Breath-Powered(TM) Bi-Directional(TM) intranasal delivery system containing low-dose sumatriptan (22 mg intranasal powder) that avoids limitations of other types of intranasal administration by taking advantage of unique features of nasal anatomy and physiology. This review summarizes intranasal drug delivery for migraine, how the breath-powered technology works, and AVP-825 pharmacokinetic, efficacy and safety/tolerability findings. To identify AVP-825 clinical studies, a PubMed/MEDLINE database search was conducted with the terms AVP-825, OptiNose, OptiNose Sumatriptan, Breath-Powered Nasal Delivery or sumatriptan powder. Of 20 articles, 5 clinical studies were identified, including the head-to-head comparative COMPASS trial (AVP-825 vs oral sumatriptan) and two placebo-controlled studies. AVP-825 has faster sumatriptan absorption versus oral tablets or traditional liquid nasal spray. In Phase II/III randomized, double-blind, placebo-controlled trials, AVP-825 produced early and sustained efficacy with minimal triptan-related adverse effects. In COMPASS, AVP-825 produced earlier reduction of migraine pain intensity and migraine-associated symptoms than 100 mg oral sumatriptan, and higher early rates of pain relief and pain freedom, similar sustained efficacy, and fewer atypical sensations. AVP-825 has the potential to provide migraine patients with improved intranasal administration of sumatriptan that may enhance efficacy and tolerability.
29 CFR Appendix B to Part 825 - Certification of Health Care Provider (Forms WH-380E & WH-380F)
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Certification of Health Care Provider (Forms WH-380E & WH-380F) B Appendix B to Part 825 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR OTHER LAWS THE FAMILY AND MEDICAL LEAVE ACT OF 1993 Pt. 825, App. B Appendix B to Part...
29 CFR 825.203 - Scheduling of intermittent or reduced schedule leave.
2010-07-01
... leave intermittently or on a reduced leave schedule for planned medical treatment, then the employee... 29 Labor 3 2010-07-01 2010-07-01 false Scheduling of intermittent or reduced schedule leave. 825... OF LABOR OTHER LAWS THE FAMILY AND MEDICAL LEAVE ACT OF 1993 Employee Leave Entitlements Under the...
The oxidation behavior of three different zones of welded Incoloy 800H alloy
International Nuclear Information System (INIS)
Chen, W.S.; Kai, W.; Tsay, L.W.; Kai, J.J.
2014-01-01
Highlights: • The oxidation kinetics of 800H followed the parabolic-rate law in dry-air. • The scales formed on the alloys were composed of Cr 2 O 3 and MCr 2 O 4 (M = Fe, Cr). • Internal-oxidation of Al 2 O 3 and SiO 2 dissolved T i were observed in 800H-SUB and 800H-HAZ • The weight loss behavior of 800H-SUB and 800H-HAZ were observed in wet air. • The mass-loss behavior of 800H-HAZ is more severe than 800H-SUB in wet air. - Abstract: The oxidation behavior of three different zones of welded Incoloy 800H alloys, containing the substrate (800H-SUB), heat-affected zone (800H-HAZ) and the melt zone (800H-MZ) was studied at 950 °C in dry and wet air. The steady-state oxidation rate constants (k p values) were calculated based on the mass-gain data, and the oxidation resistant ability of the alloys followed by the rank of 800H-MZ > 800H-SUB > 800H-HAZ in dry air. The scales formed on the 800H-SUB and 800H-HAZ consisted of a heterophasic mixture of Cr 2 O 3 and FeCr 2 O 4 , while a mixture of Cr 2 O 3 and MnCr 2 O 4 was observed on the 800H-MZ. On the other hand, the oxidation kinetics of the alloy, initially followed the parabolic-rate law up to 48 h, while a significant mass-lost kinetics was observed for a prolong exposure in wet air. The detail oxidation mechanisms for the alloys in both environments were investigated
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Consequences for an employer when not paying the penalty assessment after a final order is issued. 825.404 Section 825.404 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR OTHER LAWS THE FAMILY AND MEDICAL LEAVE ACT OF 1993...
Initial specifications for nuclear waste package external dimensions and materials
International Nuclear Information System (INIS)
Gregg, D.W.; O'Neal, W.C.
1983-09-01
Initial specifications of external dimensions and materials for waste package conceptual designs are given for Defense High Level Waste (DHLW), Commercial High Level Waste (CHLW) and Spent Fuel (SF). The designs have been developed for use in a high-level waste repository sited in a tuff media in the unsaturated zone. Drawings for reference and alternative package conceptual designs are presented for each waste form for both vertical and horizontal emplacement configurations. Four metal alloys: 304L SS, 321 SS, 316L SS and Incoloy 825 are considered for the canister or overpack; 1020 carbon steel was selected for horizontal borehole liners, and a preliminary packing material selection is either compressed tuff or compressed tuff containing iron bearing smectite clay as a binder
13 CFR 108.825 - Purchasing securities from an underwriter or other third party.
2010-01-01
... ADMINISTRATION NEW MARKETS VENTURE CAPITAL (âNMVCâ) PROGRAM Financing of Small Businesses by NMVC Companies Structuring Nmvc Company's Financing of Eligible Small Businesses § 108.825 Purchasing securities from an... Financing of the Small Business. Limitations on Disposition of Assets ...
29 CFR 825.212 - Employee failure to pay health plan premium payments.
2010-07-01
... Family and Medical Leave Act § 825.212 Employee failure to pay health plan premium payments. (a)(1) In... obligations to maintain health insurance coverage cease under FMLA if an employee's premium payment is more... an employee's insurance in accordance with this section and fails to restore the employee's health...
7 CFR 4290.825 - Purchasing securities from an underwriter or other third party.
2010-01-01
... (Continued) RURAL BUSINESS-COOPERATIVE SERVICE AND RURAL UTILITIES SERVICE, DEPARTMENT OF AGRICULTURE RURAL BUSINESS INVESTMENT COMPANY (âRBICâ) PROGRAM Financing of Enterprises by RBICs Structuring Rbic Financing of Eligible Enterprises-Types of Financings § 4290.825 Purchasing securities from an underwriter or...
29 CFR 825.211 - Maintenance of benefits under multi-employer health plans.
2010-07-01
..., DEPARTMENT OF LABOR OTHER LAWS THE FAMILY AND MEDICAL LEAVE ACT OF 1993 Employee Leave Entitlements Under the Family and Medical Leave Act § 825.211 Maintenance of benefits under multi-employer health plans. (a) A... that the employee would have been laid off and the employment relationship terminated; or, (3) The...
13 CFR 107.825 - Purchasing securities from an underwriter or other third party.
2010-01-01
... ADMINISTRATION SMALL BUSINESS INVESTMENT COMPANIES Financing of Small Businesses by Licensees Structuring Licensee's Financing of Eligible Small Businesses: Types of Financing § 107.825 Purchasing securities from... Financing of the Small Business under the Act; or (2) The securities are acquired to finance a change of...
International Nuclear Information System (INIS)
Bai, Qin; Zhao, Qing; Xia, Shuang; Wang, Baoshun; Zhou, Bangxin; Su, Cheng
2017-01-01
Grain boundary engineering (GBE) of nickel-based alloy 825 tubes was carried out with different cold drawing deformations by using a draw-bench on a factory production line and subsequent annealing at various temperatures. The microstructure evolution of alloy 825 during thermal-mechanical processing (TMP) was characterized by means of the electron backscatter diffraction (EBSD) technique to study the TMP effects on the grain boundary network and the evolution of grain boundary character distributions during high temperature annealing. The results showed that the proportion of ∑ 3 n coincidence site lattice (CSL) boundaries of alloy 825 tubes could be increased to > 75% by the TMP of 5% cold drawing and subsequent annealing at 1050 °C for 10 min. The microstructures of the partially recrystallized samples and the fully recrystallized samples suggested that the proportion of low ∑ CSL grain boundaries depended on the annealing time. The frequency of low ∑ CSL grain boundaries increases rapidly with increasing annealing time associating with the formation of large-size highly-twinned grains-cluster microstructure during recrystallization. However, upon further increasing annealing time, the frequency of low ∑ CSL grain boundaries decreased markedly during grain growth. So it is concluded that grain boundary engineering is achieved through recrystallization rather than grain growth. - Highlights: •The grain boundary engineering (GBE) is applicable to 825 tubes. •GBE is achieved through recrystallization rather than grain growth. •The low ∑ CSL grain boundaries in 825 tubes can be increased to > 75%.
International Nuclear Information System (INIS)
Korzan, M.A.
1994-05-01
One of the key engineered barriers in the design of the proposed Yucca Mountain repository is the waste canister that encapsulates the spent fuel elements. Current candidate metals for the canisters to be emplaced at Yucca Mountain include cast iron, carbon steel, Incoloy 825 and titanium code-12. This project was designed to evaluate passive electrochemical noise techniques for measuring pitting and corrosion characteristics of candidate materials under prototypical repository conditions. Experimental techniques were also developed and optimized for measurements in a radiation environment. These techniques provide a new method for understanding material response to environmental effects (i.e., gamma radiation, temperature, solution chemistry) through the measurement of electrochemical noise generated during the corrosion of the metal surface. In addition, because of the passive nature of the measurement the technique could offer a means of in-situ monitoring of barrier performance
Segregation in welded nickel-base alloys
International Nuclear Information System (INIS)
Akhtar, J.I.; Shoaib, K.A.; Ahmad, M.; Shaikh, M.A.
1990-05-01
Segregation effects have been investigated in nickel-base alloys monel 400, inconel 625, hastelloy C-276 and incoloy 825, test welded under controlled conditions. Deviations from the normal composition have been observed to varying extents in the welded zone of these alloys. Least effect of this type occurred in Monel 400 where the content of Cu increased in some of the areas. Enhancement of Al and Ti has been found over large areas in the other alloys which has been attributed to the formation of low melting slag. Another common feature is the segregation of Cr, Fe or Ti, most likely in the form of carbides. Enrichment of Al, Ti, Nb, Mb, Mo, etc., to different amounts in some of the areas of these materials is in- terpretted in terms of the formation of gamma prime precipitates or of Laves phases. (author)
Preclosure analysis of conceptual waste package designs for a nuclear waste repository in tuff
International Nuclear Information System (INIS)
O'Neal, W.C.; Gregg, D.W.; Hockman, J.N.; Russell, E.W.; Stein, W.
1984-01-01
This report discusses the selection and analysis of conceptual waste package developed by the Nevada Nuclear Waste Storage Investigations (NNWSI) project for possible disposal of high-level nuclear waste at a candidate site at Yucca Mountain, Nevada. The design requirements that the waste package must conform to are listed, as are several desirable design considerations. Illustrations of the reference and alternative designs are shown. Four austenitic stainless steels (316L SS, 321 SS, 304L SS and Incoloy 825 high nickel alloy) have been selected for candidate canister/overpack materials, and 1020 carbon steel has been selected as the reference metal for the borehole liners. A summary of the results of technical and ecnonmic analyses supporting the selection of the conceptual waste package designs is included. Postclosure containment and release rates are not analyzed in this report
29 CFR 825.124 - Needed to care for a family member or covered servicemember.
2010-07-01
..., DEPARTMENT OF LABOR OTHER LAWS THE FAMILY AND MEDICAL LEAVE ACT OF 1993 Coverage Under the Family and Medical Leave Act § 825.124 Needed to care for a family member or covered servicemember. (a) The medical... serious health condition, the family member is unable to care for his or her own basic medical, hygienic...
Li, Hui-Lan; Zhang, Yan-Jiao; Chen, Xiao-Ping; Luo, Jian-Quan; Liu, Si-Yun; Zhang, Zan-Lin
2016-09-01
The association between G protein β-polypeptide 3 gene (GNB3) c.825C > T polymorphism (rs5443) and the risk of overweight/obesity has been investigated in many published studies, but the results were conflicting and inconclusive. A meta-analysis was performed to make a more accurate assessment of the relationship. The PubMed, ProQuest Health & Medical Complete, Web of Science, Chinese Biomedical Medical databases (CBM), Chinese National Knowledge Infrastructure (CNKI), and Wan Fang databases were searched to identify eligible literatures. Pooled odds ratios (ORs) with the corresponding 95% confidence intervals (CIs) were used to assess the strength of association between GNB3 c.825C > T polymorphism and overweight/obesity. Eleven articles including 15 case-control studies with a total of 10,396 subjects (3171 cases of overweight/obesity and 7225 controls) were enrolled in the meta-analysis. The GNB3 c.825C > T was significantly associated with overweight/obesity under a recessive model (OR = 1.22, 95% CI: 1.04-1.44, P = 0.015). Moreover, the GNB3 825T allele was obviously associated with overweight alone in all inheritable models (P model (P = 0.084). In the stratification analysis by potential confounding variables, a significant association was observed between GNB3 c.825C > T polymorphism and overweight/obesity risk in males under an allelic model (P = 0.008), a homozygous model (P = 0.014), a recessive model (P = 0.005), and a dominant model (P = 0.049). And the results also showed that GNB3 c.825C > T polymorphism was significantly associated with overweight/obesity in subgroups of mean age less than 30 years, consistent with HWE, and high-quality studies (P = 0.027, P = 0.043, P = 0.040, respectively) under a recessive model, but not in other subgroups. Meta-regression also revealed that P value of HWE, publication year, and the quality scores of studies were the sources of heterogeneity in a recessive model and an allelic
Fatigue and fatigue crack growth properties of 316LN and Incoloy 908 below 10 K
International Nuclear Information System (INIS)
Nyilas, A.; Zhang, J.; Obst, B.; Ulbricht, A.
1992-01-01
The cyclic loading characteristics of Tokamak type thermonuclear machines demand study of the fatigue response of the materials used in critical components. The large superconducting magnets and their superconductors will operate under cyclic mechanical stress conditions. The present paper is biased towards the current superconductor design of the NET (Next European Torus) model coil concept. The superconductor of this coil will be a cable-in-conduit Nb 3 Sn type with an enveloped stiff external jacket structure. The wall thickness of the jacket structure is within the range of 4-5 mm. The manufacturing of the jacket lengths for several hundred meters require an appropriate joining process due to the prefabricated section pieces available only in short lengths of 5-7 meters. The recently anticipated solution favors the flash butt welding technique. The performance of the superconductors jacket will depend on the material selection and the proper structural design according to the existing low temperature structural materials data base. The wind and react Nb 3 Sn-manufacturing process must also account the materials properties after ageing. A program was set up to elucidate the fatigue-life behavior and fatigue crack growth rate (FCGR) of the selected two candidate materials. These materials were the AISI 316LN with a specified low carbon content to avoid the embrittlement after the ageing process and the Incoloy 908. The 316LN material in the as received condition was tested with respect to its fatigue-life for specimens bearing predefined flaws and cracks. The propagation of surface cracks at 12 K and at 295 K was characterized with non standard specimens. The tests were performed in a cryogenic dynamic test facility under helium gas environment between 7 K and 20 K. Using the reference growth laws obtained from these measurements the total crack propagation starting with the initial crack length of the specimen could be predicted by numerical computation
2010-07-01
..., and fax number of the health care provider and type of medical practice/specialization; (2) The... nature of any other work restrictions, and the likely duration of such inability (see § 825.123(b) and (c...
Nuclear waste package design for the Vadose zone in tuff
International Nuclear Information System (INIS)
O'Neal, W.C.; Ballou, L.B.; Gregg, D.W.; Russell, E.W.
1984-02-01
This report presents an overview of the selection and analysis of conceptual waste package designs that will be used by the Nevada Nuclear Waste Storage Investigations (NNWSI) project for disposal of high-level nuclear waste (HLW) at the proposed Yucca Mountain, Nevada Site. The design requirements that the waste packages are required to meet are listed. Concept drawings for the reference designs and one alternative package design are shown. Four metal alloys; 304L SS, 321 SS, 316L SS and Incoloy 825 have been selected for candidate canister/overpack materials, and 1020 carbon steel has been selected as the reference metal for the borehole liners. A summary of the results of technical and economic analysis supporting the selection of the conceptual waste package designs is included. Post-closure containment and release rates are not discussed in this paper. 17 references, 2 figures, 2 tables
29 CFR 825.604 - Special rules for school employees, restoration to “an equivalent position.”
2010-07-01
... employee to “an equivalent position” must provide substantially the same protections as provided in the Act... 29 Labor 3 2010-07-01 2010-07-01 false Special rules for school employees, restoration to âan... to Employees of Schools § 825.604 Special rules for school employees, restoration to “an equivalent...
Creep properties of heat-resistant superalloys for nuclear plants in helium
International Nuclear Information System (INIS)
Shimizu, Shigeki; Satoh, Keisuke; Matsuda, Shozo; Murase, Hirokazu; Fujioka, Junzo.
1979-01-01
In order to estimate the creep and rupture strengths of candidate alloys for the intermediate heat exchanger of VHTR, creep and stress rupture tests in impure helium were conducted on Hastelloy X, Inconel 617, Inconel 625, Incoloy 800 and Incoloy 807 at 900 0 C. The results were discussed in comparison with those in air and the alloys were examined from the point of view of the elevated temperature structural design. The main results obtained are summarized as follows: (1) No appreciable decrease in creep and rupture strengths in helium as compared with those in air is observed on Hastelloy X and Inconel 625. On the contrary, the creep and rupture strengths of Inconel 617 in helium decrease slightly as compared with those in air. In the case of Incoloy 807, the creep strength to cause 1 percent total strain and that to initiate secondary creep increase remarkably in helium as compared with those in air. However, the creep strength to cause initiation of tertiary creep and the rupture strength in helium remarkably decrease as compared with those in air. (2) The order of magnitude of the S 0 value for each material in helium is as follows; Hastelloy X > Inconel 617 > Incoloy 807 > Inconel 625 > Incoloy 800 Meanwhile, that of the S sub(t) value in helium is; Inconel 617 > Hastelloy X > Incoloy 807 > Inconel 625 > Incoloy 800. (author)
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Authentication and clarification of medical certification... ACT OF 1993 Employee and Employer Rights and Obligations Under the Act § 825.307 Authentication and... authentication. If an employee submits a complete and sufficient certification signed by the health care provider...
2010-07-01
...) of the health care provider, the type of medical practice, the medical specialty, and whether the... illness for which the current need for leave exists. An employer may seek authentication and/or... authentication and clarification of the ITO or ITA under § 825.307. An employer may not utilize the second or...
Λ, Σ0 and Y* inclusive reaction in K-p interactions at 8.25 GeV/c
International Nuclear Information System (INIS)
Baubillier, M.; Levy, F.; Rivoal, M.
1978-01-01
A study of inclusive Λ production in a bubble chamber K - p experiment at 8.25 GeV/c (present sensitivity about 50 evts/μb) is reported. A comparison with Σ 0 and Y* inclusive production is made. The inclusive Λ production is studied in the frame-work of the triple-Regge model
Directory of Open Access Journals (Sweden)
Wenzel Rene R
2003-06-01
Full Text Available Abstract Background A C825T polymorphism was recently identified in the gene encoding the β3 subunit of heterotrimeric G-proteins (GNB3. The T-allele is significantly associated with essential hypertension and obesity. In order to further explore a possible pathogenetic link between the T-allele and impaired glucose tolerance we studied metabolic and haemodynamic responses to oral glucose loading in young, healthy subjects with and without the 825T-allele. Methods Twelve subjects with and 10 without the 825T-allele were investigated at rest and following glucose ingestion (75 g. Blood glucose, serum insulin and haemodynamics were determined prior to and over 2 hours following glucose ingestion. We non-invasively measured stroke volume (SV, by impedance-cardiography, blood pressure (BP, heart rate (HR, and systolic-time-intervals. Cardiac output (CO was calculated from HR and SV. Total peripheral resistance was calculated from CO and BP. Metabolic and haemodynamic changes were quantified by maximal responses and by calculation of areas under the concentration time profile (AUC. Significances of differences between subjects with and without the T-allele were determined by unpaired two-tailed t-tests. A p Results Metabolic and haemodynamic parameters at baseline were very similar between both groups. The presence of the T-allele did not alter the response of any metabolic or haemodynamic parameter to glucose loading. Conclusions In conclusion, this study does not support the hypothesis that the C825T polymorphism may serve as a genetic marker of early impaired glucose tolerance.
Review of waste package verification tests. Semiannual report, April 1985-September 1985
International Nuclear Information System (INIS)
Soo, P.
1986-01-01
Several studies were completed this period to evaluate experimental and analytical methodologies being used in the DOE waste package program. The first involves a determination of the relevance of the test conditions being used by DOE to characterize waste package component behavior in a salt repository system. Another study focuses on the testing conditions and procedures used to measure radionuclide solubility and colloid formation in repository groundwaters. An attempt was also made to evaluate the adequacy of selected waste package performance codes. However, the latter work was limited by an inability to obtain several codes from DOE. Nevertheless, it was possible to comment briefly on the structures and intents of the codes based on publications in the open literature. The final study involved an experimental program to determine the likelihood of stress-corrosion cracking of austenitic stainless steels and Incoloy 825 in simulated tuff repository environments. Tests for six-month exposure periods in water and air-steam conditions are described. 52 figs., 48 tabs
2010-07-01
... multiple family members with the same level of relationship to the covered servicemember, all such family... law.” See § 825.127(b)(2). (j) Documenting relationships. For purposes of confirmation of family relationship, the employer may require the employee giving notice of the need for leave to provide reasonable...
International Nuclear Information System (INIS)
Lucan, D.; Fulger, M.; Savu, G.; Velciu, L.
2004-01-01
Steam generators (SGs) are crucial components of pressurized water reactors. The failure of the steam generator as a result of tube degradation by corrosion has been a major cause of Pressurized Water Reactor (PWR) plant unavailability. Steam generator problems have caused major economic losses in terms of lost electricity production through forced unit outages and, in cases of extreme damage, as additional direct cost for large-scale repair or replacement of steam generators. Steam generator tubes are susceptible to failure by a variety of mechanisms, the vast majority of which are related a corrosion. The feedwater that enters into the steam generators under normal operating conditions is extremely pure, but nevertheless contains low levels (generally in the μg/l concentration range) of impurities such as iron, chloride, sulphate, silicate, etc. When water is converted to steam and exits the steam generator, the non-volatile impurities are left behind. As a result, their concentration in the bulk steam generator water is considerably higher than those in the feedwater. Nevertheless, the concentrations of corrosive impurities are still generally sufficiently low that the bulk water is not significantly aggressive towards steam generator materials. The excellent performance to date of CANDU steam generators can be attributed, in part, to their design and performance characteristics, which typically involve higher recirculation ratios and lower heat fluxes and temperatures. The purpose of this paper consists in assessment of generalized corrosion behaviour of the tubes materials (Incoloy-800) and tubesheet material (carbon steel SA 508 cl.2) at the normal secondary circuit parameters (temperature-260 deg C, pressure-5.1MPa). The testing environment was the demineralized water without impurities, at pH=9.5 regulated with morpholine and ciclohexilamine (all volatile treatment - AVT). The results are presented like micrographies and graphics representing loss of metal
Directory of Open Access Journals (Sweden)
Prystupa L.N.
2015-09-01
Full Text Available The aim of the study was to investigate the frequency of genotypes of C825T polymorphism G-protein β3-subunit gene (GNB3 in patients with arterial hypertension (AH, depending on body mass index (BMI. The study involved 155 patients with verified diagnosis of AH (study group and 50 healthy individuals (control group. The patients of the main group were divided into 3 groups according to BMI: I - 35 patients with normal body weight, II - 38 patients with overweight, III - 82 patients with obesity. We used general clinical, anthropometric, instrumental, molecular-genetic and statistical methods. Probability of differences in the frequency of alleles and genotypes was determined using χ² criteria. Pairwise comparison of groups was made using nonparametric Mann-Whitney test. The difference was considered statistically significant at p <0,05. Investigation of the distribution of genotypes C825T polymorphism GNB3 in patients with AH according to BMI showed statistically significant increase in the frequency of genotypes C / T and T / T and T allele in patients with overweight and obesity as compared with patients with normal body weight (χ² = 26 8; p <0.001. The risk of weight increase in AH patients with T allele carriers is 2,2 times higher than in C allele carriers. Association of C825T polymorphism of GNB3 with a tendency to obesity and overweight in patients with AH was proved.
Comparison of the reactions $K^{\\pm} p \\rightarrow Q^{\\pm} p$ at incident momentum 8.25 GeV/c
Stergiou, Athanase; Dallman, David Peter; Drijard, Daniel; Dunwoodie, W M; Fry, John R; Goldschmidt-Clermont, Yves; Grard, F; Henri, Victor P; Heughebaert, J; Markytan, Manfred; Matthews, Robert; Michaelidis, P; Muirhead, William Hugh; Peeters, P; Quinquard, J; Simopoulou, Errietta; Sotiriou, D; Strauss, Josef; Tsilimigras, Panayiotis; Vayaki, Anna; Verbeure, Frans; Windmolders, R
1976-01-01
A comparison of the general features of the reactions K/sup +or-/P to Q/sup +or-/p at incident momentum 8.25 GeV/c is presented. The relevant data derive from events yielding four-constraint fits to the reactions K/sup +or-/p to K/sup +or-/ pi /sup +/ pi /sup -/p in exposures of the CERN 2 m HBC to RF-separated K/sup +/ and K/sup -/ beams. The (K pi pi ) effective mass distributions, producing angular distributions in the Q region (1.2
Nickel-plating for active metal dissolution resistance in molten fluoride salts
Energy Technology Data Exchange (ETDEWEB)
Olson, Luke [Department of Engineering Physics, 1500 Engineering Drive, University of Wisconsin, Madison, WI 53706 (United States); Sridharan, Kumar, E-mail: kumar@engr.wisc.edu [Department of Engineering Physics, 1500 Engineering Drive, University of Wisconsin, Madison, WI 53706 (United States); Anderson, Mark; Allen, Todd [Department of Engineering Physics, 1500 Engineering Drive, University of Wisconsin, Madison, WI 53706 (United States)
2011-04-15
Ni electroplating of Incoloy-800H was investigated with the goal of mitigating Cr dissolution from this alloy into molten 46.5%LiF-11.5%NaF-42%KF eutectic salt, commonly referred to as FLiNaK. Tests were conducted in graphite crucibles at a molten salt temperature of 850 deg. C. The crucible material graphite accelerates the corrosion process due to the large activity difference between the graphite and the alloy. For the purposes of providing a baseline for this study, un-plated Incoloy-800H and a nearly pure Ni-alloy, Ni-201 were also tested. Results indicate that Ni-plating has the potential to significantly improve the corrosion resistance of Incoloy-800H in molten fluoride salts. Diffusion of Cr from the alloy through the Ni-plating does occur and if the Ni-plating is thin enough this Cr eventually dissolves into the molten salt. The post-corrosion test microstructure of the Ni-plating, particularly void formation was also observed to depend on the plating thickness. Diffusion anneals in a helium environment of Ni-plated Incoloy-800H and an Fe-Ni-Cr model alloy were also investigated to understand Cr diffusion through the Ni-plating. Further enhancements in the efficacy of the Ni-plating as a protective barrier against Cr dissolution from the alloy into molten fluoride salts can be achieved by thermally forming a Cr{sub 2}O{sub 3} barrier film on the surface of the alloy prior to Ni electroplating.
Corrosion of high Ni-Cr alloys and Type 304L stainless steel in HNO3-HF
International Nuclear Information System (INIS)
Ondrejcin, R.S.; McLaughlin, B.D.
1980-04-01
Nineteen alloys were evaluated as possible materials of construction for steam heating coils, the dissolver vessel, and the off-gas system of proposed facilities to process thorium and uranium fuels. Commercially available alloys were found that are satisfactory for all applications. With thorium fuel, which requires HNO 3 -HF for dissolution, the best alloy for service at 130 0 C when complexing agents for fluoride are used is Inconel 690; with no complexing agents at 130 0 C, Inconel 671 is best. At 95 0 C, six other alloys tested would be adequate: Haynes 25, Ferralium, Inconel 625, Type 304L stainless steel, Incoloy 825, and Haynes 20 (in order of decreasing preference); based on composition, six untested alloys would also be adequate. The ions most effective in reducing fluoride corrosion were the complexing agents Zr 4+ and Th 4+ ; Al 3+ was less effective. With uranium fuel, modestly priced Type 304L stainless steel is adequate. Corrosion will be most severe in HNO 3 -HF used occasionally for flushing and in solutions of HNO 3 and corrosion products (ferric and dichromate ions). HF corrosion can be minimized by complexing the fluoride ion and by passivation of the steel with strong nitric acid. Corrosion caused by corrosion products can be minimized by operating at lower temperatures
Review of waste package verification tests. Semiannual report, October 1984-March 1985
International Nuclear Information System (INIS)
Soo, P.
1985-07-01
The potential of WAPPA, a second-generation waste package system code, to meet the needs of the regulatory community is analyzed. The analysis includes an indepth review of WAPPA's individual process models and a review of WAPPA's operation. It is concluded that the code is of limited use to the NRC in the present form. Recommendations for future improvement, usage, and implementation of the code are given. This report also describes the results of a testing program undertaken to determine the chemical environment that will be present near a high-level waste package emplaced in a basalt repository. For this purpose, low carbon 1020 steel (a current BWIP reference container material), synthetic basaltic groundwater and a mixture of bentonite and basalt were exposed, in an autoclave, to expected conditions some period after repository sealing (150 0 C, approx. =10.4 MPa). Parameters measured include changes in gas pressure with time and gas composition, variation in dissolved oxygen (DO), pH and certain ionic concentrations of water in the packing material across an imposed thermal gradient, mineralogic alteration of the basalt/bentonite mixture, and carbon steel corrosion behavior. A second testing program was also initiated to check the likelihood of stress corrosion cracking of austenitic stainless steels and Incoloy 825 which are being considered for use as waste container materials in the tuff repository program. 82 refs., 70 figs., 27 tabs
Compatibility of heat resistant alloys with boron carbide, 5
International Nuclear Information System (INIS)
Baba, Shinichi; Kurasawa, Toshimasa; Endow, Taichi; Someya, Hiroyuki; Tanaka, Isao.
1986-08-01
This paper includes an experimental result of out-of-pile compatibility and capsule design for irradiation test in Japan Materials Testing Reactor (JMTR). The compatibility between sheath material and neutron absorber materials for control rod devices (CRD) was examined for potential use in a very high temperature reactor (VHTR) which is under development at JAERI. The purpose of the compatibility tests are preliminary evaluation of safety prior to irradiation tests. Preliminary compatibility evaluation was concerned with three items as follows : 1) Lithium effects on the penetrating reaction of Incoloy 800H alloy in contact with a mixture of boronated graphite and lithium hydroxide powders, 2) Short term tensile properties of Incoloy 800H and Hastelloy XR alloy reacted with boronated graphite and fracture mode analysis, 3) Reaction behavior of both alloys under transient power conditions of a VHTR. It was clear that the reaction rate constant of the Incoloy 800H alloy was accelerated by doping lithium hydroxide into the boron carbide and graphite powder. The mechanical properties of Incoloy 800H and Hastelloy XR alloy reacted with boronated graphite were decreased. Ultimate tensile strength and tensile ductilities at temperatures over 850 deg C were reduced, but there was no change in the proof (yield) stress. Both alloys exhibited a brittle intergranular fracture mode during transient power conditions of a VHTR and also exhibited severe penetration. Irradiation capsules for compatibility test were designed to simulate three irradiation conditions of VHTR: 1) steady state for VHTR, 2) Transient power condition, 3) Service limited life of CRD. Capsule irradiation experiments have been carried out satisfactorily and thus confirm the validity of the capsule design procedure. (author)
Creep properties of superalloys for the HTGR in impure helium environments
International Nuclear Information System (INIS)
Kawakami, H.; Nakanishi, T.
1981-01-01
This paper describes creep behaviors of two heat resistant alloys, Hastelloy X and Incoloy 800, in helium environments of the HTGR. In impure helium environments, these alloys are susceptible to carburization and oxidization. We have investigated these effects separately, and related them to the creep behaviors of the alloys. Experiments were carried out at 900 0 C both in helium and in air. Carburization results in decrease of secondary creep strain rate and delay of tertiary creep initiation. Oxidization caused decrease in tertiary creep strain rate of Hastelloy X, but did not that of Incoloy 800. Enhancement in tertiary creep strain rate of Hastelloy X in a very weakly oxidizing environment was confirmed in creep crack growth experiment using notched plate specimens. The rupture time of Hastelloy X in helium was short when compared with in air. Stress versus rupture time curves for both environments were parallel up to 5000 hours test, and a ratio of rupture stress in helium to that in air was about 0.9. In case of Incoloy 800, rupture time in helium was markedly prolonged as compared with that in air. (orig.)
International Nuclear Information System (INIS)
Dunn, D.S.; Sridhar, N.; Cragnolino, G.A.
1995-01-01
Effects of the chromium-depleted, mill-finished surface on the localized corrosion resistance of alloy 825 (UNS N08825) were investigated. Tests were conducted in solutions based on the ground water at Yucca mountain, Nevada, but with a higher concentration of chloride. Results indicated that breakdown (E p ) and repassivation (E rp ) potentials for mill-finished surfaces were more active than those for polished surfaces. Potentiodynamic polarization tests indicated pits could be initiated on the chromium-depleted surface at potentials of 220 mV SCE in a solution containing 1,000 ppm Cl - at 95 C. Potentiostatic tests identified a similar pit initiation potential for the mill-finished surface. However, under longterm potentiostatic tests, a higher potential of 300 mV SCE was needed to sustain stable pit growth beyond the chromium-depleted layer. An increase in surface roughness also was observed to decrease localized corrosion resistance of the material
Wilms, E; Gerritsen, J; Smidt, H; Besseling-van der Vaart, I; Rijkers, G T; Garcia Fuentes, A R; Masclee, A A M; Troost, F J
2016-01-01
Probiotics, prebiotics and synbiotics have been suggested as dietary strategies to improve intestinal barrier function. This study aimed to assess the effect of two weeks synbiotic supplementation on intestinal permeability under basal and stressed conditions. Secondary aims were the assessment of two weeks synbiotic supplementation on systemic immune function and gastrointestinal symptoms including defecation pattern. Twenty healthy adults completed a double-blind, controlled, randomized, parallel design study. Groups either received synbiotic (1.5 × 1010 CFU Ecologic® 825 + 10 g fructo-oligosaccharides (FOS P6) per day) or control supplements for two weeks. Intestinal segment specific permeability was assessed non-invasively by oral administration of multiple sugar probes and, subsequently, assessing the excretion of these probes in urine. This test was conducted at baseline and at the end of intervention, in the absence and in the presence of an indomethacin challenge. Indomethacin was applied to induce a compromised gut state. Plasma zonulin, cytokines and chemokines were measured at baseline and at the end of intervention. Gastrointestinal symptoms and stool frequency were recorded at baseline and daily during intervention. Significantly more male subjects were in the synbiotic group compared to the control group (P = 0.025). Indomethacin significantly increased urinary lactulose/rhamnose ratio versus without indomethacin, both in the control group (P = 0.005) and in the synbiotic group (P = 0.017). Urinary sugar recoveries and ratios, plasma levels of zonulin, cytokines and chemokines, and gastrointestinal symptom scores were not significantly different after control or synbiotic intervention. Stool frequency within the synbiotic group was significantly increased during synbiotic intervention compared to baseline (P = 0.039) and higher compared to control intervention (P = 0.045). Two weeks Ecologic® 825/FOS P6 supplementation increased stool frequency
Chen, M Q; Cheng, W B; Xu, H F; Cai, Y S; Fan, L R; Zhong, F; Chen, X; Jin, W; Chen, X B; Li, J Y
2016-11-06
Objective: To explore prevalence and predictors of the use of Rush poppers among men who have sex with men in education in Guangdong Province. Methods: An internet survey was conducted via a gay website from March to August 2014 and a sample of 833 male respondents over 16 years who had ever had anal sex with a male, studied in Guangdong Province and who had completed an online questionnaire was identified- of which 93.4% ( n =825) provided valid responses and were included in the study. Respondents provided information on their socio-demographic characteristics, HIV testing history, sexual activity in last 3 months, Rush poppers use and time since first sexual encounter with a male. We used the Chi-squared test and multivariate logistic regression modeling to identify the predictors of Rush poppers use in this population group. Results: Among our sample of 825 MSM, whose ages ranged from 21-27 years, 14.8% ( n =122) reported having used Rush poppers in the past 3 months. Rates of use were higher among those who had ever been tested for HIV (16.7% vs. 10.9%, χ 2 =4.80, P= 0.028), had anal intercourse in the last 3 months (16.8% vs. 10.7%, χ 2 =5.48, P= 0.019), had multiple sexual partners in the past 3 months (19.3% vs. 13.1%, χ 2 =5.14, P= 0.023), had a casual partner (18.0% vs. 12.1%, χ 2 =5.68, P= 0.017) or had a sexually transmitted infection (23.4% vs. 14.0%, χ 2 =4.85, P= 0.028). Those who reported having had their first sexual encounter with another male over 5 years prior had higher rates of use (18.0%) than for those who had been sexually active ≤1 year (10.7%) or 2-4 years (12.5%, χ 2 =6.41, P= 0.041). HIV testing ( OR : 1.70, 95% CI: 1.07-2.70), having a casual partner ( OR : 1.67, 95% CI: 1.12-2.50) and being sexually active with other males for over 5 years ( OR : 1.87, 95% CI: 1.05-3.31) were significantly associated with Rush poppers use. Conclusion: A large proportion of student MSM in Guangdong Province used Rush poppers. Proxy measures of
Effect of a helium environment on the mechanical properties of HTGR primary system metals
International Nuclear Information System (INIS)
Chow, J.G.Y.; Soo, P.; Sabatini, R.L.
1978-01-01
Creep and high cycle fatigue tests have been carried out on Incoloy 800H and Hastelloy X in a helium environment containing 40 μ atm of H 2 O, 200 μ atm H 2 , 40 μ atm CO, 20 μ atm CH 4 and 10 μ atm CO 2 . The creep behavior of Incoloy 800H does not appear to show significant differences from that measured in air. However, the Hastelloy X at the maximum test temperature studied (871 0 C, 1600 0 F) shows behavior which is inferior. With respect to high cycle fatigue, the Incoloy 800H is weaker in the helium environment at a test temperature of 649 0 C (1200 0 F). At 760 0 C (1400 0 F) the strength in helium is higher but there is a tendency to lose strength more rapidly than for the air tests as the test time increases. Hastelloy X tested at 871 0 C (1600 0 F) also shows higher strength in helium for short test times but for extended tests the strengths in air and helium become similar. Scanning electron microprobe analyses have been carried out to correlate the strength measurements with surface oxidation characteristics and internal structural changes
[Update of a database on plants involved in the composition of 825 drugs: Pharmaplantes-Kénitra 98].
Choulli, M K; Quyou, A; Ait Aguil, F; Rmouch, H
1999-01-01
The main objective of this work lies in the setting up of a database on plants used in medicines which is aimed at pharmacological development of plant resources in Morocco. We have, as a first step, made an inventory of different plant species involved in medicine making in Morocco. This survey dealt with 825 miscellaneous pharmaceutical products and reveals the use of 445 different plant species in medicine making. For each plant species, we have also noted the parts of the plant which are used in the pharmaceutical industry. Furthermore, we have taken an interest in plant extracts involved in this medicine making. The results show that in all these medicines contain 46 extracts of a vegetal nature. At the top of the list, menthol is used in the manufacture of 110 pharmaceutical products. Finally, an analysis per pharmaco-therapeutic family reveals the impact of the involvement of these plants on each of these families. In fact, it turns out that 204 plant species play a part in medicines classified in the family of gastro-entero-hepatology whereas only one plant is involved in anti-inflammatory medicines.
Use of ferritic steels in breeder reactors worldwide
International Nuclear Information System (INIS)
Patriarca, P.
1983-01-01
The performance of LMFBR reactor steam generator materials is reviewed. Tensile properties of stainless steel-304, stainless steel-316, chromium-molybdenum steels, and Incoloy 800H are presented for elevated temperatures
Wilms, E.; Gerritsen, J.; Smidt, H.; Besseling-van der Vaart, I.; Rijkers, G. T.; Garcia Fuentes, A. R.; Masclee, A. A. M.; Troost, F. J.
2016-01-01
Background and Aims Probiotics, prebiotics and synbiotics have been suggested as dietary strategies to improve intestinal barrier function. This study aimed to assess the effect of two weeks synbiotic supplementation on intestinal permeability under basal and stressed conditions. Secondary aims were the assessment of two weeks synbiotic supplementation on systemic immune function and gastrointestinal symptoms including defecation pattern. Design Twenty healthy adults completed a double-blind, controlled, randomized, parallel design study. Intervention Groups either received synbiotic (1.5 × 1010 CFU Ecologic® 825 + 10 g fructo-oligosaccharides (FOS P6) per day) or control supplements for two weeks. Outcomes Intestinal segment specific permeability was assessed non-invasively by oral administration of multiple sugar probes and, subsequently, assessing the excretion of these probes in urine. This test was conducted at baseline and at the end of intervention, in the absence and in the presence of an indomethacin challenge. Indomethacin was applied to induce a compromised gut state. Plasma zonulin, cytokines and chemokines were measured at baseline and at the end of intervention. Gastrointestinal symptoms and stool frequency were recorded at baseline and daily during intervention. Results Significantly more male subjects were in the synbiotic group compared to the control group (P = 0.025). Indomethacin significantly increased urinary lactulose/rhamnose ratio versus without indomethacin, both in the control group (P = 0.005) and in the synbiotic group (P = 0.017). Urinary sugar recoveries and ratios, plasma levels of zonulin, cytokines and chemokines, and gastrointestinal symptom scores were not significantly different after control or synbiotic intervention. Stool frequency within the synbiotic group was significantly increased during synbiotic intervention compared to baseline (P = 0.039) and higher compared to control intervention (P = 0.045). Conclusion Two weeks
Directory of Open Access Journals (Sweden)
E Wilms
Full Text Available Probiotics, prebiotics and synbiotics have been suggested as dietary strategies to improve intestinal barrier function. This study aimed to assess the effect of two weeks synbiotic supplementation on intestinal permeability under basal and stressed conditions. Secondary aims were the assessment of two weeks synbiotic supplementation on systemic immune function and gastrointestinal symptoms including defecation pattern.Twenty healthy adults completed a double-blind, controlled, randomized, parallel design study.Groups either received synbiotic (1.5 × 1010 CFU Ecologic® 825 + 10 g fructo-oligosaccharides (FOS P6 per day or control supplements for two weeks.Intestinal segment specific permeability was assessed non-invasively by oral administration of multiple sugar probes and, subsequently, assessing the excretion of these probes in urine. This test was conducted at baseline and at the end of intervention, in the absence and in the presence of an indomethacin challenge. Indomethacin was applied to induce a compromised gut state. Plasma zonulin, cytokines and chemokines were measured at baseline and at the end of intervention. Gastrointestinal symptoms and stool frequency were recorded at baseline and daily during intervention.Significantly more male subjects were in the synbiotic group compared to the control group (P = 0.025. Indomethacin significantly increased urinary lactulose/rhamnose ratio versus without indomethacin, both in the control group (P = 0.005 and in the synbiotic group (P = 0.017. Urinary sugar recoveries and ratios, plasma levels of zonulin, cytokines and chemokines, and gastrointestinal symptom scores were not significantly different after control or synbiotic intervention. Stool frequency within the synbiotic group was significantly increased during synbiotic intervention compared to baseline (P = 0.039 and higher compared to control intervention (P = 0.045.Two weeks Ecologic® 825/FOS P6 supplementation increased stool
Study of Kπ and Nπ systems in the K+n→KπN reaction at 8.25GeV/c
International Nuclear Information System (INIS)
Vignaud, Daniel.
1976-10-01
The reaction K + n→KπN is studied at 8.25GeV/c from a 25000 picture exposure to the CERN 2m deuterium bubble chamber. The main results concern the channel K + n→K + π - p for which data at 4.6 and 12 GeV/c are also available. The K + π - system is dominated by K*(892) and K*(1420) which are studied separately. A partial wave analysis is performed for K + π - effective mass smaller than 1,6 GeV. This analysis shows an important S wave contribution which is smooth and broad and peaks around 1250 MeV. However a small narrower peak around 1350 MeV cannot be excluded. The pπ - system shows a wide bump at threshold. The properties of this bump are mainly diffractive. It is globally interpreted by a reggeised Deck model with π exchange but the data show that nucleon exchange must be considered for a complete interpretation of the phenomenon. An s-channel analysis is also discussed [fr
Properties of super alloys for high temperature gas cooled reactor
International Nuclear Information System (INIS)
Izaki, Takashi; Nakai, Yasuo; Shimizu, Shigeki; Murakami, Takashi
1975-01-01
The existing data on the properties at high temperature in helium gas of iron base super alloys. Incoloy-800, -802 and -807, nickel base super alloys, Hastelloy-X, Inconel-600, -617 and -625, and a casting alloy HK-40 were collectively evaluated from the viewpoint of the selection of material for HTGRs. These properties include corrosion resistance, strength and toughness, weldability, tube making, formability, radioactivation, etc. Creep strength was specially studied, taking into consideration the data on the creep characteristics in the actual helium gas atmosphere. The necessity of further long run creep data is suggested. Hastelloy-X has completely stable corrosion resistance at high temperature in helium gas. Incoloy 800 and 807 and Inconel 617 are not preferable in view of corrosion resistance. The creep strength of Inconel 617 extraporated to 1,000 deg C for 100,000 hours in air was the greatest rupture strength of 0.6 kg/mm 2 in all above alloys. However, its strength in helium gas began to fall during a relatively short time, so that its creep strength must be re-evaluated in the use for long time. The radioactivation and separation of oxide film in primary construction materials came into question, Inconel 617 and Incoloy 807 showed high induced radioactivity intensity. Generally speaking, in case of nickel base alloys such as Hastelloy-X, oxide film is difficult to break away. (Iwakiri, K.)
Long range plan for flexible joint development program
International Nuclear Information System (INIS)
Objective is to develop bellows expansion joints into CDS and subsequent LMFBR and liquid metal applications. An assessment was performed on the use of Incoloy 800H and Inconel 718 as bellows materials
Wonnabussapawich, Preetiwat; Hamlin, Michael J; Lizamore, Catherine A; Manimmanakorn, Nuttaset; Leelayuwat, Naruemon; Tunkamnerdthai, Orathai; Thuwakum, Worrawut; Manimmanakorn, Apiwan
2017-12-01
Wonnabussapawich, P, Hamlin, MJ, Lizamore, CA, Manimmanakorn, N, Leelayuwat, N, Tunkamnerdthai, O, Thuwakum, W, and Manimmanakorn, A. Living and training at 825 m for 8 weeks supplemented with intermittent hypoxic training at 3,000 m improves blood parameters and running performance. J Strength Cond Res 31(12): 3287-3294, 2017-We aimed to investigate the effect of an 8-week low-altitude training block supplemented with intermittent hypoxic training, on blood and performance parameters in soccer players. Forty university-level male soccer players were separated into altitude (n = 20, 825 m) or sea-level (n = 20, 125 m) groups. Before (1-2 days ago) and after (1 and 14 days later) training, players were asked to give a resting venous blood sample and complete a series of performance tests. Compared with sea level, the altitude group increased erythropoietin, red blood cell (RBC) count, and hematocrit 1 day after training (42.6 ± 24.0%, 1.8 ± 1.3%, 1.4 ± 1.1%, mean ± 95% confidence limits (CL), respectively). By 14 days after training, only RBC count and hemoglobin were substantially higher in the altitude compared with the sea-level group (3.2 ± 1.8%, 2.9 ± 2.1% respectively). Compared with sea level, the altitude group 1-2 days after training improved their 50-m (-2.9 ± 1.4%) and 2,800-m (-2.9 ± 4.4%) run times and demonstrated a higher maximal aerobic speed (4.7 ± 7.4%). These performance changes remained at 14 days after training with the addition of a likely higher estimated V[Combining Dot Above]O2max in the altitude compared with the sea-level group (3.2 ± 3.0%). Eight weeks of low-altitude training, supplemented with regular bouts of intermittent hypoxic training at higher altitude, produced beneficial performance improvements in team-sport athletes, which may increase the viability of such training to coaches and players that cannot access more traditional high altitude venues.
Effects of HTGR helium on the high cycle fatigue of structural materials
International Nuclear Information System (INIS)
Soo, P.; Sabatini, R.L.; Gerlach, L.
1982-01-01
High cycle fatigue tests have been conducted on Incoloy 800H and Hastelloy X in air and in HTGR helium environments containing low and high levels of moisture. For the helium environments, a higher mositure level usually gives a lower fatigue strength. For air, however, the strength is usually much lower than those for helium. For long test times at higher test temperatures, the fatigue strengths for Incoloy 800H often show a large decrease, and the fatigue limits are much lower than those anticipated from low cycle tests. Optical and scanning electron microscope observations were made to correlate fatigue life with surface and bulk microstructural changes in the material during test. Oxide scale cracking and spallation, surface recrystallization and intergranular attack appear to contribute to losses in fatigue strength
Creep properties of heat-resistant superalloys for nuclear plants in helium
International Nuclear Information System (INIS)
Shimizu, Shigeki; Satoh, Keisuke; Honda, Yoshio; Matsuda, Shozo; Murase, Hirokazu
1979-01-01
Creep properties of candidate superalloys for VHTR components in a helium environment at both temperatures of 800 0 C and 900 0 C were compared with those of the same alloys in the atmospheric condition, and the superalloys were contrasted with each other from the viewpoint of high temperature structural design. At 800 0 C, no significant effect of a helium environment on creep properties of the superalloys is observed. At 900 0 C, however, creep strength of Inconel 617, Incoloy 800 and Incoloy 807 in the helium environment decrease more than in the atmospheric environment. In Hastelloy X and Inconel 625, there is no significant difference between creep strengths in helium and those in the atmospheric condition. Concerning So and St values in helium at 900 0 C, Inconel 617 and Hastelloy X are clearly superior to other superalloys. (author)
International Nuclear Information System (INIS)
Cheal, Sarah M.; Lee, Sang-gyu; Punzalan, Blesida; Larson, Steven M.; Xu, Hong; Guo, Hong-fen; Chalasani, Sandhya; Carrasquillo, Jorge A.; Fung, Edward K.; Jungbluth, Achim; Zanzonico, Pat B.; O'Donoghue, Joseph; Smith-Jones, Peter M.; Wittrup, K.D.; Cheung, Nai-Kong V.
2016-01-01
GPA33 is a colorectal cancer (CRC) antigen with unique retention properties after huA33-mediated tumor targeting. We tested a pretargeted radioimmunotherapy (PRIT) approach for CRC using a tetravalent bispecific antibody with dual specificity for GPA33 tumor antigen and DOTA-Bn-(radiolanthanide metal) complex. PRIT was optimized in vivo by titrating sequential intravenous doses of huA33-C825, the dextran-based clearing agent, and the C825 haptens 177 Lu-or 86 Y-DOTA-Bn in mice bearing the SW1222 subcutaneous (s.c.) CRC xenograft model. Using optimized PRIT, therapeutic indices (TIs) for tumor radiation-absorbed dose of 73 (tumor/blood) and 12 (tumor/kidney) were achieved. Estimated absorbed doses (cGy/MBq) to tumor, blood, liver, spleen, and kidney for single-cycle PRIT were 65.8, 0.9 (TI 73), 6.3 (TI 10), 6.6 (TI 10), and 5.3 (TI 12), respectively. Two cycles of PRIT (66.6 or 111 MBq 177 Lu-DOTA-Bn) were safe and effective, with a complete response of established s.c. tumors (100 - 700 mm 3 ) in nine of nine mice, with two mice alive without recurrence at >140 days. Tumor log kill in this model was estimated to be 2.1 - 3.0 based on time to 500-mm 3 tumor recurrence. In addition, PRIT dosimetry/diagnosis was performed by PET imaging of the positron-emitting DOTA hapten 86 Y-DOTA-Bn. We have developed anti-GPA33 PRIT as a triple-step theranostic strategy for preclinical detection, dosimetry, and safe targeted radiotherapy of established human colorectal mouse xenografts. (orig.)
Cheal, Sarah M.; Xu, Hong; Guo, Hong-fen; Lee, Sang-gyu; Punzalan, Blesida; Chalasani, Sandhya; Fung, Edward K.; Jungbluth, Achim; Zanzonico, Pat B.; Carrasquillo, Jorge A.; O’Donoghue, Joseph; Smith-Jones, Peter M.; Wittrup, K. Dane; Cheung, Nai-Kong V.; Larson, Steven M.
2015-01-01
Purpose GPA33 is a colorectal cancer (CRC) antigen with unique retention properties after huA33-mediated tumor targeting. We tested a pre-targeted radioimmunotherapy (PRIT) approach for CRC using a tetravalent bispecific antibody with dual specificity for GPA33 tumor antigen and DOTA-Bn (radiolanthanide metal) complex. Methods PRIT was optimized in vivo by titrating sequential intravenous doses of huA33-C825, the dextran-based clearing agent (CA), and the C825-haptens 177Lu-or 86Y-DOTA-Bn in mice bearing the SW1222 subcutaneous (s.c.) CRC xenograft model. Results Using optimized PRIT, therapeutic indices (TIs) for tumor radiation absorbed dose of 73 (tumor/blood) and 12 (tumor/kidney) were achieved. Estimated absorbed doses (cGy/MBq) to tumor, blood, liver, spleen, and kidney for single-cycle PRIT were 65.8, 0.9 (TI: 73), 6.3 (TI: 10), 6.6 (TI: 10), and 5.3 (TI: 12), respectively. Two cycles of PRIT treatment (66.6 or 111 MBq 177Lu-DOTA-Bn) were safe and effective, with 9/9 complete responses of established s.c. tumors (100–700 mm3) and 2/9 alive without recurrence >140 d. Tumor log kill in this model was estimated to be 2.1–3.0 based time to 500-mm3 tumor recurrence. In addition, PRIT dosimetry/diagnosis was performed by PET imaging of the positron-emitting DOTA-hapten 86Y-DOTA-Bn. Conclusions We have developed anti-GPA33 PRIT, as a triple-step theranostic strategy for pre-clinical detection, dosimetry and safe targeted radiotherapy of established human colorectal mouse xenografts. PMID:26596724
International Nuclear Information System (INIS)
Zink, U.
1983-11-01
The coupling of H 2 -permeation and corrosion has been examined with the high-temperature alloys Incoloy 800 and Incoloy 802. Permeationsrates as well as corrosionsrates have been measured simultanously under H 2 O-H 2 atmospheres in the test-facility HD-PERM. Test parameters have been temperature and oxidationpotential. Parabolic laws for the growth of the oxide scales have been identified and are considered to be highly important for the efficiency of a permeation barrier. A comparison between the temperature dependencies of corrosionsrates and H 2 -permeationsrates has revealed that permeation and corrosion are coupled only in so far that the permeation barrier is formed by the corrosion reaction. The corrosion data (parabolic rate constant, activation energy) of the oxide scales have given clear indications for the existence of a Cr 2 O 3 -layer, which is considered to be responsible for efficient oxide permeation barriers. (orig.) [de
International Nuclear Information System (INIS)
Tilborg, P.J. van; Linde, A. van der
1969-10-01
Sheet samples of Inconel-625, Hastelloy-X280 and Incoloy-800 were tested, in the solution annealed and in the solution annealed + 20% cold worked + 800°C tempered condition, in steam with a velocity of 5 m/sec. at 550, 650 and 750°C and in steam with a volocity of 15 and 85 m/sec. at 550°C. At 550°C and 750°C the samples were tested in the heat treated, annealed or tempered and the heat treated + electropolished condition. At 650°C moreover as heat treated + ground and pickled samples were tested. Post-corrosion sample investigations involved measurement of the adherent oxide thickness, the total amount of corroded metal, the metal loss to system, and the metallographic and microprobe investigation of the adherent oxide film and adjacent diffusion disturbed alloy layer. The results obtained up to 6000 hours exposure time showed that the surface treatment has a decisive influence on the corrosion behaviour of all three alloys tested. The differences in the corrosion data for the two heat treatment conditions are small. The influence of the steam velocity, as tested at 550°C, on the initial corrosion rate was surprisingly high, while the long-term linear corrosion rates are only slightly influenced by the gas velocity. In general the linear corrosion rates were low, 1-5 mg/dm 2 month, and not consistently affected by the test-temperature. The metal loss to system values were 2 <15 mg/dm 2 in the low velocity steam at all three test temperatures and <30 mg/dm 2 in the high velocity steam at 550°C. The metallographic and microprobe examinations revealed no remarkable results, as compared with the results of analogous tests reported in literature. (author)
Energy Technology Data Exchange (ETDEWEB)
Cheal, Sarah M.; Lee, Sang-gyu; Punzalan, Blesida; Larson, Steven M. [Memorial Sloan Kettering Cancer Center, Department of Radiology, New York, NY (United States); Memorial Sloan Kettering Cancer Center, Molecular Pharmacology and Chemistry Program, New York, NY (United States); Xu, Hong; Guo, Hong-fen [Memorial Sloan Kettering Cancer Center, Department of Pediatrics, New York, NY (United States); Chalasani, Sandhya; Carrasquillo, Jorge A. [Memorial Sloan Kettering Cancer Center, Department of Radiology, New York, NY (United States); Fung, Edward K. [Memorial Sloan Kettering Cancer Center, Molecular Pharmacology and Chemistry Program, New York, NY (United States); Memorial Sloan Kettering Cancer Center, Department of Medical Physics, New York, NY (United States); Jungbluth, Achim [Memorial Sloan Kettering Cancer Center, Department of Pathology, New York, NY (United States); Zanzonico, Pat B.; O' Donoghue, Joseph [Memorial Sloan Kettering Cancer Center, Department of Medical Physics, New York, NY (United States); Smith-Jones, Peter M. [Stony Brook University, Department of Psychiatry and Behavioral Science, Stony Brook, NY (United States); Stony Brook University, Department of Radiology, Stony Brook, NY (United States); Wittrup, K.D. [Massachusetts Institute of Technology, Department of Chemical Engineering, Cambridge, MA (United States); Massachusetts Institute of Technology, Department of Biological Engineering, Cambridge, MA (United States); Massachusetts Institute of Technology, Koch Institute for Integrative Cancer Research, Cambridge, MA (United States); Cheung, Nai-Kong V. [Memorial Sloan Kettering Cancer Center, Molecular Pharmacology and Chemistry Program, New York, NY (United States); Memorial Sloan Kettering Cancer Center, Department of Pediatrics, New York, NY (United States)
2016-05-15
GPA33 is a colorectal cancer (CRC) antigen with unique retention properties after huA33-mediated tumor targeting. We tested a pretargeted radioimmunotherapy (PRIT) approach for CRC using a tetravalent bispecific antibody with dual specificity for GPA33 tumor antigen and DOTA-Bn-(radiolanthanide metal) complex. PRIT was optimized in vivo by titrating sequential intravenous doses of huA33-C825, the dextran-based clearing agent, and the C825 haptens {sup 177}Lu-or {sup 86}Y-DOTA-Bn in mice bearing the SW1222 subcutaneous (s.c.) CRC xenograft model. Using optimized PRIT, therapeutic indices (TIs) for tumor radiation-absorbed dose of 73 (tumor/blood) and 12 (tumor/kidney) were achieved. Estimated absorbed doses (cGy/MBq) to tumor, blood, liver, spleen, and kidney for single-cycle PRIT were 65.8, 0.9 (TI 73), 6.3 (TI 10), 6.6 (TI 10), and 5.3 (TI 12), respectively. Two cycles of PRIT (66.6 or 111 MBq {sup 177}Lu-DOTA-Bn) were safe and effective, with a complete response of established s.c. tumors (100 - 700 mm{sup 3}) in nine of nine mice, with two mice alive without recurrence at >140 days. Tumor log kill in this model was estimated to be 2.1 - 3.0 based on time to 500-mm{sup 3} tumor recurrence. In addition, PRIT dosimetry/diagnosis was performed by PET imaging of the positron-emitting DOTA hapten {sup 86}Y-DOTA-Bn. We have developed anti-GPA33 PRIT as a triple-step theranostic strategy for preclinical detection, dosimetry, and safe targeted radiotherapy of established human colorectal mouse xenografts. (orig.)
Nijhuis, Arend; Wessel, Wilhelm A.J.; Knoopers, H.G.; Ilyin, Y.; ten Kate, Herman H.J.; Della Corte, A.
2005-01-01
The large Cable-In-Conduit Conductors (CICC) designed for the magnet coils in the International Thermonuclear Experimental Reactor (ITER), are composed of Nb/sub 3/Sn strand bundles in a Stainless Steel (SS) or Incoloy conduit. Both, the thermal contraction of the strand composite and the conduit
International Nuclear Information System (INIS)
Moteff, J.
1977-01-01
Transmission electron microscopy used to evaluate the deformation (creep, fatigue and tensile) induced microstructure of 304 SS, Incoloy 800, 330 SS and three of the experimental alloys (E19, E23 and E36) obtained from the National Alloy Program clearly shows that the relationship between the subgrain size (lambda) and the applied stress (sigma) obeys the equation lambda = Ab (sigma/E) -1 where A is a constant of the order of 4, b the Burgers rector and E is Young's modulus. Hot-hardness studies on 304 SS, 316 SS, Incoloy 800, 2 1 / 4 Cr-1 Mo steels, 330 SS, Inconel 718, PE-16, Inconel 706, M-813 and the above three experimental alloys suggests that reasonable effective activation energies for creep may be obtained through the use of the hardness test as a strength microprobe tool. The ordering of the strength levels obtained through hot-hardness follows quite closely that obtained in tensile tests when those data are available
Residual stress measurement of the jacket material for ITER coil by neutron diffraction
Energy Technology Data Exchange (ETDEWEB)
Tsuchiya, Yoshinori [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment
1998-03-01
Nickel-Iron based super alloy INCOLOY 908 is used for the jacket of a central solenoid coil (CS coil) of the International Thermonuclear Experimental Reactor (ITER). INCOLOY 908, however, has a possibility of fracture due to Stress Accelerated Grain Boundary Oxidation (SAGBO) under a tensile residual stress beyond 200MPa. Therefore it is necessary to measure the residual stress of the jacket to avoid SAGBO. We performed residual stress measurement of the jacket by neutron diffraction using the neutron diffractometer for residual stress analysis (RESA) installed at JRR-3M in JAERI. A sample depth dependence of internal strain was obtained from the (111) plane spacing. A residual stress distribution was calculated from the strain using Young`s modulus and Poisson`s ratio that were evaluated by a tensile test with neutron diffraction. The result shows that the tensile residual stress exceeds 200MPa of the SAGBO condition in some regions inside the jacket. (author)
Langevoort, J.C.; Fransen, T.; Gellings, P.J.
1984-01-01
AISI 304, 314, 321, and Incoloy 800H have been subjected to several pretreatments: polishing, milling, grinding, and cold drawing. In the temperature range 800–1400 K, cold work improves the oxidation resistance of AISI 304 and 321 slightly, but has a relatively small negative effect on the
Contaminants in light water reactor coolants
International Nuclear Information System (INIS)
Michael, I.; Bechtold, G.
1975-01-01
At a lower oxygen content of the pressurized water a reduced metal loss by about 10% was detected. The state of oxidation for incoloy resulting from surface examination was 2,3 +- 0,3 which corresponds to Fe 3 O 4 and a smaller fraction of iron hydroxide. (orig.) [de
International Nuclear Information System (INIS)
Vignaud, D.; Ginestet, J.; Burlaud, D.; Sene, M.
1975-01-01
The fragmentation of the neutron into pπ - induced by incident K + of 8.25GeV/c is studied using data from the CERN 2m deuterium bubble chamber and compared with data at 4.6 and 12GeV/c. The pπ - low mass enhancement below 1.85GeV/c is analyzed and the major part exhibits the properties expected for diffraction dissociation. The presence of resonances is discussed. The data are fairly well represented by a double Regge exchange model involving pion and Pomeron exchanges. The violation of the s-channel and t-channel helicity conservation is observed and compared to the s-channel description of Humble [fr
Fransen, T.; Gellings, P.J.; Fuggle, J.C.; van der Laan, G.; Esteva, J.-M.; Karnatak, R.C.
1985-01-01
In this paper a study is reported concerning ceramic coatings containing cerium oxide, prepared by the sol-gel method, used to protect Incoloy 800H against sulphidation. When the coating is sintered in air at 850°C good protection is obtained. In an X-ray absorption spectroscopic study of the
Energy Technology Data Exchange (ETDEWEB)
McKimpson, Marvin G.
2006-04-06
This project was undertaken by Michigan Technological University and Special Metals Corporation to develop creep-resistant, coking-resistant oxide-dispersion-strengthened (ODS) tubes for use in industrial-scale ethylene pyrolysis and steam methane reforming operations. Ethylene pyrolysis tubes are exposed to some of the most severe service conditions for metallic materials found anywhere in the chemical process industries, including elevated temperatures, oxidizing atmospheres and high carbon potentials. During service, hard deposits of carbon (coke) build up on the inner wall of the tube, reducing heat transfer and restricting the flow of the hydrocarbon feedstocks. About every 20 to 60 days, the reactor must be taken off-line and decoked by burning out the accumulated carbon. This decoking costs on the order of $9 million per year per ethylene plant, accelerates tube degradation, and requires that tubes be replaced about every 5 years. The technology developed under this program seeks to reduce the energy and economic cost of coking by creating novel bimetallic tubes offering a combination of improved coking resistance, creep resistance and fabricability not available in current single-alloy tubes. The inner core of this tube consists of Incoloy(R) MA956, a commercial ferritic Fe-Cr-Al alloy offering a 50% reduction in coke buildup combined with improved carburization resistance. The outer sheath consists of a new material - oxide dispersion strengthened (ODS) Alloy 803(R) developed under the program. This new alloy retains the good fireside environmental resistance of Alloy 803, a commercial wrought alloy currently used for ethylene production, and provides an austenitic casing to alleviate the inherently-limited fabricability of the ferritic Incoloy(R) MA956 core. To provide mechanical compatibility between the two alloys and maximize creep resistance of the bimetallic tube, both the inner Incoloy(R) MA956 and the outer ODS Alloy 803 are oxide dispersion
Considerations in selecting tubing materials for CANDU steam generators
International Nuclear Information System (INIS)
Hemmings, R.L.
1978-01-01
Corrosion resistance is the major consideration in selecting tubing material for CANDU steam generators. Corrosion, and additional considerations, lead to the following steam generator tubing material recommendations: for CANDU-BPHWR's (boiling pressurized heavy water reactors) low-cobalt Incoloy-800; for CANDU-PHWR's (pressurized, non-boiling, heavy water reactors), low-cobalt Monel-400
Dhutia, Harshil; Malhotra, Aneil; Parpia, Sameer; Gabus, Vincent; Finocchiaro, Gherardo; Mellor, Greg; Merghani, Ahmed; Millar, Lynne; Narain, Rajay; Sheikh, Nabeel; Behr, Elijah R; Papadakis, Michael; Sharma, Sanjay
2016-01-01
The short QT syndrome is a cardiac channelopathy characterised by accelerated repolarisation which manifests as a short QT interval on the ECG. The definition of a short QT interval is debated, ranging from <390 to ≤320 ms, and its clinical significance in healthy young individuals is unknown. We assessed the prevalence and medium-term significance of an isolated short QT interval in a diverse young British population. Between 2005 and 2013, 18 825 apparently healthy people aged 14-35 years underwent cardiovascular evaluation with history, physical examination and ECG. QT intervals were measured by cardiologists using 4 recommended guidelines (Seattle 2013, Heart Rhythm Society 2013, European Society of Cardiology 2010 and American Heart Association 2009). The prevalence of a short QT interval was 0.1% (26 patients, ≤320 ms), 0.2% (44 patients, ≤330 ms), 7.9% (1478 patients, <380 ms), 15.8% (2973 patients, <390 ms). Male gender and Afro-Caribbean ethnicity had the strongest association with short QT intervals. Athletes had shorter QT intervals than non-athletes but athletic status did not predict short QT intervals. Individuals with short QT intervals ≤320 ms did not report syncope or a sinister family history, and during a follow-up period of 5.3±1.2 years, there were no deaths in this group. The prevalence of a short QT interval depends on the recommended cut-off value. Even at values ≤320 ms, there was an excellent medium-term prognosis among 14 people followed. We conclude that a definition of ≤320 ms is realistic to prevent overdiagnosis and excessive investigations. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/
International Nuclear Information System (INIS)
Busch, R.; Johnson, W.L.
1998-01-01
Viscosity and enthalpy relaxation from the amorphous state into the supercooled liquid state was investigated in the bulk metallic glass forming Zr 46.75 Ti 8.25 Cu 7.5 Ni 10 Be 27.5 alloy below the calorimetric glass transition. At different temperatures, the viscosities relax into states that obey the same Vogel endash Fulcher endash Tammann relation as the data obtained at higher temperatures in the supercooled liquid. Enthalpy recovery experiments after relaxation in the same temperature range show that the enthalpy of the material reaches values that also corresponds to the supercooled liquid state. The glass relaxes into a metastable supercooled liquid state, if it is observed on a long time scale. Equilibration is possible far below the calorimetric glass transition and very likely even below the isentropic temperature. copyright 1998 American Institute of Physics
Creep behavior of materials for high-temperature reactor application
International Nuclear Information System (INIS)
Schneider, K.; Hartnagel, W.; Iischner, B.; Schepp, P.
1984-01-01
Materials for high-temperature gas-cooled reactor (HTGR) application are selected according to their creep behavior. For two alloys--Incoloy-800 used for the live steam tubing of the thorium high-temperature reactor and Inconel-617 evaluated for tubings in advanced HTGRs--creep curves are measured and described by equations. A microstructural interpretation is given. An essential result is that nonstable microstructures determine the creep behavior
Chemical decontamination of reactor components
International Nuclear Information System (INIS)
Riess, R.; Berthold, H.O.
1977-08-01
A solution for the decontamination of reactor components of the primary system was developed. This solution is a modification of the APAC- (Alkaline Permanganate Ammonium Citrate) system described in the literature. The most important advantage of the present solution over the APAC-method is that it does not induce any selective corrosion attack on materials like stainless steel (austenitic), Inconel 600 and Incoloy 800. (orig.) [de
International Nuclear Information System (INIS)
Quinet, J.L.; Lannou, L.
1978-01-01
The results of a survey made Electricite de France on the behaviour of cracked tubes under operating conditions of an industrial steam generator are submitted in this communication. A comparison is made of the tube material: INCOLOY 800, 2 1/4 Cr-1 Mo, 9 Cr-2 Mo land to the initial leak. Finally, a description is given of the self-development process of a water leak into sodium. (author)
Some tests of explosion welding in Zry 4 - Zry 4 and other materials
International Nuclear Information System (INIS)
Badino, N.S.; Nashmias, J.L.
1993-01-01
The possibility of welding explosion for nuclear industry materials is studied. In this case, difficulties to join them by fusion welding are presented. The following pairs are selected: Zry 4-Zry 4, Zry 4-Incoloy, Zry 4-stainless steel, Zry 4-Inconel. Good results in Zry 4-Zry 4 and not so clear results are obtained in other cases. Other possible tests are now being studied and thought about. (Author)
De Ferrari, Aldo; Miranda, J Jaime; Gilman, Robert H; Dávila-Román, Victor G; León-Velarde, Fabiola; Rivera-Ch, Maria; Huicho, Luis; Bernabé-Ortiz, Antonio; Wise, Robert A; Checkley, William
2014-11-01
Excessive erythrocytosis (EE) is a prevalent condition in populations living at high altitudes (> 2,500 m above sea level). Few large population-based studies have explored the association between EE and multiple subject-specific traits including oxygen saturation, iron status indicators, and pulmonary function. We enrolled a sex-stratified and age-stratified sample of 1,065 high-altitude residents aged ≥ 35 years from Puno, Peru (3,825 m above sea level) and conducted a standardized questionnaire and physical examination that included spirometry, pulse oximetry, and a blood sample for multiple clinical markers. Our primary objectives were to estimate the prevalence of EE, characterize the clinical profile and iron status indicators of subjects with EE, and describe subject-specific traits associated with EE. Overall prevalence of EE was 4.5% (95% CI, 3.3%-6.0%). Oxygen saturation was significantly lower among EE than non-EE group subjects (85.3% vs 90.1%, P .09 for all values). In multivariable logistic regression, we found that age ≥ 65 years (OR = 2.45, 95% CI, 1.16-5.09), male sex (3.86, 1.78-9.08), having metabolic syndrome (2.66, 1.27-5.75) or being overweight (5.20, 1.95-16.77), pulse oximetry overweight (26.7%), followed by male sex (21.5%), pulse oximetry overweight or having metabolic syndrome were associated with an important fraction of cases in our study population.
Breneman, W. C.; Farrier, E. G.; Morihara, H.
1978-01-01
The presence of copper promotes a more rapid approach to the steady stete operating condition and results in a more consistent reactor effluent composition. The average kinetic and equilibrium yield are unchanged. Incoloy has been identified as the preferred choice of material of construction for the hydrogenation reactor although certain metallurgical changes were noted in samples exposed to the H2/HCl atmosphere at 500 C which indicate the need for more testing.
Corrosion problems of PWR steam generators
International Nuclear Information System (INIS)
Urbancik, L.; Kostal, M.
Literature data are assessed on corrosion failures of steam generator tubes made of INCONEL 600 or INCOLOY 800. It was found that both alloys with high nickel content showed good stability in a corrosion environment while being sensitive to carbide formation on grain boundaries. The gradual depletion of chromium results from the material and corrosion resistance deteriorates. INCOLOY 800 whose chromium carbide precipitation on grain boundaries in pure water and steam is negligible up to 75O degC and which is not subject to corrosion attacks in the above media and in an oxidizing environment at a temperature to about 700 degC shows the best corrosion resistance. Its favourable properties were tested in long-term operation in the Peach Bottom 1 nuclear power plant where no failures due to corrosion of this material have been recorded since 1967. In view of oxygenic-acid surface corrosion, it is necessary to work in a neutral or slightly basic environment should any one of the two alloys be used for steam generator construction. The results are summed up of an analysis conducted for the Beznau I NOK reactor. Water treatment with ash-free amines can be used as prevention against chemical corrosion mechanisms, although the treatment itself does not ensure corrosion resistance of steam generator key components. (J.B.)
Swelling in neutron irradiated nickel-base alloys
International Nuclear Information System (INIS)
Brager, H.R.; Bell, W.L.
1972-01-01
Inconel 625, Incoloy 800 and Hastelloy X were neutron irradiated at 500 to 700 0 C. It was found that of the three alloys investigated, Inconel 625 offers the greatest swelling resistance. The superior swelling resistance of Inconel 625 relative to that of Hastelloy-X is probably related to differences in the concentrations of the minor rather than major alloy constituents, and can involve (a) enhanced recombination of defects in the Inconel 625 and (b) preferential attraction of vacancies to incoherent precipitates. (U.S.)
Creep crack growth investigations for elevated temperature material application
International Nuclear Information System (INIS)
Krompholz, K.; Pierick, J.B.; Grosser, E.D.
1981-01-01
Creep crack growth data for the cast alloys IN-519 at 1123 K, Manaurite 36 X at 1123 K and 1173 K, and for the wrought alloys Incoloy 800 H and Inconel 617 at 1123 K, 1173 K, 1223 K, and 1273 K are reported. Up to 1273 K the crack lengths were measured by means of the potential drop technique. The data are plotted da/dt vs. net section stress. These results are compared with data on Inconel 617 analyzed according to stress intensity. (orig.)
Mechanisms of Recovering Low Cycle Fatigue Damage in Incoloy 901.
1979-01-01
ZAP. 0665 0374 19A% DATA : 19AE MPS 15 0666 2375 F2e4 JMP .IDF r e667 e376 9 110 LSI ZAP 668 e377 E2?E LOX F,12 ASSURE X- PEG !0SITIVE FOR LSI 0669 0378...NC(MC) 0( 3350 PRIN4T 22,N4TDELTELC(M),DLTPLC(MC,SIGC(MC)o , 03360 A~1~C..,TP(M.T~4l~lC) -003370 230 22 VORMAT (12, IT1,F6.5,T2,F6.5,T30,F7.2,T42
Proposed changes to Incoloy Alloy 800 and 800H specifications
International Nuclear Information System (INIS)
Bassford, T.H.; Rahoi, D.W.
1978-01-01
Preliminary results from an extensive investigation of Alloy 800 and 800H have led the authors to recommend changes to the specifications covering these alloys usage under Code Case 1592-10 and Sec. VIII, Div. 7. The compositional changes recommended would result in changes in rupture ductility and design stress. (Auth.)
International Nuclear Information System (INIS)
Soo, P.; Chow, J.G.Y.
1977-05-01
An assessment has been made of the effects of mean tensile stresses on the high-cycle fatigue behavior of solution-treated Type 304 stainless steel, normalized and tempered 2 1 / 4 Cr-1Mo steel, Incoloy-800H, and low-carbon Incoloy-800. Mean stresses are usually detrimental to fatigue strength, especially at high temperatures and stress levels, where significant creep can occur during fatigue cycling. Depending on the magnitudes of the alternating and mean stresses, failure may be creep or fatigue controlled. Strain accumulation is also affected by these stress levels and possibly, also, by the cyclic work-hardening characteristics of the material. It is shown that the Goodman Law for estimating mean stress effects is inadequate, since it does not account for time-dependent deformation. An alternative expression not having such a limitation was, therefore, derived and this relates the alternating and mean stresses to the time to failure. Based on limited metallographic observations of fatigue striations in the 2 1 / 4 Cr-1Mo steel an estimate was made of the crack propagation rate. It was found that a crack of critical size could, under certain conditions, propagate through most of the specimen diameter in a matter of seconds. This presents a more significant safety problem than the case for a crack extending under low-cycle conditions since preventative measures probably could not be implemented before the crack had grown to a large size
International Nuclear Information System (INIS)
Fulger, M.; Lucan, D.; Radulescu, M.; Velciu, L.
2003-01-01
Nuclear steam generator tubes operate in high temperature water and on the secondary side in restricted flow areas many nonvolatile impurities accidentally introduced into circuit tend to concentrate. The concentration process leads to the formation of highly aggressive alkaline or acid solutions in crevices, and these solutions can cause stress corrosion cracking (SCC) on stressed tube materials. Even though alloy 800 has shown to be highly resistant to general corrosion in high temperature water, it has been found that the steam generator tubes may crack during service from the primary and/or secondary side. Stress corrosion cracking is still a serious problem occurring on outside tubes in operating steam generators. The purpose of this study was to evaluate the environmental factors affecting the stress corrosion cracking of steam generators tubing. The main test method was the exposure for 1000 hours into static autoclaves of plastically stressed C-rings of Incoloy 800 in caustic solutions (10% NaOH) and acidic chloride solutions because such environments may sometimes form accidentally in crevices on secondary side of tubes. Because the kinetics of corrosion of metals is indicated by anodic polarization curves, in this study, some stressed specimens were anodically polarized in caustic solutions in electrochemical cell, and other in chloride acidic solutions. The results presented as micrographs, potentiokinetic curves, and electrochemical parameters have been compared to establish the SCC behavior of Incoloy 800 in such concentrated environments. (authors)
Investigation of the behaviour of 35% nickel alloys in the presence of helium coolant impurities
International Nuclear Information System (INIS)
Dixmier, J.; Leclercq, D.; Olivier, P.; Vincent, L.; Willermoz, H.
1976-01-01
Alloys of the Incoloy 800 type containing 35% nickel are being considered for the heat exchangers of steam-cycle high-temperature reactors for electricity production. Corrosion tests at 650 and 800 0 C have been carried out at atmospheric pressure and at 50 bar on four such alloys (commercially available and specially produced ones) with different titanium and aluminium contents. It appears that the degree of intergranular attack occurring in these materials increases with the titanium and aluminium concentration. Examination with a scanning electron microscope fitted with analysers confirms the decisive role of these two elements which are actually to be found in oxidized form at the grain boundaries to the exclusion of other components of the alloy. This type of corrosion can lead in the long run to a deterioration in the alloy's mechanical characteristics at high temperature. To assess the true risk of in-service rupture, various rigs have been developed for investigating corrosion under stress conditions. The atmosphere in these rigs consists of helium, of which the impurity content is rigorously controlled. In particular, the Aida high-pressure loop installed at the Grenoble Nuclear Research Centre can accommodate a large number of test-pieces. These are either subjected to a definite tensile stress or placed in a circuit through which helium is passed at high velocity. At present experiments are being conducted at 700 and 750 0 C on an Incoloy 800 alloy corresponding to the designers' specifications. The experiments are performed at atmospheric pressure and a pressure of 50 bar with the same impurity pressures. (author)
Multifrequency Eddy current testing of heat exchange tubes with a rotating probe
International Nuclear Information System (INIS)
Levy, R.
1982-01-01
Multi-frequency eddy current analyses have been used in France industrially since 1975. In light of the experienced gained during many steam generator inspections, this technique was applied to the examination of sheet and tube heat exchangers featuring tubes in very different materials such as copper, stainless steel and titanium. The principle of multi-frequency Eddy current inspection is first reviewed, using the example of a condenser with nickel alloy tubes (Inconel, Incoloy). This is followed by the description of a specific application of this technique to a condenser with titanium tubes, analyzed with a rotating local probe [fr
Effect of helium on creep and fatigue (MAT 11)
International Nuclear Information System (INIS)
Schroeder, H.
1991-03-01
This final report contains experimental results on mechanical properties (creep, fatigue, tensile) and microstructural investigations (SEM, TEM) of pre-implanted samples of steels or alloys. (AISI 316, AISI 316L, DIN 1.4970, JPCA 8206, DIN 1.4914; Incoloy 800H, Hastelloy X, DIN 1.4981, (Fe 0.49 Ni 0.51 ) 3 V, Fe17Ni17Cr, Fe15Ni15Cr, Nimonic PE 16, Ni8Si). Furthermore theoretical aspects and developed models and mechanisms for helium embrittlement are described. This report is presented in the form of an extended summary without figures. (MM)
International Nuclear Information System (INIS)
Lenglet, M.; Delaunay, F.; Lefez, B.
1997-01-01
The purpose of this paper is to study the reflectance spectra of the different single oxide layer systems : Cr 2 O 3 /Fe, MnCr 2 O 4 /Fe, TiO 2 /Fe, NiCr 2 O 4 /Fe and NiFe 2 O 4 /Fe and to extend the theoretical calculations to multilayer oxide systems on metallic substrates. The interpretation of the resulting reflectance spectra for these systems is used to explain the initial stages of oxide formation and the influence of minor alloying elements on the high temperature oxidation of three commercial nickel alloys : Incoloy 800, Inconel 600 and X. (orig.)
Properties and application study of Inconel alloy tube made in China
International Nuclear Information System (INIS)
Yang Xiang; Su Xingwan; Wen Yan
1997-01-01
The mech-physical properties and the corrosion resistance properties of the SG tube of Inconel alloy made in China under any conditions are briefly presented, and the test and research for bending and expending the tubes have been performed. In the process of corrosion experiments the Inconel alloy tubes were compared with that of the same kind of materials made in foreign countries. The Inconel alloy tubes have better stress corrosion resistance cracking prosperities than Inconel 600 and Incoloy 800 when they were in the solutions which contained high concentrated chlorine ion and alkali at high temperature
International Nuclear Information System (INIS)
Walker, W.L.
1979-10-01
Stress-corrosion cracking test specimens were prepared for Dow Nuclear Services for insertion in the Dresden 1 reactor during the chemical decontamination of the primary system, and for subsequent exposure under operating conditions when the station returns to service. The specimens consist of pressurized tubes fabricated from Type-304 and -304L stainless steel, Inconel 600, Incoloy 800, and Zircaloy 2. In addition, constant radius bent-beam specimens of 3/4 hard Type-410 stainless steel were also included. All specimens were stressed to, or slightly above, their respective 0.2% offset yield strengths at the temperatures of interest
Thermal cycling influence on microstructural characterization of alloys with high nickel content
International Nuclear Information System (INIS)
Abrudeanu, M.; Gradin, O.; Vulpe, S. C.; Ohai, D.
2013-01-01
The IV nuclear energy generation systems are aimed at making revolutionary improvements in economics, safety and reliability, and sustainability. To achieve these goals, Generation IV systems will operate at higher temperatures and in higher radiation fields. This paper shows the thermal cycling influences on microstructure and hardness of nickel based alloys: Incoloy 800 HT and Inconel 617. These alloys were meekly at a thermal cycling of 25, 50, 75 and 100 cycles. The temperature range of a cycle was between 400 O C and 700 O C. Nickel base alloys develop their properties by solid solution and/or precipitation strengthening. (authors)
Saenz, D T; Fiskus, W; Qian, Y; Manshouri, T; Rajapakshe, K; Raina, K; Coleman, K G; Crew, A P; Shen, A; Mill, C P; Sun, B; Qiu, P; Kadia, T M; Pemmaraju, N; DiNardo, C; Kim, M-S; Nowak, A J; Coarfa, C; Crews, C M; Verstovsek, S; Bhalla, K N
2017-09-01
The PROTAC (proteolysis-targeting chimera) ARV-825 recruits bromodomain and extraterminal (BET) proteins to the E3 ubiquitin ligase cereblon, leading to degradation of BET proteins, including BRD4. Although the BET-protein inhibitor (BETi) OTX015 caused accumulation of BRD4, treatment with equimolar concentrations of ARV-825 caused sustained and profound depletion (>90%) of BRD4 and induced significantly more apoptosis in cultured and patient-derived (PD) CD34+ post-MPN sAML cells, while relatively sparing the CD34+ normal hematopoietic progenitor cells. RNA-Seq, Reverse Phase Protein Array and mass cytometry 'CyTOF' analyses demonstrated that ARV-825 caused greater perturbations in messenger RNA (mRNA) and protein expressions than OTX015 in sAML cells. Specifically, compared with OTX015, ARV-825 treatment caused more robust and sustained depletion of c-Myc, CDK4/6, JAK2, p-STAT3/5, PIM1 and Bcl-xL, while increasing the levels of p21 and p27. Compared with OTX015, PROTAC ARV-771 treatment caused greater reduction in leukemia burden and further improved survival of NSG mice engrafted with luciferase-expressing HEL92.1.7 cells. Co-treatment with ARV-825 and JAK inhibitor ruxolitinib was synergistically lethal against established and PD CD34+ sAML cells. Notably, ARV-825 induced high levels of apoptosis in the in vitro generated ruxolitinib-persister or ruxolitinib-resistant sAML cells. These findings strongly support the in vivo testing of the BRD4-PROTAC based combinations against post-MPN sAML.
Energy Technology Data Exchange (ETDEWEB)
Sridharan, Kumar; Anderson, Mark; Allen, Todd; Corradini, Michael
2012-01-30
The goal of this NERI project was to perform research on high temperature fluoride and chloride molten salts towards the long-term goal of using these salts for transferring process heat from high temperature nuclear reactor to operation of hydrogen production and chemical plants. Specifically, the research focuses on corrosion of materials in molten salts, which continues to be one of the most significant challenges in molten salts systems. Based on the earlier work performed at ORNL on salt properties for heat transfer applications, a eutectic fluoride salt FLiNaK (46.5% LiF-11.5%NaF-42.0%KF, mol.%) and a eutectic chloride salt (32%MgCl2-68%KCl, mole %) were selected for this study. Several high temperature candidate Fe-Ni-Cr and Ni-Cr alloys: Hastelloy-N, Hastelloy-X, Haynes-230, Inconel-617, and Incoloy-800H, were exposed to molten FLiNaK with the goal of understanding corrosion mechanisms and ranking these alloys for their suitability for molten fluoride salt heat exchanger and thermal storage applications. The tests were performed at 850C for 500 h in sealed graphite crucibles under an argon cover gas. Corrosion was noted to occur predominantly from dealloying of Cr from the alloys, an effect that was particularly pronounced at the grain boundaries Alloy weight-loss due to molten fluoride salt exposure correlated with the initial Cr-content of the alloys, and was consistent with the Cr-content measured in the salts after corrosion tests. The alloys weight-loss was also found to correlate to the concentration of carbon present for the nominally 20% Cr containing alloys, due to the formation of chromium carbide phases at the grain boundaries. Experiments involving molten salt exposures of Incoloy-800H in Incoloy-800H crucibles under an argon cover gas showed a significantly lower corrosion for this alloy than when tested in a graphite crucible. Graphite significantly accelerated alloy corrosion due to the reduction of Cr from solution by graphite and formation
2010-10-01
... not limited to, any raw, dressed, or dyed fur or skin: Scientific name Common name Ursus maritimus Polar bear. Enhydra lutris Sea Otter. Odobenus rosmarus Walrus. Dugong dugong Dugong. Trichechus...
2010-07-01
... “health care provider” as: (i) A doctor of medicine or osteopathy who is authorized to practice medicine...)(1). Son or daughter means a biological, adopted, or foster child, a stepchild, a legal ward, or a child of a person standing in loco parentis, who is either under age 18, or age 18 or older and...
Modelling the long-term corrosion behaviour of candidate alloys for Canadian SCWR
Energy Technology Data Exchange (ETDEWEB)
Steeves, G.; Cook, W., E-mail: wcook@unb.ca, E-mail: graham.steeves@unb.ca [University of New Brunswick, Department of Chemical Engineering, Fredericton, NB (Canada)
2015-07-01
Corrosion behaviour of Inconel 625 and Incoloy 800H, two of the candidate fuel cladding materials for Canadian supercritical water (SCW) reactor designs, were evaluated by exposing the metals to SCW in UNB's SCW flow loop. Individual experiments were conducted over a range of 370{sup o}C and 600{sup o}C. Exposure times were typically intervals of 100, 250, and 500 hours. Experimental data was used to create an empirical kinetic equation for each material. Activation energies for the alloys were determined, and showed a distinct difference between low-temperature electrochemical corrosion mechanism and direct high-temperature chemical oxidation. (author)
Current CTR-related tritium handling studies at ORNL
International Nuclear Information System (INIS)
Watson, J.S.; Bell, J.T.; Clinton, S.D.; Fisher, P.W.; Redman, J.D.; Smith, F.J.; Talbot, J.B.; Tung, C.P.
1976-01-01
The Oak Ridge National Laboratory has a comprehensive program concerned with plasma fuel recycle, tritium recovery from blankets, and tritium containment in fusion reactors. Two studies of most current interest are investigations of cryosorption pumping of hydrogen isotopes and measurements of tritium permeation rates through steam generator materials. Cryosorption pumping speeds have been measured for hydrogen, deuterium, and helium at pressures from 10 -8 torr to 3 x 10 -3 torr. Permeation rates through Incoloy 800 have been shown to be drastically reduced when the low pressure side of permeation tubes are exposed to steam. These results will be important considerations in the design of fusion reactor steam generators
The influence of cold work on the oxidation behaviour of stainless steel
International Nuclear Information System (INIS)
Langevoort, J.C.
1985-01-01
In this thesis the study of the interaction of oxygen gas with stainless steel surfaces is described. Thermogravimetry, microscopy and ellipsometry have been used to follow the oxidation in situ, while EDX, AES and XPS have been used to determine the oxide compositions. The aim of this thesis is to reveal the influence on the oxidation behaviour of stainless steel of i) cold work (rolling, drawing, milling, polishing and Ar ion bombardment) ii) the initially formed oxide and iii) the experimental conditions. Two types of stainless steels have been used (AISI 304 (a 18/8 Cr/Ni steel) and Incoloy 800 H (a 20/30 Cr/Ni steel)). (Auth.)
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLC438 (Link to dictyBase) - - - Contig-U10771-1 SLC438Z (Link... to Original site) - - SLC438Z 549 - - - - Show SLC438 Library SL (Link to library) Clone ID SLC438 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-B/SLC438Q.Seq.d/ Representative seq. ID SLC43...8Z (Link to Original site) Representative DNA sequence >SLC438 (SLC438Q) /CSM/SL/SLC4-B/SLC438Q.Seq.d/ XXXXX...es producing significant alignments: (bits) Value SSM825 (SSM825Q) /CSM/SS/SSM8-B/SSM825Q.Seq.d/ 948 0.0 SLC438 (SLC4
Improving Distribution of Military Programs’ Technical Criteria
1993-08-01
Vacuum System ETL 1110-3-380 01/29/88 Std Distribution of Military Arfid Pavement Dsg ETL 1110-3-381 01/29/88 Airfield Pavement Design ETL 1110-3...Army Arfid O&M Facilities TM 5-825-2 08/01/78 Flexible Pavement Design for Airfields TM 5-825-2-1 11/01/89 Army Airfields Pavements, Flex (Appendix
Incoloy 800 steam generator tubes stubbing by laser and electron beams process
International Nuclear Information System (INIS)
Bonnin, P.; Noel, J.P.; Gauthier, J.P.; Peigney, A.
1988-01-01
The electron beam welding conditions are optimized for different thermal cycles and chemical compositions of the fusion zone. The metallurgical and mechanical properties of the joints are described and compared with the properties of laser and TIG welds [fr
Nursing Performance and Mobile Phone Use: Are Nurses Aware of Their Performance Decrements?
McBride, Deborah; LeVasseur, Sandra A; Li, Dongmei
2015-04-23
Prior research has documented the effect of concurrent mobile phone use on medical care. This study examined the extent of hospital registered nurses' awareness of their mobile-phone-associated performance decrements. The objective of this study was to compare self-reported performance with reported observed performance of others with respect to mobile phone use by hospital registered nurses. In March 2014, a previously validated survey was emailed to the 10,978 members of the Academy of Medical Surgical Nurses. The responses were analyzed using a two-proportion z test (alpha=.05, two-tailed) to examine whether self-reported and observed rates of error were significantly different. All possible demographic and employment confounders which could potentially contribute to self-reported and observed performance errors were tested for significance. Of the 950 respondents, 825 (8.68%, 825/950) met the inclusion criteria for analysis. The representativeness of the sample relative to the US nursing workforce was assessed using a two-proportion z test. This indicated that sex and location of primary place of employment (urban/rural) were represented appropriately in the study sample. Respondents in the age groups 55 years old were overrepresented. Whites, American Indians/Alaskan natives, and Native Hawaiian or Pacific Islanders were underrepresented, while Hispanic and multiple/other ethnicities were overrepresented. It was decided to report the unweighted, rather than the weighted survey data, with the recognition that the results, while valuable, may not be generalizable to the entire US registered nursing workforce. A significant difference was found between registered nurses' self-reported and observed rates of errors associated with concurrent mobile phone use in following three categories (1) work performance (z=-26.6142, Pmobile phone use by nurses at work was a serious distraction; always (13%, 107/825), often (29.6%, 244/825), sometimes (44.6%, 368/825), rarely
Optical photometry and spectroscopy for five dwarf M stars
Energy Technology Data Exchange (ETDEWEB)
Doyle, J.G.; Byrne, P.B.; Menzies, J.W.
1986-05-01
A search for flaring and BY Dra (spotted) variations on five M-dwarf stars, Gliese 1, 461, 825, 899 and 908 is reported. The results for Gl 461 and 825 are compared with predictions of activity levels based on the measured quiescent X-ray flux. The chromospheric radiative loss rate in the Ca H and K lines are determined for Gl 461.
Stress corrosion cracking of steam generator tube and primary pipe in PWR type nuclear power plants
International Nuclear Information System (INIS)
Zhang Weiguo; Gao Fengqin; Zhou Hongyi
1992-03-01
The behavior of stress corrosion cracking (SCC) was studied by slow strain rate test (SSRT), constant load test (CLT) and low frequency cyclic loading test (LFCLT). The purpose of these tests is to get the test data for evaluating the integrity of pressurized boundary of pipes in Qinshan and Guangdong nuclear power plants (NPPs). Tested materials are 316 nuclear grade stainless steel (SS) for primary pipes in welded heat affected zone (WHAZ) and tubes of heat transfer, such as Incoloy-800, Inconel-600 and 321 SS which are used for steam generator in PWR NPPs. The effects of material metallurgy, shot peening treatment, tensile load, strain rate, cyclic load and water chemistry on the behavior of SCC were considered
A study of small leaks of water into sodium-heated steam generators - self evolution and wastage
International Nuclear Information System (INIS)
Feburie, V.; Desmas, T.; Cronier, B.
1987-01-01
MICROMEGAS is a fully automatic test loop operating without human surveillance. It is utilized to study small leaks of water into sodium, specially the spontaneous development of a fatigue-induced crack in a tube of Incoloy 800 (dormant period, microleak, self-evolution) and the wastage of neighbouring tubes. The thermohydraulic conditions of the last tests corresponded to the economizer zone of SUPER-PHENIX steam generators, at 350 0 C. These tests were compared with those which had been done before, corresponding to the superheating zone, at 490 0 C. The main result was that the microleak phase was longer and the self-evolution slower at 350 0 C than at 490 0 C. (author)
Stress corrosion cracking of steam generator tube and primary pipe in PWR type nuclear power plants
International Nuclear Information System (INIS)
Zhang Weiguo; Gao Fengqin; Zhou Hongyi
1993-01-01
The behavior of stress corrosion cracking (SCC) is studied by slow strain rate test (SSRT), constant load test (CLT) and low frequency cyclic loading test (LFCLT). The purpose of these tests is to get the test data for evaluating the integrity of pressurized boundary of pipes in Qinshan and Guangdong nuclear power plants. Tested materials are 316 nuclear grade stainless steel (SS) for primary pipes in welded heat affected zone (WHAZ) and steam generator tubes, such as Incoloy-800, Inconel-600, Inconel-690 and 321 SS which are used for steam generator in PWR. The effects of material metallurgy, shot-peening treatment, tensile load, strain rate, cyclic load and water chemistry on the behavior of SCC are investigated
Progress toward determining the potential of ODS alloys for gas turbine applications
Dreshfield, R. L.; Hoppin, G., III; Sheffler, K.
1983-01-01
The Materials for Advanced Turbine Engine (MATE) Program managed by the NASA Lewis Research Center is supporting two projects to evaluate the potential of oxide dispersion strengthened (ODS) alloys for aircraft gas turbine applications. One project involves the evaluation of Incoloy (TM) MA-956 for application as a combustor liner material. An assessment of advanced engine potential will be conducted by means of a test in a P&WA 2037 turbofan engine. The other project involves the evaluation of Inconel (TM) MA 6000 for application as a high pressure turbine blade material and includes a test in a Garrett TFE 731 turbofan engine. Both projects are progressing toward these engine tests in 1984.
Region-of-influence approach to a frequency analysis of heavy precipitation in Slovakia
Czech Academy of Sciences Publication Activity Database
Gaál, L.; Kyselý, Jan; Szolgay, J.
2008-01-01
Roč. 12, č. 3 (2008), s. 825-839 ISSN 1027-5606 R&D Projects: GA AV ČR KJB300420601 Institutional research plan: CEZ:AV0Z30420517 Keywords : regional frequency analysis * region-of-influence approach * pooling groups * extreme precipitation events * L-moments * Slovakia Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 2.167, year: 2008 http://www.hydrol-earth-syst-sci.net/12/825/2008/
29 CFR 825.500 - Recordkeeping requirements.
2010-07-01
... employer or employee of the reasons for the designation and for the disagreement. (d) Covered employers... transcription or copying. (c) Covered employers who have eligible employees must maintain records that must disclose the following: (1) Basic payroll and identifying employee data, including name, address, and...
2010-04-01
... TAXES Mutual Insurance Companies (other Than Life and Certain Marine Insurance Companies and Other Than Fire Or Flood Insurance Companies Which Operate on Basis of Perpetual Policies Or Premium Deposits) § 1.... For the taxable year 1967, F, a mutual insurance company subject to the tax imposed by section 821(a...
29 CFR 825.115 - Continuing treatment.
2010-07-01
... paragraph (a)(1) of this section means circumstances beyond the employee's control that prevent the follow... after an accident or other injury; or (2) A condition that would likely result in a period of incapacity... consecutive, full calendar days. For example, an employee with asthma may be unable to report for work due to...
Effect of galvanic coupling between overpack materials for high-level nuclear waste containers
International Nuclear Information System (INIS)
Dunn, D.S.; Cragnolino, G.A.; Sridhar, N.
1998-01-01
The effect of environmental parameters and area ratio on the galvanic protection of Alloy 825 by A516 steel was studied. A simplified model was used to calculate the potential and corrosion current density of the bimetallic couple as a function of the galvanic coupling efficiency. Galvanic corrosion tests were performed to gain confidence in the calculated values. Both the calculations and laboratory testing indicate that, with highly efficient coupling, the potential of the galvanic couple is maintained below the repassivation potential for Alloy 825 in chloride-containing solutions. As a result, the initiation of localized corrosion on Alloy 825 is prevented. The formation of oxides, scales, and corrosion product layers between the barriers is shown to reduce the efficiency of the galvanic couple, which may result in conditions under which the localized corrosion of the inner corrosion resistant barrier can occur
On the grain boundary character distribution of Incoloy 800H during dynamic recrystallization
Energy Technology Data Exchange (ETDEWEB)
Cao, Yu, E-mail: vieri32825@126.com [College of Materials Science and Engineering, Chongqing University, Chongqing 400045 (China); Di, Hongshuang [State Key Laboratory of Rolling and Automation, Northeastern University, Shenyang 110819 (China); Huang, Guangjie [College of Materials Science and Engineering, Chongqing University, Chongqing 400045 (China)
2017-04-01
In this paper, we investigated the influence of hot deformation parameters on the distribution and proliferation of twin boundaries during dynamic recrystallization (DRX). The results showed that microstructure evolution is characterized by a process of “dynamic recovery (DRV)→necklace/multiple necklace→fully DRX” with increasing temperature and decreasing strain rate. The predominant proliferation mechanism of Σ3{sup n} (1 ≤ n ≤ 3) boundaries is transformed from Σ3 regeneration to new twinning during the growth of DRX grains.
On the grain boundary character distribution of Incoloy 800H during dynamic recrystallization
International Nuclear Information System (INIS)
Cao, Yu; Di, Hongshuang; Huang, Guangjie
2017-01-01
In this paper, we investigated the influence of hot deformation parameters on the distribution and proliferation of twin boundaries during dynamic recrystallization (DRX). The results showed that microstructure evolution is characterized by a process of “dynamic recovery (DRV)→necklace/multiple necklace→fully DRX” with increasing temperature and decreasing strain rate. The predominant proliferation mechanism of Σ3 n (1 ≤ n ≤ 3) boundaries is transformed from Σ3 regeneration to new twinning during the growth of DRX grains.
Low concentration NP preoxidation condition for PWR decontamination
International Nuclear Information System (INIS)
Huang Fuduan; Yu Degui; Lu Jingju; Ding Dejun; Zhao Yukun
1991-02-01
To use preoxidation condition with low concentration NP (nitric acid permanganate) instead of conventional high concentration AP (alkline permanganate ) for PWR oxidation decontamination (POD) was summarized. Experiments including three parts have been performed. The defilming performance and decontamination factor of preoxidation with low concentration NP, which is 100, 10 times lower than that of AP are better than that with high concentration AP. The reason has been studied with the aid of prefilmed specimens of corrosion potential measuring in NP solution and chromium release in NP and AP solutions. The behaviour of alloy 13 prefilmed specimen in NP preoxidation solution is different from 18-8 ss and Incoloy 800. In the low acidity, the corrosion potential moves toward positive direction as the acidity becomes high
Effect of fission product interactions on the corrosion and mechanical properties of HTGR alloys
International Nuclear Information System (INIS)
Aronson, S.; Chow, J.G.Y.; Soo, P.; Friedlander, M.
1978-01-01
Preliminary experiments have been carried out to determine how fission product interactions may influence the mechanical integrity of reference HTGR structural metals. In this work Type 304 stainless steel, Incoloy 800 and Hastelloy X were heated to 550 to 650 0 C in the presence of CsI. It was found that no corrosion of the alloys occurred unless air or oxygen was also present. A mechanism for the observed behavior is proposed. A description is also given of some long term exposures of HTGR materials to more prototypic, low concentrations of I 2 , Te 2 and CsI in the presence of low partial pressures of O 2 . These samples are scheduled for mechanical bend tests after exposure to determine the degree of embrittlement
Status of the TRIGA shipments to the INEEL from Europe
International Nuclear Information System (INIS)
Mustin, T.; Stump, R.C.; Tyacke, M.J.
1997-01-01
This paper reports the activities underway by the US Department of Energy (DOE) for returning Training, Research, Isotope, General Atomics (TRIGA) spent nuclear fuel (SNF) from foreign research reactors (FRR) in four European countries to the Idaho National Engineering and Environmental Laboratory (INEEL). Those countries are Germany, Italy, Romania, and Slovenia. This is part of the ''Nuclear Weapons Nonproliferation Policy'' of returning research reactor SNF containing uranium enriched in the US. This paper describes the results of a pre-assessment trip in September, 1997, to these countries, including: history of the reactors and research being performed; inventory of TRIGA SNF; fuel types (stainless steel, aluminum, or Incoloy) and enrichments; and each country's plans for returning their TRIGA SNF to the INEEL
Evaluation of metallic materials for use in engineering barrier systems
International Nuclear Information System (INIS)
Pitman, S.G.; Griggs, B.; Elmore, R.P.
1980-01-01
Conclusions of this work are as follows: Inconel, Incoloy, Hastelloy C-276, and titanium alloys all had excellent corrosion resistance in all postulated repository environments tested. Further work will be required to evaluate the pertinent enviro-mechanical properties of these materials; the mechanical properties of grade 2 titanium are better than those of grade 12 titanium, except the tensile and yield strengths. These properties include fatigue-crack-growth rate, environmental fatigue-crack-growth rate, fracture toughness, impact toughness, and dynamic fracture toughness; there is no evidence in the current data to indicate that the simulated repository environment is aggressive to grade 2 or grade 12 titanium. This includes data from corrosion-fatigue, crevice corrosion, wedge-loaded cracked specimens, and residual-stress specimens
Energy Technology Data Exchange (ETDEWEB)
Fan, Ximing; Lin, Dunmin; Zheng, Qiaoji; Sun, Hailing; Wan, Yang; Wu, Xiaochun [College of Chemistry and Materials Science, and Visual Computing and Virtual Reality Key Laboratory of Sichuan Province, Sichuan Normal University, Chengdu 610066 (China); Wu, Lang [State Key Laboratory Cultivation Base for Nonmetal Composites and Functional Materials, Southwest University of Science and Technology, Mianyang 621010 (China)
2012-12-15
Lead-free ceramics 0.825NaNbO{sub 3}-0.175Ba{sub 0.6}(Bi{sub 0.5}K{sub 0.5}){sub 0.4}TiO{sub 3} + xmol% MnO{sub 2} were prepared by an ordinary sintering technique and the effects of MnO{sub 2} doping on the structure, dielectric, and piezoelectric properties of the ceramics were studied. The ceramics with perovskite structure are transformed from tetragonal to pseudocubic phases by increasing the doping level of MnO{sub 2}. After the addition of MnO{sub 2}, the Curie temperature T{sub C} of the ceramics decreases and the ferroelectric-paraelectric phase transition at T{sub C} becomes more diffusive. Because of the donor and acceptor doping effects of Mn ions simultaneously, the piezoelectric constant d{sub 33}, electromechanical coupling coefficient k{sub p}, relative permittivity {epsilon}{sub r}, and mechanical quality factor Q{sub m} are enhanced considerably after the addition of 1 mol% MnO{sub 2}. The ceramic with 1 mol% MnO{sub 2} doping possesses the optimum piezoelectricity (d{sub 33} = 131 pC/N and k{sub p} = 21.8%) and relatively high Q{sub m} = 627. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
Energy Technology Data Exchange (ETDEWEB)
Farmer, J.C.; Van Konynenburg, R.A.; McCright, R.D. (Lawrence Livermore National Lab., CA (USA)); Bullen, D.B. (Science and Engineering Associates, Inc., Pleasanton, CA (USA))
1988-04-01
Three iron- to nickel-based austenitic alloys (Types 304L and 316L stainless steels and Alloy 825) are being considered as candidate materials for the fabrication of high-level radioactive-waste containers. Waste will include fuel assemblies from reactors as well as high-level waste in borosilicate glass forms, and will be sent to the prospective repository at Yucca Mountain, Nevada. The decay of radionuclides in the repository will result in the generation of substantial heat and in fluences of gamma radiation. Container materials may undergo any of several modes of degradation in this environment, including atmospheric oxidation; uniform aqueous phase corrosion; pitting; crevice corrosion; sensitization and intergranular stress corrosion cracking (IGSCC); and transgranular stress corrosion cracking (TGSCC). This report is an analysis of data relevant to the pitting, crevice corrosion, and stress corrosion cracking (SCC) of the three austenitic candidate alloys. The candidates are compared in terms of their susceptibilities to these forms of corrosion. Although all three candidates have demonstrated pitting and crevice corrosion in chloride-containing environments, Alloy 825 has the greatest resistance to these types of localized corrosion (LC); such resistance is important because pits can penetrate the metal and serve as crack initiation sites. Both Types 304L and 316L stainless steels are susceptible to SCC in acidic chloride media. In contrast, SCC has not been documented in Alloy 825 under comparable conditions. Gamma radiation has been found to enhance SCC in Types 304 and 304L stainless steels, but it has no detectable effect on the resistance of Alloy 825 to SCC. Furthermore, while the effects of microbiologically induced corrosion have been observed for 300-series stainless steels, nickel-based alloys such as Alloy 825 seem to be immune to such problems. 211 refs., 49 figs., 10 tabs.
International Nuclear Information System (INIS)
Farmer, J.C.; Van Konynenburg, R.A.; McCright, R.D.; Bullen, D.B.
1988-04-01
Three iron- to nickel-based austenitic alloys (Types 304L and 316L stainless steels and Alloy 825) are being considered as candidate materials for the fabrication of high-level radioactive-waste containers. Waste will include fuel assemblies from reactors as well as high-level waste in borosilicate glass forms, and will be sent to the prospective repository at Yucca Mountain, Nevada. The decay of radionuclides in the repository will result in the generation of substantial heat and in fluences of gamma radiation. Container materials may undergo any of several modes of degradation in this environment, including atmospheric oxidation; uniform aqueous phase corrosion; pitting; crevice corrosion; sensitization and intergranular stress corrosion cracking (IGSCC); and transgranular stress corrosion cracking (TGSCC). This report is an analysis of data relevant to the pitting, crevice corrosion, and stress corrosion cracking (SCC) of the three austenitic candidate alloys. The candidates are compared in terms of their susceptibilities to these forms of corrosion. Although all three candidates have demonstrated pitting and crevice corrosion in chloride-containing environments, Alloy 825 has the greatest resistance to these types of localized corrosion (LC); such resistance is important because pits can penetrate the metal and serve as crack initiation sites. Both Types 304L and 316L stainless steels are susceptible to SCC in acidic chloride media. In contrast, SCC has not been documented in Alloy 825 under comparable conditions. Gamma radiation has been found to enhance SCC in Types 304 and 304L stainless steels, but it has no detectable effect on the resistance of Alloy 825 to SCC. Furthermore, while the effects of microbiologically induced corrosion have been observed for 300-series stainless steels, nickel-based alloys such as Alloy 825 seem to be immune to such problems. 211 refs., 49 figs., 10 tabs
International Nuclear Information System (INIS)
Cragnolino, G.A.; Dunn, D.S.; Sridhar, N.
1998-01-01
Two corrosion resistant nickel-based alloys, 625 and C22, have been selected by the US Department of Energy as candidate materials for the inner container of high-level radioactive waste packages. The susceptibility of these materials to localized corrosion was evaluated by measuring the repassivation potential as a function of solution chloride concentration and temperature using cyclic potentiodynamic polarization and lead-in-pencil potential step test methods. At intermediate Cl- concentrations, e.g., 0.028--0.4 M, the repassivation potential of alloy 625 is greater than that for alloy 825 and is dependent on the Cl- concentration. However, at higher concentrations, the repassivation potential is slightly less than that for alloy 825 and is weakly dependent on Cl- concentration. The repassivation potentials for alloy C-22 under all test conditions are considerably higher than those of either alloy 625 or 825 and are in the range where oxygen evolution is expected to occur
Search Results | Page 825 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 8241 - 8250 of 8494 ... Current perceptions of organised crime are too rigid and narrow. Organised crime should be re-defined to comprise a set of core activities which should encompass the ancillary acts of those who assist core actors. Briefs. How to improve the socio-economic benefit of public private R&D ...
29 CFR 825.113 - Serious health condition.
2010-07-01
... illness, injury, impairment or physical or mental condition that involves inpatient care as defined in... medications such as aspirin, antihistamines, or salves; or bed-rest, drinking fluids, exercise, and other... “serious health conditions” unless inpatient hospital care is required or unless complications develop...
49 CFR 825.40 - Ex parte communications.
2010-10-01
... the proceeding; Ex parte communication means an oral or written communication not on the public record...: (1) All such written communications; (2) Memoranda stating the substance of all such oral communication; and (3) All written responses, and memoranda stating the substance of all oral responses, to...
Search Results | Page 825 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 8241 - 8250 of 8491 ... Economic and social development POVERTY ALLEVIATION ... Social Policy Gender Citizenship WOMEN'S RIGHTS MISSING ... A new study estimates that 10 million girls are “missing” from India's population.
29 CFR 825.300 - Employer notice requirements.
2010-07-01
... (vii) The employee's potential liability for payment of health insurance premiums paid by the employer... requirements for the employee to furnish certification of a serious health condition, serious injury or illness... Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR OTHER LAWS THE FAMILY...
Search Results | Page 825 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 8241 - 8250 of 8531 ... Can minimum wages help to reduce labour market inequality? ... the regulatory framework is sporadic and limited, and institutional capacity is weak. ... direct investment from Taiwan, Hong Kong, China and South Korea. ... problems such as monopolized markets, poor financial intermediation, ...
29 CFR 825.200 - Amount of leave.
2010-07-01
...'s son or daughter, and to care for the newborn child; (2) The placement with the employee of a son or daughter for adoption or foster care, and to care for the newly placed child; (3) To care for the... option only by providing the 60-day notice to all employees of the option the employer intends to...
Creep rupture behavior of candidate materials for nuclear process heat applications
International Nuclear Information System (INIS)
Schubert, F.; te Heesen, E.; Bruch, U.; Cook, R.; Diehl, H.; Ennis, P.J.; Jakobeit, W.; Penkalla, H.J.; Ullrich, G.
1984-01-01
Creep and stress rupture properties are determined for the candidate materials to be used in hightemperature gas-cooled reactor (HTGR) components. The materials and test methods are briefly described based on experimental results of test durations of about20000 h. The medium creep strengths of the alloys Inconel-617, Hastelloy-X, Nimonic-86, Hastelloy-S, Manaurite-36X, IN-519, and Incoloy-800H are compared showing that Inconel-617 has the best creep rupture properties in the temperature range above 800 0 C. The rupture time of welded joints is in the lower range of the scatterband of the parent metal. The properties determined in different simulated HTGR atmospheres are within the scatterband of the properties obtained in air. Extrapolation methods are discussed and a modified minimum commitment method is favored
Chen, Qian; Liang, Chao; Wang, Xin; He, Jingkang; Li, Yonggang; Liu, Zhuang
2014-11-01
A large variety of cancers are associated with a high incidence of lymph node metastasis, which leads to a high risk of cancer death. Herein, we demonstrate that multimodal imaging guided photothermal therapy can inhibit tumor metastasis after surgery by burning the sentinel lymph nodes (SLNs) with metastatic tumor cells. A near-infrared dye, IR825, is absorbed onto human serum albumin (HSA), which is covalently linked with diethylenetriamine pentaacetic acid (DTPA) molecules to chelate gadolinium. The formed HSA-Gd-IR825 nanocomplex exhibits strong fluorescence together with high near-infrared (NIR) absorbance, and in the mean time could serve as a T1 contrast agent in magnetic resonance (MR) imaging. In vivo bi-modal fluorescence and MR imaging uncovers that HSA-Gd-IR825 after being injected into the primary tumor would quickly migrate into tumor-associated SLNs through lymphatic circulation. Utilizing the strong NIR absorbance of HSA-Gd-IR825, SLNs with metastatic cancer cells can be effectively ablated under exposure to a NIR laser. Such treatment when combined with surgery to remove the primary tumor offers remarkable therapeutic outcomes in greatly inhibiting further metastatic spread of cancer cells and prolonging animal survival. Our work presents an albumin-based theranostic nano-probe with functions of multimodal imaging and photothermal therapy, together with a 'photothermal ablation assisted surgery' strategy, promising for future clinical cancer treatment. Copyright © 2014 Elsevier Ltd. All rights reserved.
Residual stresses determination in an 8 mm Incoloy 800H weld via neutron diffraction
International Nuclear Information System (INIS)
Chen, Xizhang; Zhang, Shu Yan; Wang, Jingjun; Kelleher, Joe F.
2015-01-01
Highlights: • Stress through thickness at 5 mm from weld centerline indicates a “U” distribution. • Declining of tensile stress through thickness occurred at weld centerline. • Residual stress between layers is the lowest. - Abstract: To investigate the distribution of residual stresses, the 8 mm 800H alloy was joined by multi-layer butt TIG process. Residual stresses in the longitudinal, transverse and normal directions were measured via neutron diffraction. These residual stress measurements were taken at a series of points 2 mm below the top surface, covering the fusion zone, heat affected zone (HAZ) and base metal. In addition, two lines of longitudinal residual stress values at the weld centerline and 5 mm from weld centerline through thickness were measured. Results show that both the longitudinal and transverse stresses from the weld centerline to base metal are mainly tensile stresses. The longitudinal residual stress is the largest, with a maximum value of 330 MPa. As for the normal residual stress, the weld zone shows tensile stress, while the HAZ shows compressive stress. The middle of the thickness shows compressive residual stress along the thickness direction. The longitudinal stress at weld centerline through thickness reveals the interlayer heat treat effects leads to a declining of tensile stress. While the stress at 5 mm from weld centerline indicates a “U” distribution due to the mixed microstructure close to fusion line. With the increasing distance from weld seam, the residual stress decreases gradually
International Nuclear Information System (INIS)
Kulichevsky, Raul M.
1995-01-01
Fretting wear of Steam Generator tubes caused by flow induced vibrations generates uncertainty on their integrity. The knowledge of the controlling variables of the wear process may give a criterion to evaluate the tubes residual life. Information on vibratory response and dynamic interaction between tubes and their supports are prerequisites for understanding the relationship between fretting wear and tube vibration. Experimental results of the vibratory response of an Atucha-I nuclear power plant type U-tube, the influence of tube/support clearance on this response and a study of tube/support dynamic interaction, which allow the verification of a finite element model of this type of tubes, are presented in this work. Also wear results for the Incoloy 800/DIN 1.4550 austenitic stainless steel pair of materials and a first evaluation of the wear constant of this pair are presented. (author)
International Nuclear Information System (INIS)
Udoguchi, T.; Nakanishi, T.
1981-01-01
Steady and cyclic creep tests with internal pressure were performed at temperatures of 800 to 1000 0 C on Hastelloy X cylinders with and without a circumferential Tungsten Inert Gas (TIG) welding technique. The creep rupture strength of the TIG welded cylinders was much lower than that of the non-welded cylinders whilst creep rupture strength reduction by the TIG technique was not observed in uniaxial creep tests. The reason for the low creep strength of welded cylinders is discussed and it is noted that the creep ductility of weld metal plays an essentially important role. In order to improve the creep strength of the TIG welded cylinder, various welding procedures with assorted weld metals were investigated. Some improvements were obtained by using welding techniques which had either Incoloy 800 or a modified Hastelloy X material as the filler metal. (U.K.)
Steam generator materials and secondary side water chemistry in nuclear power stations
International Nuclear Information System (INIS)
Rudelli, M.D.
1979-04-01
The main purpose of this work is to summarize the European and North American experiences regarding the materials used for the construction of the steam generators and their relative corrosion resistance considering the water chemestry control method. Reasons underlying decision for the adoption of Incoloy 800 as the material for the secondary steam generator system for Atucha I Nuclear Power Plant (Atucha Reactor) and Embalse de Rio III Nuclear Power Plant (Cordoba Reactor) are pointed out. Backup information taken into consideration for the decision of utilizing the All Volatil Treatment for the water chemistry control of the Cordoba Reactor is detailed. Also all the reasonswhich justify to continue with the congruent fosfatic method for the Atucha Reactor are analyzed. Some investigation objectives which would eventually permit the revision of the decisions taken on these subjects are proposed. (E.A.C.) [es
International Nuclear Information System (INIS)
Yun, H.M.
1984-01-01
The creep rupture properties of high temperature alloys are being determined as part of the materials programme for the development of the high temperature, gas-cooled reactor (HTGR) as a source of nuclear process heat, especially for the gasification of lignite and coal. INCOLOY 800H AND INCONEL 617 have been tested in the temperature range from 1073 K to 1223 K in air as well as in helium with HTGR specific impurities. The static and dynamic creep behaviour of INCONEL 617 have been determined in constant load creep tests, relaxation tests and stress reduction tests. The results have been interpreted using the internal stress on the applied stress and test temperature was determined. In a few experiments the influence of cold deformation prior to the creep test on the magnitude of the internal stress was also investigated. (Author)
Analysis of structural materials for fast-breeder reactors by X-ray fluorescence spectrometry
International Nuclear Information System (INIS)
Roca, M.; Diaz-Guerra, J.P.
1978-01-01
A procedure for the X-ray spectrometric determination of Co, Cr, Cu, Mn, Mo, Nb, Ni, P, S, Si and Ti in stainless steels and some nickel-base alloys, such as incoloy-800, is described. The use of different sets of standards has allowed the calculation of the inter-element influence coefficients for the correction of matrix effects, making the method suited for wide concentration range determinations. The efficiency of X-ray tubes with Cr and W targets has been studied, the former allowing the determination of all the above-named elements. The average relative error is 3.7%, except for P and S, where the determinations are semiquantitative. The use of a programmable spectrometer interfaced with a 16 K computer facilitates considerably the treatment of data with a proper mathematic model and furthermore provides an automatic performance of the analyses. (author)
Conceptual core model for the reactor core test
International Nuclear Information System (INIS)
Swenson, L.D.
1970-01-01
Several design options for the ZrH Flight System Reactor were investigated which involved tradeoffs of core excess reactivity, reactor control, coolant mixing and cladding thickness. A design point was selected which is to be the basis for more detailed evaluation in the preliminary design phase. The selected design utilizes 295 elements with 0.670 inch element-to-element pitch, 32 mil thick Incoloy cladding, 18.00 inches long fuel meat, hydrogen content of 6.3 x 10 22 atoms/cc fuel, 10.5 w/o uranium, and a spiraled fin configuration with alternate elements having fins with spiral to the right, spiral to the left, and no fin at all (R-L-N fin configuration). Fin height is 30 mils for the center region of the core and 15 mils for the outer region. (U.S.)
Genetic and bibliographic information: ASAH1 [GenLibi
Lifescience Database Archive (English)
Full Text Available System (C10.228.140.163.100.435) > Sphingolipidoses (C10.228.140.163.100.435.825) > Farber Lipogranulomatosi...ain Diseases, Metabolic, Inborn (C16.320.565.189) > Lysosomal Storage Diseases, Nervous System (C16.320.565.189.435) > Sphingolipidos...16.320.565.398) > Lipidoses (C16.320.565.398.641) > Sphingolipidoses (C16.320.565.398.641.803) > Farber Lipo...rage Diseases, Nervous System (C18.452.132.100.435) > Sphingolipidoses (C18.452.132.100.435.825) > Farber Li... (C18) > Metabolic Diseases (C18.452) > Lipid Metabolism Disorders (C18.452.584) > Lipidoses (C18.452.584.687) > Sphingolipidos
Finding optimum airfoil shape to get maximum aerodynamic efficiency for a wind turbine
Sogukpinar, Haci; Bozkurt, Ismail
2017-02-01
In this study, aerodynamic performances of S-series wind turbine airfoil of S 825 are investigated to find optimum angle of attack. Aerodynamic performances calculations are carried out by utilization of a Computational Fluid Dynamics (CFD) method withstand finite capacity approximation by using Reynolds-Averaged-Navier Stokes (RANS) theorem. The lift and pressure coefficients, lift to drag ratio of airfoil S 825 are analyzed with SST turbulence model then obtained results crosscheck with wind tunnel data to verify the precision of computational Fluid Dynamics (CFD) approximation. The comparison indicates that SST turbulence model used in this study can predict aerodynamics properties of wind blade.
42 CFR 405.825 - Location of carrier hearing.
2010-10-01
... and place for the hearing reasonably convenient to the requesting party and not inconsistent with the public interest. (b) Adjournment or postponement. The hearing officer may, for a good and sufficient reason, fix a new time and/or place for the hearing; he may change the time and place for the hearing or...
Lifescience Database Archive (English)
Full Text Available (All Frames) Frame A: wptgknvk*ikkkkkikknfxxf*kgxvlikkkkxpxffxxkkxxkxkkkkxkkxxxxx...p rgx*kkkkxxkkxkkxxkkkkkxkkxxfkxpxxxlgxxxxxxxggxxppxxxxxppxpkx fgppxxxppxxxxgexpxxxxxxxxxxtpfxxkkxflkkkxxkxx...xkkxxf*xffxkxllkk--- Frame C: aywxkcqinkkkkkn*kkfxxvlkgxsfnkkkkxpxfffxkkkxkxkkkkxkkxxxxxxp galkkkkxxkkkxkxxkkkkkxkkkxf*xpxxxfggxxkxxx...xgxxppxxxxxxpxpxkx wapxkxapkxxxggxpxxxxxxfxxxnpxxxkkxffkkkxxkxxffkxffxxxf*kk--- Hom
29 CFR 825.209 - Maintenance of employee benefits.
2010-07-01
...” shall not include an insurance program providing health coverage under which employees purchase... THE FAMILY AND MEDICAL LEAVE ACT OF 1993 Employee Leave Entitlements Under the Family and Medical... maintain the employee's coverage under any group health plan (as defined in the Internal Revenue Code of...
Lifescience Database Archive (English)
Full Text Available ttpttt*km**empxr p*m*s*stwkrmlrccp*tttkmlfkmsxkt*m*sqplw*rmlc*sspr*mfiemstrp* m*s...tt*km**empxr p*m*s*stwkrmlrccp*tttkmlfkmsxkt*m*sqplw*rmlc*sspr*mfiemstrp* m*s*stwkrmlrccp*tttkmlikmstkt*m*nq
29 CFR 825.101 - Purpose of the Act.
2010-07-01
..., to promote the stability and economic security of families, and to promote national interests in... stability in the family and productivity in the workplace. FMLA will encourage the development of high...
Molten Chloride Salts for Heat Transfer in Nuclear Systems
Ambrosek, James Wallace
2011-12-01
A forced convection loop was designed and constructed to examine the thermal-hydraulic performance of molten KCl-MgCl2 (68-32 at %) salt for use in nuclear co-generation facilities. As part of this research, methods for prediction of the thermo-physical properties of salt mixtures for selection of the coolant salt were studied. In addition, corrosion studies of 10 different alloys were exposed to the KCl-MgCl2 to determine a suitable construction material for the loop. Using experimental data found in literature for unary and binary salt systems, models were found, or developed to extrapolate the available experimental data to unstudied salt systems. These property models were then used to investigate the thermo-physical properties of the LINO3-NaNO3-KNO 3-Ca(NO3), system used in solar energy applications. Using these models, the density, viscosity, adiabatic compressibility, thermal conductivity, heat capacity, and melting temperatures of higher order systems can be approximated. These models may be applied to other molten salt systems. Coupons of 10 different alloys were exposed to the chloride salt for 100 hours at 850°C was undertaken to help determine with which alloy to construct the loop. Of the alloys exposed, Haynes 230 had the least amount of weight loss per area. Nickel and Hastelloy N performed best based on maximum depth of attack. Inconel 625 and 718 had a nearly uniform depletion of Cr from the surface of the sample. All other alloys tested had depletion of Cr along the grain boundaries. The Nb in Inconel 625 and 718 changed the way the Cr is depleted in these alloys. Grain-boundary engineering (GBE) of Incoloy 800H improved the corrosion resistance (weight loss and maximum depth of attack) by nearly 50% as compared to the as-received Incoloy 800H sample. A high temperature pump, thermal flow meter, and pressure differential device was designed, constructed and tested for use in the loop, The heat transfer of the molten chloride salt was found to
X-ray measurement of residual stress in metals at Chalk River Nuclear Laboratories
International Nuclear Information System (INIS)
Winegar, J.E.
1980-06-01
X-ray diffraction is used at CRNL to measure residual stress in metals. This report summarizes the basic principles of stress measurement, and reviews factors affecting accuracy of measurement. The technique and equipment described were developed at CRNL to give reliable measurements. Accuracy of measurement is achieved by using fixed-count step-scanning and by computer analysis of intensity data using a cubic spline curve smoothing routine. Specific reference is made to the measurement of residual stress in Inconel-600 and Incoloy-800 boiler tubing. Because it measures stress in thin surface layers, the X-ray method can also be used to measure the depth profile of stresses. As there are no standardized procedures for measuring residual stress, this report will be useful both to those unfamiliar with the measurement of residual stress and to those already making such measurements in other laboratories. (auth)
Tension layer winding of cable-in-conduit conductor
International Nuclear Information System (INIS)
Devernoe, A.; Ciancetta, G.; King, M.; Parizh, M.; Painter, T.; Miller, J.
1996-01-01
A 710 mm i.d. by 440 mm long, 6 layer Cable-in-Conduit (CIC) coil was precision tension layer wound with Incoloy 908 jacketed conductor to model winding technology that will be used for the Nb 3 Sn outsert coils of the 45 Tesla Hybrid Magnet Project at the US National High Magnetic Field Laboratory. This paper reports on the set up of a new winding facility with unique capabilities for insulating and winding long length CIC conductor and on special procedures which were developed to wind and support layer to layer transitions and to safely form conductor into and out of the winding. Analytical methods used to predict conduit keystoning, springback and back tensioning requirements before winding are reported in comparison to results obtained during winding and actual winding build-up dimensions on a layer by layer basis in comparison to design requirements
International Nuclear Information System (INIS)
Vancon, D.
1989-11-01
Dissolution kinetics and repassivation of inconel 600 in simulated primary coolant circuits of PWR is studied by fast traction experiment under potentiostatic control. The notion of elementary electrochemical transient is introduced. The model of anodic dissolution - film rupture allows the calculation of crack growth in constant deformation rate tests. When sulfur concentration is smaller than 100 micrograms/g the current is low, above the current is high. Calculation of crack growth from high level current are consistent with experimental data. Influence of pH, temperature, solution composition are determined. A Comparative study with nickel, incoloy 690 and a 19% chromium alloy was carried out to understand fast traction phenomena. Chromium plays an important part without pollution a protecting chromium oxide is formed. In polluted environment sulfur prevent nucleation of this compound and chromium hydroxides are precipitated on the surface. With pure nickel there is no passivity in presence of sulfur [fr
Arc-discharge system for nondestructive detection of flaws in thin ceramic coatings
International Nuclear Information System (INIS)
Scott, G.W.; Davis, E.V.
1978-04-01
The feasibility of nondestructively detecting small cracks or holes in plasma-sprayed ceramic coatings with an electric arc-discharge system was studied. We inspected ZrO 2 coatings 0.46 mm (0.018 in.) thick on Incoloy alloy 800 substrates. Cracks were artificially induced in controlled areas of the specimens by straining the substrates in tension. We designed and built a system to scan the specimen's surface at approximately 50 μm (0.002 in.) clearance with a sharp-pointed metal-tipped probe at high dc potential. The system measures the arc currents occurring at flaws, or plots a map of the scanned area showing points where the arc current exceeds a preset threshold. A theoretical model of the probe-specimen circuit shows constant dc potential to be the best choice for arc-discharge inspection of insulating coatings. Experimental observations and analysis of the data disclosed some potential for flaw description
International Nuclear Information System (INIS)
Farmer, J.C.; McCright, R.D.
1988-01-01
Container materials may undergo any of several modes of degradation in this environment, including: undesirable phase transformations due to lack of phase stability; atmospheric oxidation; general aqueous corrosion; pitting; crevice corrosion; intergranular stress corrosion cracking (IGSCC); and transgranular stress corrosion cracking (TGSCC). This paper is an analysis of data from the literature relevant to the pitting, crevice corrosion, and stress corrosion cracking (SCC) of these alloys. Though all three austenitic candidates have demonstrated pitting and crevice corrosion in chloride-containing environments, Alloy 825 has the greatest resistance to these forms of localized attack. Both types 304L and 316L stainless steels are susceptible to SCC in acidic chloride media. In contrast, SCC has not been documented for Alloy 825 under comparable conditions. Gamma irradiation has been found to enhance SCC of Types 304 and 304L stainless steels, but it has no detectable effect on the resistance of Alloy 825 to SCC. Furthermore, while microbiologically induced corrosion effects have been observed for 300-series stainless steels, nickel-based alloys such as Alloy 825 seem to be immune to such problems. Of the copper-based alloys, CDA 715 has the best overall resistance to localized attack. Its resistance to pitting is comparable to that of CDA 613 and superior to that of CDA 102. Observed rates of dealloying in CDA 715 are less than those observed in CDA 613 by orders of magnitude. The resistance of CDA 715 to SCC in tarnishing ammonical environments is comparable to that of CDA 102 and superior to that of CDA 613. Its resistance to SCC in nontarnishing ammonical environments is comparable to that of CDA 613 and superior to that of CDA 102. 22 refs., 8 figs., 4 tabs
Pre-Stretched Low Equivalent Weight PFSA Membranes with Improved Fuel Cell Performance
DEFF Research Database (Denmark)
Zhang, Wenjing (Angela); Wycisk, Ryszard; Kish, Daniel L.
2014-01-01
for the morphological changes to be permanent. For 825 EW PFSA, stretching increased the polymer crystallinity by 22.5%, with a reduction in methanol permeability and a small increase in proton conductivity. In direct methanol fuel cell tests at 60◦C with 1.0 M methanol, the power density at 0.4 V with a DR = 4...... stretched 825 EW membrane (72 mW/cm2) was considerably greater than that obtained with a solution-cast membrane (28 mW/cm2) or with a commercial Nafion 117 membrane (55 mW/cm2). For 733 EW PFSA, stretching promoted the formation of ordered ionic domains leading to an increase in proton conductivity...
TPX: Contractor preliminary design review. Volume 5, Manufacturing R ampersand D
International Nuclear Information System (INIS)
Roach, J.F.; Urban, W.M.; Hartman, D.
1995-01-01
TPX Insulation ampersand Impregnation R ampersand D test results are reported for 1x2 samples designed for screening candidate conduit insulation systems for TPX PF and TF coils. The epoxy/glass insulation system and three proposed alternate insulation systems employing Kapton, was evaluated in as received sample condition and after 10 thermal cycles in liquid nitrogen. Two DGBA impregnation systems, Shell 826 and CTD101K were investigated. Square incoloy 908 and 316 LN stainless hollow conduits were used for 1x2 sample fabrication. Capacitance, dielectric loss, and insulation resistance dielectric characteristics were measured for all samples. Partial discharge performance was measured for samples either in air, under silicon oil, or under liquid nitrogen up to 10kVrms at 60 Hz. Hipot screening was performed at 10 kVdc. The samples were cross sectioned and evaluated for impregnation quality. The implications of the test results on the TPX preliminary design decision are discussed
Comparison of French and German NPP water chemistry programs
International Nuclear Information System (INIS)
Staudt, U.; Odar, S.; Stutzmann, A.
2002-01-01
PWRs in the western hemisphere obey basically the same rules concerning design, choice of material and operational mode. In spite of these basic similarities, the manufacturers of PWRs in different countries developed different solutions in respect to single components in the steam/water cycle. Looking specifically at France and Germany, the difference in the tubing material of the steam generators (Inconel 600/690 chosen by Framatome and Incoloy 800 chosen by the former Siemens KWU) led to specific differences in the respective chemistry programs and in some respect to different 'philosophies' in operating the water/steam cycle. Compared to this, basic differences in operating the reactor coolant system cannot be observed. Nevertheless specific solutions as zinc injection and the use of enriched B-10 are applied in German PWRs. The application of such measures arises from a specific dose rate situation in older PWRs (zinc injection) or from economic reasons mainly (B-10). (authors)
International Nuclear Information System (INIS)
Susei, S.; Shimizu, S.; Aota, T.
1982-04-01
In this report, electron-beam (EB) welded joints and TIG welded joints of various superalloys to be used for nuclear plants, such as Hastelloy-type, Inconel-type and Incoloy-type, are systematically evaluated in terms of tensile properties, low-cycle fatigue properties at elevated temperatures, creep and creep-rupture properties. It was fully confirmed as conclusion that the EB welded joints are superior to the TIG welded ones in mechanical properties, especially at high temperature. In the evaluation of creep properties, ductility is one of the most important criteria to represent the resistance against fracture due to creep deformation, and this criterion is very useful in evaluating the properties of welded joints. Therefore, the more comparable to the base metal the electron beam welded joint becomes in terms of ductility, the more resistant is it against fracture. From this point of view, the electron beam welded joint is considerably superior to the TIG welded joint [fr
Tritium permeation through helium-heated steam generators of ceramic breeder blankets for DEMO
International Nuclear Information System (INIS)
Fuetterer, M.A.; Raepsaet, X.; Proust, E.
1994-01-01
The specifications of permeation barriers, tritium recovery process maintaining a very low tritium activity in the coolant, and control of the coolant chemistry, required the evaluation of the tritium losses through the steam generators and include the definition of its operating conditions by thermodynamic cycle calculations and its thermal-hydraulic design. For both tasks specific computer tools were developed. The obtained geometry, surface area, and temperature profiles along the heat exchanger tubes were then used to estimate the daily tritium permeation into the steam cycle. Steam oxidized Incoloy 800 austenitic stainless steel was identified as the best suited existing material; in nominal steady-state operation, the tritium escape into the steam cycle could be restricted to less than 10 Ci/d. Tritium permeation during temperature and pressure transients in the steam generator (destruction and possible self-healing of the permeation barrier) is identified to bear a large tritium release potential. Solutions are proposed. (from authors). 4 figs., 1 tab
Tritium permeation through helium-heated steam generators of ceramic breeder blankets for DEMO
Energy Technology Data Exchange (ETDEWEB)
Fuetterer, M A; Raepsaet, X; Proust, E
1994-12-31
The specifications of permeation barriers, tritium recovery process maintaining a very low tritium activity in the coolant, and control of the coolant chemistry, required the evaluation of the tritium losses through the steam generators and include the definition of its operating conditions by thermodynamic cycle calculations and its thermal-hydraulic design. For both tasks specific computer tools were developed. The obtained geometry, surface area, and temperature profiles along the heat exchanger tubes were then used to estimate the daily tritium permeation into the steam cycle. Steam oxidized Incoloy 800 austenitic stainless steel was identified as the best suited existing material; in nominal steady-state operation, the tritium escape into the steam cycle could be restricted to less than 10 Ci/d. Tritium permeation during temperature and pressure transients in the steam generator (destruction and possible self-healing of the permeation barrier) is identified to bear a large tritium release potential. Solutions are proposed. (from authors). 4 figs., 1 tab.
TPX: Contractor preliminary design review. Volume 5, Manufacturing R&D
Energy Technology Data Exchange (ETDEWEB)
Roach, J.F.; Urban, W.M.; Hartman, D. [Everson Electric Co., Bekthlehem, PA (United States)
1995-08-04
TPX Insulation & Impregnation R&D test results are reported for 1x2 samples designed for screening candidate conduit insulation systems for TPX PF and TF coils. The epoxy/glass insulation system and three proposed alternate insulation systems employing Kapton, was evaluated in as received sample condition and after 10 thermal cycles in liquid nitrogen. Two DGBA impregnation systems, Shell 826 and CTD101K were investigated. Square incoloy 908 and 316 LN stainless hollow conduits were used for 1x2 sample fabrication. Capacitance, dielectric loss, and insulation resistance dielectric characteristics were measured for all samples. Partial discharge performance was measured for samples either in air, under silicon oil, or under liquid nitrogen up to 10kVrms at 60 Hz. Hipot screening was performed at 10 kVdc. The samples were cross sectioned and evaluated for impregnation quality. The implications of the test results on the TPX preliminary design decision are discussed.
International Nuclear Information System (INIS)
Breitbach, G.; Ahmed, K.; Over, H.; Schubert, F.; Nickel, H.
1991-10-01
The wall thickness of tubes in high temperature plants must be limited in such a way that pressure differences can not produce unadmissible deformations. For HTR (PNP-Plant) the postulated loss of secondary pressure is one of the considered accidents. In that case the tubes of the heat exchangers are loaded by the outher pressure of the primary coolant. So the risk of a creep collapse is given. The report is related to experimental and theoretical work for the creep collapse phenomena. HTR relevant tube geometries of the high temperature alloys NiCr22Co12Mo (INCONEL 617) and X10NiCrAlTi 32 20 (INCOLOY 800) were tested at temperatures of 900 and 950deg C and outer pressure loads in the range 40 bars. The experimental results are compared with theoretically computed values and discussed. The problem of safety margin is treated. Further, simplified procedures are developed for the estimation of the collapse time. (orig.) [de
International Nuclear Information System (INIS)
Brixy, H.; Hecker, R.; Oehmen, J.; Barbonus, P.; Hans, R.
1982-06-01
The behaviour was studied of NiCr-Ni sheathed thermocouples (sheath Inconel 600 or Incoloy 800, insulation MgO) in a helium and carbon atmosphere at temperatures of 950-1150 deg. C. All the thermocouples used retained their functional performance. The insulation resistance tended towards a limit value which is dependent on the temperature and quality of the thermocouple. Temperature measurements were loaded with great uncertainty in the temperature range of 950-1150 deg. C. Recalibrations at the temperature of 950 deg. C showed errors of up to 6%. Measuring sensors were developed which consist of a sheathed double thermocouple with a noise resistor positioned between the two hot junctions. Using the noise thermometer it is possible to recalibrate the thermocouple at any time in situ. A helium system with a high temperature experimental area was developed to test the thermocouples and the combined thermocouple-noise thermometer sensors under true experimental conditions
Comparison of French and German NPP water chemistry programs
Energy Technology Data Exchange (ETDEWEB)
Staudt, U. [VGB Powertech (Germany); Odar, S. [Framatome ANP GmbH (Germany); Stutzmann, A. [EDF/GDL (France)
2002-07-01
PWRs in the western hemisphere obey basically the same rules concerning design, choice of material and operational mode. In spite of these basic similarities, the manufacturers of PWRs in different countries developed different solutions in respect to single components in the steam/water cycle. Looking specifically at France and Germany, the difference in the tubing material of the steam generators (Inconel 600/690 chosen by Framatome and Incoloy 800 chosen by the former Siemens KWU) led to specific differences in the respective chemistry programs and in some respect to different 'philosophies' in operating the water/steam cycle. Compared to this, basic differences in operating the reactor coolant system cannot be observed. Nevertheless specific solutions as zinc injection and the use of enriched B-10 are applied in German PWRs. The application of such measures arises from a specific dose rate situation in older PWRs (zinc injection) or from economic reasons mainly (B-10). (authors)
International Nuclear Information System (INIS)
Corrieu, J.M.; Cortial, F.; Maillard, J.L.; Vernot-Loier, C.; Lebeau, M.
1994-01-01
The INCO ''INCOLOY 800'' trademark groups the Fe-Cr-Ni alloys containing 30 to 35% nickel, 19 to 23% chromium, 0,15 to 0,60% aluminium, 0,15 to 0,60% titanium and less than 0,10% carbon contents, used as construction materials for condenser and heat exchanger tubes. In parallel with water chemistry control and studies aimed at reducing the residual stresses resulting from tube expansion, studies have been conducted to a better understanding of this alloy, its metallurgy and its corrosion behaviour under accurately defined fabrication and heat treatment conditions. The purpose of this paper is to present the results of a behaviour study of INDRET alloy 800 concerning isothermal relaxation and effects of the said relaxation heat treatments on alloy microstructure studied with a transmission electron-chemical method to determine the sensitiveness to intergranular corrosion, and by electrochemistry in pressurized hot water. (authors). 4 figs., 5 tabs., 7 refs
Reduction of tritium permeation through Inconel 718 and Incoloy 800 HT by means of natural oxides
Energy Technology Data Exchange (ETDEWEB)
Aiello, A., E-mail: antonio.aiello@enea.it [ENEA C.R. Brasimone, I-40032 Camugnano (Italy); Utili, M.; Ciampichetti, A. [ENEA C.R. Brasimone, I-40032 Camugnano (Italy)
2011-10-01
Chronical releases of tritium from the helium primary coolant into the water secondary coolant is a fundamental safety issue in the design of a fusion reactor steam generator. It is well known that the steam/water circuit of a fusion reactor would be considered not relevant from a radiological point of view, while if a strong permeation of tritium will be present it will be released together with incondensable gases in the condenser. The permeation of hydrogen isotopes through candidate steam generator materials in different conditions was studied in the past. Further experiments demonstrated that nickel alloys of nuclear interest are always covered by a thin and adherent oxide layer able to reduce permeation of orders of magnitude. The major objective of this work is the evaluation of the permeated flux through nickel alloys, when exposed to pure hydrogen and to an oxidant gas stream, to verify the real permeability of these materials in conditions close to those foreseen in the helium side of the steam generator.
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLC485 (Link to dictyBase) - - - Contig-U16358-1 SLC485Z (Link... to Original site) - - SLC485Z 452 - - - - Show SLC485 Library SL (Link to library) Clone ID SLC485 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-D/SLC485Q.Seq.d/ Representative seq. ID SLC48...5Z (Link to Original site) Representative DNA sequence >SLC485 (SLC485Q) /CSM/SL/SLC4-D/SLC485Q.Seq.d/ XXXXX... 825 0.0 SLG820 (SLG820Q) /CSM/SL/SLG8-A/SLG820Q.Seq.d/ 825 0.0 SLC485 (SLC485Q) /CSM/SL/SLC4-D/SLC4
Energy Technology Data Exchange (ETDEWEB)
Russell, E.W.; Clarke, W. [Lawrence Livermore National Lab., CA (United States); Domian, H.A. [Babcock and Wilcox Co., Lynchburg, VA (United States); Madson, A.A. [Kaiser Engineers California Corp., Oakland, CA (United States)
1991-08-01
This report summarizes the bottoms-up cost estimates for fabrication of high-level radioactive waste disposal containers based on the Site Characterization Plan Conceptual Design (SCP-CD). These estimates were acquired by Babcock and Wilcox (B&S) under sub-contract to Lawrence Livermore National Laboratory (LLNL) for the Yucca Mountain Site Characterization Project (YMP). The estimates were obtained for two leading container candidate materials (Alloy 825 and CDA 715), and from other three vendors who were selected from a list of twenty solicited. Three types of container designs were analyzed that represent containers for spent fuel, and for vitrified high-level waste (HLW). The container internal structures were assumed to be AISI-304 stainless steel in all cases, with an annual production rate of 750 containers. Subjective techniques were used for estimating QA/QC costs based on vendor experience and the specifications derived for the LLNL-YMP Quality Assurance program. In addition, an independent QA/QC analysis is reported which was prepared by Kasier Engineering. Based on the cost estimates developed, LLNL recommends that values of $825K and $62K be used for the 1991 TSLCC for the spent fuel and HLW containers, respectively. These numbers represent the most conservative among the three vendors, and are for the high-nickel anstenitic steel (Alloy 825). 6 refs., 7 figs.
Modified Mathematical Model For Neutralization System In Stirred Tank Reactor
Directory of Open Access Journals (Sweden)
Ahmmed Saadi Ibrehem
2011-05-01
Full Text Available A modified model for the neutralization process of Stirred Tank Reactors (CSTR reactor is presented in this study. The model accounts for the effect of strong acid [HCL] flowrate and strong base [NaOH] flowrate with the ionic concentrations of [Cl-] and [Na+] on the Ph of the system. In this work, the effect of important reactor parameters such as ionic concentrations and acid and base flowrates on the dynamic behavior of the CSTR is investigated and the behavior of mathematical model is compared with the reported models for the McAvoy model and Jutila model. Moreover, the results of the model are compared with the experimental data in terms of pH dynamic study. A good agreement is observed between our model prediction and the actual plant data. © 2011 BCREC UNDIP. All rights reserved(Received: 1st March 2011, Revised: 28th March 2011; Accepted: 7th April 2011[How to Cite: A.S. Ibrehem. (2011. Modified Mathematical Model For Neutralization System In Stirred Tank Reactor. Bulletin of Chemical Reaction Engineering & Catalysis, 6(1: 47-52. doi:10.9767/bcrec.6.1.825.47-52][How to Link / DOI: http://dx.doi.org/10.9767/bcrec.6.1.825.47-52 || or local: http://ejournal.undip.ac.id/index.php/bcrec/article/view/825 ] | View in
International Nuclear Information System (INIS)
Russell, E.W.; Clarke, W.; Domian, H.A.; Madson, A.A.
1991-08-01
This report summarizes the bottoms-up cost estimates for fabrication of high-level radioactive waste disposal containers based on the Site Characterization Plan Conceptual Design (SCP-CD). These estimates were acquired by Babcock and Wilcox (B ampersand S) under sub-contract to Lawrence Livermore National Laboratory (LLNL) for the Yucca Mountain Site Characterization Project (YMP). The estimates were obtained for two leading container candidate materials (Alloy 825 and CDA 715), and from other three vendors who were selected from a list of twenty solicited. Three types of container designs were analyzed that represent containers for spent fuel, and for vitrified high-level waste (HLW). The container internal structures were assumed to be AISI-304 stainless steel in all cases, with an annual production rate of 750 containers. Subjective techniques were used for estimating QA/QC costs based on vendor experience and the specifications derived for the LLNL-YMP Quality Assurance program. In addition, an independent QA/QC analysis is reported which was prepared by Kasier Engineering. Based on the cost estimates developed, LLNL recommends that values of $825K and $62K be used for the 1991 TSLCC for the spent fuel and HLW containers, respectively. These numbers represent the most conservative among the three vendors, and are for the high-nickel anstenitic steel (Alloy 825). 6 refs., 7 figs
The poor or the kids? Distributional impacts of taxes and benefits among Czech households
Czech Academy of Sciences Publication Activity Database
Dušek, Libor; Kalíšková, Klára; Münich, Daniel
2015-01-01
Roč. 24, č. 5 (2015), s. 602-617 ISSN 1210-0455 Institutional support: PRVOUK-P23 Keywords : TAXBEN models * redistribution * income inequality Subject RIV: AH - Economics Impact factor: 0.825, year: 2015
Anesthesia Awareness (Waking Up) During Surgery
... after surgery. This is normal. You might even dream during surgery and only think you experienced awareness. ... Stories Policymakers Media ASA Member Toolkit Headquarters 1061 American Lane Schaumburg, IL 60173-4973 telephone: (847) 825- ...
FastStats: Birth Defects or Congenital Anomalies
... this? Submit What's this? Submit Button NCHS Home Birth Defects or Congenital Anomalies Recommend on Facebook Tweet ... 4,825 Infant deaths per 100,000 live births: 121.3 Cause of infant death rank: 1 ...
2013-12-18
...(a)-825(r). h. Applicant Contact: Dr. Darrell Townsend, P.O. Box 70, Langley, Oklahoma, 74350-0070; (918) 256-0616; [email protected] . i. FERC Contact: Stephen Bowler, (202) 502-6861, or stephen.bowler...
A low-power wide range transimpedance amplifier for biochemical sensing.
Rodriguez-Villegas, Esther
2007-01-01
This paper presents a novel low voltage and low power transimpedance amplifier for amperometric potentiostats. The power is optimized by having three different gain settings for different current ranges, which can be programmed with a biasing current. The voltage ranges have been optimized by using FGMOS transistors in a second voltage amplification stage that simultaneously allow for offset calibration as well as independent biasing of the gates. The circuit operates with input currents from 1 pA to 1 microA, with a maximum power supply voltage of 1.5 V and consumes 82.5 nW, 9.825 microW, 47.325 microW for currents varying from (1 pA, 0.25 nA), (0.25 nA, 62.5 nA) and (62.5 nA, 1 microA) respectively.
78 FR 1200 - Endangered and Threatened Species; Take of Anadromous Fish
2013-01-08
..., 1655 Heindon Road, Arcata, CA 95521, (707) 825-5171. The permit application may be viewed online at... the ESA to mean to harass, harm, pursue, hunt, shoot, wound, kill, trap, capture, or collect, or to...
Czech Academy of Sciences Publication Activity Database
Kovalská, M.; Hruška-Plocháň, Marian; Ostrup, O.; Adamkov, M.; Lehotský, J.; Strejček, F.; Statelová, M.; Mikušková, K.; Varga, I.; Petrovičová, I.
2012-01-01
Roč. 67, č. 4 (2012), s. 818-825 ISSN 0006-3088 Institutional support: RVO:67985904 Keywords : embryonic genome activation * nucleous * gene expression Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.506, year: 2012
Extremely Low Loss THz Guidance Using Kagome Lattice Porous Core Photonic Crystal Fiber
DEFF Research Database (Denmark)
Hossain, Anwar; Hasanuzzaman, G.K.M.; Habib, Selim
2015-01-01
A novel porous core Kagome lattice photonic crystal fiber is proposed for extremely low loss THz waves guiding. It has been reported that 82.5% of bulk effective material loss of Topas can be reduced...
Genetics Home Reference: glutaric acidemia type I
... Glutaric acidemia type 1 in patients of Lumbee heritage from North Carolina. Mol Genet Metab. 2006 May; ... 825-8. Review. Citation on PubMed More from Genetics Home Reference Bulletins Genetics Home Reference Celebrates Its ...
Czech Academy of Sciences Publication Activity Database
Huang, J.; Kumar, S.; Abbassi-Ghadi, N.; Španěl, Patrik; Smith, D.
2013-01-01
Roč. 85, č. 6 (2013), s. 3409-3416 ISSN 0003-2700 Institutional support: RVO:61388955 Keywords : SOLID-PHASE MICROEXTRACTION * SIFT-MS * ORGANIC-COMPOUNDS Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 5.825, year: 2013
Czech Academy of Sciences Publication Activity Database
Kumar, S.; Huang, J.; Abbassi-Ghadi, N.; Španěl, Patrik; Smith, D.; Hanna, G. B.
2013-01-01
Roč. 85, č. 12 (2013), s. 6121-6128 ISSN 0003-2700 Institutional support: RVO:61388955 Keywords : SOLID-PHASE MICROEXTRACTION * SIFT-MS * GASTROESOPHAGEAL CANCER Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 5.825, year: 2013
LiDAR (Terrain), THURSTON COUNTY, WASHINGTON, USA
Federal Emergency Management Agency, Department of Homeland Security — Fugro EarthData Company furnished the collection, processing, and development of LiDAR for 825 square miles in Washington (805 square miles of Thurston County and 20...
Czech Academy of Sciences Publication Activity Database
Svoboda, Jiří; Fischer, F. D.; Klinger, L.; Rabkin, E.
2014-01-01
Roč. 94, č. 30 (2014), s. 3398-3412 ISSN 1478-6435 Institutional support: RVO:68081723 Keywords : grain boundary diffusion * liquid metals * stress analysis * interfacial thermodynamics Subject RIV: BJ - Thermodynamics Impact factor: 1.825, year: 2014
Liquid Phase Isomerisation of Dichlorobenzenes over H-Zeolites
Czech Academy of Sciences Publication Activity Database
Kaucký, Dalibor; Fajula, F.; Moreau, P.; Finiels, A.
2003-01-01
Roč. 243, - (2003), s. 301-307 ISSN 0926-860X Institutional research plan: CEZ:AV0Z4040901 Keywords : dichlorobenzenes * isomerisation * H-ZSM-5 Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.825, year: 2003
Synthesis of Diphenylamine Catalyzed by Zeolites
Czech Academy of Sciences Publication Activity Database
Hronec, M.; Cvengrošová, Z.; Čejka, Jiří
2003-01-01
Roč. 255, - (2003), s. 197-202 ISSN 0926-860X Institutional research plan: CEZ:AV0Z4040901 Keywords : zeolites beta * bentonite * Bronsted site Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.825, year: 2003
Full Text Available ... CDC) 97,825 views 5:12 CDC Flu Education Video - Duration: 10:26. Nicole Shelton 213 views ... Infection Control Video - Duration: 20:55. Paramedical Services Education Page 4,735 views 20:55 Hand Washing ...
Czech Academy of Sciences Publication Activity Database
Kumari, A.; Papenfus, H. B.; Kulkarni, M. G.; Pošta, Martin; van Staden, J.
2015-01-01
Roč. 17, č. 4 (2015), s. 825-830 ISSN 1435-8603 Institutional support: RVO:61388963 Keywords : karrikinolide * pollen germination * pollen tube growth * smoke-water * trimethylbutenolide Subject RIV: CC - Organic Chemistry Impact factor: 2.216, year: 2015
2010-12-01
...--825r. h. Applicant Contact: Mr. Lance E. Houser, P.E., Assistant City Engineer, 290 North 100 West..., here P-13820, in the docket number field to access the document. For assistance, call toll-free 1-866...
On Eddy current examination (ECE) of Incoloy 800 SG tube using OD encircling and ID bobbin coil
International Nuclear Information System (INIS)
Kapoor, K.; Sunder Krishna, K.; Bakshu, S.A.
2015-01-01
The purpose of this paper is to present and compare the results of ECE carried out on steam generator tubes from OD side and ID side. During the manufacturing of the tubes Eddy current testing is being carried out using OD encircling probe as per ASTM E 571. Here the purpose of the test is to capture the manufacturing defects. The parameters of the test are optimized to achieve best sensitivity to this requirement. These tubes are then installed in the steam generator and once again ECE is carried out during installation (pre-service inspection-PSI) and during in-service inspection (ISI) by using ID bobbin coil. These tests are carried out as per ASME section V article 8 appendix 1. Here the purpose of the test is to detect wall thinning, dent, pits etc due to operation and to locate these defects (OD side or ID side). Here the operating parameters are optimized for phase separation of defects from OD and ID. These parameters are quite different from those used during the manufacturing ECE. Interpretation of the signals detected in PSI/ISI in must be done with care to correlate with defect indications detected during manufacturing. In the present study, tubes with certain manufacturing defects, detected with OD encircling test were subjected to ID bobbin coil examination. Also certain tubes with signal picked up during test from ID were examined by using the OD encircling probe. This comparison of the results provides a clear picture about the sensitivity and deficiency of the either type of test. (author)
International Nuclear Information System (INIS)
Penkalla, H.J.; Nickel, H.; Schubert, F.
1989-01-01
At temperatures above 800 0 C the material behaviour under mechanical load is determined by creep. The service of heat exchanging components leads to multiaxial loading conditions. For design and inelastic analysis of the component behaviour time dependent design values and suitable constitutive equations are necessary. The present report gives a survey of the approaches to describing creep under multiaxial loading. Norton's law and v. Mises' theory are applied. The load combinations of internal pressure, tensile and torsional stress are studied more closely, cyclic stress superposition in the tensile-pulsating range is discussed and cases of partial relaxation are examined. Experimental results are presented for the loading conditions discussed, and satisfactory agreement between theory and experiment has been found up to now for these results. Regarding lifetime determination under multiaxial creep load, a more precise analysis of creep damage is presented suggesting a suitable deviatoric stress for evaluation in the long-time range. (orig.)
Hamed, Saja H; Altrabsheh, Bilal; Assa'd, Tareq; Jaradat, Said; Alshra'ah, Mohammad; Aljamal, Abdulfattah; Alkhatib, Hatim S; Almalty, Abdul-Majeed
2012-12-01
Different probes are used in dermato-cosmetic research to measure the electrical properties of the skin. The principle governing the choice of the geometry and material of the measuring probe is not well defined in the literature and some device's measuring principles are not accessible for the scientific community. The purpose of this work was to develop a simple inexpensive conductance meter for the objective in vivo evaluation of skin hydration. The conductance meter probe was designed using the basic equation governing wave propagation along Transverse Electromagnetic transmission lines. It consisted of two concentric copper circular electrodes printed on FR4 dielectric material. The performance of the probe was validated by evaluating its measurement depth, its ability to monitor in vitro water sorption-desorption and in vivo skin hydration effect in comparison to that of the Corneometer CM 825. The measurement depth of the probe, 15 μm, was comparable to that of CM 825. The in vitro readings of the probe correlated strongly with the amount of water adsorbed on filter paper. Skin hydration after application of a moisturizer was monitored effectively by the new probe with good correlation to the results of CM 825. In conclusion, a simple probe for evaluating skin hydration was made from off-the-shelf materials and its performance was validated in comparison to a commercially available probe. Copyright © 2012 IPEM. Published by Elsevier Ltd. All rights reserved.
RICE VALUE CHAIN ANALYSIS IN TANZANIA: IDENTIFICATION OF ...
African Journals Online (AJOL)
ACSS
A sample of 240 producers, 60 traders and 30 processors was involved in the study. .... Information from traders, processors and other actors ..... free (8-25%), exchange seeds (10-18%) and own .... measurements such as tins and bags; while.
The catastrophic flood in February/March 1784 - a natural disaster of European scope
Czech Academy of Sciences Publication Activity Database
Munzar, Jan; Elleder, L.; Deutsch, M.
2005-01-01
Roč. 13, č. 1 (2005), s. 8-25 ISSN 1210-8812 Institutional research plan: CEZ:AV0Z30860518 Keywords : winter flood 1784 * Central and West Europe * documentation and impacts Subject RIV: DE - Earth Magnetism, Geodesy, Geography
77 FR 108 - Lockhart Power Company, Inc.; Notice Soliciting Scoping Comments
2012-01-03
... affect any federal lands. g. Filed Pursuant to: Federal Power Act 16 U.S.C. 791 (a)-825(r). h. Applicant Contacts: Bryan D. Stone, Chief Operating Officer, Lockhart Power Company, Inc., 420 River Street, P.O. Box...
2012-05-14
...: Federal Power Act, 16 U.S.C. 791(a)-825(r). h. Applicant Contact: Bryan D. Stone, Chief Operating Officer... filing, documents may also be paper-filed. To paper-file, mail an original and seven copies to: Kimberly...
2012-10-10
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. EL12-110-000] Arkansas Electric Cooperative Corporation; Mississippi Delta Energy Agency; Clarksdale Public Utilities Commission.... 825(h), Arkansas Electric Cooperative Corporation, Mississippi Delta Energy Agency, and its two...
Pyrolysis of low-boiling gas condensate of the Shatlyk field
Energy Technology Data Exchange (ETDEWEB)
Khankuliyev, K.; Kul' dzhayev, B.A.; Magaril, R.Z.; Sergiyenko, S.R.
1984-01-01
A study was made of pyrolysis of the 60-180/sup 0/C fraction of condensate from the Shatlyk field at temperature 800-850/sup 0/ and contact time of 0.3-1.5 sec. An optimal pyrolysis mode was selected (825/sup 0/C, contact time 0.5-0.7 sec) at which there is simultaenously high yield of ethylene (36-40%) and olefins C/sub 2/-C/sub 4/ (60-61%). It is shown that the total yield of olefins and ethylene, as well as the correlation in them of ethylene/propylene, can be regulated by changing the temperature and contact time in the process. The maximum ethylene yields with the highest selectivity indicators for ethylene are observed under the following conditions: temperature 825/sup 0/C and contact time 0.9 sec; 850/sup 0/C and 0.7 sec.
Energy Technology Data Exchange (ETDEWEB)
Strum, M.J.; Weiss, H.; Farmer, J.C. (Lawrence Livermore National Lab., CA (USA)); Bullen, D.B. (Science and Engineering Associates, Inc., Pleasanton, CA (USA))
1988-06-01
This volume surveys the effects of welding on the degradation modes of three austenitic alloys: Types 304L and 316L stainless steels and Alloy 825. These materials are candidates for the fabrication of containers for the long-term storage of high-level nuclear waste. The metallurgical characteristics of fusion welds are reviewed here and related to potential degradation modes of the containers. Three specific areas are discussed in depth: (1) decreased resistance to corrosion in the forms of preferential corrosion, sensitization, and susceptibility to stress corrosion cracking, (2) hot cracking in the heat-affected zone and the weld zone, and (3) formation of intermetallic phases. The austenitic alloys are ranked as follows in terms of overall weldability: Alloy 825 (best) > Type 316L stainless steel > Type 304L stainless steel (worst). 108 refs., 31 figs., 7 tabs.
International Nuclear Information System (INIS)
Strum, M.J.; Weiss, H.; Farmer, J.C.; Bullen, D.B.
1988-06-01
This volume surveys the effects of welding on the degradation modes of three austenitic alloys: Types 304L and 316L stainless steels and Alloy 825. These materials are candidates for the fabrication of containers for the long-term storage of high-level nuclear waste. The metallurgical characteristics of fusion welds are reviewed here and related to potential degradation modes of the containers. Three specific areas are discussed in depth: (1) decreased resistance to corrosion in the forms of preferential corrosion, sensitization, and susceptibility to stress corrosion cracking, (2) hot cracking in the heat-affected zone and the weld zone, and (3) formation of intermetallic phases. The austenitic alloys are ranked as follows in terms of overall weldability: Alloy 825 (best) > Type 316L stainless steel > Type 304L stainless steel (worst). 108 refs., 31 figs., 7 tabs
DEFF Research Database (Denmark)
Hashemi, Hamid; Christensen, Jakob Munkholt; Glarborg, Peter
A series of experimental and numerical investigations into hydrogen oxidation at high pressures and intermediate temperatures has been conducted. The experiments were carried out in a high pressure laminar flow reactor at 50 bar pressure and a temperature range of 600–900 K. The equivalence ratio......, the mechanism is used to simulate published data on ignition delay time and laminar burning velocity of hydrogen. The flow reactor results show that at reducing, stoichiometric, and oxidizing conditions, conversion starts at temperatures of 750–775 K, 800–825 K, and 800–825 K, respectively. In oxygen atmosphere......, ignition occurs at the temperature of 775–800 K. In general, the present model provides a good agreement with the measurements in the flow reactor and with recent data on laminar burning velocity and ignition delay time....
Badra, Jihad A.; Bokhumseen, Nehal; Mulla, Najood; Sarathy, Mani; Farooq, Aamir; Kalghatgi, Gautam; Gaillard, Patrick
2015-01-01
, are correlated with a fundamental chemical kinetic parameter, specifically, homogeneous gas-phase fuel/air ignition delay time. Ignition delay times for stoichiometric fuel/air mixtures are calculated at various constant volume conditions (835 K and 20 atm, 825 K
2013-05-20
.... Filed Pursuant to: Federal Power Act, 16 U.S.C. 791a-825r. h. Applicant Contact: Mr. Stephen J. Fisk... (202) 502- 8659. A copy is also available for inspection and reproduction at the address in item (h...
Lifescience Database Archive (English)
Full Text Available AISQDNGLVPI Sbjct: 184 WRTVVSIPNGPSALAVKEAAWGLARYAAISQDNGLVPI 221 >tr|Q8LK59|Q8LK59_METGY Fructose-bisphosphate aldolase OS=Metasequo...ia glyptostroboides PE=2 SV=1 Length = 319 Score = 322 bits (825), Expect = 1e-86 I
2013-12-20
...: Federal Power Act, 16 U.S.C. 791(a)-825(r). h. Applicant Contact: David Brown Kinloch, Lock 14 Hydro... of: (1) An existing 248-foot- long, 17-foot-high concrete lock and dam with a 319-foot-long stone...
DEFF Research Database (Denmark)
Swindell, W. R.; Cummings, S. R.; Sanders, J. L.
2012-01-01
Background: Characterization of long-term health trajectory in older individuals is important for proactive health management. However, the relative prognostic value of information contained in clinical profiles of nonfrail older adults is often unclear. Methods: We screened 825 phenotypic and ge...
Directory of Open Access Journals (Sweden)
Florin Pomoja
2013-05-01
Full Text Available This paper presents theoretical results of flow simulations, performed on cross-flow type turbine of 8.25 kW, and also the results obtained on the improved turbine, with modified shapes for the rotor, case, and guiding palette.
Indian Academy of Sciences (India)
dell
Material, BET Surface area (m2/g), Specific capacitance (F/g) at 0.2 A/g. Graphene oxide, -, 255. Reduced graphene oxide, -, 14. Non Ac-Sugar, 787, 104. Ac-Sugar, 655, 140. AC-rice husk, 547, 369. AC-jute, 825, 476.
A Development Methodology for Copper End Termination Paste — Part 1: Origin of Green Defects
Directory of Open Access Journals (Sweden)
Umesh Kumar
2002-01-01
etc. is discussed. Additionally, the influence of process condition such as dipping parameters, drying conditions etc., on the green cosmetic defects are discussed. Finally, properties of a copper termination, which can be processed between 800–825°C, are discussed.
Directory of Open Access Journals (Sweden)
Pedro Alberto Bolívar Chávez
2005-12-01
Full Text Available En Colombia existen alrededor de 2500 ha de rosas con destino a la exportación. Con el fin de mejorar el comportamiento en poscosecha de rosas de corte cultivadas en invernadero. Se realizó un ensayo en rosa variedad ‘Madame Delbard’, combinando tratamientos en pre y poscosecha. En precosecha: (1 Aplicaciones foliares de Hormonagro ANAâ (2 Testigo. En poscosecha: (1 Floríssima 825â; (2 Inmersión de los tallos en una solución con 0,2 % de Klip Calcioâ 8,4 % (CaO durante 15 s y Floríssima 825â 1 %; (3 1-Metilciclopropano (1-MCP 0,5 gm-3 más Floríssima 825â1 %; (4 solución de 200 mgL-1 de citrato de 8-hidroxiquinoleina (8-HQC más 800 mgL-1 de sulfato de aluminio (Al2 (SO43 más 2 % de sacarosa (C12H22O11 y (5 hipoclorito de calcio (Ca (ClO2 2 %. El manejo poscosecha consistió en hidratación, tratamiento de carga, almacenamiento y simulación de transporte. La mayor longevidad en florero se obtuvo en los tratamientos con ANA (ANA más Floríssima, 10,3 días; ANA más Floríssima más calcio, 9,3 días; y ANA más Floríssima más 1-MCP, 8,3 días y la menor, en los tratamientos con 8-HQC más Al2(SO43 más sacarosa. La interacción ANA más Floríssima disminuyó significativamente el cabeceo y aumentó el consumo de agua con respecto a los demás tratamientos. Se observó un efecto sinérgico entre ANA y CaO, el cual retardó el proceso de senescencia.In Colombia , there are approximately 2500 ha grown in roses for the purpose of exportation. In order to improve the postharvest behavior of cut roses grown under greenhouse conditions, a study was conducted with the ‘Madame Delbard‘ rose variety, combining pre and postharvest treatments. At preharvest: (1 Foliar sprays of Hormonagro ANAâ, and (2 Control. At postharvest: (1 Floríssima 825â; (2 Inmersion of the stems in a solution of 0,2 % Klip Calcioâ 8.4 % (CaO during 15 s and Floríssima 825â 1 %; (3 1-Methylcyclepropene (1-MCP 0,5 gm-3 plus Florissima 825â 1 %; (4
Automatic orbital GTAW welding: Highest quality welds for tomorrow's high-performance systems
Henon, B. K.
1985-01-01
Automatic orbital gas tungsten arc welding (GTAW) or TIG welding is certain to play an increasingly prominent role in tomorrow's technology. The welds are of the highest quality and the repeatability of automatic weldings is vastly superior to that of manual welding. Since less heat is applied to the weld during automatic welding than manual welding, there is less change in the metallurgical properties of the parent material. The possibility of accurate control and the cleanliness of the automatic GTAW welding process make it highly suitable to the welding of the more exotic and expensive materials which are now widely used in the aerospace and hydrospace industries. Titanium, stainless steel, Inconel, and Incoloy, as well as, aluminum can all be welded to the highest quality specifications automatically. Automatic orbital GTAW equipment is available for the fusion butt welding of tube-to-tube, as well as, tube to autobuttweld fittings. The same equipment can also be used for the fusion butt welding of up to 6 inch pipe with a wall thickness of up to 0.154 inches.
Directory of Open Access Journals (Sweden)
Ramaswami P.
2017-09-01
Full Text Available The present paper makes an attempt to depict the effect of ovality in the inlet pigtail pipe bend of a reformer under combined internal pressure and in-plane bending. Finite element analysis (FEA and experiments have been used. An incoloy Ni-Fe-Cr B407 alloy material was considered for study and assumed to be elastic-perfectly plastic in behavior. The design of pipe bend is based on ASME B31.3 standard and during manufacturing process, it is challenging to avoid thickening on the inner radius and thinning on the outer radius of pipe bend. This geometrical shape imperfection is known as ovality and its effect needs investigation which is considered for the study. The finite element analysis (ANSYS-workbench results showed that ovality affects the load carrying capacity of the pipe bend and it was varying with bend factor (h. By data fitting of finite element results, an empirical formula for the limit load of inlet pigtail pipe bend with ovality has been proposed, which is validated by experiments.
Safety analysis calculations for research and test reactors
International Nuclear Information System (INIS)
Chen, S.Y.; MacDonald, R.; MacFarlane, D.
1983-01-01
Safety issues for the two general types of reactors, i.e., the plate-type (MTR-type) reactor and the rod-type (TRIGA-type) reactor, resulting from the changes associated with LEU vs HEU fuels, are explored. The plate-type fuels are typically uranium aluminide (UAl/sub x/) compounds dispersed in aluminum and clad with aluminum. Moderation is provided by the water coolant. Self shut-down reactivity coefficients with HEU fuel are entirely a result of coolant heating, whereas with LEU fuel there is an additional shut down contribution provided by the direct heating of the fuel due to the Doppler coefficient. In contrast, the rod-type (TRIGA) fuels are mixtures of zirconium hydride, uranium, and erbium. This fuel mixture is formed into rods (approx. 1 cm diameter) and clad with stainless steel or Incoloy. In the TRIGA fuel the self-shutdown reactivity is more complex, depending on heating of the fuel rather than the coolant. Results of transient calculations performed with existing computer codes, most suited for each type of reactor, are presented
2010-03-30
... Electric Cooperative; North Carolina Electric Membership Corporation, Complainants v. Virginia Electric and... the Federal Power Act, 16 U.S.C. 824(e) and 825(e), Old Dominion Electric Cooperative and North Carolina Electric Membership Corporation (Complainants) filed a formal complaint against Virginia Electric...
High-temperature unimolecular decomposition of ethyl propionate
Giri, Binod; Alabbad, Mohammed; Farooq, Aamir
2016-01-01
This work reports rate coefficients of the thermal unimolecular decomposition reaction of ethyl propionate (EP) behind reflected shock waves over the temperature range of 976–1300 K and pressures of 825–1875 Torr. The reaction progress was monitored
The poor or the kids? Distributional impacts of taxes and benefits among Czech households
Czech Academy of Sciences Publication Activity Database
Dušek, Libor; Kalíšková, Klára; Münich, Daniel
2015-01-01
Roč. 24, č. 5 (2015), s. 602-617 ISSN 1210-0455 R&D Projects: GA TA ČR(CZ) TD010033 Institutional support: RVO:67985998 Keywords : TAXBEN models * redistribution * income inequality Subject RIV: AH - Economics Impact factor: 0.825, year: 2015
Label-Free Biosensing in Complex Media: A Referencing Approach
Czech Academy of Sciences Publication Activity Database
Špringer, Tomáš; Bocková, Markéta; Homola, Jiří
2013-01-01
Roč. 85, č. 12 (2013), s. 5637-5640 ISSN 0003-2700 R&D Projects: GA MŠk(CZ) LH11102 Institutional support: RVO:67985882 Keywords : BLOOD-PLASMA * BIOMARKER * PROTEIN Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 5.825, year: 2013
The Namibia bridge management system: a tool for preservation of structures on the road network
CSIR Research Space (South Africa)
Roux, MP
2010-10-01
Full Text Available This paper describes the development and implementation of a bridge management system (BMS) for the Namibia Roads Authority (NRA). Namibia is a vast country (825 420 km2) with a very low population density and the NRA is currently responsible...
Nutritional characterization of Moringa (Moringa oleifera Lam.) leaves
African Journals Online (AJOL)
Jane
2011-10-05
Oct 5, 2011 ... (0.63%), zinc (13.03 mg/kg), copper (8.25%), manganese (86.8 mg/kg), iron (490 mg/kg) and .... The leaves were harvested green, air-dried under shade ..... Meat quality of Nguni steers supplemented with Acacia karroo leaf.
Long-term neuro-endocrine sequelae after treatment for childhood medulloblastoma
Heikens, J.; Michiels, E. M.; Behrendt, H.; Endert, E.; Bakker, P. J.; Fliers, E.
1998-01-01
The occurrence of neuro-endocrine deficiencies following craniospinal irradiation for medulloblastoma is well known, but data concerning the spectrum and prevalence of endocrine abnormalities in adulthood are scarce. We studied endocrine function in 20 (median age 25 years) adult subjects, 8-25
Photoluminescence eigenmodes in the ZnO semiconductor microcavity on the Ag/Si substrate
Czech Academy of Sciences Publication Activity Database
Luo, X.; Wang, J.; Mao, H.; Remeš, Zdeněk; Král, Karel
2013-01-01
Roč. 112, č. 4 (2013), s. 821-825 ISSN 0947-8396 R&D Projects: GA MŠk LH12186 Institutional support: RVO:68378271 Keywords : ZnO * photoluminescence * microcavity Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.694, year: 2013
Czech Academy of Sciences Publication Activity Database
Jebavá, Marcela; Dyrčíková, Petra; Němec, Lubomír
2015-01-01
Roč. 430, DEC 15 (2015), s. 52-63 ISSN 0022-3093 Institutional support: RVO:67985891 Keywords : glass melt flow * mathematical modelling * energy distribution * space utilizatios * melting performance Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass Impact factor: 1.825, year: 2015
29 CFR 825.126 - Leave because of a qualifying exigency.
2010-07-01
... duty status of a covered military member; (6) Rest and recuperation. (i) To spend time with a covered... spouse, son, daughter, or parent (the “covered military member”) is on active duty or call to active duty...-notice deployment. (i) To address any issue that arises from the fact that a covered military member is...
29 CFR 825.112 - Qualifying reasons for leave, general rule.
2010-07-01
... employees. A father, as well as a mother, can take family leave for the birth, placement for adoption, or foster care of a child. (c) Active employee. In situations where the employer/employee relationship has... OTHER LAWS THE FAMILY AND MEDICAL LEAVE ACT OF 1993 Coverage Under the Family and Medical Leave Act...
26 CFR 1.825-1 - Unused loss deduction; in general.
2010-04-01
... TAX (CONTINUED) INCOME TAXES Mutual Insurance Companies (other Than Life and Certain Marine Insurance Companies and Other Than Fire Or Flood Insurance Companies Which Operate on Basis of Perpetual Policies Or...) provides that the unused loss deduction of a mutual insurance company subject to the tax imposed by section...
26 CFR 1.825-2 - Unused loss carryovers and carrybacks.
2010-04-01
... TAX (CONTINUED) INCOME TAXES Mutual Insurance Companies (other Than Life and Certain Marine Insurance Companies and Other Than Fire Or Flood Insurance Companies Which Operate on Basis of Perpetual Policies Or... insurance company taxable under section 821(a) must first determine the part of any unused losses for any...
Study on high-cycle fatigue behavior of candidate Fe-Cr-Ni alloys for SCWR
International Nuclear Information System (INIS)
Zhao Yuxiang; Liu Guiliang; Tang Rui; Xiong Ru; Qiao Yingjie
2014-01-01
In the design for supercritical water reactor (SCWR), the operating temperature, pressure, burn up and irradiation damage are very high, so it seems vital to make correct choice of structural materials in core and obtain their key application behavior which would beneficial the research and development of SCWR. In this paper, the high cycle fatigue (HCF) tests of commerce austenite alloys including 6XN and 825 were conducted under bending and rotating loads at room temperature (RT) as well as at 550 ℃ in air. The experimental data were analyzed and the S-N curves were processed, the fracture morphology was also observed by SEM. The results indicate that the fatigue limited stresses at RT for the 2 Fe-Cr-Ni alloy were in such order of 825 < 6XN, which consistent with the order of their tensile strength. Elevated temperature would accelerate the oxidation of the specimen and therefore the fatigue life would decrease, among them 6XN was more sensitive to high temperature with the larger decreasing tendency which make the fatigue limited stress of the two alloys more closer at 550 ℃. While 825 is more sensitive to the stress cycles. All the two alloys have good resistance to high cycle fatigue when comparing their experimental data with the calculated value from the empirical formula. The fracture morphology presents areas of crack initiation, crack growth and fracture, the fracture area has much dimples. This work can be applied to the conceptional design for SCWR. (authors)
DEFF Research Database (Denmark)
Thomas, Kevin L; Al-Khatib, Sana M; Lokhnygina, Yuliya
2008-01-01
, a randomized comparison of valsartan, captopril, or both in patients with acute myocardial infarction with HF and/or left ventricular systolic dysfunction. We compared baseline characteristics of 825 patients treated with amiodarone at randomization with 13,875 patients not treated with amiodarone. Using Cox...
Satellite gravity anomalies and crustal features of the Central Indian Ocean Basin
Digital Repository Service at National Institute of Oceanography (India)
Rao, D.G.; Krishna, K.S.; Neprochnov, Y.P.; Grinko, B.N.
-air anomalies due to volcanic constructs that trend in arcuate shape from north to south parallel to 82.5 degrees E are noted as southern continuity of the 85 degrees E Ridge, which terminates at the Afanasy Nikitin seamount. Change in rheology of the crustal...
2010-01-26
... DEPARTMENT OF COMMERCE International Trade Administration [A-351-825] Stainless Steel Bar From... antidumping duty order on certain stainless steel bar from Brazil for the period February 1, 2008, through... Steel Bar From Brazil: Extension of Time Limit for Preliminary Results of Antidumping Duty...
2013-01-22
... DEPARTMENT OF COMMERCE International Trade Administration [A-351-825] Stainless Steel Bar From... steel bar (SSB) from Brazil. The period of review (POR) is February 1, 2011, through January 31, 2012... Review: Stainless Steel Bar from Brazil'' dated concurrently with this notice (``Preliminary Decision...
Czech Academy of Sciences Publication Activity Database
Šponer, Jiří
2009-01-01
Roč. 26, č. 6 (2009), s. 824-825 ISSN 0739-1102. [The 17th Conversation . 16.06.2009-20.06.2009, Albany] Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : molecular dynamics * RNA Subject RIV: BO - Biophysics
Participatory Democracy in Local School Districts: Fact or Fiction, Boon or Bane?
Hatley, Richard V.
1976-01-01
Discusses the viability of participatory democracy and representative democracy for educational decision-making and argues that pure representative democracy would be preferable to the combination of participatory and representative democracy that now predominates. (Available from the Kansas Association of School Boards, 825 Western, Topeka, KS…
Czech Academy of Sciences Publication Activity Database
Votýpka, Jan; Kostygov, A.Y.; Kraeva, N.; Grybchuk-Ieremenko, A.; Tesařová, Martina; Grybchuk, D.; Lukeš, Julius; Yurchenko, Vyacheslav
2014-01-01
Roč. 165, č. 6 (2014), s. 825-838 ISSN 1434-4610 R&D Projects: GA MŠk(CZ) EE2.3.30.0032 Institutional support: RVO:60077344 Keywords : Kentomonas * Trypanosomatidae * bacterial endosymbionts * phylogeny Subject RIV: EI - Biotechnology ; Bionics Impact factor: 3.045, year: 2014
77 FR 63308 - J. William Foley Incorporated v. United Illuminating Company; Notice of Complaint
2012-10-16
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. EL12-106-000] J. William Foley Incorporated v. United Illuminating Company; Notice of Complaint Take notice that on October 5...) and 825(e), J. William Foley Incorporated (Complainant) filed a formal complaint against United...
Acquisition of Space Systems. Volume 7. Past Problems and Future Challenges
2015-01-01
smaller space systems to enable disaggregated mission architectures. The Commercially Hosted Nonimaging Infrared Program developed and launched a wide...new missions.24 21 In June 2008, an $82.5 million contract (which included launch and operations) was awarded for the Com- mercially Hosted Nonimaging
The cosmetic outcome of the scar formation after cesarean section
DEFF Research Database (Denmark)
Lindholt, Jes Sanddal; Möller-Christensen, T; Steele, R E
1994-01-01
Three methods of skin closure after cesarean section were tested and compared in a prospective trial. Eighty-nine (82.5%) appeared for follow-up investigation 4-5 months after delivery. The mean scar width was significantly narrower after phannenstiel incision compared with percutaneous nylon sut...
2012-04-23
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. EL12-55-000] SIG Energy, LLLP v. California Independent System Operator Corporation; Notice of Complaint Take notice that on.... 824(e) and 825(e), SIG Energy, LLLP (Complainant) filed a formal complaint against the California...
Behandling af ustabil angina pectoris. En spørgeskemaundersøgelse
DEFF Research Database (Denmark)
Nielsen, J D; Stoltenberg, Meredin; Juul, A
1990-01-01
Questionnaires about therapy in unstable angina pectoris were sent to 63 Danish medical departments and were answered by 52 departments (82.5%). Nitroglycerin is commonly used but only in half of the departments is Nitroglycerin administered intravenously. Calcium-receptor-blockers are used in more...
2011-04-04
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 13124-002] Copper Valley.... Applicant: Copper Valley Electric Association (Copper Valley) d. Name of Project: Allison Creek Project. e.... 791(a)-825(r). g. Applicant Contact: Robert A. Wilkinson, CEO, Copper Valley Electric Association, P.O...
How much genetic variation is stored in the seed bank? A study of Atriplex tatarica (Chenopodiaceae)
Czech Academy of Sciences Publication Activity Database
Mandák, Bohumil; Bímová, Kateřina; Mahelka, Václav; Plačková, Ivana
2006-01-01
Roč. 15, - (2006), s. 2653-2663 ISSN 0962-1083 R&D Projects: GA AV ČR IAA6005206 Institutional research plan: CEZ:AV0Z60050516 Keywords : seed bank * population genetic structure * competition Subject RIV: EF - Botanics Impact factor: 4.825, year: 2006
Studies on plutonium and americium in coastal environment of Bombay Harbour Bay
International Nuclear Information System (INIS)
Matkar, V.M.; Usha, N.; Rudran, K.
1999-01-01
Low level treated radioactive effluents generated at the Bhabha Atomic Research Centre are discharged at CIRUS situated on Trombay shore. The discharges are made at 825 m away from the shore where 1.8 m depth of water is available even at neap tide
Application of the ASME-code-case N 47 to a typical thickwalled HTR-component made of Incoloy 800
International Nuclear Information System (INIS)
Kemter, F.; Schmidt, A.
Several components of the HTR-plant are exposed to temperatures beyond 500 0 C, i.e. within the high-temperature range. The service life of those components is not only limited by fatigue damage but also mainly by creep damage and accumulated inelastic strain. These can be conservatively estimated according to the ASME-Code (high temperature part CC N47) by means of the results of elastic calculations, yet this simplified method to provide evidence often leads to calculated overloads such as the present case of the live steam collector of the steam generator of a HTR. For providing the evidence that the actual loads of the component are within permissible limits, comprehensive inelastic analyses have to be referred to in such a case. The two-dimensional inelastic analysis which is reported here in detail shows that the creep and fatigue failure as well as the inelastic extensions of the live steam collectors accumulated during the service time are below the permissible limit stated in the ASME-Code and failure of those components while used in the reactor can this be excluded. (orig.) [de
2011-01-11
... DEPARTMENT OF COMMERCE International Trade Administration [A-351-825] Stainless Steel Bar From... duty order on stainless steel bar from Brazil. The review covers one producer/exporter of the subject... its administrative review of the antidumping duty order on stainless steel bar (SSB) from Brazil. See...
2010-07-12
... DEPARTMENT OF COMMERCE International Trade Administration [A-351-825] Stainless Steel Bar From... duty order on certain stainless steel bar from Brazil. The review covers one producer/exporter of the... antidumping duty order on certain stainless steel bar from Brazil. See Stainless Steel Bar From Brazil...
Microsurgery for Aneurysms on the Circle of Willis | de Klerk | South ...
African Journals Online (AJOL)
A description of a microsurgical approach for aneurysms on the anterior part of the circle of Willis is given. Certain practical points are stressed. The operative results obtained in 37 consecutive aneurysms operated on in 30 patients are discussed. S. Afr. Med. J., 48, 825 (1974).
Czech Academy of Sciences Publication Activity Database
Janega, P.; Kojšová, S.; Jendeková, L.; Babál, P.; Pecháňová, Olga
2007-01-01
Roč. 56, č. 6 (2007), s. 825-828 ISSN 0862-8408 R&D Projects: GA MŠk(CZ) 1M0510 Institutional research plan: CEZ:AV0Z50110509 Keywords : indapamide * myocardial fibrosis * genetic hypertension Subject RIV: ED - Physiology Impact factor: 1.505, year: 2007
The use of electroconvulsive therapy in the treatment ofpsychiatric ...
African Journals Online (AJOL)
1991-04-06
Apr 6, 1991 ... 82,5% were diagnosed as having schizophrenia (including cata- tonic schizophrenia 6%; chronic schizophrenia 4%). The remaining patients had a variety of diagnoses including: epi- lepsy 8 patients; alcoholism or cannabis abuse 5; senile dementia. 4; depression 4; undetermined 4; not recorded 7.
2010-03-10
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 13526-001] Bowersock Mills...: Bowersock Mills Power Company (Bowersock). e. Name of Project: Bowersock Mills and Power Company Expanded....S.C. 791(a)-825(r). h. Applicant Contact: Sarah Hill-Nelson, The Bowersock Mills and Power Company...
The crystal structure of Pd.sub.3./sub.HgTe.sub.3./sub., the synthetic analogue of temagamite
Czech Academy of Sciences Publication Activity Database
Laufek, F.; Vymazalová, A.; Drábek, M.; Dušek, Michal; Navrátil, Jiří; Černošková, E.
2016-01-01
Roč. 28, č. 4 (2016), s. 825-834 ISSN 0935-1221 Institutional support: RVO:68378271 ; RVO:61389013 Keywords : temagamite * crystal structure * crystal-structure solution * Pd-Hg telluride Subject RIV: BM - Solid Matter Physics ; Magnetism; CD - Macromolecular Chemistry (UMCH-V) Impact factor: 1.362, year: 2016
Flotillins, Erlins, and HIRs: From Animal Base Camp to Plant New Horizons
Czech Academy of Sciences Publication Activity Database
Daněk, Michal; Valentová, O.; Martinec, Jan
2016-01-01
Roč. 35, č. 4 (2016), s. 191-214 ISSN 0735-2689 R&D Projects: GA ČR GA14-09685S Institutional support: RVO:61389030 Keywords : Arabidopsis thaliana * erlin * flotillin * hir * membrane microdomains * SPFH domain Subject RIV: CE - Biochemistry Impact factor: 6.825, year: 2016
Effect of The Preparation of Ir-Mo/Al2O3 Sulfide Catalyst on Activity and HDN/HDS Selectivity
Czech Academy of Sciences Publication Activity Database
Cinibulk, Josef; Gulková, Daniela; Yoshimura, Y.; Vít, Zdeněk
2003-01-01
Roč. 255, č. 2 (2003), s. 321-329 ISSN 0926-860X R&D Projects: GA AV ČR IAA4072103 Institutional research plan: CEZ:AV0Z4072921 Keywords : hydrodenitrogenation * hds * iridium Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.825, year: 2003
The adoption and design of enterprise risk management practices : An empirical study
Paape, L.; Speklé, R.F.
2010-01-01
Using data from 825 organizations, we examine (1) the extent of ERM implementation and the factors that are associated with cross-sectional differences in the level of ERM adoption, and (2) specific ERM design choices and their effect on perceived ERM effectiveness. Broadly consistent with previous
Coculture fermentation of banana agro-waste to ethanol by ...
African Journals Online (AJOL)
ONOS
2010-03-29
Mar 29, 2010 ... Scanning electron microscopic pictures clearly indicate cellulolysis and close interaction of ... This is the first report on anaerobic single step conversion ... the current trend, ethanol produced from biomass is the ... In co-culture system ..... enhanced cellulase production. Agric. Biol. Chem. 54: 825–826.
76 FR 74009 - Fisheries of the Northeastern United States; Bluefish Fishery; Quota Transfer
2011-11-30
.... 101228634-1149-02] RIN 0648-XA825 Fisheries of the Northeastern United States; Bluefish Fishery; Quota... a portion of its 2011 commercial bluefish quota to New York State. By this action, NMFS adjusts the... Specialist, (978) 281-9224. SUPPLEMENTARY INFORMATION: Regulations governing the bluefish fishery are found...
2011-12-19
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 13124-003] Copper Valley... Application: Major License. b. Project No.: P-13124-003. c. Date filed: August 30, 2011. d. Applicant: Copper.... 791 (a)-825(r). h. Applicant Contact: Robert A. Wilkinson, CEO, Copper Valley Electric Association...
2010-04-30
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 13124-000] Copper Valley....: 13124-000. c. Applicant: Copper Valley Electric Association. d. Name of Project: Allison Lake Project. e.... 791(a)-825(r). g. Applicant Contact: Robert A. Wilkinson, CEO, Copper Valley Electric Association, P.O...
Li, Huipin; Lin, Lianzhu; Feng, Yunzi; Zhao, Mouming; Li, Xiuting; Zhu, Qiyuan; Xiao, Zuobing
2018-02-01
The adsorption and desorption characteristics of seven macroporous resins on the antioxidants in soy sauce were investigated. SP-207 and SP-825 resins possessing good adsorption and desorption capacities were studied further. The pseudo-second-order kinetics and Langmuir isotherm models were demonstrated to be appropriate to describe the whole exothermic and physical adsorption processes of antioxidants onto resins. The 60% ethanol eluted fraction from soy sauce purified by SP-825 resin column possessed the strongest antioxidant activity. The antioxidant activities and contents of typical soy isoflavones, furanones, pyranones, and phenolic acids in soy sauce were determined. These compounds contributed to 50.02% of the total antioxidant activity of the SP-60% fraction. The key small molecule antioxidant compounds in soy sauce were identified as 4-ethylguaiacol, catechol, daidzein, and 4-ethylphenol by the antioxidants omission experiments. Additionally, the purified active fraction with high contents of antioxidants from soy sauce could be applied as bioactive ingredient in food industry. Copyright © 2017 Elsevier Ltd. All rights reserved.
Misiou, Ourania; van Nassau, Tomas J; Lenz, Christian A; Vogel, Rudi F
2018-02-02
The aim of this work was to examine the combination of endolysin PlyP825 and high hydrostatic pressure (HHP) processing against a cocktail of stationary phase Listeria monocytogenes cells in several Listeria-critical food products (i.e. milk, mozzarella and smoked salmon). In order to determine the efficacy of the combined application, both challenge-lethality tests and storage tests were performed. In milk and mozzarella, we could demonstrate that the application of PlyP825 prior to HHP processing allowed for a synergistic inactivation of cells, a reduction in the pressure level with equal antimicrobial efficacy and an enhanced eradication of L. monocytogenes during storage at abuse temperatures. For smoked salmon, no such effects were detected. Although the efficacy of the method was highly dependent on the food vehicle and parameters applied, we hereby demonstrated the potential of the combined endolysin-HHP application for complete eradication of L. monocytogenes from foods at milder processing conditions. Copyright © 2017 Elsevier B.V. All rights reserved.
Nitride-based Schottky diodes and HFETs fabricated by photo-enhanced chemical wet etching
International Nuclear Information System (INIS)
Su, Y.K.; Chang, S.J.; Kuan, T.M.; Ko, C.H.; Webb, J.B.; Lan, W.H.; Cherng, Y.T.; Chen, S.C.
2004-01-01
Photo-enhanced chemical (PEC) wet etching technology was used to etch GaN and AlGaN epitaxial layers. It was found that the maximum etch rates were 510, 1960, 300, and 0 nm/mm for GaN, Al 0.175 Ga 0.825 N, Al 0.23 Ga 0.77 N, and Al 0.4 Ga 0.6 N, respectively. It was also found that we could achieve a high Al 0.175 Ga 0.825 N to GaN etch rate ratio of 12.6. Nitride-based Schottky diodes and heterostructure field effect transistors (HFETs) were also fabricated by PEC wet etching. It was found that we could achieve a saturated I D larger than 850 mA/mm and a maximum g m about 163 mS/mm from PEC wet etched HFET with a 0.5 μm gate length. Compared with dry etched devices, the leakage currents observed from the PEC wet etched devices were also found to be smaller
Lu, S H; McLaren, A-M
2017-10-01
Patients with diabetic foot ulcers (DFU) have an increased risk of lower extremity amputation. A retrospective chart review of patients with DFUs attending the Foot Treatment and Assessment chiropodist-led outpatient clinic at an inner-city academic hospital was conducted to determine wound healing outcomes and characteristics contributing to outcomes. We reviewed the complete clinical history of 279 patients with 332 DFUs spanning over a five-year period. The mean age of patients was 61.5±12.5 years and most patients (83.5%) had one DFU. The majority of wounds (82.5%) were in the forefoot. Overall, 267/332 (80.5%) wounds healed. A greater proportion of wounds healed in the forefoot (82.5%) and midfoot (87.1%) than hindfoot (51.9%; phealing. Our findings are the first to demonstrate the benefits of chiropodists leading an acute care outpatient clinic in the management of DFUs in Canada and delivers wound healing outcomes equivalent to or exceeding those previously published.
The Campus Racial Climate: Contexts of Conflict.
Hurtado, Sylvia
1992-01-01
An examination of data from several studies investigated white (n=1,825), African-American (n=328), and Chicano (n=340) college student perceptions of campus racial climate and institutional commitment to cultural diversity. Student demographic variables were considered. Results indicated common and distinct views concerning the environment types…
2013-04-15
... DEPARTMENT OF COMMERCE International Trade Administration [A-351-825] Stainless Steel Bar From... duty order on stainless steel bar (SSB) from Brazil. For these final results, we continue to find that....\\1\\ The period of review is February 1, 2011, through January 31, 2012. \\1\\ See Stainless Steel Bar...
DOE ZERH Case Study: Sunroc Builders, Bates Avenue, Lakeland, FL
Energy Technology Data Exchange (ETDEWEB)
none,
2015-09-01
Case study of a DOE 2015 Housing Innovation Award winning affordable home in the hot-humid climate that got HERS 57 without PV, with 6.5” SIP walls and 8.25” SIP roof; uninsulated slab foundation; fresh air intake; SEER 16 ducted air source heat pump.
76 FR 14372 - Glenn/Colusa County Resource Advisory Committee
2011-03-16
... Committee (RAC) will meet in Willows, California. Agenda items covered include: (1) Introductions, (2) Approve Minutes, (3) RAC Admin Updates, (4) Public Comment, (5) New Project Proposals, (6) Project Updates... Office, 825 N. Humboldt Ave., Willows, CA 95988. Individuals who wish to speak or propose a project or...
75 FR 27287 - Glenn/Colusa County Resource Advisory Committee
2010-05-14
... Committee (RAC) will meet in Willows, California. Agenda items covered include: (1) Introductions, (2) Approve Minutes, (3) RAC Admin Updates, (4) Public Comment, (5) FY08 and FY09 New Project Presentations... to speak or propose agenda items send their names and proposals to Eduardo Olmedo, DFO, 825 N...
Jensenius, Mogens; Han, Pauline V.; Schlagenhauf, Patricia; Schwartz, Eli; Parola, Philippe; Castelli, Francesco; von Sonnenburg, Frank; Loutan, Louis; Leder, Karin; Freedman, David O.; Simon, Fabrice; Delmont, Jean; Carosi, Giampiero; Chappuis, François; Caumes, Eric; Pérignon, Alice; Burchard, Gerd-Dieter; Torresi, Joseph; Brown, Graham; Kain, Kevin; Boggild, Andrea; Keystone, Jay S.; Pandey, Prativa; Pradhan, Rashila; Murphy, Holly; Coyle, Christina M.; Wittner, Murray; de Vries, Peter; Grobusch, Martin C.; Gadroen, Kartini; Rapp, Christophe; Aoun, Olivier; Kanagawa, Shuzo; Kato, Yasuyuki; Mizunno, Yasutaka; Gkrania-Klotsas, Effrossyni; McCarthy, Anne; Weber, Rainer; Steffen, Robert; Hagmann, Stefan; Henry, Michael; Miller, Andy O.; Hale, Devon C.; Anand, Rahul; Gelman, Stephanie S.; Kozarsky, Phyllis E.; Fairley, Jessica; Franco-Paredes, Carlos; Barnett, Elizabeth D.; Libman, Michael D.
2013-01-01
We performed a descriptive analysis of acute and potentially life-threatening tropical diseases among 82,825 ill western travelers reported to GeoSentinel from June of 1996 to August of 2011. We identified 3,655 patients (4.4%) with a total of 3,666 diagnoses representing 13 diseases, including
2010-09-08
...-AG50 Defense Federal Acquisition Regulation Supplement; Government Rights in the Design of DoD Vessels.... Section 825 clarifies the Government's rights in technical data in the designs of a DoD vessel, boat... cite DFARS Case 2008-D039. SUPPLEMENTARY INFORMATION: A. Background This final rule implements section...
Acidic and Catalytic Properties of Mo-MCM-22 in Methane Aromatization: An FTIR Study
Czech Academy of Sciences Publication Activity Database
Sobalík, Zdeněk; Tvarůžková, Zdenka; Wichterlová, Blanka; Fíla, V.; Špatenka, Š.
2003-01-01
Roč. 253, - (2003), s. 271-282 ISSN 0926-860X R&D Projects: GA ČR GA104/99/0432 Institutional research plan: CEZ:AV0Z4040901 Keywords : methane aromatization * FTIR technique * MCM-22 Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.825, year: 2003
První staroslověnská legenda o sv. Václavu v rekonstrukcích Miloše Weingarta a Josefa Vašici
Czech Academy of Sciences Publication Activity Database
Chromá, Martina
2010-01-01
Roč. 10, 2-3 (2010), s. 102-106 ISSN 1802-825X. [Škola, jazyk a literatura 2010. Ústí nad Labem, 27.10.2010] Institutional research plan: CEZ:AV0Z90920516 Keywords : First Old Slavonic Legend of St. Wenceslas * paleoslavistic Subject RIV: AI - Linguistics
Hyphal Growth from Spores of the Mycorrhizal Fungus Glomus Caledonius: Effect of Amino Acids
DEFF Research Database (Denmark)
Hepper, C.M.; Jakobsen, Iver
1983-01-01
Hyphal growth from spores of Glomus caledonius (Nicol. and Gerd.) Trappe and Gerdemann was stimulated by cystine, glycine and lysine at optimum concentrations of 4.6, 556 and 825 mg l−1 respectively. When all three amino acids were supplied together in water agar, five times more growth...
FEAR AND ENTHUSIASM IN SPORT PARACHUTING,
Replies to a mail questionnaire by 825 sport parachutists affiliated with 103 parachute clubs are the data of this study. Questionnaires were...parachutists, attitudes relevant to sport parachuting, and included the Ma and Hy scales from the MMP1, a Draw-A-Person Test, and four story stimulus pictures
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education. Paul S Follansbee. Articles written in Resonance – Journal of Science Education. Volume 11 Issue 6 June 2006 pp 8-25 General Article. Dr Smith goes to Los Alamos - Cyril Stanley Smith, Plutonium Metallurgy, and the Manhattan Project · Srivilliputhur G ...
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education. Siegfried S Hecker. Articles written in Resonance – Journal of Science Education. Volume 11 Issue 6 June 2006 pp 8-25 General Article. Dr Smith goes to Los Alamos - Cyril Stanley Smith, Plutonium Metallurgy, and the Manhattan Project · Srivilliputhur G ...
Czech Academy of Sciences Publication Activity Database
Hájek, J.; Kumar, N.; Mäki-Arvela, P.; Salmi, T.; Murzin, D. Z.; Paseka, Ivo; Heikkilä, T.; Laine, E.; Laukkanen, P.; Väyrynen, J.
2003-01-01
Roč. 251, č. 2 (2003), s. 385-396 ISSN 0926-860X R&D Projects: GA ČR GA104/03/0409 Institutional research plan: CEZ:AV0Z4032918 Keywords : mesoporous molecular sieve * zeolites * ruthenium Subject RIV: CA - Inorganic Chemistry Impact factor: 2.825, year: 2003
2012-10-16
.... 791(a)-825(r). h. Applicant Contact: Duff Mitchell, Business Manager, Juneau Hydropower, Inc., P.O... information at the end of your comments. For assistance, please contact FERC Online Support at FERCOnline... access the document. For assistance, contact FERC Online Support. You may also register online at http...
2010-04-09
... Illinois Hydropower, LLC; Notice of Application Accepted for Filing and Soliciting Motions To Intervene and... No.: 12626-002. c. Date filed: March 31, 2009. d. Applicant: Northern Illinois Hydropower, LLC. e... Power Act, 16 U.S.C. 791(a)-825(r). h. Applicant Contact: Damon Zdunich, Northern Illinois Hydropower...
76 FR 12103 - Erie Boulevard Hydropower, L.P; Notice of Settlement Agreement and Soliciting Comments
2011-03-04
... Hydropower, L.P; Notice of Settlement Agreement and Soliciting Comments Take notice that the following... Boulevard Hydropower, L.P. e. Location: The existing multi-development project is located on the Oswegatchie... 791 (a)-825(r) h. Applicant Contact: Daniel Daoust, Erie Boulevard Hydropower, 33 West 1st Street...
Czech Academy of Sciences Publication Activity Database
Kaščáková, N.; Husárová, D.; Hašto, J.; Kolarčik, P.; Poláčková Šolcová, Iva; Madarasová Gecková, A.; Tavel, P.
2016-01-01
Roč. 119, č. 3 (2016), s. 804-825 ISSN 0033-2941 Institutional support: RVO:68081740 Keywords : Short form of the ECR-R * Experiences in Close Relationships Revised Questionnaire * validation * attachment anxiety * attachment avoidance * attachment styles * representative sample Subject RIV: AN - Psychology Impact factor: 0.629, year: 2016
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education. Srivilliputhur G Srinivasan. Articles written in Resonance – Journal of Science Education. Volume 11 Issue 6 June 2006 pp 8-25 General Article. Dr Smith goes to Los Alamos - Cyril Stanley Smith, Plutonium Metallurgy, and the Manhattan Project · Srivilliputhur G ...
Benthic Exchange of Biogenic Elements in the Estuarine and Nearshore Waters of Western India
Digital Repository Service at National Institute of Oceanography (India)
Pratihary, A.K.
chosen sites i.e. Mandovi estuary (15.502oN, 73.825oE) and a coastal station (15.509oN, 73.65 oE) ~15 Km off Goa coast during 2004 to 2006. Monthly variation of relevant physico-chemical and biological parameters were also recorded at these sites. Benthic...
Probing the structure of unstable nuclei through the recoiled proton tagged knockout reaction
International Nuclear Information System (INIS)
Ye, Y.; Cao, Z.; Jiang, D.
2010-01-01
Recoiled proton tagged knockout reaction experiments were carried-out for 8 He at 82,5 MeV/u in RIKEN and for 6 He at 65 MeV/u in Lanzhou. The very preliminary results for the distinguish of the reaction mechanism are presented and compared to the kinematics calculation. (authors)
East and Central African Journal of Surgery Volume 15 Number 2 ...
African Journals Online (AJOL)
DELL
Audit of surgical mortality should be part of the health workers' general .... all surgical patients, adequate fluid resuscitation and recording on the daily fluid balance chart, timely ... Although physical access to health facilities in Uganda has improved with 82.5% ... population and the life expectancy is below sixty years19,26.
Advanced Pattern Recognition Techniques (Techniques avancees de reconnaissance de forme)
1998-09-01
alarmes dans la d6tection des mines terrestres et des munitions explosives non explos6es. Les m~thodes classiques de reconnaissance de forme...the XVIII. Congress of the International Society for [19] DIN EN 60825-1(IEC 825-1) VDE 0837, Photogrammetry and Remote Sensing Sicherheit von Laser
Sadhana | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Sadhana. R SIVARAJ. Articles written in Sadhana. Volume 41 Issue 8 August 2016 pp 825-836. BAGEL:A non-ignorable missing value estimation method for mixed attribute datasets · R DEVI PRIYA S KUPPUSWAMI R SIVARAJ · More Details Abstract Fulltext PDF. Surveys are mainly conducted to obtain ...
75 FR 8916 - Glenn/Colusa County Resource Advisory Committee
2010-02-26
...) Introductions, (2) Approve Minutes, (3) RAC Admin Updates, (4) Public Comment, (5) FY08 and FY09 New Project... National Forest Supervisor's Office, 825 N. Humboldt Ave., Willows, CA 95988. Individuals who wish to speak... . SUPPLEMENTARY INFORMATION: The meeting will be open to the public. Committee discussion is limited to Forest...
75 FR 63436 - Glenn/Colusa County Resource Advisory Committee
2010-10-15
... Committee (RAC) will meet in Willows, California. Agenda items covered include: (1) Introductions, (2) Approve Minutes, (3) RAC Admin Updates, (4) Public Comment, (5) Project Updates FY 08, 09, 10, (6) General... who wish to speak or propose agenda items send their names and proposals to Eduardo Olmedo, DFO, 825 N...
2010-10-22
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 13815-000] Renew Hydro, LLC... Municipal Utilities Authority's existing 115-foot-high, 2,150-foot-long concrete gravity dam, with 500-foot...; (3) the existing Boonton reservoir with an 825-acre surface area and a 28,200 acre-foot storage area...
2013-08-19
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket Nos. EL13-84-000] Kansas Municipal Energy Agency v. Sunflower Electric Power Corporation, Mid-Kansas Electric Company, LLC, Southwest... 306 of the Federal Power Act, 16 U.S.C. 824e and 825e and Rule 206 of the Federal Energy Regulatory...
African Journals Online (AJOL)
abp
2012-10-12
Oct 12, 2012 ... We defined postoperative morbidity as the occurrence of a specific or nonspecific complication during the first 30 days of surgery and postoperative mortality .... well defined in the literature and the reported results are conflicting and controversial [27]. Our study was .... Rev Esp Enferm Dig. 2008; 100: 82-5.
Prevalence and Correlates of Spouse Violence Among Women in a ...
African Journals Online (AJOL)
Method: Three hundred and twenty one participants, who were patients and/or mothers of (children) patients, were selected through a systematic sampling method; 265 of them eventually participated in the study (82.5% response rate). A questionnaire on domestic violence was used to collect data. The data were analyzed ...
2012-04-06
... March 14, 2012. d. Applicant: Black Bear Hydro Partners, LLC. e. Name of Projects: Orono Project 2710.... 791a-825r. h. Applicant Contact: Mr. Scott D. Hall, Black Bear Hydro Partners, LLC, P.O. Box 276... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project Nos. 2710-057; 2712-074] Black...
Variation in GNB3 predicts response and adverse reactions to antidepressants
DEFF Research Database (Denmark)
Keers, Robert; Bonvicini, Cristian; Scassellati, Catia
2011-01-01
of change in core mood symptoms. We here report analysis of data from GENDEP, a part-randomized pharmacogenomic trial, on the outcome of 811 subjects with major depression undergoing treatment with either escitalopram or nortriptyline in which the C825T SNP and three further SNPs in GNB3 were genotyped...
Volume transmission in health and disease: communication via the brain extracellular space
Czech Academy of Sciences Publication Activity Database
Syková, Eva
2003-01-01
Roč. 85, č. 2 (2003), s. 2 ISSN 0022-3042. [Meeting of the European Society for Neurochemistry /14./. Varšava, 01.06.2003-04.06.2003] Institutional research plan: CEZ:AV0Z5039906 Keywords : volume transmission * extracellular space Subject RIV: FH - Neurology Impact factor: 4.825, year: 2003
75 FR 51266 - Reedsport OPT Wave Park, LLC; Notice of Settlement Agreement and Soliciting Comments
2010-08-19
... of Practice and Procedure, 18 CFR 385.602, Federal Power Act 16 U.S.C. 791 (a)-825(r). h. Applicant... behalf of itself; National Marine Fisheries Service; U.S. Fish and Wildlife Service; U.S. Forest Service... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 12713-002] Reedsport OPT...
Ekonomie obnovitelných zdrojů energie – příklad větrné energie v České republice
Czech Academy of Sciences Publication Activity Database
Ryvolová, I.; Zemplinerová, Alena
2010-01-01
Roč. 58, č. 6 (2010), s. 814-825 ISSN 0032-3233 R&D Projects: GA MŠk LC542 Institutional research plan: CEZ:AV0Z70850503 Keywords : renewable energy sources * energy market regulation * wind energy * redistributive transfers * interest groups Subject RIV: AH - Economics Impact factor: 0.650, year: 2010
Isotopic substitution of boron and carbon in superconducting diamond epilayers grown by MPCVD
Czech Academy of Sciences Publication Activity Database
Achatz, P.; Omnès, F.; Ortega, L.; Marcenat, C.; Vacík, Jiří; Hnatowicz, Vladimír; Koster, U.; Jomard, F.; Bustarret, E.
2010-01-01
Roč. 19, č. 7 (2010), s. 814-817 ISSN 0925-9635 R&D Projects: GA AV ČR(CZ) KAN400480701 Institutional research plan: CEZ:AV0Z10480505 Keywords : Isotopic effects * Vibrational properties * p-type doping Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.825, year: 2010
78 FR 8833 - The Family and Medical Leave Act
2013-02-06
... creates a new qualifying exigency leave category for parental care. In military caregiver leave, the Final... covered employers to take job- protected, unpaid leave, or to substitute appropriate accrued paid leave... CFR Part 825 The Family and Medical Leave Act; Final Rule #0;#0;Federal Register / Vol. 78 , No. 25...
2010-12-27
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. EL11-11-000] Critical Path Transmission, LLC; Clear Power, LLC; v. California Independent System Operator, Inc.; Notice of Complaint... and 306 of the Federal Power Act, 16 U.S.C. 824e and 825e (2006), Critical Path Transmission, LLC and...
Drugli, May Britt
2013-01-01
This study explored the association between teacher-reported student-teacher relationship quality (closeness and conflict) and demographic factors, school functioning and child mental health in a cross-sectional study. The study was conducted among a national sample of Norwegian school children (N?=?825) in grades 1 to 7. Bivariate analyses and…
Ion collisional transport coefficients in the solar wind at 1 au
Czech Academy of Sciences Publication Activity Database
Hellinger, Petr
2016-01-01
Roč. 825, č. 2 (2016), 120/1-120/5 ISSN 0004-637X R&D Projects: GA ČR GA15-10057S Grant - others:European Commission(XE) 284515 Institutional support: RVO:67985815 Keywords : solar wind Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 5.533, year: 2016
Sexual Health of Prison Inmates: A Case Study of Kano Central ...
African Journals Online (AJOL)
Sexual and reproductive health of prison inmates suffers from serious neglect in Nigeria. This mixed method study examined prison officials and 160 inmates on prison law and administration, and sexual health of inmates. Most of the inmates examined (82.5%) reported having frequent sexual desire. Wet dreams (46.2%) ...
2012-10-24
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 14367-001] Don W. Gilbert...: Original Minor License. b. Project No.: 14367-001. c. Date filed: May 30, 2012. d. Applicant: Don W...(a)-825(r). (2006). h. Applicant Contact: Don W. Gilbert and DeAnn G. Somonich, Don W. Gilbert Hydro...
Factor, Reina S.; Ryan, Sarah M.; Farley, Julee P.; Ollendick, Thomas H.; Scarpa, Angela
2017-01-01
Children with autism spectrum disorder (ASD) experience internalizing and externalizing problems at higher rates than typically developing children, which could worsen social impairment. The present study compared impairment scores (social responsiveness scale, 2nd edition; SRS-2 scores) in 57 children (3-17 years, 82.5% male) with ASD, either…
Analysis of three genetic polymorphisms in Malaysian essential ...
African Journals Online (AJOL)
STORAGESEVER
2009-05-18
May 18, 2009 ... In addition, a large study of 933 Hong Kong Chinese with various aspects of the metabolic syndrome, the ... gene and C825T polymorphism of GNβ3 gene in Malay- sian essential hypertensive and type 2 ... Socio-demographic factors were assessed by both Malay and. English language questionnaires.
Czech Academy of Sciences Publication Activity Database
Vajdlová, Miloslava
2013-01-01
Roč. 13, č. 2 (2013), s. 19-25 ISSN 1802-825X R&D Projects: GA ČR GAP406/10/1153 Institutional support: RVO:68378092 Keywords : lexeme dietě (Cz) * Old Czech * semantic analysis * meanings Subject RIV: AI - Linguistics http://www.pf.ujep.cz/files/KBO/USTA/Usta_2013-2.pdf
Czech Academy of Sciences Publication Activity Database
Pilát, Štefan
2010-01-01
Roč. 10, 2-3 (2010), s. 107-113 ISSN 1802-825X. [Škola, jazyk a literatura 2010. Ústí nad Labem, 27.10.2010] R&D Projects: GA ČR(CZ) GA405/08/1582 Institutional research plan: CEZ:AV0Z90920516 Keywords : paleoslavistics * textology Subject RIV: AI - Linguistics
2010-07-01
...); Pub. L. 87-825; § 3.700(a)). Day preceding entrance on active duty. See § 3.654. (b) Aid and... treatment. (n) Section 3.853. Incompetents; estate over $25,000. Incompetent veteran receiving compensation, without spouse, child, or dependent parent, whose estate exceeds $25,000: Last day of the first month in...
Czech Academy of Sciences Publication Activity Database
Šlais, Karel; Horká, Marie; Karásek, Pavel; Planeta, Josef; Roth, Michal
2013-01-01
Roč. 85, č. 9 (2013), s. 4296-4300 ISSN 0003-2700 R&D Projects: GA ČR(CZ) GAP106/12/0522; GA MV VG20102015023 Institutional support: RVO:68081715 Keywords : capillary isoelectric focusing * resolution of ampholytes * supercritical water Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 5.825, year: 2013
Bulletin of Materials Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Bulletin of Materials Science. Jiuxing Zhang. Articles written in Bulletin of Materials Science. Volume 34 Issue 4 July 2011 pp 825-828. Magnetocaloric effect of Gd5Si2Ge2 alloys in low magnetic field · Hong Zeng Chunjiang Kuang Jiuxing Zhang Ming Yue · More Details Abstract Fulltext PDF.
Aryadoust, Vahid; Baghaei, Purya
2016-01-01
This study aims to examine the relationship between reading comprehension and lexical and grammatical knowledge among English as a foreign language students by using an Artificial Neural Network (ANN). There were 825 test takers administered both a second-language reading test and a set of psychometrically validated grammar and vocabulary tests.…
Anticipating Stimulus Money for Campus Projects, Colleges Get "Shovel Ready"
Carlson, Scott
2009-01-01
Help for colleges may be on the way in the $825-billion stimulus package being pressed by Congressional leaders. The bill that House Democrats introduced this month includes $7-billion for higher-education modernization, renovation, and repair that could kick-start projects like upgrading heating and cooling systems, fixing roofs, and doing…
Preparation and Characterization of Ag-Doped Crystalline Titania for Photocatalysis Applications
Czech Academy of Sciences Publication Activity Database
Krejčíková, Simona; Matějová, Lenka; Kočí, K.; Obalová, L.; Matěj, Z.; Čapek, L.; Šolcová, Olga
111-112, - (2012), s. 119-125 ISSN 0926-3373 R&D Projects: GA ČR GD203/08/H032; GA ČR GA104/09/0694 Institutional research plan: CEZ:AV0Z40720504 Keywords : TiO2 * photocatalysis * silver Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 5.825, year: 2012
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education. Alok Kumar. Articles written in Resonance – Journal of Science Education. Volume 8 Issue 3 March 2003 pp 8-25 General Article. What can we Learn from the Electromagnetic Spectrum? A W Joshi Alok Kumar · More Details Fulltext PDF. Volume 9 Issue 10 ...
Access to continued professional education among health workers ...
African Journals Online (AJOL)
Results: Fifty-seven healthcare workers participated of whom 47 (82.5%) were nurses, 8 (14.0%) were either medical assistants or clinical officers, and one laboratory technician and a dental therapist. At the time of the study, 50(87.7%) were prescribers and 54 (94.7%) had ever issued a prescription for medications.
Current trends in microbial diagnostics based on mass spectrometry
Czech Academy of Sciences Publication Activity Database
Havlíček, Vladimír; Lemr, Karel; Schug, K. A.
2013-01-01
Roč. 85, č. 2 (2013), s. 790-797 ISSN 0003-2700 R&D Projects: GA ČR(CZ) GAP206/12/1150; GA MŠk(CZ) ME10013 Institutional support: RVO:61388971 Keywords : DESORPTION IONIZATION-TIME * MALDI - TOF -MS * CLINICAL MICROBIOLOGY Subject RIV: EE - Microbiology, Virology Impact factor: 5.825, year: 2013
Assignment of sigma factors of RNA polymerase to promoters in Corynebacterium glutamicum
Czech Academy of Sciences Publication Activity Database
Dostálová, Hana; Holátko, Jiří; Busche, T.; Rucká, Lenka; Rapoport, Andrey; Halada, Petr; Nešvera, Jan; Kalinowski, J.; Pátek, Miroslav
2017-01-01
Roč. 7, JUN 23 (2017), s. 1-13, č. článku 133. ISSN 2191-0855 R&D Projects: GA ČR(CZ) GA17-06991S Institutional support: RVO:61388971 Keywords : Corynebacterium glutamicum * Promoter * Sigma factor Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 1.825, year: 2016
Czech Academy of Sciences Publication Activity Database
Vallo, Peter; Guillén-Servent, A.; Benda, P.; Pires, D. B.; Koubek, Petr
2008-01-01
Roč. 10, č. 2 (2008), s. 193-206 ISSN 1508-1109 R&D Projects: GA AV ČR IAA6093404 Institutional research plan: CEZ:AV0Z60930519 Keywords : leaf-nosed bats * Africa * cryptic species * cytochrome b * molecular systematics * phylogeny Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.825, year: 2008
Reaction of soda-lime-silica glass melt with water vapour at melting temperatures
Czech Academy of Sciences Publication Activity Database
Vernerová, Miroslava; Kloužek, Jaroslav; Němec, Lubomír
2015-01-01
Roč. 416, MAY 15 (2015), s. 21-30 ISSN 0022-3093 R&D Projects: GA TA ČR TA01010844 Institutional support: RVO:67985891 Keywords : glass melt * sulfate * water vapour * bubble nucleation * melt foaming * glass melting Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass Impact factor: 1.825, year: 2015
Finnish Pupils' Views on the Place of Religion in School
Kuusisto, Arniika; Poulter, Saila; Kallioniemi, Arto
2017-01-01
This mixed method study examines Finnish pupils' (N = 825; age groups 12-13, 15-16) views on the place of religion in the public school. Religious landscape in Finnish society has changed significantly in recent years, as the "new" diversity (Vertovec 2015) has supplemented the "old" one. The role of institutionalized religion…
2010-01-01
... after being moved interstate. (c) Before moving interstate any vehicles, cages, coops, containers... other containers or equipment used by or to move pet birds moved interstate in accordance with § 82.5(a... generated by or litter used by the birds or poultry, may be moved interstate from a quarantined area only in...
2011-07-07
... U.S. Patent No. 5,825,352 (``the '352 patent''). 75 FR 22625. The complaint named Apple, Inc. of Cupertino, California (``Apple'') as the only respondent. On April 29, 2011, the ALJ issued a final ID... construction rulings. The investigation is terminated with a finding that Apple did not violate section 337...
2011-09-22
... 306 of the Federal Power Act, 16 USC 824e and 825(e) and 18 CFR 386.206 of the Commission's Rules of..., violates the Federal Power Act, Entergy's Open Access Transmission Tariff and constitutes affiliate abuse... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. EL11-63-000] Notice of...
29 CFR 825.303 - Employee notice requirements for unforeseeable FMLA leave.
2010-07-01
... employee's child has a severe asthma attack and the employee takes the child to the emergency room, the employee would not be required to leave his or her child in order to report the absence while the child is receiving emergency treatment. However, if the child's asthma attack required only the use of an inhaler at...
42 CFR 82.5 - Definition of terms used in this part.
2010-10-01
... will determine probability of causation under EEOICPA. (o) Radiation means ionizing radiation... of producing ions in the body. For purposes of this rule, radiation does not include sources of non-ionizing radiation such as radio-frequency radiation, microwaves, visible light, and infrared or...
42 CFR 8.25 - Informal review and the reviewing official's response.
2010-10-01
... GENERAL PROVISIONS CERTIFICATION OF OPIOID TREATMENT PROGRAMS Procedures for Review of Suspension or Proposed Revocation of OTP Certification, and of Adverse Action Regarding Withdrawal of Approval of an...
GASSAR-6 (General Atomic Standard Safety Analysis Report). Volume 1
International Nuclear Information System (INIS)
1975-01-01
A standard nuclear steam system for a 3000 MW(t), 1160 MW(e) high temperature gas-cooled reactor (HTGR) nuclear power station is described. The HTGR operates on a uranium-235/thorium-232 cycle. Spherical fuel pellets are coated with multiple layers of pyrolytic carbon, bonded into rods, and encased in hexagonal graphite fuel elements. The core is nuclear-purity-grade, near isotropic graphite machined in hexagonal blocks, which serves as moderator and the heat transfer medium between the fuel and the coolant. Forced helium is the primary coolant and water is the secondary coolant. A prestressed concrete reactor vessel (PCRV) houses the reactor core, primary coolant system and portions of the secondary coolant system, steam generators and circulators. A continuous internal steel liner in the PCRV acts as the primary coolant boundary and sealing membrane. The control rods contain boron carbide in a graphite matrix sheathed in Incoloy 800 cans. Boron constitutes about 40 percent of the absorber material by volume. The control rod drives provide insertion and withdrawal rates consistent with the required reactivity changes for operational load fluctuations and reactor shutdown. Control rods have shim and trip capability. (U.S.)
Status of the TRIGA shipments to the INEEL from Europe
International Nuclear Information System (INIS)
Stump, Robert C.; Mustin, Tracy
1997-01-01
During 1999 shipment from 4 European countries, involving the following 4 research reactors was foreseen: ENEA of Italy, ICN of Romania, TRIGA-IJS of Slovenia, and MHH of Germany. The research reactors under consideration are LENA of Italy, IFK and DKFZ of Germany. Unique challenges of this task are: first shipment to the INEEL from the east coast of the United States; Need to identify a transportation route and working with the states, tribes and local governments to ensure that adequate public safety and security planning is done and followed; first shipment to INEEL involving both high-income and less-than-high-income countries in one shipment. There is an opportunity to save a significant amount of money for both DOE and the high-income countries by cooperating and coordinating the shipments together. The First will be the shipment to INEEL of mixed TRIGA SNF and more than one shipping cask type. This shipment will include a mixture of LEU, HEU, aluminum clad, stainless steel clad, and Incoloy clad rods. INEEL will need to prepare the safety documentation, procedures, and make equipment and facility modifications necessary to handle the ifferent fuel and cask types
Alloy SCR-3 resistant to stress corrosion cracking
International Nuclear Information System (INIS)
Kowaka, Masamichi; Fujikawa, Hisao; Kobayashi, Taiki
1977-01-01
Austenitic stainless steel is used widely because the corrosion resistance, workability and weldability are excellent, but the main fault is the occurrence of stress corrosion cracking in the environment containing chlorides. Inconel 600, most resistant to stress corrosion cracking, is not necessarily safe under some severe condition. In the heat-affected zone of SUS 304 tubes for BWRs, the cases of stress corrosion cracking have occurred. The conventional testing method of stress corrosion cracking using boiling magnesium chloride solution has been problematical because it is widely different from actual environment. The effects of alloying elements on stress corrosion cracking are remarkably different according to the environment. These effects were investigated systematically in high temperature, high pressure water, and as the result, Alloy SCR-3 with excellent stress corrosion cracking resistance was found. The physical constants and the mechanical properties of the SCR-3 are shown. The states of stress corrosion cracking in high temperature, high pressure water containing chlorides and pure water, polythionic acid, sodium phosphate solution and caustic soda of the SCR-3, SUS 304, Inconel 600 and Incoloy 800 are compared and reported. (Kako, I.)
Evaluation of the Control Rod Super Alloy Material of HTR-PM
International Nuclear Information System (INIS)
Li Pengjun; Yan He; Diao Xingzhong
2014-01-01
The control rod drive mechanism (CRDM) system is served as the first reactivity control and shutdown system for the high temperature reactor pebble-bed module (HTR-PM) in Shandong, China. And the control rod, which is pulled up and down by a chain sprocket mechanism of CRDM to realize reactivity control, compensation and shutdown, has to be durable under temperature as high as 550℃ for a long time. Thus the material persistent strength under high temperature is quite important for the reliability of the CRDM. In this paper, a review on material selection of control rod of high temperature gas cooled reactors, including AVR and THTR-300 in Germany, HTTR in Japan, PBMR in South Africa and Dragon in Britain, was summarized. The major parameters of two kinds of high temperature alloy, incoloy 800H and alloy 625, were compared and discussed. According to the ASME NH volume, a design criterion for the control rod was established and applied in the analysis of the chain by using finite element method. The numerical simulations showed that the chain made of alloy 625 could meet the condition and work for a long time under high temperature. (author)
Directory of Open Access Journals (Sweden)
Sarah A. Murphy
2016-11-01
Full Text Available Abstract: This article describes the formation of reactive oxygen species as a result of the oxidation of dissolved sulfide by Fe(III-containing sediments suspended in oxygenated seawater over the pH range 7.00 and 8.25. Sediment samples were obtained from across the coastal littoral zone in South Carolina, US, at locations from the beach edge to the forested edge of a Spartina dominated estuarine salt marsh and suspended in aerated seawater. Reactive oxygen species (superoxide and hydrogen peroxide production was initiated in sediment suspensions by the addition of sodium bisulfide. The subsequent loss of HS-, formation of Fe(II (as indicated by Ferrozine, and superoxide and hydrogen peroxide were monitored over time. The concentration of superoxide rose from the baseline and then persisted at an apparent steady state concentration of approximately 500 nanomolar at pH 8.25 and 200 nanomolar at pH 7.00 respectively until >97% hydrogen sulfide was consumed. Measured superoxide was used to predict hydrogen peroxide yield based on superoxide dismutation. Dismutation alone quantitatively predicted hydrogen peroxide formation at pH 8.25 but over predicted hydrogen peroxide formation at pH 7 by a factor of approximately 102. Experiments conducted with episodic spikes of added hydrogen peroxide indicated rapid hydrogen peroxide consumption could account for its apparent low instantaneous yield, presumably the result of its reaction with Fe(II species, polysulfides or bisulfite. All sediment samples were characterized for total Fe, Cu, Mn, Ni, Co and hydrous ferric oxide by acid extraction followed by mass spectrometric or spectroscopic characterization. Sediments with the highest loadings of hydrous ferric oxide were the only sediments that produced significant dissolved Fe(II species or ROS as a result of sulfide exposure.
Heidelberger, Christopher; Fitzgerald, Eugene A.
2018-04-01
Heterojunction bipolar transistors (HBTs) with GaAs0.825P0.175 bases and collectors and In0.40Ga0.60P emitters were integrated monolithically onto Si substrates. The HBT structures were grown epitaxially on Si via metalorganic chemical vapor deposition, using SiGe compositionally graded buffers to accommodate the lattice mismatch while maintaining threading dislocation density at an acceptable level (˜3 × 106 cm-2). GaAs0.825P0.175 is used as an active material instead of GaAs because of its higher bandgap (increased breakdown voltage) and closer lattice constant to Si. Misfit dislocation density in the active device layers, measured by electron-beam-induced current, was reduced by making iterative changes to the epitaxial structure. This optimized process culminated in a GaAs0.825P0.175/In0.40Ga0.60P HBT grown on Si with a DC current gain of 156. By considering the various GaAsP/InGaP HBTs grown on Si substrates alongside several control devices grown on GaAs substrates, a wide range of threading dislocation densities and misfit dislocation densities in the active layers could be correlated with HBT current gain. The effect of threading dislocations on current gain was moderated by the reduction in minority carrier lifetime in the base region, in agreement with existing models for GaAs light-emitting diodes and photovoltaic cells. Current gain was shown to be extremely sensitive to misfit dislocations in the active layers of the HBT—much more sensitive than to threading dislocations. We develop a model for this relationship where increased base current is mediated by Fermi level pinning near misfit dislocations.
Strengths and difficulties questionnaire (SDQ: a study of school children in Ribeirão Preto
Directory of Open Access Journals (Sweden)
Cury Camilo Ramos
2003-01-01
Full Text Available OBJECTIVE: The objective of this study is to investigate possible child psychiatric disorders using the strengths and difficulties questionnaire (SDQ. METHOD: SDQ is a questionnaire that screens child mental health problems, comprising a total of 25 items divided in five subscales: emotional problems, hyperactivity, relationship, conduct and pro-social behavior, with five items in each subscale. We also used the impact supplement that evaluates the impairment caused by symptoms. Out of 143 children randomly chosen from a public school of Ribeirão Preto, 107 questionnaires were correctly filled in by parents. Teachers received 114 questionnaires (regarding children with parents' consent, and 108 questionnaires were correctly filled in. As a final sample, we obtained 112 questionnaires answered by parents or teachers. RESULTS: In the questionnaires answered by the parents, we obtained high scorings such as 30.8% for emotional symptoms, 17,7% for conduct disorders, 16.8% for hyperactivity, 14% for interpersonal relationships, 18,7% for the total scores and 10.2% for the impact supplement. Questionnaires answered by the teachers had 1.83% for emotional symptoms, 8.25% for conduct disorders, 8.25% for hyperactivity, 2.75% for interpersonal relationships, 8.25% for the total scoring and 4.58% for the impact supplement. Combining the results obtained from parents and teachers we have diagnostic hypotheses in the frequencies of 7.14% for emotional disorders, 9.82% for conduct disorders, and 12.5% for psychiatric disorder not otherwise specified and no combination was noted between parents and teachers for hyperactivity. Mean age was 8.18 years, with 63% of the children being male and 37% female. CONCLUSION: SDQ can be useful for a preliminary screening in the investigation of possible psychiatric disorders in childhood.
Cheung, Cecilia Sin-Sze; Pomerantz, Eva M.
2011-01-01
This research examined parents' involvement in children's learning in the United States and China. Beginning in seventh grade, 825 American and Chinese children (mean age = 12.74 years) reported on their parents' involvement in their learning as well as their parents' psychological control and autonomy support every 6 months until the end of 8th…
Research note: Extracting a Cycvle from Ethiopian Agricultural ...
African Journals Online (AJOL)
This study has two objectives. First, to extract a cycle from agricultural GDP. Second, to compute the periodicity of the cycle. To achieve these objectives, a univariate time series procedure is applied. It is found that agricultural GDP is cyclic and that the cycle occurs every 8.25 years. (Eastern Africa Social Science Research ...
Electrical, dielectric, and optical properties of Sb2O3–Li2O–MoO3 glasses
Czech Academy of Sciences Publication Activity Database
Kubliha, M.; Soltani, M.T.; Trnovcová, V.; Legouera, M.; Labaš, V.; Kostka, Petr; Le Coq, D.; Hamzaoui, M.
2015-01-01
Roč. 428, NOV 15 (2015), s. 42-48 ISSN 0022-3093 R&D Projects: GA ČR GAP106/12/2384 Institutional support: RVO:67985891 Keywords : lithium molybdenum–antimonite glasses * electrical conductivity * electrical relaxation * dielectric response * optical properties Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass Impact factor: 1.825, year: 2015
Czech Academy of Sciences Publication Activity Database
Karásek, Pavel; Planeta, Josef; Roth, Michal
2013-01-01
Roč. 85, č. 1 (2013), s. 327-333 ISSN 0003-2700 R&D Projects: GA ČR(CZ) GAP106/12/0522; GA ČR(CZ) GAP206/11/0138 Institutional support: RVO:68081715 Keywords : supercritical water * fused silica capillary * surface treatment Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 5.825, year: 2013
Resonance – Journal of Science Education | News
Indian Academy of Sciences (India)
S G Srinivasan · More Details Fulltext PDF. pp 6-7 Table of Contents. Table of Contents · More Details Fulltext PDF. pp 8-25 General Article. Dr Smith goes to Los Alamos - Cyril Stanley Smith, Plutonium Metallurgy, and the Manhattan Project · Srivilliputhur G Srinivasan Siegfried S Hecker Paul S Follansbee Michael I Baskes.
17 CFR 9.12 - Effective date of disciplinary or access denial action.
2010-04-01
... ACTIONS Notice and Effective Date of Disciplinary Action or Access Denial Action § 9.12 Effective date of disciplinary or access denial action. (a) Effective date. Any disciplinary or access denial action taken by an... cause a disciplinary action to become effective prior to that time if: (1) As authorized by § 8.25 of...
WA97 results on strangeness production in lead lead collisions at 158 A GeV/c
Czech Academy of Sciences Publication Activity Database
Andersen, E.; Andrighetto, A.; Antinori, F.; Böhm, Jan; Píška, Karel; Staroba, Pavel; Šťastný, Jan; Vaníčková, Marcela; Závada, Petr
1996-01-01
Roč. 610, - (1996), 165c-174c ISSN 0375-9474 R&D Projects: GA ČR GA202/95/0217 Keywords : hyperon * antihyperon production * yield (Lambda Antilambda) * yield (Omega- Xi-) * mass spectrum * CERN SPS * 158 GeV/c/nucleon Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 1.825, year: 1996
Dégâts des bruches sur le pouvoir germinatif des graines de quatre ...
African Journals Online (AJOL)
Diamond and variety germination presented a much lower 0.75% than the other three varieties (Mujilanga 7.75%, 8.25% and IT82D Yamashi-889 12.75%. Conclusion and application of results: This survey permitted to conclude that the variety Diamant lost the germinating power after a length of conservation of 60 days.
Czech Academy of Sciences Publication Activity Database
Spangler, J.; Tomala, Jakub; Luca, V.C.; Jude, K.M.; Dong, S.; Ring, A.M.; Votavová, Petra; Pepper, M.; Kovář, Marek; Garcia, K.Ch.
2015-01-01
Roč. 42, č. 5 (2015), s. 815-825 ISSN 1074-7613 R&D Projects: GA ČR GA13-12885S; GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:61388971 Keywords : IN-VIVO EXPANSION * AUTOIMMUNE-DISEASE * SMALL-MOLECULE Subject RIV: EC - Immunology Impact factor: 24.082, year: 2015
Problematika předloh Druhé církevněslovanské legendy o sv. Václavu
Czech Academy of Sciences Publication Activity Database
Spurná, Kateřina
2013-01-01
Roč. 13, č. 1 (2013), s. 16-24 ISSN 1802-825X. [Škola, jazyk a literatura na po č átku nového ti síciletí 2012–2013. Ústí nad Labem, 27.2.2013] Institutional support: RVO:68378017 Keywords : Old Church Slavonic Subject RIV: AI - Linguistics
Mechanical, microstructure and electrical properties of ternary ZnO ...
Indian Academy of Sciences (India)
V2O5–Mn3O4 (ZVM)-based varis- tors were investigated at different sintering temperatures of 825–950◦C. The microstructure of the samples consists mainly of ZnO grains with Zn3(VO4)2, ZnV2O4 and VO2 as minor secondary phases.
Variation in the chemical composition of the essential oils of different ...
African Journals Online (AJOL)
The essential oils from the different organs of wild and domesticated Lippia multiflora Moldenke, analysed by GPC-FID and GPC-MS, were rich in monoterpenes. These made up 95.0, 94.0, 82.5 and 61.0% of oils from leaves, flowers, stems and roots, respectively, with a predominance of aromatic monoterpenes: p-cymene, ...
Almond, Douglas; Edlund, Lena; Palme, Marten
2007-01-01
Japanese atomic bomb survivors irradiated 8-25 weeks after ovulation subsequently suffered reduced IQ [Otake and Schull, 1998]. Whether these findings generalize to low doses (less than 10 mGy) has not been established. This paper exploits the natural experiment generated by the Chernobyl nuclear accident in April 1986, which caused a spike in…
2011-11-16
..., Young and Stephens Counties, Texas. g. Filed Pursuant to: Federal Power Act, 16 U.S.C. 791a-825r. h..., 888 First Street NE., Washington, DC 20426. Commenters can submit brief comments up to 6,000... motion to intervene in accordance with the Commission's Rules may become a party to the proceeding. Any...
Ignition of DME and DME/CH4 at High Pressure: Flow Reactor Experiments and Kinetic Modeling
DEFF Research Database (Denmark)
Hashemi, Hamid; Christensen, Jakob Munkholt; Glarborg, Peter
The pyrolysis and oxidation of dimethyl ether (DME) and its mixtures with methane were investigated at high pressures (50 and 100 bar) and intermediate temperatures (450―900 K) in a laminar flow reactor. DME pyrolysis started at 825 K (at 50 bar). The onset of DME reaction was detected at 525―550 K...
The Social Self in Early Adolescence: Two Longitudinal Investigations in the United States and China
Setoh, Peipei; Qin, Lili; Zhang, Xin; Pomerantz, Eva M.
2015-01-01
This research examined how children's inclusion of social personal attributes (e.g., talkative and argumentative) in their views of themselves changes over early adolescence in the United States and China. In 2 studies (N = 825 in Study 1 and 394 in Study 2) using open-ended methods (e.g., completion of "I ... " stems), American and…
The bird's-eye perspective: how do district health managers ...
African Journals Online (AJOL)
KB Von Pressentin
This study supports the employment of FPs at scale within the. South African district ... by the academic leadership.8,25 In South Africa, policy documents acknowledge the ... KvP conducted the qualitative data analysis under the supervision of RM. ..... cited as examples of them making a 'huge difference as part of a complex ...
78 FR 65639 - Notice of Filing; Wyrsch, Martha B.
2013-11-01
... Filing; Wyrsch, Martha B. Take notice that on October 25, 2013, Martha B. Wyrsch submitted for filing, an application for authority to hold interlocking positions, pursuant to section 305(b) of the Federal Power Act (FPA), 16 U.S.C. 825d(b) and Part 45 of the Federal Energy Regulatory Commission's (Commission) Rules...
College Student Assessment of the Signs of Alcohol Poisoning: To Dream the Impossible Dream
Misch, Donald A.
2011-01-01
In 2005 there were 1,825 alcohol-related unintentional injury deaths (e.g., vehicular accidents, falls, drowning, burns, suffocation, and gunshot wounds) among college students from 18 to 24 years of age. Of these, 468 college students died from alcohol-related, nontraffic injuries. Unfortunately, there is no good estimate of the number of college…
24 CFR 8.26 - Distribution of accessible dwelling units.
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Distribution of accessible dwelling units. 8.26 Section 8.26 Housing and Urban Development Office of the Secretary, Department of Housing... accessible dwelling units. Accessible dwelling units required by § 8.22, 8.23, 8.24 or 8.25 shall, to the...
Genome Sequence of the Marine Photoheterotrophic Bacterium Erythrobacter sp Strain NAP1
Czech Academy of Sciences Publication Activity Database
Koblížek, Michal; Janouškovec, J.; Oborník, Miroslav; Johnson, J. H.; Ferriera, S.; Falkowski, P. G.
2011-01-01
Roč. 193, č. 20 (2011), s. 5881-5882 ISSN 0021-9193 R&D Projects: GA ČR GAP501/10/0221 Institutional research plan: CEZ:AV0Z50200510; CEZ:AV0Z60220518 Keywords : BACTERIOCHLOROPHYLL-A * OCEAN Subject RIV: EE - Microbiology, Virology; EE - Microbiology, Virology (BC-A) Impact factor: 3.825, year: 2011
Energy Technology Data Exchange (ETDEWEB)
Moure, A.; Tartaj, J.; Moure, C. [Instituto de Ceramica y Vidrio, CSIC, C/Kelsen 5, 28049 Madrid (Spain); Castro, A. [Instituto de Ciencia de Materiales de Madrid, CSIC, c/Sor Juana Ines de la Cruz, 3 Cantoblanco, 28049 Madrid (Spain)
2009-03-15
Dense ceramics with La{sub 0.80}Sr{sub 0.20}Ga{sub 0.85}Mg{sub 0.15}O{sub 2.825} and La{sub 0.80}Sr{sub 0.15}Ga{sub 0.85}Mg{sub 0.20}O{sub 2.825} compositions have been prepared by sintering of mechanosynthesized precursors. The perovskite is synthesized after 85 h of milling in a planetary mill. Single phases have been obtained at conditions that are not possible if traditional solid-state reaction (SSR) method is used. The influence of milling time and composition in the reactivity of the precursors is studied. Highest purity is obtained in Sr = 0.15 and Mg = 0.20 composition, with relative density higher than 97%. The total elimination of typical secondary phases for these compositions, as SrLaGaO{sub 4} and SrLaGa{sub 3}O{sub 7}, allows the total conductivity of the ceramics to be improved. The influence of the grain size and the nature of the grain boundaries on the electrical characteristic of the ceramics are also discussed. (author)
DEFF Research Database (Denmark)
Din, Rameez Ud; Piotrowska, Kamila; Gudla, Visweswara Chakravarthy
2015-01-01
The surface treatment of aluminium alloys under steam containing KMnO4 and HNO3resulted in the formation of an oxide layer having a thickness of up to 825 nm. The use of KMnO4 and HNO3 in the steam resulted in incorporation of the respective chemical species into the oxide layer. Steam treatment ...
76 FR 76710 - Merritt, Beck C.; Notice of Filing
2011-12-08
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. ID-6730-000] Merritt, Beck C.; Notice of Filing Take notice that on December 1, 2011, Beck C. Merritt submitted for filing, an..., 16 U.S.C. 825d (b) and Part 45 of Title 18 of the Code of Federal Regulations, 18 CFR part 45. Any...
The frost-resistance mechanism in paramo plants is related to geographic origin
Czech Academy of Sciences Publication Activity Database
Sklenář, P.; Kučerová, Andrea; Macek, Petr; Macková, J.
2012-01-01
Roč. 50, č. 4 (2012), s. 391-400 ISSN 0028-825X R&D Projects: GA MŠk LC06073; GA AV ČR IAA601110702 Institutional research plan: CEZ:AV0Z60050516 Institutional support: RVO:67985939 Keywords : avoidance by supercooling * equatorial Andes * freezing tolerance Subject RIV: EH - Ecology, Behaviour Impact factor: 0.622, year: 2012
Překlad latinského puer v nejstarším českém biblickém překladu
Czech Academy of Sciences Publication Activity Database
Pytlíková, Markéta
2013-01-01
Roč. 13, č. 2 (2013), s. 26-34 ISSN 1802-825X R&D Projects: GA ČR GAP406/10/1140; GA ČR GAP406/10/1153 Institutional support: RVO:68378092 Keywords : Bible * Old Czech * translation * polysemy * synonyms Subject RIV: AI - Linguistics http://www.pf.ujep.cz/files/KBO/USTA/Usta_2013-2.pdf
Pramana – Journal of Physics | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Pramana – Journal of Physics. K S Ojo. Articles written in Pramana – Journal of Physics. Volume 80 Issue 5 May 2013 pp 825-835. Comparison of backstepping and modified active control in projective synchronization of chaos in an extended Bonhöffer–van der Pol oscillator · K S Ojo A N Njah S T Ogunjo.
Cheung, Cecilia Sin-Sze; Pomerantz, Eva M.
2015-01-01
This research examined whether the benefits of parents' involvement in children's learning are due in part to value development among children. Four times over the 7th and 8th grades, 825 American and Chinese children (M age = 12.73 years) reported on their parents' involvement in their learning and their perceptions of the value their parents…
Does Adolescents' Disclosure to their Parents Matter for their Academic Adjustment?
Cheung, Cecilia S.-S.; Pomerantz, Eva M.; Dong, Wei
2013-01-01
The role of adolescents' disclosure to their parents in their academic adjustment was examined in a study of 825 American and Chinese adolescents (mean age = 12.73 years). Four times over the seventh and eighth grades, adolescents reported on their spontaneous disclosure of everyday activities to their parents, the quality of their relationships…
78 FR 12307 - Taylor, G. Tom; Notice of Filing
2013-02-22
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. ID-5705-001] Taylor, G. Tom; Notice of Filing Take notice that on February 14, 2013, G. Tom Taylor filed an application to hold interlocking positions pursuant to section 305(b) of the Federal Power Act, 16 U.S.C. 825d(b), Part 45 of the...
Ionophorous functions of phosphatidic acid in the plant cell
Czech Academy of Sciences Publication Activity Database
Medvedev, S.S.; Tankelyun, O.V.; Batov, A.Y.; Voronina, O.V.; Martinec, Jan; Macháčková, Ivana
2006-01-01
Roč. 53, č. 1 (2006), s. 39-47 ISSN 1021-4437 R&D Projects: GA MŠk 1P05ME825 Grant - others:Russian Foundation for Basic Research 05-04-49619 Institutional research plan: CEZ:AV0Z50380511 Keywords : Zea mays * phosphatidic acid * membrane vesicles Subject RIV: EF - Botanics Impact factor: 0.321, year: 2006
Qin, Lili; Pomerantz, Eva M.; Wang, Qian
2009-01-01
This research examined the role of children's decision-making autonomy in their emotional functioning during early adolescence in the United States and China. Four times over the 7th and 8th grades, 825 American and Chinese children (M = 12.73 years) reported on the extent to which they versus their parents make decisions about issues children…
Journal of Astrophysics and Astronomy | Indian Academy of Sciences
Indian Academy of Sciences (India)
2016-01-27
Jan 27, 2016 ... ... of the two bands were simultaneously analyzed using the W–D code. The solutions show that GSC 02265-01456 is an extremely low mass ratio ( = 0.087) overcontact binary system with a contact degree of = 82.5%. The difference between the two maxima of the light curve can be explained by a dark ...
Indian Academy of Sciences (India)
to date, no data are available on size-distributions of aerosols of various species at this site. From the diurnal variation of aerosol size distri- butions reported in Chate and Pranesha (2004), the baseline distributions at 0300h IST (corres- ponding to 82.5. ◦. E longitude), depleted number distributions owing to fog formation at ...
New fractal structures for frequencies close to the visible range
DEFF Research Database (Denmark)
Malureanu, Radu; Sandru, A.; Andryieuski, Andrei
2011-01-01
In this paper we present a new type of fractal resonator to be used in the red/NIR region of the spectra. The structure presents high-transmission band in 795-825nm range. The stop band is in the 683-731 nm range. Due to the huge difference in the spectra within such a short range, the structure...
2010-04-01
..., containing a gated timber spillway structure 65 feet wide, with 3 gates and a fish passage facility; (2) a... wide with 5 gates and a fish passage facility 24 feet wide; (2) a reservoir with surface area of 23.825..., 250 feet long and 5.5 feet high, with a concrete cut-off wall and rock masonry downstream face...
Genetic variation in ABC transporter A1 contributes to HDL cholesterol in the general population
DEFF Research Database (Denmark)
Frikke-Schmidt, Ruth; Nordestgaard, Børge G; Jensen, Gorm B
2004-01-01
on lipid traits in 9,259 individuals from the general population. Heterozygosity for ABCA1 mutations was identified in 10% of individuals with low HDL-C only. Three of 6 nonsynonymous SNPs (V771M, V825I, and R1587K) were associated with increases or decreases in HDL-C in women in the general population...
2010-06-15
... cattle, lean hogs, feeder cattle), softs (e.g., sugar, cotton, coffee, cocoa) and energy (e.g., crude oil........ none none 8:25 a.m.-1:25 p.m. Cocoa Cocoa ICE-US 10 metric tons.... none none 4 a.m.-2 p.m. Coffee... derivative products, including Trust Issued Receipts, to monitor trading in the Units. The Exchange...
Czech Academy of Sciences Publication Activity Database
Strachota, Adam; Černý, Martin; Chlup, Zdeněk; Šlouf, Miroslav; Brus, Jiří; Pleštil, Josef; Sucharda, Zbyněk; Havelcová, Martina; Halasová, Martina
423-424, 1 September (2015), s. 9-17 ISSN 0022-3093 R&D Projects: GA ČR GAP107/12/2445 Institutional support: RVO:61389013 ; RVO:67985891 ; RVO:68081723 Keywords : silicon oxynitrocarbide * silicon oxycarbide * hydrosilylation Subject RIV: CD - Macromolecular Chemistry; JI - Composite Materials (USMH-B); JL - Materials Fatigue, Friction Mechanics (UFM-A) Impact factor: 1.825, year: 2015
Horizontal transfer of mitochondria between mammalian cells: beyond co-culture approaches
Czech Academy of Sciences Publication Activity Database
Berridge, M.V.; McConnell, M. J.; Grasso, C.; Bajziková, Martina; Kovářová, Jaromíra; Neužil, Jiří
2016-01-01
Roč. 38, June (2016), s. 75-82 ISSN 0959-437X R&D Projects: GA ČR(CZ) GAP301/10/1937; GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:86652036 Keywords : MESENCHYMAL STEM-CELLS * GENE-TRANSFER * SUPPORTING ASPARTATE BIOSYNTHESIS Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.825, year: 2016
Adjustable-Speed Single-Phase IM Drive with Reduced Number of Switches
Czech Academy of Sciences Publication Activity Database
Chomát, Miroslav; Lipo, T. A.
2003-01-01
Roč. 39, č. 3 (2003), s. 819-825 ISSN 0093-9994 R&D Projects: GA ČR GA102/02/0554 Grant - others:National Science Foundation(US) GA9820434 Institutional research plan: CEZ:AV0Z2057903 Keywords : AC motor drives * converters * induction motor drives Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.783, year: 2003
Inclusive jet cross-section and a search for quark compositeness at the CERN anti pp Collider
International Nuclear Information System (INIS)
Alitti, J.; Bareyre, P.; Bonamy, P.; Bourliaud, M.; Magneville, C.; Meyer, J.P.; Stirling, A.V.; Zaccone, H.; Ansari, R.; Buskulic, D.; Chollet, J.C.; Fayard, L.; Froidevaux, D.; Gaillard, J.M.; Merkel, B.; Moniez, M.; Parrour, G.; Petroff, P.; Repellin, J.P.; Unal, G.; Blaylock, G.; DiLella, L.; Egan, G.F.; Einsweiler, K.F.; Fumagalli, G.; Gildemeister, O.; Goessling, C.; Goggi, V.G.; Hellman, S.; Hultqvist, K.; Incandela, J.; Jakobs, K.; Jenni, P.; Linssen, L.; Lubrano, P.; Mapelli, L.; Meier, K.; Nessi, M.; Nessi-Tedaldi, F.; Onions, C.; Pal, T.; Parker, M.A.; Poppleton, A.; Rasmussen, L.; Stapnes, S.; Tovey, S.N.; Vercesi, V.; Weidberg, A.R.; Wood, D.R.; Bonesini, M.; Cavalli, D.; Costa, G.; Gianotti, F.; Mandelli, L.; Mazzanti, M.; Perini, L.; Polesello, G.; Borer, K.; Federspiel, A.; Hara, K.; Hugentobler, E.; Moning, R.; Mueller, L.; Pretzl, K.; Schacher, J.; Conta, C.; Dell'Acqua, A.; Ferrari, R.; Fraternali, M.; Livan, M.; Pastore, F.; Pennacchio, E.; Rimoldi, A.; DeWolf, R.S.; Lefebvre, M.; Munday, D.J.; Pentney, J.M.; Singh, S.L.; Wells, P.S.; White, T.O.; Wotton, S.A.; Gruenendahl, S.; Kluge, E.E.; Kurz, N.; Lami, S.; Plothow-Besch, H.; Tsesmelis, E.
1991-01-01
The inclusive jet cross-section has been measured at the CERN anti pp Collider (√s = 630 GeV) as a function of the jet transverse momentum (p T ) and pseudorapidity (η) for p T values up to 180 GeV and for -2 c >825 GeV (95% CL) is set on the quark compositeness scale Λ c . (orig.)
van Krefeld-Alfane, S.; Sarntheim, M.; Erlenkeuser, S.; Grootes, P.; Jung, S.J.A.; Nadeau, M.J.; Pflaumann, U.; Voelker, A.
2000-01-01
Surface and deepwater paleoclimate records in Irminger Sea core SO82-5 (59°N, 31°W) and Icelandic Sea core PS2644 (68°N, 22°W) exhibit large fluctuations in thermohaline circulation (THC) from 60 to 18 calendar kyr B.P., with a dominant periodicity of 1460 years from 46 to 22 calendar kyr B.P.,
Czech Academy of Sciences Publication Activity Database
Bouřová, Lenka; Koštrnová, Alexandra; Hejnová, Lucie; Moravcová, Zuzana; Moon, H. E.; Novotný, Jiří; Milligan, G.; Svoboda, Petr
2003-01-01
Roč. 85, č. 1 (2003), s. 34-49 ISSN 0022-3042 R&D Projects: GA MŠk LN00A026; GA ČR GA309/01/0255 Grant - others:Welcome Trust(GB) xx Institutional research plan: CEZ:AV0Z5011922 Keywords : membrane domains * GTPase activity * G protein coupling Subject RIV: CE - Biochemistry Impact factor: 4.825, year: 2003
Czech Academy of Sciences Publication Activity Database
Culling, M.; Janko, Karel; Boron, A.; Vasiljev, V. P.; Cote, I. M.; Hewitt, G. M.
2006-01-01
Roč. 15, 1 (2006), s. 173-190 ISSN 0962-1083 R&D Projects: GA ČR GP206/05/P586; GA AV ČR IBS5045111 Grant - others:RFBR 02-04-48354 Institutional research plan: CEZ:AV0Z50450515 Keywords : colonization * glacial refugia * mitochondrial DNA Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.825, year: 2006
K problematice církevněslovanského překladu Benediktovy Řehole
Czech Academy of Sciences Publication Activity Database
Spurná, Kateřina
2010-01-01
Roč. 10, 2-3 (2010), s. 122-126 ISSN 1802-825X. [Škola, jazyk a literatura 2010. Ústí nad Labem, 27.10.2010] R&D Projects: GA AV ČR IAA900920901 Institutional research plan: CEZ:AV0Z90920516 Keywords : paleoslavistics * Croatian Glagolitic texts * translation method of Latin ablative absolute * Rule of Saint Benedict Subject RIV: AI - Linguistics
Czech Academy of Sciences Publication Activity Database
Horká, Marie; Šalplachta, Jiří; Karásek, Pavel; Kubesová, Anna; Horký, J.; Matoušková, H.; Šlais, Karel; Roth, Michal
2013-01-01
Roč. 85, č. 14 (2013), s. 6806-6812 ISSN 0003-2700 R&D Projects: GA MV VG20112015021; GA ČR(CZ) GAP106/12/0522 Institutional support: RVO:68081715 Keywords : capillary isoelectric focusing * matrix-assisted laser desorption/ionization time-of-flight mass spectrometry * Dickeya spp. bacteria Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 5.825, year: 2013
Elements of Boolean-Valued Dempster-Shafer Theory
Czech Academy of Sciences Publication Activity Database
Kramosil, Ivan
2000-01-01
Roč. 10, č. 5 (2000), s. 825-835 ISSN 1210-0552. [SOFSEM 2000 Workshop on Soft Computing. Milovy, 27.11.2000-28.11.2000] R&D Projects: GA ČR GA201/00/1489 Institutional research plan: AV0Z1030915 Keywords : Boolean algebra * belief function * Dempster-Shafer theory * Dempster combination rule * nonspecifity degree Subject RIV: BA - General Mathematics
Organized Mesoporous Alumina: Synthesis, Structure and Potential in Catalysis
Czech Academy of Sciences Publication Activity Database
Čejka, Jiří
2003-01-01
Roč. 254, - (2003), s. 327-338 ISSN 0926-860X R&D Projects: GA AV ČR IAA4040001; GA ČR GA104/02/0571; GA MŠk ME 404 Institutional research plan: CEZ:AV0Z4040901 Keywords : organized mesoporous alumina * mesoporous molecular sieves * synthesis Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.825, year: 2003
Research Article Special Issue
African Journals Online (AJOL)
pc
2017-11-10
Nov 10, 2017 ... natural convection state, the motion of fluid occurs when there is a change in density of fluid or gases. Heat transfer for vertical plates in equation 1 can be conducted with accuracy of RA >. 109. Nu = 0.825 +. 0.387Ra. 1 + ( . ) (1). Convention only happens when there is a medium for it to travel. If there is no ...
Physiological Monitoring in Diving Mammals
2015-09-30
1 DISTRIBUTION STATEMENT A. Approved for public release; distribution is unlimited. Physiological Monitoring in Diving Mammals Andreas...825-2025 email: andreas.fahlman@tamucc.edu Peter L. Tyack School of Biology Sea Mammal Research Unit Scottish Oceans Institute...OBJECTIVES This project is separated into three aims: Aim 1: Develop a new generation of tags/data logger for marine mammals that will
Irradiation induced densification and its correlation with three-membered rings in vitreous silica
Czech Academy of Sciences Publication Activity Database
Gavenda, T.; Gedeon, O.; Jurek, Karel
2015-01-01
Roč. 425, Oct (2015), s. 61-66 ISSN 0022-3093 R&D Projects: GA ČR(CZ) GA15-12580S Institutional support: RVO:68378271 Keywords : silica glass * electron irradiation * densification * Raman spectroscopy * glass topology * three-membered rings Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 1.825, year: 2015
29 CFR 825.702 - Interaction with Federal and State anti-discrimination laws.
2010-07-01
..., therefore, not an “eligible” employee under FMLA) may not be denied maternity leave if the employer normally..., DEPARTMENT OF LABOR OTHER LAWS THE FAMILY AND MEDICAL LEAVE ACT OF 1993 Effect of Other Laws, Employer... under that act. Thus, the leave provisions of the [FMLA] are wholly distinct from the reasonable...
Generation of biogas using crude glycerin from biodiesel production as a supplement to cattle slurry
Energy Technology Data Exchange (ETDEWEB)
Robra, S.; Neto, J. A. Almeida [Departamento de Ciencias Agrarias e Ambientais, Universidade Estadual de Santa Cruz, Rod. Ilheus/Itabuna km 16 s/n, CEP 45662-000 Ilheus, Bahia (Brazil); Serpa da Cruz, R.; de Oliveira, A.M.; Santos, J.V. [Departamento de Ciencias Exatas e Tecnologicas, Universidade Estadual de Santa Cruz, Rod. Ilheus/Itabuna km 16 s/n, CEP 45662-000 Ilheus, Bahia (Brazil)
2010-09-15
The influence of crude glycerin on biogas production and methane content of the produced biogas was studied, when added to cattle slurry. The experimental design consisted of 5% wt (Gli 5), 10% wt (Gli 10), and 15% wt (Gli 15) of crude glycerin added to cattle slurry, and one control digester without addition of crude glycerin. Anaerobic digestion was carried out in 4 laboratory size CSTR-type biogas digesters with a working volume of 3 L, in semi-continuous regime at mesophilic conditions, over a period of 10 weeks. The highest biogas yields (825.3 mL g{sup -1} and 825.7 mL g{sup -1}, respectively) relative to mass of volatile compounds added, were produced by the treatments Gli 5 and Gli 10. The control treatment produced 268.6 mL g{sup -1}, whereas the treatment Gli 15 produced 387.9 mL g{sup -1}. This low value was due to the breakdown of the process. Compared to the control, methane contents was increased by 9.5%, 14.3%, and 14.6%, respectively, for the treatments Gli 5, Gli 10, and Gli 15. (author)
International Nuclear Information System (INIS)
Bullen, D.B.; Gdowski, G.E.; McCright, R.D.
1987-10-01
The Nuclear Waste Management Program at Lawrence Livermore National Laboratory is responsible for the development of the waste package design to meet the Nuclear Regulatory Commission licensing requirements for the Nevada Nuclear Waste Storage Investigations (NNWSI) Project. The metallic container component of the waste package is required to assist in providing substantially complete containment of the waste for a period of up to 1000 years. Long term phase stability of the austenitic candidate materials (304L and 316L stainless steels and alloy 825) over this time period at moderate temperatures (100-250 0 C) can impact the mechanical and corrosion behavior of the metal barrier. A review of the technical literature with respect to phase stability of 304L, 316L and 825 is presented. The impact of martensitic transformations, carbide precipitation and intermediate (σ, chi, and eta) phase formation on the mechanical properties and corrosion behavior of these alloys at repository relevant conditions is discussed. The effect of sensitization on intergranular stress corrosion cracking (IGSCC) of each alloy is also addressed. A summary of the impact of phase stability on the degradation of each alloy in the proposed repository environment is included. 32 refs., 6 figs
International Nuclear Information System (INIS)
Fayaz, Rima; Kari, Behrouz M.
2009-01-01
To improve the energy efficiency of buildings via compliance to regulation in Iran, Code No. 19 was devised in 1991. The code lacks high level aims and objectives, addressing the characteristics of Iranian buildings. As a consequence, the code has been revised and is not completely implemented in practice, and still remains inefficient. As with any energy coding system, this code has to identify the right balance between the different energy variables for the Iranian climate and way of life. In order to assist improvements to high level objectives of Code 19, this code is compared with ISO 9164, EN 832, German regulation, TS 825 of Turkey and China's GB 50189 to understand how these have adapted international standards to national features. In order to test the appropriateness of Code 19, five case study buildings in Iran are assessed against Code 19 as well as Turkish standard TS 825 and the results are compared. The results demonstrate that Code 19 is efficient in calculations of building envelope, but it needs improvements in the areas of ventilation, gains from internal and solar sources. The paper concludes by offering suggestions for improving the code.
Cytological and histological changes in the spleen of continuously irradiated rats
International Nuclear Information System (INIS)
Praslicka, M.; Chlebovsky, O.
1976-01-01
The study evaluates quantitative cytological and histological changes in splenic white and red pulp of rats continuously irradiated for up to 140 days with daily doses ranging from 0.5 R to 82.5 R. A significant reduction of lymphocyte incidence begins at 5 R/day and it continues to drop with every further increase in the dose rate until a steady state of about 5 per cent is reached at 82.5 R/day. Small lymphocytes are relatively more affected. Irradiated animals show a wave-like increase in ectopic erythropoiesis in spleen red pulp from day 30 on even with the lowest dose rates of 0.5 and 1 R/day. The ratio or relative incidences of haemocytoblasts and erythroblasts increases approximately twofold, indicating that a substantial reduction of stem cells is compensated to a large extent already at an early stage of erythropoiesis. The incidence of myeloid elements rises, from the 40th day of exposure, the increase being more apparent at medium dose rates for eosinophils than for neutrophils. Both the red and white splenic pulps of exposed animals display an increased incidence of plasma cells. (author)
Contact angle measurements at the colemanite and realgar surfaces
Koca, Sabiha; Savas, Mehmet
2004-03-01
Colemanite is one of the most important boron minerals and covers an important part of Turkey's boron mineral deposits. The friable nature of the colemanite tends to produce a large amount of fines. Flotation appears to be a promising technique to recover colemanite from such fines. During flotation process, selectivity problem arises between colemanite and associated gangue minerals such as realgar. There is a close relationship between floatability of minerals and contact angle. Therefore, surface hydrophobicity of colemanite and realgar minerals were investigated by receding contact angle measurements in the absence and presence of flotation reagents. The water contact angle values at the colemanite surface remained almost unchanged at 32-35° in the solutions of potassium amyl xanthate (KAX), potassium ethyl xanthate (KEX) and petroleum sulphanate (R825) while another petroleum sulphanate (R840), sodium oleate and tallow amine (Armac-T) affected hydrophobicity of colemanite, and the contact angle values increased up to 47°. The contact angle values of 62, 63, 45, 46, 39, and 43° at the realgar surface were obtained in the solutions of KAX, KEX, sodium oleate, R825, R840 and Armac-T, respectively.
International Nuclear Information System (INIS)
Sisman, Nuri; Kahya, Emin; Aras, Nil; Aras, Haydar
2007-01-01
The external walls and roof of a building are the interface between its interior and the outdoor environment. Insulation of the external walls and roof is the most cost-effective way of controlling the outside elements to make homes more comfortable. Although insulation is generally accepted as a factor increasing the building costs, with the calculations we have shown that this is not the case. Fuel consumption and operational costs are reduced by increasing the thickness of the external walls and roof (ceiling), despite an increase in the investment costs. According to Turkish Standard Number 825 (TS 825), there are four different degree-day (DD) regions, and the required heat loads for the buildings in these regions exhibit large differences. Therefore, a method based on costs is needed for the determination of optimum insulation thicknesses of different DD regions. In this study, optimum insulation thicknesses for different DD regions of Turkey, namely, Izmir (DD: 1450), Bursa (DD: 2203), Eskisehir (DD: 3215) and Erzurum (DD: 4856), have been determined for a lifetime of N years, maximizing the present worth value of annual energy savings for insulated external walls
Estadio de Kansas City (EE. UU.
Directory of Open Access Journals (Sweden)
Murphy, C. F.
1978-05-01
Full Text Available The Crosby Kemper stadium, located in the center of an industrial district of Kansas City, was designed for various uses which include activities ranging from music and sports competitions to equestrian sports. It has a capacity for approximately 16 to 18,000 people and parking for 4,000 cars.
The outstanding feature of its architectonic conception is the solution adopted for building the roof, by means of enormous metal tubular beams, of triangular section and a height of 8.25 meters with pipe diameters reaching 120 cm.
El estadio Crosby Kemper, situado en el centro de un distrito industrial de Kansas, fue concebido para un funcionamiento diverso que comprende actividades que van desde la música y competiciones deportivas hasta pruebas hípicas. Tiene capacidad para unas 16.000 ó 18.000 personas, y plazas de aparcamiento para 4.000 coches.
En su concepción arquitectónica sobresale la solución adoptada para la realización de la cubierta, mediante enormes vigas tubulares metálicas, de sección triangular y altura de 8,25 m, con diámetros de tubo que alcanzan los 120 cm.
Problems in the design and specification of containers for vitrified high-level liquid waste
International Nuclear Information System (INIS)
Corbet, A.D.W.; Hall, G.G.; Spiller, G.T.
1976-01-01
In the United Kingdom the growing problem of ensuring the safe storage of high-level liquid waste over long time scales has led to a policy for implementing solidification. A brief description is given of the HARVEST vitrification process, which is essentially a scaled-up version of the FINGAL process with increased throughput. The functional requirements of the container are considered. It must be made of a material which can be fabricated to a high standard. Diameters up to 600 mm for right circular cylindrical containers and 1200 mm for annular containers are contemplated. Computer aids for axisymmetric and three-dimensional heat transfer and stress analysis are identified. One example is given of the thermal profile for the cylindrical container in the furnace and another example for the annular container following an accident condition. Measured values are given for high temperature oxidation, emissivity and the short-term creep strength of various alloys. Corrosion in fresh water and sea water over long time periods and leaching of partially exposed solid waste are discussed and a conceptual package for sea bed disposal is described. The relative merits of the different methods of manufacture are pointed out and the paper concludes that HK-40 or better INCOLOY alloy 800L are suitable materials of construction. (author)
Preliminary design of the cooling system for a gas-cooled, high-fluence fast pulsed reactor (HFFPR)
International Nuclear Information System (INIS)
Monteith, H.C.
1978-10-01
The High-Fluence Fast Pulsed Reactor (HFFPR) is a research reactor concept currently being evaluated as a source for weapon effects experimentation and advanced reactor safety experiments. One of the designs under consideration is a gas-cooled design for testing large-scale weapon hardware or large bundles of full-length, fast reactor fuel pins. This report describes a conceptual cooling system design for such a reactor. The primary coolant would be helium and the secondary coolant would be water. The size of the helium-to-water heat exchanger and the water-to-water heat exchanger will be on the order of 0.9 metre (3 feet) in diameter and 3 metres (10 feet) in length. Analysis indicates that the entire cooling system will easily fit into the existing Sandia Engineering Reactor Facility (SERF) building. The alloy Incoloy 800H appears to be the best candidate for the tube material in the helium-to-water heat exchanger. Type 316 stainless steel has been recommended for the shell of this heat exchanger. Estimates place the cost of the helium-to-water heat exchanger at approximately $100,000, the water-to-water heat exchanger at approximately $25,000, and the helium pump at approximately $450,000. The overall cost of the cooling system will approach $2 million
Fracture toughness determination in steam generator tubes
International Nuclear Information System (INIS)
Bergant M; Yawny, A; Perez Ipina, J
2012-01-01
The assessment of the structural integrity of steam generator tubes in nuclear power plants deserved increasing attention in the last years due to the negative impact related to their failures. In this context, elastic plastic fracture mechanics (EPFM) methodology appears as a potential tool for the analysis. The application of EPFM requires, necessarily, knowledge of two aspects, i.e., the driving force estimation in terms of an elastic plastic toughness parameter (e.g., J) and the experimental measurement of the fracture toughness of the material (e.g., the material J-resistance curve). The present work describes the development of a non standardized experimental technique aimed to determine J-resistance curves for steam generator tubes with circumferential through wall cracks. The tubes were made of Incoloy 800 (Ni: 30.0-35.0; Cr: 19.0-23.0; Fe: 35.5 min, % in weight). Due to its austenitic microstructure, this alloy shows very high toughness and is widely used in applications where a good corrosion resistance in aqueous environment or an excellent oxidation resistance in high temperature environment is required. Finally, a procedure for the structural integrity analysis of steam generator tubes with crack-like defects, based on a FAD diagram (Failure Assessment Diagram), is briefly described (author)
Alfa-Laval plate heat exchangers for the power industries
International Nuclear Information System (INIS)
Kitae, Junnosuke; Mtsuura, Kazuyuki
1979-01-01
Within power-generating plants, the transfer and conversion of heat energy of very large quantity are carried out in the process of energy conversion, accordingly the importance of heat exchangers is very high. Heretofore, multi-tube heat exchangers have been used mostly, but Alfa-Laval group developed the heat exchanger with very high efficiency to incorporate it effectively into a power-generating plant. In this plate type heat exchanger, the heat transfer efficiency is very high, and the quantity of stagnation is small as it is compact, consequently it is suitable to the secondary cooling for power-generating plant or the heat exchange of high-priced liquid heat media such as heavy water. Originally, plate type heat exchangers were used for food and chemical industries, therefore the prevention of mixing two liquids, sanitary construction, and corrosion resistance were required. Then they were adopted in iron and steel industry, and large thermal load, large heat transfer area and corrosion resistance to sea water were required. They were adopted in a nuclear power plant for the first time in 1964. In this heat exchanger, channels are formed with corrugated metal sheets, and titanium, stainless steels, Incoloy, Hastelloy and others are used as occasion demands. The Alfa-Laval heat exchangers and their features are explained. (Kako, I.)
Energy Technology Data Exchange (ETDEWEB)
Ilg, Ulf [EnBW Kernkraft GmbH (Germany). Kernkraftwerk Philippsburg; Koenig, Guenter [EnBW Kernkraft GmbH (Germany). Kernkraftwerk Neckarwestheim; Erve, Manfred [AREVA NP GmbH, Erlangen (Germany)
2008-07-01
In the design and construction stage of nuclear power plants relevant decisions may affect the service life of a component, and thus influence safety and availability of the plant. The German ''basic safety concept'' has an important effect on the quality of the BOL (begin of life) status. Materials selection and qualification are of significant importance for the component lifetime and the profitability of the plant. Examples for the implementation of this concept are demonstrated for the steam generator tubing material Incoloy 800, the inside-plated ferritic compound tubes as control rod drive mechanism nozzle through the RPV head of BWR plants that are not susceptible for corrosion enhanced cracking that was observed for Inconel 600 tubing. A fundamental failure analysis of crack formation in Ti stabilized austenitic pipes of BWR plants found since 1993 were definitely identified as intergranular stress corrosion caused by a local sensitization of the welding process induced overheated structured in the heat affected zone. This allowed target-oriented mitigation measures. The safety culture implemented in German nuclear plants in connection with the break preclusion or integrity concept, respectively, including a continuous actualization with respect to the state-of-the art are the technical prerequisites for damage precaution and possible life time extension.
The one-parameter-model - a constitutive equation applied to a heat resistant alloy
International Nuclear Information System (INIS)
Schwarze, E.; Schuster, H.; Nickel, H.
1992-01-01
In the present work a constitutive model earlier developed and used to predict experimental results of hot tests and fatigue tests from creep experiments of metallic materials were modified to comply with the properties of a high temperature resistant material. The improved model accounts for the properties of a material developing a density and a structure of dislocation lines which are capable of interactions with particles (carbides) from a second phase. The time and temperature dependent evolution of the carbide structure has been described by an equation which explains the formation of seeds as well as their growths (Ostwald ripening). The extended model was applied to Incoloy 800H which is known to develop a carbide structure. Therefore hot tensile and fatigue tests, creep and relaxation experiments using the heats ADU and BAK (KFA specifications) at temperature between 800deg C and 900deg C were performed including both solution treated specimens and specimens heat treated for 10, 100 and 1000 hours. As compared with the results from tensile tests where the carbide structures play a subordinated role, alternately, these structures have a decisive influence on the creep properties of specimens during the primary creep phase, i.e. low stresses and high temperatures. (orig.) [de
Development of expanded type plugging technique for leaky tubes of steam generators of Indian PHWRs
International Nuclear Information System (INIS)
Das, Nirupam; Samuel, K.A.; Joemon, V.; Rupani, B.B.
2006-01-01
Steam generators are very important component of Nuclear Power Plant (NPP), as they are part of Primary Heat Transport (PHT) system of Pressurised Heavy Water Reactors (PHWRs). A nuclear power plant of 220 MWe capacity has four mushroom type steam generators, each consisting of 1830 U-tubes (16 mm outside diameter and 1 mm wall thickness) made of Incoloy-800 material. The tubes of 'tube and shell type steam generator' act as the pressure boundary of PHT System. Any structural failure of these tubes may lead to release of radioactivity along with plant outage and significant economic loss. Hence, it is necessary to plug the leaky tubes for continued and safe operation of a steam generator. An expanded type plugging technique has been developed at Reactor Engineering Division to plug the leaky tubes. This plugging technique is selected because of low residual stress imparted in the adjacent 'tube to tube-sheet' joints. This plug meets the various codal requirements of steam generator. A number of qualification trials have been carried out with such plugs in the mock up facility. The expanded plugs meet the design requirements for pull out strength and leak-tightness. This paper describes the design concept of the plug, developmental aspects and qualification of the plugging technique. (author)
Adnan ul, Haque; John, Aston
2016-01-01
Aim is to examine the relationship between occupational stress and organisational commitment of employees at middle and operational level. Additionally, the occupational therapists role is examined through self-developed ‘stress model’ containing perceived job satisfaction, organisational commitment, and distinctive stressors. Using purposive, snowball and convenience sampling 825 responses (403 from UK and 422 from Pakistan) gathered through on-line matrix based survey questionnaire to gain ...
2008-06-08
cells (HUVEC) to evaluate potential gene expression involvement. CAPE exhibited dose- dependent cytoprotection of HUVEC. A gene screen with...highly induced (8.25-fold) by CAPE compared to DMSO control. To validate this particular microarray screening result, quantitative real-time RT-PCR was...the Nrf2 transcription factor in response to the antioxidant phytochemical carnosol. The Journal of Biological Chemistry 279, 8919–8929. Minami, T
Identification of new solar OH lines in the 10--12 micron region
International Nuclear Information System (INIS)
Goldman, A.; Murcray, F.J.; Gillis, J.R.; Murcray, D.G.
1981-01-01
High-resolution (0.02 cm -1 ) infrared solar spectra obtained with a balloon-borne interferometer reveal new solar absorption features, which appear as regularly spaced quartets, in the 825--960 cm -1 region. The lines are interpreted as high N'' (25--33) pure rotation lines of solar OH. An effective amount of approx.8 x 10 15 molecules cm -2 of OH is estimated from the spectra
A new fashion in angular correlations
Schlesinger, J
1974-01-01
Preliminary results on correlations between pions, in the exclusive reaction K/sup +/p to K/sup +/p2 pi /sup +/2 pi /sup -/ at 8.25 GeV/c are presented. The results obtained by a new method due to Kopylov and Podgeretsky (1973) are compared with space angle and p/sub T/ plane correlations. Similar investigations in pp annihilation are suggested. (10 refs).
Directory of Open Access Journals (Sweden)
Kupryś-Caruk Marta
2018-03-01
Full Text Available Introduction: One aim of the study was to evaluate the impact when added to feed of the two potentially probiotic strains of lactic acid bacteria (LAB Lactobacillus plantarum K KKP 593/p and Lactobacillus rhamnosus KKP 825 on production performance, health, and the composition of gut microbiota. The complementary aim was to assess the safety of these strains in broiler rearing.
2010-02-01
.../31/10 Malaysia: Stainless Steel Butt-Weld Pipe Fittings A- 2/1/09-1/31/10 557-809 Philippines... Duty Proceedings Brazil: Stainless Steel Bar A-351-825 2/1/09-1/31/10 Frozen Warmwater Shrimp A-351-838... Steel Plate 2/1/09-1/31/10 A-533-817 Forged Stainless Steel Flanges A-533-809......... 2/1/09-1/31/10...
INCIDENCE OF NAMATODE PARASITES IN COMMERCIAL LAYERS IN SWAT
R.S. Sayyed, M.S. Phulan1, W.M. Bhatti1, M. Pardehi and Shamsher Ali
2000-01-01
Research was conducted on 400 guts of commercial layers collected from various shops at District Swat during April to September 1998. Out of 400 guts, 36 per cent were positive for nematodes, Mixed infestation of nematodes and cestodes was found in 4.75 per cent layers. Incidence rate of Ascaridia galli, Heterakis gallinarum and Subulura brumpli was 25.75, 8.25 and 2 per cent, respectively.
Glutamate regulation of non-quantal release of acetylcholine in the rat neuromuscular junction
Czech Academy of Sciences Publication Activity Database
Malomouzh, A. I.; Mukhtarov, M. R.; Nikolsky, E. E.; Vyskočil, František; Lieberman, E. M.; Urazaev, A. K.
2003-01-01
Roč. 85, č. 1 (2003), s. 206-213 ISSN 0022-3042 R&D Projects: GA AV ČR IAA7011902; GA ČR GA305/02/1333; GA ČR GA202/02/1213 Institutional research plan: CEZ:AV0Z5011922; CEZ:MSM 113100003 Keywords : muscle endplate * nitric oxide * N-methyl-D-aspartate receptor Subject RIV: CG - Electrochemistry Impact factor: 4.825, year: 2003
Exercise-Dependent Modulation of Neurourological Health Following Spinal Cord Injury
2014-11-01
fascia and connective tissue, the skull was gently scored with a scalpel blade, and holes were carefully drilled to allow for the placement of three...proper plantar placement—e.g. complete toe extension, no ankle rotation, and incorporation of forelimb-hindlimb coordination with minimal assistance...consistency of weight supported plantar stepping and forelimb to hindlimb coordination. AUTONOMIC, SENSORY, MOTOR RECOVERY POST-SCI 825 important to note
First report of HIV-related oral manifestations in Mali | Tamí-Maury ...
African Journals Online (AJOL)
OM prevalence during the first month of HIV care was 31.4%, being oral candidiasis the commonest lesion. 73.2% and 82.5% of the patients with OM had CD4 count < 200 cells/mm3 and were classified as WHO clinical stage III or IV. WHO clinical stage III and VI patients had 5.4-fold increased odds of having any OM (both ...
Energy Technology Data Exchange (ETDEWEB)
Deenen, Maarten J. [Division of Clinical Pharmacology, Department of Medical Oncology, The Netherlands Cancer Institute, Amsterdam (Netherlands); Dewit, Luc [Department of Radiotherapy, The Netherlands Cancer Institute, Amsterdam (Netherlands); Boot, Henk [Division of Gastroenterology and Hepatology, Department of Medical Oncology, The Netherlands Cancer Institute, Amsterdam (Netherlands); Beijnen, Jos H. [Department of Pharmacy and Pharmacology, Slotervaart Hospital, Amsterdam (Netherlands); Faculty of Science, Department of Pharmaceutical Sciences, Division of Pharmaco-epidemiology and Clinical Pharmacology, Utrecht University, Utrecht (Netherlands); Schellens, Jan H.M. [Division of Clinical Pharmacology, Department of Medical Oncology, The Netherlands Cancer Institute, Amsterdam (Netherlands); Faculty of Science, Department of Pharmaceutical Sciences, Division of Pharmaco-epidemiology and Clinical Pharmacology, Utrecht University, Utrecht (Netherlands); Cats, Annemieke, E-mail: a.cats@nki.nl [Division of Gastroenterology and Hepatology, Department of Medical Oncology, The Netherlands Cancer Institute, Amsterdam (Netherlands)
2013-04-01
Purpose: Newer radiation techniques, and the application of continuous 5-FU exposure during radiation therapy using oral capecitabine may improve the treatment of anal cancer. This phase 1, dose-finding study assessed the feasibility and efficacy of simultaneous integrated boost–intensity modulated radiation therapy (SIB-IMRT) with concomitant capecitabine and mitomycin C in locally advanced anal cancer, including pharmacokinetic and pharmacogenetic analyses. Methods and Materials: Patients with locally advanced anal carcinoma were treated with SIB-IMRT in 33 daily fractions of 1.8 Gy to the primary tumor and macroscopically involved lymph nodes and 33 fractions of 1.5 Gy electively to the bilateral iliac and inguinal lymph node areas. Patients received a sequential radiation boost dose of 3 × 1.8 Gy on macroscopic residual tumor if this was still present in week 5 of treatment. Mitomycin C 10 mg/m{sup 2} (maximum 15 mg) was administered intravenously on day 1, and capecitabine was given orally in a dose-escalated fashion (500-825 mg/m{sup 2} b.i.d.) on irradiation days, until dose-limiting toxicity emerged in ≥2 of maximally 6 patients. An additional 8 patients were treated at the maximum tolerated dose (MTD). Results: A total of 18 patients were included. The MTD of capecitabine was determined to be 825 mg/m{sup 2} b.i.d. The predominant acute grade ≥3 toxicities included radiation dermatitis (50%), fatigue (22%), and pain (6%). Fifteen patients (83% [95%-CI: 66%-101%]) achieved a complete response, and 3 (17%) patients a partial response. With a median follow-up of 28 months, none of the complete responders, and 2 partial responders had relapsed. Conclusions: SIB-IMRT with concomitant single dose mitomycin C and capecitabine 825 mg/m{sup 2} b.i.d. on irradiation days resulted in an acceptable safety profile, and proved to be a tolerable and effective treatment regimen for locally advanced anal cancer.
International Nuclear Information System (INIS)
Deenen, Maarten J.; Dewit, Luc; Boot, Henk; Beijnen, Jos H.; Schellens, Jan H.M.; Cats, Annemieke
2013-01-01
Purpose: Newer radiation techniques, and the application of continuous 5-FU exposure during radiation therapy using oral capecitabine may improve the treatment of anal cancer. This phase 1, dose-finding study assessed the feasibility and efficacy of simultaneous integrated boost–intensity modulated radiation therapy (SIB-IMRT) with concomitant capecitabine and mitomycin C in locally advanced anal cancer, including pharmacokinetic and pharmacogenetic analyses. Methods and Materials: Patients with locally advanced anal carcinoma were treated with SIB-IMRT in 33 daily fractions of 1.8 Gy to the primary tumor and macroscopically involved lymph nodes and 33 fractions of 1.5 Gy electively to the bilateral iliac and inguinal lymph node areas. Patients received a sequential radiation boost dose of 3 × 1.8 Gy on macroscopic residual tumor if this was still present in week 5 of treatment. Mitomycin C 10 mg/m 2 (maximum 15 mg) was administered intravenously on day 1, and capecitabine was given orally in a dose-escalated fashion (500-825 mg/m 2 b.i.d.) on irradiation days, until dose-limiting toxicity emerged in ≥2 of maximally 6 patients. An additional 8 patients were treated at the maximum tolerated dose (MTD). Results: A total of 18 patients were included. The MTD of capecitabine was determined to be 825 mg/m 2 b.i.d. The predominant acute grade ≥3 toxicities included radiation dermatitis (50%), fatigue (22%), and pain (6%). Fifteen patients (83% [95%-CI: 66%-101%]) achieved a complete response, and 3 (17%) patients a partial response. With a median follow-up of 28 months, none of the complete responders, and 2 partial responders had relapsed. Conclusions: SIB-IMRT with concomitant single dose mitomycin C and capecitabine 825 mg/m 2 b.i.d. on irradiation days resulted in an acceptable safety profile, and proved to be a tolerable and effective treatment regimen for locally advanced anal cancer
Czech Academy of Sciences Publication Activity Database
Acharya, S.; Adamová, Dagmar; Bielčík, J.; Bielčíková, Jana; Brož, M.; Contreras, J. G.; Ferencei, Jozef; Hladký, Jan; Horák, D.; Křížek, Filip; Kučera, Vít; Kushpil, Svetlana; Lavička, R.; Mareš, Jiří A.; Petráček, V.; Šumbera, Michal; Vaňát, Tomáš; Závada, Petr
2017-01-01
Roč. 77, č. 12 (2017), č. článku 825. ISSN 1434-6044 R&D Projects: GA MŠk(CZ) LG15052 Institutional support: RVO:68378271 ; RVO:61389005 Keywords : ALICE collaboration * heavy ion collisions * LHC Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders; BF - Elementary Particles and High Energy Physics (FZU-D) OBOR OECD: Nuclear physics; Particles and field physics (FZU-D) Impact factor: 5.331, year: 2016
2010-11-10
nanoparticles, and nanoshells by making sub 100 nm diameter nanoshells to mesoscopic sized nanoparticles (gold meatballs ) and micron sized nanoshells. In...mesoscopic gold ‘ meatballs ’, gold bipyrimids etc. In addition nanoparticles such as the nanostar demonstrate some of the highest LSPR sensitivity but...20, 535-538 (2008). 64. H. Wang and N. J. Halas, “Mesoscopic Au ‘ Meatball ’ Particles”, Advanced Materials 20, 820-825 (2008). 65. S. Priya
Subcellular localization of Arabidopsis pathogenesis-related 1 (PR1) protein
Czech Academy of Sciences Publication Activity Database
Pečenková, Tamara; Pleskot, Roman; Žárský, V.
2017-01-01
Roč. 18, č. 4 (2017), č. článku 825. E-ISSN 1422-0067 R&D Projects: GA ČR(CZ) GA15-14886S Grant - others:OPPK(XE) CZ.2.16/3.1.00/21519 Institutional support: RVO:61389030 Keywords : cape * mvb * pi(3)p * pr1 * Secretion * Trafficking Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Cell biology Impact factor: 3.226, year: 2016
Czech Academy of Sciences Publication Activity Database
Bednářová, Andrea; Hanna, M. E.; Rakshit, K.; O’Donnell, J. M.; Krishnan, N.
2017-01-01
Roč. 45, č. 6 (2017), s. 816-825 ISSN 0953-816X R&D Projects: GA MŠk(CZ) LH14047 Grant - others:GA JU(CZ) 038/2014/P Institutional support: RVO:60077344 Keywords : 4-hydroxynonenal * aging * circadian rhythms Subject RIV: ED - Physiology OBOR OECD: Biology (theoretical, mathematical, thermal, cryobiology, biological rhythm), Evolutionary biology Impact factor: 2.941, year: 2016 http://onlinelibrary.wiley.com/doi/10.1111/ejn.13525/pdf
7 CFR 201.76 - Minimum Land, Isolation, Field, and Seed Standards.
2010-01-01
... 2,500 0.5 7 1 825(59 251.46m) 27 1,250 1.0 Onion 7 1 5,280(59 1,609.36m) 22 200 0.0 7 1 2,640(59 804... varieties of dissimilar adaptation and establishment of the stand for the production of the Certified class of seed. 3 Isolation distance for certified seed production shall be at least 500 feet (152.07m) from...
2011-02-01
... 2/1/10-1/31/11 Malaysia: Stainless Steel Butt-Weld Pipe Fittings, A- 2/1/10-1/31/11 557-809... Brazil: Stainless Steel Bar, A-351-825 2/1/10-1/31/11 Frozen Warmwater Shrimp, A-351-838 2/1/10-1/31/11 France: Uranium, A-427-818 2/1/10-1/31/11 India: Certain Cut-to-Length Carbon-Quality Steel Plate, 2/1/10...