In vivo red blood cell compatibility testing using indium-113m tropolone-labeled red blood cells
International Nuclear Information System (INIS)
Morrissey, G.J.; Gravelle, D.; Dietz, G.; Driedger, A.A.; King, M.; Cradduck, T.D.
1988-01-01
In vivo radionuclide crossmatch is a method for identifying compatible blood for transfusion when allo- or autoantibodies preclude the use of conventional crossmatching techniques. A technique for labeling small volumes of donor red blood cells with [/sup 113m/In]tropolone is reported. The use of /sup 113m/In minimizes the accumulation of background radioactivity and the radiation dose especially so when multiple crossmatches are performed. Labeling red cells with [/sup 113m/In]tropolone is faster and easier to perform than with other radionuclides. Consistently high labeling efficiencies are obtained and minimal /sup 113m/In activity elutes from the labeled red blood cells. A case study involving 22 crossmatches is presented to demonstrate the technique. The radiation dose equivalent from /sup 113m/In is significantly less than with other radionuclides that may be used to label red cells
International Nuclear Information System (INIS)
Nelson, M.J.; Klopper, J.F.
1985-01-01
Liver scanning with radiocolloids is an important method to determine the presence, the position and the size of space-occupying lesions in the liver. Unfortunately, this information is nonspecific and it is not possible to distinguish between tumours, abscesses or cysts. Thirty-six patients in whom a definite diagnosis of hepatoma, amoebic liver abscess or echinococcus cyst had been made were examined with technetium-99m tin colloid and indium-113m chloride. The amoebic liver abscesses were avascular, showed a hyperaemic area surrounding the abscess and appeared smaller on the indium than on the technetium scan. The hepatomas showed greater vascularity and absence of the hyperaemic area. Cysts were avascular, did not show a hyperaemic rim and the size was equal on both scans. The experience of the observers had an influence on the accuracy of interpretation of the scans; experienced observers made a correct diagnosis in 73% of cases. It is suggested that simultaneous technetium-99m tin colloid and indium 113m-chloride scans provide additional specificity in the differential diagnosis between hepatoma, amoebic liver abscess and echinococcus cysts
Energy Technology Data Exchange (ETDEWEB)
Nelson, M.J. (Provincial Hospital, Port Elizabeth (South Africa). Dept. of Nuclear Medicine); Klopper, J.F. (Stellenbosch Univ. (South Africa). Dept. of Nuclear Medicine)
1985-01-26
Liver scanning with radiocolloids is an important method to determine the presence, the position and the size of space-occupying lesions in the liver. Unfortunately, this information is nonspecific and it is not possible to distinguish between tumours, abscesses or cysts. Thirty-six patients in whom a definite diagnosis of hepatoma, amoebic liver abscess or echinococcus cyst had been made were examined with technetium-99m tin colloid and indium-113m chloride. The amoebic liver abscesses were avascular, showed a hyperaemic area surrounding the abscess and appeared smaller on the indium than on the technetium scan. The hepatomas showed greater vascularity and absence of the hyperaemic area. Cysts were avascular, did not show a hyperaemic rim and the size was equal on both scans. The experience of the observers had an influence on the accuracy of interpretation of the scans; experienced observers made a correct diagnosis in 73% of cases. It is suggested that simultaneous technetium-99m tin colloid and indium 113m-chloride scans provide additional specificity in the differential diagnosis between hepatoma, amoebic liver abscess and echinococcus cysts.
Measurement of placental blood flow by the sup(113m)In accumulation method
International Nuclear Information System (INIS)
Olkkonen, H.; Suonio, S.
1976-01-01
The present work introduces the use of isotope In-113m in the assessment of placental blood flow. It is almost completely bound to plasma transferrin. Owing to this and its short half-life, In-113m introduces considerably slighter radiation dose to the fetus than Tc-99m. A typical tracer appearance curve is given and the In accumulation index is calculated. (M.S.)
A simple in vitro method of radiolabelling human erythrocytes in whole blood with 113mIn-tropolonate
International Nuclear Information System (INIS)
Osman, S.; Danpure, H.J.
1987-01-01
A simple and rapid in vitro procedure has been developed for selectively radiolabelling erythrocytes in whole blood using 113m In-tropolonate. A maximum labelling efficiency of 97% was achieved, of which 95.5% was on the erythrocytes after only 5 min incubation of whole blodd at room temperature. The optimum amount of tropolone for labelling whole blood was 10 μg of tropolone per ml of blood using acid-citrate dextrose (ACD) as the anticoagulant and 50 μg of tropolone per ml of blood using heparin. Under these optimim conditions, only 2.5% of the cell-bound 113m In was released from the labelled cells during a 1 h in vitro incubation in cell-free plasma, irrespective of the anticoagulant used. These results suggest that 113m In-tropolonate may prove to be useful in vitro agent for labelling erythrocytes for short-term clinical investigations, especially at centres where 99m Tc and 111 In are unavailable. (author)
International Nuclear Information System (INIS)
Nylund, L.; Lunell, N.O.; Lewander, R.; Persson, B.; Sarby, B.
1982-01-01
The uteroplacental blood flow index in the last trimester of pregnancy in 26 women with diabetes mellitus was compared to that in 41 healthy control subjects. After an intravenous injection of 1 mCi of indium 113m, the radiation over the placenta was recorded with a computer-linked gamma camera. From time-activity analysis of the isotope accumulation curve, a uteroplacental blood flow index could be calculated. In the diabetic pregnant women, the maternal-placental blood flow index was reduced 35% to 45% compared to that in healthy women. The blood flow index tended to be further impaired in those diabetic women who had higher blood glucose values
Fundamental evaluation of in vivo labeling of red blood cells with Tc-99m using stannous chloride
Energy Technology Data Exchange (ETDEWEB)
Hiraki, T; Katayama, M; Ando, I; Ando, A [Kanazawa Univ. (Japan). School of Paramedicine; Hisada, K
1982-04-01
Stannous chloride was evaluated as a stannous ion source for the in vivo labeling of red blood cells(RBC) with Tc-99m. In this study, the labeling of RBC with Tc-99m was performed by two successive intravenous administrations of stannous chloride and Tc-99m-pertechnetate, and the optimal dose of stannous chloride and the optimal time interval between the two injections were evaluated. The labeling efficiency for this procedure was also evaluated as a function of time after the pertechnetate injection. The results of our investigation revealed that the maximal in vivo RBC labeling (86%) can be obtained at 15 min after the pertechnetate injection with an i.v. dose of 12.7 ..mu..g/kg of stannous chloride followed 15 min later by an i.v. injection of Tc-99m-pertechnetate. In conclusion, stannous chloride was found to be an excellent stannous ion source for the in vivo labeling of RBC with Tc-99m.
Chloride flux from blood to CSF: inhibition by furosemide and bumetanide
International Nuclear Information System (INIS)
Johnson, D.C.; Singer, S.; Hoop, B.; Kazemi, H.
1987-01-01
Movement of chloride from blood to cerebrospinal fluid (CSF) is one of the factors that may be involved in regulation of CSF [Cl-], which is important to CSF acid-base balance. We made quantitative measurements of the unidirectional flux of radiolabeled chloride between blood and CSF in anesthetized dogs, using 38 Cl, a short-lived isotope (half-life 37.3 min). This allowed multiple studies to be performed in a given animal. A three-compartment model for the blood, CSF, brain extracellular fluid, and ventriculocisternal perfusion system was used to determine the flux rate. With normocapnia, the flux was 0.01.1 min-1. The influx could be reproducibly measured for three separate determinations in the same animal over a period of 6 h, being 98 +/- 6% of the control first run on the second run and 113 +/- 6% on the third. Furosemide and bumetanide, inhibitors of sodium-coupled chloride movement, lowered the flux to 43 +/- 3% and 55 +/- 6% of control, respectively. The combination of hypercapnia and furosemide lowered the influx to 63 +/- 9% of control. These results indicate that a major mechanism of chloride entry into CSF is sodium-coupled chloride transport
A Study on Liver Scan using 113mIn Colloid
International Nuclear Information System (INIS)
Koh, Chang Soon; Rhee, Chong Hoen; Chang, Kochang; Hong, Chang Gi
1969-01-01
There have been reported numberous cases of liver scanning in use of 198 Au colloid by many investigators, however, one in use of 113m In colloid has not been reported as yet in this country. The dose of 113 mIn for high diagnostic value in examination of each organ was determined and the diagnostic interpretability of liver scanning with the use of 113m In was carefully evaluated in comparison with the results of the liver scanning by the conventionally applied radioisotope. The comparative study of both figures of liver scanning with the use of 113m In colloid and 198 Au colloid delivered following results:1) The liver uptake rate and clearance into peripheral blood were accentuated more in case of 113m In colloid than in case of 198 Au colloid. 2) The interpretability of space occupying lesion in liver scanning with 113m In was also superior to one with 198 Au. 3) The figure of liver scanning with 113m In colloid corresponds not always to the figure with 198 Au. This difference can be explained by difference of phagocytic ability of reticuloendothelial system within liver. 4) In the liver scanning with 113m In colloid, the spleen is also visualized even in normal examine. 5) In the cases of disturbed liver function, uptake is more decreased in use of 113m In colloid than in 198 Au, in the spleen, however, the way is contrary. 6) With use of 113m In colloid, the time required for scanning could be shortened in comparison with 198 Au. 7) The filtration of 113m In colloid for scanning prior to human administration gives an expectation for better scanning figure.
Measurement of utero-placental blood flow with /sup 113m/In in diabetic pregnancy
International Nuclear Information System (INIS)
Semmler, K.; Kirsch, G.; Zoellner, P.; Fuhrmann, K.; Jutzi, E.; Ernst-Moritz-Arndt-Universitaet, Greifswald
1985-01-01
In 122 diabetic pregnancies the placental blood flow has been estimated determining the half-life of the activity inflow (2 MBq /sup 113m/In-transferrin) into the placenta. A highly sensitive detector (modified pinhole collimator) and a computer-supported evaluation were used. 259 flow measurements were compared to the risk of complication in the course of diabetic pregnancy. The half-life values in the diabetic group, calculated by a gamma camera computer system by means of an iterative regression analysis, were significantly different compared to a control group (12 pregnancies without risk.) Severe diabetic angiopathic complications (classes D, F, and R according to White) are accompanied by higher half-life values (placental blood flow reductions) and perinatal complications. Even in pregnant women with gestational diabetes of disturbances of the carbohydrate metabolism disturbed placental hemodynamics is to be found. (author)
Measurement of utero-placental blood flow with /sup 113m/In in diabetic pregnancy
Energy Technology Data Exchange (ETDEWEB)
Semmler, K.; Kirsch, G.; Zoellner, P.; Fuhrmann, K.; Jutzi, E. (Zentralinstitut fuer Diabetes, Karlsburg (German Democratic Republic); Ernst-Moritz-Arndt-Universitaet, Greifswald (German Democratic Republic). Radiologische Klinik)
1985-01-01
In 122 diabetic pregnancies the placental blood flow has been estimated determining the half-life of the activity inflow (2 MBq /sup 113m/In-transferrin) into the placenta. A highly sensitive detector (modified pinhole collimator) and a computer-supported evaluation were used. 259 flow measurements were compared to the risk of complication in the course of diabetic pregnancy. The half-life values in the diabetic group, calculated by a gamma camera computer system by means of an iterative regression analysis, were significantly different compared to a control group (12 pregnancies without risk.) Severe diabetic angiopathic complications (classes D, F, and R according to White) are accompanied by higher half-life values (placental blood flow reductions) and perinatal complications. Even in pregnant women with gestational diabetes of disturbances of the carbohydrate metabolism disturbed placental hemodynamics is to be found.
Quality control of the 113Sn-113mIn generator
International Nuclear Information System (INIS)
Morin Zorilla, J.; Olive, E.; Isaac, M.; Cruz, J.
1989-01-01
Methods for quality control of 113 Sn- 113m In generators are compared and recommended the most convenient to applicate in hospitals and in more specialized quality control laboratories. The quality of 113 Sn- 113m In generator produced by POLATOM (Poland) is also evaluated. The product met the requirements of the International Pharmacopeia
Scintigraphy of the Placenta With {sup 113m}In
Energy Technology Data Exchange (ETDEWEB)
Lewitus, Z.; Lubin, E.; Rechnic, J.; Laor, J.; Eckerling, E. [Beilinson Medical Centre, University of Tel Aviv School of Medicine (Israel)
1969-05-15
The paper describes the merits of using {sup 113m}In in scintigraphic placental localization. The {sup 113m}In, generated from a commercial {sup 113}Sn cow, eluted with 0.05N HC1, stabilized with gelatin at pH 4.0 and autoclaved in the carrier-free form, becomes bound to the plasma proteins after being injected intravenously and stays in the vascular system long enough to enable scanning of the placental blood pools. The short physical half-life and the decay by isomeric transition reduces the radiation dose compared with other scanning agents. The minimal elimination of the molecule into the bladder during scanning has the advantage over the use of {sup 99m}Tc because it diminishes the possible confusion of activity in this area with a low-lying placenta. The placentography has been found of value in the diagnosis of placenta praevia, twins and hydatidiform mole. (author)
International Nuclear Information System (INIS)
Guzman Acevedo, C.
1981-08-01
Studies aimed at evaluating the utility of sup(113m)In-EDTMP as a bone imaging agent in regions of the world where supplies of sup(99m)Tc are difficult to ensure are reported. Preliminary studies were concerned with characterization of unlabelled EDTMP, its toxicity in rats, its labelling with sup(113m)In and the radiochemical purity of the labelled product. Dosimetric studies were carried out with the labelled product on 15 normal human volunteers after intravenous administration of the labelled material. Preliminary imaging studies were carried out on 5 normal human volunteers. Finally, clinical studies were carried out on 199 patients with various diseases involving bone. It is concluded that sup(113m)In-EDTMP is a appropriate agent to use for bone imaging where sup(99m)Tc is unavailable
International Nuclear Information System (INIS)
Alvarez Cervera, J.
1975-01-01
The preparation of different sup(99m)Tc and sup(113m)In radiopharmaceuticals using stannous chloride was investigated. Chemical and radiochemical procedures for the quality control of these preparations were studied. Toxicity and biological controls of the preparation were carried out. Procedures for the preparation and control of the following radiopharmaceuticals have been standardized by the authors; albumin macroaggregates labelled with sup(99m)Tc, sup(113m)In and other isotopes for lung scanning; albumin microspheres labelled with sup(99m)Tc for lung scanning; sup(99m)Tc or sup(113m)In-labelled stannous hydroxide colloid for liver scanning; sup(99m)Tc-stannous phytate for liver scanning; sup(99m)Tc-Sn-dextrose, a new radiopharmaceutical which has been proposed by the authors and is now used in Mexico for renal and cerebral scanning and sup(99m)Tc-Sn pyrophosphate and diphosphonate for bone scanning
Energy Technology Data Exchange (ETDEWEB)
Kempi, V.; Sandegard, J.
1982-05-01
The uptake of in vivo labeled /sup 99m/Tc RBCs and /sup 113/In transferrin was studied in femoral bone of 21 patients who had recent operations for fracture of the femoral neck. Femoral bone biopsies and blood samples were obtained during the operation. The activity values for bone biopsies, erythrocytes, and serum were determined, and the uptake ratios between bone and erythrocyte cpm/g and between bone and serum were calculated. Biopsy samples were taken from the femoral head in 21 cases and from the trochanteric region in 14. The activity ratios for the two tracers correlated well: r . 0.94 for femoral head biopsies (P less than 0.001) and r . 0.98 for samples from the trochanteric region (P less than 0.001). Thus, the procedures are interchangeable and either may be valuable in assessing bone blood supply. An additional patient, studied only with /sup 99m/Tc RBCs, had a subsequent operation for nonunion of a fracture. Samples of both cancellous and cortical bone were obtained from the removed head. The activity ratios for the two types of bone tissue differed significantly (P . 0.02).
International Nuclear Information System (INIS)
Kempi, V.; Sandegard, J.
1982-01-01
The uptake of in vivo labeled /sup 99m/Tc RBCs and 113 In transferrin was studied in femoral bone of 21 patients who had recent operations for fracture of the femoral neck. Femoral bone biopsies and blood samples were obtained during the operation. The activity values for bone biopsies, erythrocytes, and serum were determined, and the uptake ratios between bone and erythrocyte cpm/g and between bone and serum were calculated. Biopsy samples were taken from the femoral head in 21 cases and from the trochanteric region in 14. The activity ratios for the two tracers correlated well: r . 0.94 for femoral head biopsies (P less than 0.001) and r . 0.98 for samples from the trochanteric region (P less than 0.001). Thus, the procedures are interchangeable and either may be valuable in assessing bone blood supply. An additional patient, studied only with /sup 99m/Tc RBCs, had a subsequent operation for nonunion of a fracture. Samples of both cancellous and cortical bone were obtained from the removed head. The activity ratios for the two types of bone tissue differed significantly
study on 113 Sn-113m In generator of the chromatographic column elution mode
International Nuclear Information System (INIS)
Abdel-Halim, A.A.
2002-01-01
this work has been carried out to study the optimum conditions required for local preparation of 113 Sn- 113m In radioisotope generator based on 12- molybdocerate- 113 Sn column matrix. this work was directed to: 1- investigate the optimum conditions of the tin target irradiation and dissolution processes. 2- study the different preparative conditions which affect the loading of 113 Sn radionuclide onto 12- molybdocerate (IV) columns and the elution of the generated 113m In radionuclide. 3- study the effect of generator life- time on the elution performance and quality control of the generated 113m In radionuclide over a period of 190 days
Chloride Blood Test: MedlinePlus Lab Test Information
... this page: https://medlineplus.gov/labtests/chloridebloodtest.html Chloride Blood Test To use the sharing features on this page, please enable JavaScript. What is a Chloride Blood Test? A chloride blood test measures the ...
Sup(99m) Technetium - labeled red blood cells 'in vitro'
International Nuclear Information System (INIS)
Bernardo Filho, M.; Souza Moura, I.N. de; Boasquevisque, E.M.
1983-01-01
A simple technique for the preparation of sup(99m) Tc labeled red blood cells using a comercial kit is described. To each 3ml of plain blood with anti-coagulant was added 1ml of solution of commercial kit with 6.8 μg of stannous chloride. This mixture was incubated in water bath, at 37 0 C, for 60 minutes. Then technetium-99m was added and the mixture was left for another ten minutes, in water bath, at 37 0 C. Under these conditions there was the best labeling of the red blood cells. Similar results were obtained with a solution of stannous chloride prepared freshly. The labeling is strong for 6.8 μg stannous chloride because the labeling was not removed by the several washes of the red blood cells or by the left in water bath. (Author) [pt
Energy Technology Data Exchange (ETDEWEB)
Gartshore, G [Wellcome Surgical Inst. and Hugh Fraser Neuroscience Labs., Glasgow Univ. (United Kingdom); Bannan, P [Wellcome Surgical Inst. and Hugh Fraser Neuroscience Labs., Glasgow Univ. (United Kingdom); Patterson, J [Wellcome Surgical Inst. and Hugh Fraser Neuroscience Labs., Glasgow Univ. (United Kingdom); Higley, B [Wellcome Surgical Inst. and Hugh Fraser Neuroscience Labs., Glasgow Univ. (United Kingdom); McCulloch, J [Wellcome Surgical Inst. and Hugh Fraser Neuroscience Labs., Glasgow Univ. (United Kingdom)
1994-09-01
A protocol has been devised to effectively extend the limited post-reconstitution shelf life of technetium-99m exametazime as a radiopharmaceutical for imaging cerebral blood flow (CBF) distribution. The potential of [sup 99m]Tc-exametazime stabilised with cobalt chloride for imaging CBF distribution as late as 4 h after reconstitution has been examined in ischaemic and non-ischaemic tissue in halothane-anaesthetised cats. Focal cerebral ischaemia was produced by permanent middle cerebral artery occlusion. The relationship between [sup 99m]Tc-exametazime uptake and retention and CBF (assessed with [[sup 14]C]iodoantipyrine 10 min after first radiopharmaceutical administration) was determined in the same tissue section with double label autoradiography. Over the CBF range 0 - 80 ml 100 g[sup -1] min[sup -1], the uptake of [sup 99m]Tc-exametazime (quantitatively and topographically) was linearly related to CBF irrespective of whether the [sup 99m]Tc-labelled tracer was unstabilised (and administered within 10 min of reconstitution) or was stabilised with cobalt chloride (and administered up to 240 min after reconstitution). For levels of CBF in excess of 80 ml 100 g[sup -1] min[sup -1] the excellent topographical relationship between [sup 99m]Tc-exametazime distribution and CBF is maintained but quantitatively, [sup 99m]Tc-exametazime underestimates CBF to a similar degree in animals receiving stabilised and unstabilised [sup 99m]Tc-exametazime. The presence of the stabiliser, cobalt chloride, extends greatly the period over which [sup 99m]Tc-exametazime can be used after reconstitution to generate images of CBF distribution in normal and ischaemic cerebral tissue. (orig.)
A Simplified Method for Laboratory Preparation of Organ Specific Indium 113m Compounds
Energy Technology Data Exchange (ETDEWEB)
Adatepe, M H; Potchen, E James [Washington University School of Medicine, St. Louis (United States)
1969-03-15
Generator systems producing short lived nuclides from longer lived parents have distinct clinical advantages. They are more economical, result in a lower radiation dose, and can make short lived scanning readily available even in areas remote from rapid radiopharmaceutical delivery services. The {sup 113}Sn-{sup 113m}In generator has the additional advantage that, as a transition metal, Indium can be readily complexed into organ specific preparations. 113Sn, a reactor produced nuclide with a 118 day half life, is absorbed on a zirconium or silica gel column. the generator is eluded with 5 to 8 ml of 0.05 N HCL solution at pH 1.3-1.4. The daughter nuclide, {sup 113m}In, has a half life of 1.7 hours and emits a 393 Kev monoenergetic gamma ray. Previous methods for labeling organ specific complexes with {sup 113m}In required terminal autoclaving before injection. With the recent introduction of sterile, apyrogenic {sup 113}Sn-{sup 113m}In generators, we have developed a simplified technique for the laboratory preparation of Indium labeled compounds. This method eliminates autoclaving and titration enabling us to pre-prepare organ specific complexes for blood pool, liver, spleen, brain, kidney and lung scanning.
Concentrations of /sup 113m/Cd in the marine environment
Energy Technology Data Exchange (ETDEWEB)
Noshkin, V.E.; Wong, K.M.; Eagle, R.J.; Anglin, D.L.
1980-09-18
Reports on the detection of /sup 113m/Cd in any type of environmental sample have been rare. The 113 mass chain yield is small relative to other longer-lived fission products, such as /sup 90/Sr and /sup 137/Cs, produced from uranium, plutonium and thorium fissions. Also, only a small fraction of the 113 chain yield decays to /sup 113m/Cd. Salter estimated that the /sup 113m/Cd//sup 90/Sr activity quotient in thermonuclear fission should be 0.003. He stated that this ratio is in good agreement with data from a few samples measured in the northern hemisphere prior to 1962 which have no /sup 109/Cd. This, to our knowledge, was the first report of the detection of fission-produced /sup 113m/Cd in the environment. Salter also calculated that 0.062 MCi of /sup 113m/Cd and 0.25 MCi of /sup 109/Cd were produced by activation during the atmospheric detonation of the 1.4-megaton Starfish device on 9 July 1962 over Johnston Atoll. As both /sup 109/Cd and /sup 113m/Cd are produced during neutron activation of stable cadmium, and /sup 109/Cd is not a fission product, the last part of Salter's statement is significant. The absence of /sup 109/Cd in samples collected before 1962 indicates that all nuclear testing before this time, which included all tests conducted at Enewetak and Bikini Atolls in the Marshall Islands, could have generated /sup 113m/Cd only as a fission product. It is therefore important to recognize that /sup 113m/Cd could be present in other environments contaminated with fission product wastes discharged to the aquatic environment from other nuclear facilities. /sup 113m/Cd has a half life of 14.6 +- 0.1 y and decays predominantly by beta-particle emission. We present here a preliminary report of /sup 113m/Cd concentrations measured in sediment and tissue samples of marine organisms collected around different atolls in the Marshall Islands.
Preparation of an sup(113m) indium generator
International Nuclear Information System (INIS)
Ling, H.W.
1979-01-01
This paper describes the features related to the preparation of sup(113m) In from a generator for nuclear medicine application. 113 Sn radioisotope is adsorbed on a hidrated zirconium oxide column and sup(113m) In generated from the decay of 113 Sn is eluted with diluted hydrochloric acid. This procedure is simple and appropriate for the separation of the desired radionuclide. Parameters which may affect the adsorption of 113 Sn like tin and hydrochloric acid concentration and temperature are studied. The influence of eluent concentration and temperature and flow rate of elution on sup(113m) In separation yields are observed. The purity of eluted sup(113m) In is analysed and variation of elution yield in a generator prepared with enriched tin is studied. (Author) [pt
Directory of Open Access Journals (Sweden)
Abdulrzag Ehmeeda
2017-07-01
Full Text Available When people are exposed to mercury chloride, it can produce a variety of health effects in the blood and liver. Coconut water contains Zn, Fe, Vit. C, Vit B11, Vit. B6, and Se to reduce mercury chloride level in the blood and improve blood profile. Aim of this study was to analysis the effect of green coconut water supplementation in overcoming the toxic effect of Hg chloride in the blood of Sprague dawley rats exposed to Hg chloride. Samples were randomly about 36 animals rats exposed to HgCl2 through forced feeding by 20 mg/kgBW sondage perday for 14 days, which divided into control group, and intervention groups were given fresh green coconut water in each by 6, 8, and 10 mL/kgBW for intervention 7 and 17 days. The result of this study showed that there is a significant effect and the decrease in mercury levels in the blood. There is no significant affect on the hemoglobin level, hematocrit level and platelet count with the treatment of green coconut water in the rats with exposure Hg. New findings/significance of contribution were the effectiveness of green coconut water to reduce Hg level in blood and improve blood profile.
Reagent' sets for the concentration of sup(99m)Tc and sup(113m)In
International Nuclear Information System (INIS)
Bianco de Salas, G.N.; Arciprete, J.; Mitta, A.E.A.
1976-10-01
A simple technique for the concentration of the eluates from 99 Mo/sup(99m)Tc and 113 Sn/sup(113m)In generators is described. The reagents' sets provided by the C.N.E.A. for the labelling of different radiopharmaceuticals can be used by only reducing their volumes proportionally. Both concentration techniques for Tc-99m and In-113m will be supplied to users as reagents' sets. (author) [es
Investigations on the indium-113m isotope generators
International Nuclear Information System (INIS)
Oniciu, L.; Veglia, A.
1975-01-01
Methods for the determination of sup(113Sn) in the eluate of an sup(113m)In generator are proposed. The techniques for the chemical and radionuclidic purity analysis of the eluate are also described: colorimetry, gamma-ray spectrometry, thin-film chromatography, and electrophoretic separation were used. Two generators of different origins were studied. The presence of the isotopes sup(113)Sn, sup(125)Sb, sup(125m)Te, and the elements Zr, Si and Fe were detected in the eluate. Recommendations for the use of these isotope cows are made. (G.Gy.)
Examination of uteroplacental blood flow with 113mIn (in physiological pregnancies)
International Nuclear Information System (INIS)
Ryznar, V.; Erban, J.; Pohanka, J.
1986-01-01
The total of 106 pregnant women in their 3rd trimester of physiological pregnancies were examined using 113m In and an LFOV Anger camera for the inflow rate of the applied radionuclide into the uteroplacental bed. The slope and T 1/2 were computed and the values valid for physiological pregnancies were defined. The authors' own method of normalization is used to process the obtained flow curves and all the data are assessed with the help of a PDP 11/34 on-line computer. In physiological pregnancies, T 1/2 and slope values for the 3rd trimester were found not to be influenced by the duration of the pregnancy or age of the pregnant woman. The discovered range of normal values for physiological pregnancies in their 3rd trimester are T 1/2 =8.3±1.7 s, slope more than 33. (author). 6 figs., 2 tabs., 34 refs
Cobalt chloride administration in athletes: a new perspective in blood doping?
Lippi, G; Franchini, M; Guidi, G C
2005-11-01
Blood doping is an illegal and unfair way of enhancing athletic performance by increasing the oxygen carrying capacity of the blood. Currently used methods usually involve stimulation of erythropoiesis. Gene therapy targeting the hypoxia inducible factor pathway may be an attractive alternative to traditional blood doping techniques. Hypoxia activates a large number of genes with essential roles in cell and tissue adaptation to low oxygen. Cobalt chloride is a well established chemical inducer of hypoxia-like responses such as erythropoiesis. Cobalt supplementation is not banned and therefore would not be detected by current anti-doping testing. Although there is as yet no direct or anecdotal evidence of cobalt chloride administration to athletes, its use should be warned against as being not only unfair but potentially dangerous.
International Nuclear Information System (INIS)
Romanova, A.; Kaneti, Ya.; Ivanov, Kh.
1977-01-01
To raise the specific character of the scintigraphic changes in the liver the authors suggest a two-stage scintigraphy: colloidal, followed by scintigraphy with 113mIn-trichloride, which, administerd intravenously, binds with the blood serum transferrin and vizializes the liver vasculature. A total of 153 patients with focal lesions in the liver were examined. Scintigraphy with 113mIn-trichloride was performed immediately or some time after the colloidal one. Comparison with operative, post mortem and laparoscopic data was attempted in 93 patients; there was lack of coincidence in two patients. The high percentage of coincidence (98%) is an indication of very high effectiveness on the method. (author)
Energy Technology Data Exchange (ETDEWEB)
Okuyama, S; Ito, Y; Takahashi, K; Sato, T; Matsuzawa, T [Tohoku Univ., Sendai (Japan). Research Inst. for Tuberculosis, Leprosy and Cancer
1975-07-01
sup(113m)In-iron chondroitin sulfate colloid shows a large accumulation in the bone marrow and is suitable for bone marrow imaging. Quantitative assessment of the marrow reticuloendotherial function was performed using this compound. When an appropriate amount of iron carrier was added for adjustment, the rate of accumulation of hyperfunction in the marrow reticuloendotherial system (RES) induced by acute loss of blood increased. Marrow RES hypofunction was efficiently exhibited regardless of the presence or absence of iron carrier. Deposition of sup(113m)In-iron chondroitin sulfate in the spleen increased remarkably in the presence of carrier In. sup(113m)In-iron chondroitin sulfate colloid appears to be suitable for the measurement of the conditions of marrow RES functions. If short half-life nuclide radio-colloids of the present type are clinically applied, it is possible not only to elaborately observe the bone marrow by scintigraphy but also to gradually decrease the absorbed dose of irradiation.
International Nuclear Information System (INIS)
Okuyama, Shinichi; Ito, Yasuhiko; Takahashi, Kunibumi; Sato, Tachio; Matsuzawa, Taiju
1975-01-01
sup(113m)In-iron chondroitin sulfate colloid shows a large accumulation in the bone marrow and is suitable for bone marrow imaging. Quantitative assessment of the marrow reticuloendotherial function was performed using this compound. When an appropriate amount of iron carrier was added for adjustment, the rate of accumulation of hyperfunction in the marrow reticuloendotherial system (RES) induced by acute loss of blood increased. Marrow RES hypofunction was efficiently exhibited regardless of the presence or absence of iron carrier. Deposition of sup(113m)In-iron chondroitin sulfate in the spleen increased remarkably in the presence of carrier In. sup(113m)In-iron chondroitin sulfate colloid appears to be suitable for the measurement of the conditions of marrow RES functions. If short half-life nuclide radio-colloids of the present type are clinically applied, it is possible not only to elaborately observe the bone marrow by scintigraphy but also to gradually decrease the absorbed dose of irradiation. (Mukohata, S.)
Localization of the placenta on gamma chamber with 113m In-lambratene
International Nuclear Information System (INIS)
Shejretova, E.; Blazheva, P.; Kovacheva, S.; Tsanev, Ts.
1977-01-01
The authors describe their experience in applying the radioisotopic method for localization of the placenta on gamma chamber by means of 113m In-lambratene (113m In-cysteamine). This complex is chosen due to its valuable physical characteristics of 113m In as shortliving, with whom lambratene is labelled, with proven irradiation protective properties, with the purpose of lowering irradiation load of the fetus. The authors use unique apparatus, gamma chamber Pho-Gamma HP and conventional scanner during injection of 2 mCi 113m In-lambratene. The authors examined 81 women, 42 of whom were pregnant at 6 to 10 months of gestation and 39 women from the third to the fifth month of gestation because of bleedings, Rh isoimmunization with forthcoming amniocentesis, and state after cesarian section for the first group and impending interruption of pregnancy for the second group. The diagnosis of the placenta localization was supported by cesarian section, delivery and interruption of pregnancy. There was 100% coincidence of the diagnosis. (author)
Energy Technology Data Exchange (ETDEWEB)
Kim, You Sun; Kim, Tae Young [Korea Atomic Research Institue, Seoul (Korea, Republic of)
1969-03-15
In 1968 total 94,660 mc of radioactive iodocompound were prepared and distributed to the urers. In order to obtain an effective liver scanning {sup 113m}Incolloidal of even partical size from a {sup 113}Sn-{sup 113m}In cow, the eluate(pH; 1.5) was examined by a radio paper partition chromatography. It was found that the eluate was composed of two components, ionic from and colloidal form. The ionid from could be eliminated by cation exchange resine and the eluate from the ion exchange resine was of even particle size to give an excellent liver scanning results. Labelling of {sup 113m}In to human serum albumine was attempted.
International Nuclear Information System (INIS)
Pereira, Marcia de Oliveira; Rocha, Gabrielle de Souza; Lombardi, Simone dos Santos; Santos-Filho, Sebastiao David; Fonseca, Adenilson de Souza da; Bernardo-Filho, Mario; Pereira, Mario Jose; Geller, Mauro
2008-01-01
The aim of this work was to evaluate the effect of fenoprofen on the labeling of blood constituents with technetium- 99m, on the morphology of red blood cells and on the plasmid DNA. Blood samples from Wistar rats were incubated with fenoprofen and the assay of labeling of blood constituents with technetium-99m ( 99m Tc) was performed. Blood cells, plasma, soluble and insoluble fractions of blood cells and plasma were separated. The radioactivity in each fraction was counted and percentage of incorporated radioactivity (%ATI) was determined. Blood smears were prepared, fixed, stained and the qualitative and quantitative morphology of the red blood cells (RBC) was evaluated. Plasmid (pBSK) was incubated with fenoprofen with stannous chloride, and agarose gel electrophoresis procedure was carried out to evaluate genotoxic and the protection of this drug against stannous chloride effect on DNA. In conclusion, under the conditions used in this work, our data suggest that fenoprofen would not affect the fixation of the 99m Tc on the blood constituents, alter the RBC membrane and present genotoxic and redox effects. (author)
International Nuclear Information System (INIS)
Nowotny, G.; Fraga de Suarez, A.H.; Mitta, A.E.A.
1978-05-01
A radiopharmaceutical prepared from ethylendiaminotetrametilenphosphoric acid (E.T.M.P.) is described, which can be labelled with 113 In for its use in bone scintillography. This compound has been tested satisfactorily in animals. Chemical controls for labelling are discussed as well as the biological ones for distribution and toxicity. A radiochemical yield of 95% or higher was obtained and after two hours of administration nearly 30% of dose can be localized is skeleton. (author) [es
Production of kits for the labelling with 113sup(m)In and sup(99m)Tc, at the CNEA
International Nuclear Information System (INIS)
Palcos, M.C.; Kurcbart, Horacio; Nowotny, G.; Ramos, Elsa; Riesgo, J.G.; Mitta, A.E.A.
1978-05-01
The actual state of the production of radiopharmaceuticals in the form of reagents kits at the C.N.E.A. is described. This could allow the users to label compounds with sup(113m)In and sup(99m)Tc in an easy and reproducible way. At present, the following sets are provided routinarily a) To label with sup(99m)Tc: Albumin macroaggregates: calcium gluconate; antimonium sulfide colloid, sodium phytate; sodium calcium DTPA; seroalbumin; sodium pyrophosphate; sodium citrate. b) To label with sup(113m)In: albumin macroaggregates; PVP-bicarbonate; DTPA; human seroalbumin. Regarding products in a developping stage, we have: to labed with sup(99m)Tc: dimercapto-succinic acid, set for the labelling of human erythrocytes, set for sup(113m)In and sup(99m)Tc concentration and bleomicin; to label with sup(113m)In: EDTMP sup(99m)In. (author) [es
International Nuclear Information System (INIS)
Bianco de Salas, G.N.; Arciprete, J.A.; Mitta, A.E.A.
1978-05-01
The preparation of 113 Sn/sup(113m)In generators is described as well as its installation in cell. The chemical and radiochemical controls and the conditions to concentrate the eluate, if necessary, are described in detail. Production and exportation figures are given. (author) [es
Radioactive indium labelling of the figured elements of blood. Method, results, applications
International Nuclear Information System (INIS)
Ducassou, D.; Nouel, J.P.
Following the work of Thakur et al. the authors became interested in red corpuscle, leucocyte and platelet labelling with indium 111 or 113m (8 hydroxyquinolein-indium). For easier labelling of the figured elements of blood the technique described was modified. The chelate is prepared by simple contact at room temperature of indium 111 or 113m chloride and water-soluble 8 hydroxyquinolein sulphate, in the presence of 0.2M TRIS buffer. The figured element chosen suspended in physiological serum is added directly to the solution obtained, the platelets and leucocytes being separated out beforehand by differential centrifugation. While it gives results similar to those of Thabur et al. the method proposed avoids the chloroform extraction of the radioactive chelate and the use of alcohol, liable to impair the platelet regation capacity [fr
VOCl as a Cathode for Rechargeable Chloride Ion Batteries.
Gao, Ping; Reddy, M Anji; Mu, Xiaoke; Diemant, Thomas; Zhang, Le; Zhao-Karger, Zhirong; Chakravadhanula, Venkata Sai Kiran; Clemens, Oliver; Behm, R Jürgen; Fichtner, Maximilian
2016-03-18
A novel room temperature rechargeable battery with VOCl cathode, lithium anode, and chloride ion transporting liquid electrolyte is described. The cell is based on the reversible transfer of chloride ions between the two electrodes. The VOCl cathode delivered an initial discharge capacity of 189 mAh g(-1) . A reversible capacity of 113 mAh g(-1) was retained even after 100 cycles when cycled at a high current density of 522 mA g(-1) . Such high cycling stability was achieved in chloride ion batteries for the first time, demonstrating the practicality of the system beyond a proof of concept model. The electrochemical reaction mechanism of the VOCl electrode in the chloride ion cell was investigated in detail by ex situ X-ray diffraction (XRD), infrared spectroscopy (FTIR), transmission electron microscopy (TEM), and X-ray photoelectron spectroscopy (XPS). The results confirm reversible deintercalation-intercalation of chloride ions in the VOCl electrode. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Energy Technology Data Exchange (ETDEWEB)
Skjoeldebrand, A.; Eklund, J.; Johansson, H.; Lunell, N.-O.; Nylund, L.; Sarby, B.; Thornstroem, S. (Departments of Anaesthesiology, Obstetrics and Gynaecology and Medical Physics, Karolinska Institute at Huddinge University Hospital, Stockholm (Sweden))
1990-01-01
The uteroplacental blood flow was measured before and during epidural anaesthesia for caesarean section in 11 woman. The blood flow was measured with dynamic placental scintigraphy. After an i.v. injection of indium-113m chloride, the gamma radiation over the placenta was recorded with a computer-linked scintillation camera. The uteroplacental blood flow could be calculated from the isotope accumulation curve. The anaesthesia was performed with bupivacaine plain 0.5%, 18-22 ml and a preload of a balanced electrolyte solution 10 ml/kg b.w. was given. The placental blood flow decreased in eight patients and increased in three with a median change of -21%, not being statistically significant. No correlation between maternal blood pressure and placental blood flow was found. (author).
International Nuclear Information System (INIS)
Skjoeldebrand, A.; Eklund, J.; Johansson, H.; Lunell, N.-O.; Nylund, L.; Sarby, B.; Thornstroem, S.
1990-01-01
The uteroplacental blood flow was measured before and during epidural anaesthesia for caesarean section in 11 woman. The blood flow was measured with dynamic placental scintigraphy. After an i.v. injection of indium-113m chloride, the gamma radiation over the placenta was recorded with a computer-linked scintillation camera. The uteroplacental blood flow could be calculated from the isotope accumulation curve. The anaesthesia was performed with bupivacaine plain 0.5%, 18-22 ml and a preload of a balanced electrolyte solution 10 ml/kg b.w. was given. The placental blood flow decreased in eight patients and increased in three with a median change of -21%, not being statistically significant. No correlation between maternal blood pressure and placental blood flow was found. (author)
International Nuclear Information System (INIS)
Oliveira, Joelma F.; Braga, Ana Cristina S.; Bezerra, Roberto Jose A.C.; Bernardo-Filho, Mario
1999-01-01
The use of natural products in all over the world has been increased in Brazil as well as in other countries. Maytenus ilicifolia is commonly used in popular medicine. The labeling of red blood cells (RBC) with technetium-99m ( 99m Tc) have been for many studies in nuclear medicine. This labeling procedure depends on a reducing agent and stannous chloride is normally used. Here, we investigate if the extract of Maytenus ilicifolia is capable to alter the labeling of RBC and blood proteins with 99m Tc. Blood samples were incubated with Maytenus ilicifolia. Stannous chloride solution and Tc-99m were. Blood was centrifuged and plasma (P) and blood cells (C) were isolated. Samples of P or C were precipitated with trichloroacetic acid, centrifuged and IF and IF were separated. The percentage of radioactivity (% ATI) in C, IF-P and IF-C was calculated. The %ATI in decreased in C from 93.6±2.3 to 29.0±2.7, on FI-P from 77.6±1.2 to 7.5 ±1.0 and on FI-C from 80.0±3.4 to 12.6±4.8. Once in RBC labeling procedure with 99m Tc depends on the presence of stannous (+2), the substances of the natural product could increase the valence of stannous (+2) to stannic (+4). This fact would decrease the labeling of blood elements with 99m Tc. (author)
Serum chloride test ... A greater-than-normal level of chloride is called hyperchloremia. It may be due to: Carbonic anhydrase inhibitors (used to treat glaucoma) Diarrhea Metabolic acidosis Respiratory alkalosis (compensated) Renal ...
Concentrations of sup(113m)Cd in the marine environment
International Nuclear Information System (INIS)
Noshkin, V.E.; Wong, K.M.; Eagle, R.J.; Anglin, D.L.
1980-01-01
A preliminary report is presented of sup(113m)Cd concentrations measured in sediment and tissue samples of marine organisms collected around different atols in the Marshall Islands which are considered to be representative of the levels expected at these latitudes from global fallout deposition. (U.K.)
International Nuclear Information System (INIS)
Hohloch, M.
1980-01-01
The complex formation of double labelling of bivalent 113 Sn and reduced, quadrovalent sup(99m)Tc with pyrophosphate (PPi) or ethane hydroxy diphosphorate (EHDP) has been investigated by means of in vivo distribution in the rat. The molar rates of sup(99m)Tc and 113 Sn to PPi resp. EHDP, as well as the pH-value and the initial concentration is varied. Furthermore, both elements were oxidized with H 2 O 2 in the alkaline medium. Four typical sup(99m)Tc and two typical 113 Sn in-vivo distribution patterns can be differentiated: 1. Pertechnetate, characterized by a strong enrichment in the stomach, forms when all Sn-II has been oxidized to Sn-IV in the preparation. 2. One bone-seeking 113 Sn-II PPi (EHDP) complex and a sup(99m)Tc-IV PPi (EHDP) complex each, which are formed at least equimolar ratio of Sn to PPi (EHDP) and suffiently high concentration of PPi (EHDP) in the physiological pH-value. 3. A non-bone-seeking sup(99m)Tc-IV compound, which is enriched in the kidneys instead, is formed in the weakly alkaline medium or at low PPi (EHDP) concentration. This is probably monomeric technetium dioxide dihydrate. 4. A sup(99m)Tc as well as a Sn colloid is formed at deficient ligand concentration (PPi or EHDP to Sn). The chemical composition of the complexes is discussed the possible reaction courses are illustrated in the following diagrams. (orig./MG) [de
Measurement of left ventricular ejection fraction with ionic sup(113m)In and a cardiac probe
Energy Technology Data Exchange (ETDEWEB)
Liu, X.; Harrison, K.S.; Wagner, H.N. Jr.
1982-09-01
Left ventricular ejection fraction (LVEF) was measured with a cardiac probe (Nuclear Stethoscope. Bios Inc., Valhalla, New York) and sup(113m)In in 28 normal subjects and 86 patients with coronary artery disease (CAD). In 20 normal subjects sup(99m)TC-RBCs were compared with sup(113m)In, which binds to transferrin after IV injection. With sup(99m)Tc-RBCs average LVEF was 57+-7% (1 SD); with sup(113m)In, average LEVF was 55+-8% (N.S.). Sequential measurements at different times over 60 min revealed good reproducibility. Comparison of LVEF's obtained using sup(99m)Tc-RBCs with a gamma camera and cardiac probe revealed a good correlation. The correlation coefficients were 0.92 in 25 patients with CAD and 0.95 in 10 patients with LV wall motion abnormalities. The LVEF obtained using a cardiac probe and sup(113m)In increased in 28 normals from 57+-9% to 64+-13% (P<0.001) during handgrip exercise, while the LVEF decreased from 45+-9% to 41+-10% (P<0.01) in patients with acute myocardial infarction 4-7 weeks after episode, from 48+-11 to 40+-12% (P<0.001) in patients with old myocardial infarction, and from 52+-9 to 42+-9% (P<0.001) in patients with angina pectoris. The cardiac probe and sup(113m)In provide a useful alternate means of determining left ventricular dysfunction in facilities where sup(99m)Tc and a gamma camera computer system are not readily available.
Measurement of left ventricular ejection fraction with ionic sup(113m)In and a cardiac probe
International Nuclear Information System (INIS)
Liu, X.; Harrison, K.S.; Wagner, H.N. Jr.
1982-01-01
Left ventricular ejection fraction (LVEF) was measured with a cardiac probe (Nuclear Stethoscope. Bios Inc., Valhalla, New York) and sup(113m)In in 28 normal subjects and 86 patients with coronary artery disease (CAD). In 20 normal subjects sup(99m)TC-RBCs were compared with sup(113m)In, which binds to transferrin after IV injection. With sup(99m)Tc-RBCs average LVEF was 57+-7% (1 SD); with sup(113m)In, average LEVF was 55+-8% (N.S.). Sequential measurements at different times over 60 min revealed good reproducibility. Comparison of LVEF's obtained using sup(99m)Tc-RBCs with a gamma camera and cardiac probe revealed a good correlation. The correlation coefficients were 0.92 in 25 patients with CAD and 0.95 in 10 patients with LV wall motion abnormalities. The LVEF obtained using a cardiac probe and sup(113m)In increased in 28 normals from 57+-9% to 64+-13% (P<0.001) during handgrip exercise, while the LVEF decreased from 45+-9% to 41+-10% (P<0.01) in patients with acute myocardial infarction 4-7 weeks after episode, from 48+-11 to 40+-12% (P<0.001) in patients with old myocardial infarction, and from 52+-9 to 42+-9% (P<0.001) in patients with angina pectoris. The cardiac probe and sup(113m)In provide a useful alternate means of determining left ventricular dysfunction in facilities where sup(99m)Tc and a gamma camera computer system are not readily available. (orig.)
STS-107 M.S. Laurel Clark during TCDT M113 training activities
2002-01-01
KENNEDY SPACE CENTER, FLA. -- STS-107 Mission Specialist Laurel Clark (in yellow cap) is instructed on the operation of an M113 armored personnel carrier during Terminal Countdown Demonstration Test activities, a standard part of launch preparations. STS-107 is a mission devoted to research and will include more than 80 experiments that will study Earth and space science, advanced technology development, and astronaut health and safety. Launch is planned for Jan. 16, 2003, between 10 a.m. and 2 p.m. EST aboard Space Shuttle Columbia.
Energy Technology Data Exchange (ETDEWEB)
Maliska, C.; D' Almeida, J.; Pellegrini, P.M.; Schimit, T.S. [Hospital Central do Exercito (HCE), Rio de Janeiro, RJ (Brazil). Servico de Medicina Nuclear; Pinho, W.R. [Centro de Ensino Superior, Valenca, RJ (Brazil). Fac. de Medicina Veterinaria; Lima, J.E.T. [Instituto Nacional do Cancer (INCa), Rio de Janeiro, RJ (Brazil). Servico de Medicina Nuclear
2009-07-01
The glomerular filtration rate was determined in nine healthy horses, six male and three female, aged two to 12-year-old, by means of {sup 51}Cr and {sup 113m}In labeled EDTA single injection technique. The glomerular filtration rate was calculated from the plasma disappearance curve and the volume of distribution of the radiotracer, {sup 51}Cr-EDTA or {sup 113m}In-EDTA. The result (mean +- standard deviation) was 148.80 +- 26.42 m L.min{sup -1}.100 kg. It is concluded that the measurement of glomerular filtration rate by {sup 51}Cr-EDTA or {sup 113m}In-EDTA by single injection technique eliminates the bladder catheterization, and for its simplicity, convenience, accuracy, and low dose of radiation, can be used in horses as a method of choice in clinical routine. (author)
International Nuclear Information System (INIS)
Agostinho, Raquel Terra; Santos Filho, Sebastiao David; Fonseca, Adenilson de Souza da; Bernardo-Filho, Mario; Missailidis, Sotiris
2008-01-01
This study evaluated effects of an aqueous extract of Ganoderma lucidum (reishi) on the labeling of blood constituents with technetium-99m ( 99m Tc) and on the survival of cultures of Escherichia coli treated with stannous chloride. Blood samples from Wistar rats were treated with reishi extract, radiolabeling procedure was performed, plasma (P), blood cells (BC) and insoluble (IF) and soluble (SF) fractions of P and BC were separated. The radioactivity was counted for the determination of the percentages of radioactivity (%ATI). Cultures of Escherichia coli AB1157 were treated with stannous chloride in the presence and absence of reishi extract. Blood samples and bacterial cultures treated with NaCl 0.9% were used as controls. Data indicated that reishi extract altered significantly (p 99 mTc and protecting bacterial cultures against oxidative damage induced by stannous chloride. (author)
Energy Technology Data Exchange (ETDEWEB)
Agostinho, Raquel Terra [Universidade Federal do Rio Grande do Norte (UFRN), Natal, RN (Brazil); Santos Filho, Sebastiao David; Fonseca, Adenilson de Souza da; Bernardo-Filho, Mario [Universidade do Estado do Rio de Janeiro (UERJ), RJ (Brazil). Inst. de Biologia Roberto Alcantara Gomes. Dept. de Biofisica e Biometria; Missailidis, Sotiris [The Open University, Milton Keynes (United Kingdom). Dept. of Chemistry and Analytical Sciences
2008-12-15
This study evaluated effects of an aqueous extract of Ganoderma lucidum (reishi) on the labeling of blood constituents with technetium-99m ({sup 99m}Tc) and on the survival of cultures of Escherichia coli treated with stannous chloride. Blood samples from Wistar rats were treated with reishi extract, radiolabeling procedure was performed, plasma (P), blood cells (BC) and insoluble (IF) and soluble (SF) fractions of P and BC were separated. The radioactivity was counted for the determination of the percentages of radioactivity (%ATI). Cultures of Escherichia coli AB1157 were treated with stannous chloride in the presence and absence of reishi extract. Blood samples and bacterial cultures treated with NaCl 0.9% were used as controls. Data indicated that reishi extract altered significantly (p<0.05) the %ATI of P, BC, IF-P, SF-P, IF-BC and SF-BC, as well as increased the survival of bacterial cultures treated with stannous chloride. Our results suggest that reishi extract could present a redox/chelating action, altering the labeling of blood constituents with {sup 99}mTc and protecting bacterial cultures against oxidative damage induced by stannous chloride. (author)
111In,113In-labelled platelets. I
International Nuclear Information System (INIS)
Komarek, P.; Poledne, R.; Charvat, J.; Konopkova, M.; Komarkova, I.
1983-01-01
111 In-8-hydroxyquinoline (oxine) is used for labelling blood platelets which serves diagnostic purposes in medicine. For the preparation of the complex of radioactive indium with oxine, 111 In and sup(113m)In were used under optimal conditions. Two different preparation methods for the labelled complex are described. Both methods studied the effect of pH, the amount of chelate agents and the mode of filtration on the yields of the labelled oxine. The blood platelets labelling is influenced not only by the quality of labelled oxine but also by their number. The organ distribution in laboratory animals proved that platelets were not impaired during separation and labelling and that they were suitable for diagnostic use. (author)
Renal tubular NHE3 is required in the maintenance of water and sodium chloride homeostasis.
Fenton, Robert A; Poulsen, Søren B; de la Mora Chavez, Samantha; Soleimani, Manoocher; Dominguez Rieg, Jessica A; Rieg, Timo
2017-08-01
The sodium/proton exchanger isoform 3 (NHE3) is expressed in the intestine and the kidney, where it facilitates sodium (re)absorption and proton secretion. The importance of NHE3 in the kidney for sodium chloride homeostasis, relative to the intestine, is unknown. Constitutive tubule-specific NHE3 knockout mice (NHE3 loxloxCre) did not show significant differences compared to control mice in body weight, blood pH or bicarbonate and plasma sodium, potassium, or aldosterone levels. Fluid intake, urinary flow rate, urinary sodium/creatinine, and pH were significantly elevated in NHE3 loxloxCre mice, while urine osmolality and GFR were significantly lower. Water deprivation revealed a small urinary concentrating defect in NHE3 loxloxCre mice on a control diet, exaggerated on low sodium chloride. Ten days of low or high sodium chloride diet did not affect plasma sodium in control mice; however, NHE3 loxloxCre mice were susceptible to low sodium chloride (about -4 mM) or high sodium chloride intake (about +2 mM) versus baseline, effects without differences in plasma aldosterone between groups. Blood pressure was significantly lower in NHE3 loxloxCre mice and was sodium chloride sensitive. In control mice, the expression of the sodium/phosphate co-transporter Npt2c was sodium chloride sensitive. However, lack of tubular NHE3 blunted Npt2c expression. Alterations in the abundances of sodium/chloride cotransporter and its phosphorylation at threonine 58 as well as the abundances of the α-subunit of the epithelial sodium channel, and its cleaved form, were also apparent in NHE3 loxloxCre mice. Thus, renal NHE3 is required to maintain blood pressure and steady-state plasma sodium levels when dietary sodium chloride intake is modified. Copyright © 2017 International Society of Nephrology. Published by Elsevier Inc. All rights reserved.
STS-110 M.S. Ross in M-113 personnel carrier during TCDT
2002-01-01
KENNEDY SPACE CENTER, FLA. -- STS-110 Mission Specialist Jerry Ross waits his turn at driving the M-113 armored personnel carrier, part of Terminal Countdown Demonstration Test activities. In the background, right, is Mission Specialist Lee Morin. TCDT includes emergency egress training and a simulated launch countdown, and is held at KSC prior to each Space Shuttle flight. Scheduled for launch April 4, the 11-day mission will feature Shuttle Atlantis docking with the International Space Station (ISS) and delivering the S0 truss, the centerpiece-segment of the primary truss structure that will eventually extend over 300 feet.
Chloride concentrations in human hepatic cytosol and mitochondria are a function of age.
Jahn, Stephan C; Rowland-Faux, Laura; Stacpoole, Peter W; James, Margaret O
2015-04-10
We recently reported that, in a concentration-dependent manner, chloride protects hepatic glutathione transferase zeta 1 from inactivation by dichloroacetate, an investigational drug used in treating various acquired and congenital metabolic diseases. Despite the importance of chloride ions in normal physiology, and decades of study of chloride transport across membranes, the literature lacks information on chloride concentrations in animal tissues other than blood. In this study we measured chloride concentrations in human liver samples from male and female donors aged 1 day to 84 years (n = 97). Because glutathione transferase zeta 1 is present in cytosol and, to a lesser extent, in mitochondria, we measured chloride in these fractions by high-performance liquid chromatography analysis following conversion of the free chloride to pentafluorobenzylchloride. We found that chloride concentration decreased with age in hepatic cytosol but increased in liver mitochondria. In addition, chloride concentrations in cytosol, (105.2 ± 62.4 mM; range: 24.7-365.7 mM) were strikingly higher than those in mitochondria (4.2 ± 3.8 mM; range 0.9-22.2 mM). These results suggest a possible explanation for clinical observations seen in patients treated with dichloroacetate, whereby children metabolize the drug more rapidly than adults following repeated doses, and also provide information that may influence our understanding of normal liver physiology. Copyright © 2015 Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Ritchie, J.L.; Hamilton, G.W.; Gould, K.L.; Allen, D.; Kennedy, J.W.; Hammermeister, K.E.
1975-01-01
Regional coronary blood flow distribution was studied by myocardial imaging after intracoronary injection of technetium-99m- and indium-113m-macroaggregated albumin at rest and during coronary hyperemia induced by intracoronary injection of Hypaque-M, 75 percent. The four- to five-fold increase in coronary flow after injection of radiographic contrast materaial was similar in magnitude to that occurring with maximal exercise stress. Experimentally, resting coronary blood flow and regional distribution of radioactive particles remains normal in spite of coronary stenosis of up to 85 percent. Less severe stenosis causes flow and distribution abnormalities only during periods of increased flow, and the degree of maldistribution is directly related to the physiologic severity of the stenosis. Of 49 patients with suspected coronary artery disease, 10 had no significant lesions by coronary arteriography and all had normal images at rest and during coronary hyperemia. Thirty-seven of 39 patients with significant obstructive coronary artery disease had abnormal images at rest or during contrast agent-induced hyperemia, or both. Patients with significant coronary artery disease without previous infarction usually demonstrated abnormalities in flow distribution only during coronary hyperemia. Patients with previous infarction demonstrated resting perfusion abnormalities that often became more abnormal during hyperemia. This technique provides a new method for assessing the physiologic effects of coronary stenosis in conjunction with coronary arteriography. (U.S.)
Lindemann, J; Leiacker, R; Wiesmiller, K; Rettinger, G; Keck, T
2004-08-01
Benzalkonium chloride is a preservative commonly used in nasal decongestant sprays. It has been suggested that benzalkonium chloride may be harmful to the nasal mucosa. Decongestion with the vasoconstrictor xylometazoline containing benzalkonium chloride has been shown to cause a significant reduction of the nasal mucosal temperature. The purpose of the present study was to determine the short-term influence of xylometazoline nasal spray with and without benzalkonium chloride on the nasal mucosal temperature. Healthy volunteers (30) were included in the study. Fifteen volunteers received xylometazoline nasal spray (1.0 mg/mL) containing benzalkonium chloride (0.1 mg/mL) and 15 age-matched subjects, received xylometazoline nasal spray without benzalkonium chloride. Using a miniaturized thermocouple the septal mucosal temperature was continuously measured at defined intranasal detection sites before and after application of the nasal spray. The mucosal temperature values did not significantly differ between the group receiving xylometazoline containing benzalkonium chloride and the group receiving xylometazoline spray without benzalkonium chloride before and after decongestion (P > 0.05). In both study groups septal mucosal temperatures significantly decreased after decongestion (P reduction of the nasal mucosal blood flow following vasoconstriction. This study indicates that benzalkonium chloride itself does not seem to influence nasal blood flow and nasal mucosal temperature in topical nasal decongestants.
Preparation of Tc-99m human serum albumin using stannous citrate and stannous chloride
International Nuclear Information System (INIS)
El-Asrag, H.A.; El-Wetery, A.S.; El-Mohty, A.A.
1988-01-01
99mTc-albumin is widely used as radioactive indicator in the measurement of cardiac output by external counting techniques and in blood volume studies. The quality of 99mTc-albumin depends on the method of preparation. A comparative study had been carried out on the 99mTc-albumin preparation by the stannous chloride, stannous tartarate and stannous citrate method. The different parameters investigated for each method include: pH, albumin concentration, reductant concentration and ascorbic acid as antioxidant stabilizer. The biological distribution of 99mTc-albumin, prepared by different methods, were determined in mice and rats. A procedure was developed for the preparation of stannous human serum albumin (HSA) kit for human application the kit provides a freeze dried sterile formulation for reconstitution with sterile 99mTc pertechnetate solution to give 99mTc-Hsa, the effect of irradiation sterilization on the freeze dried kit was studied by spectrophotometric determination and biological distribution in mice and rats
Avula, B; Dentali, S; Khan, I A
2007-08-01
A HPLC method has been developed which permits the quantification of methyl paraben, benzethonium chloride and triclosan in various samples of grapefruit seed extract (GSE). The best results were obtained with a Phenomenex Gemini C18 column using gradient mobile phase of water (0.1% acetic acid) and acetonitrile (0.1% acetic acid) with a flow rate of 1.0 mL per minute. The detection wavelength was 254 nm for methyl paraben, and 275 nm for benzethonium chloride and triclosan. The main synthetic antimicrobial agent identified in commercial GSE samples was benzethonium chloride in concentrations from 0.29-21.84%. Positive ion electrospray MS of a commercial GSE sample showed a molecular ion at m/z 412 [M+], which matched that of a standard of benzethonium chloride. Triclosan was detected in two samples at 0.009 and 1.13%concentrations; while methyl paraben was not detected in the samples analyzed.
Gaurav, Rohit; Bewtra, Againdra K; Agrawal, Devendra K
2015-08-01
Nicotinamide adenine dinucleotide phosphate (NADPH) oxidase is responsible for respiratory burst in immune cells. Chloride channel 3 (CLC3) has been linked to the respiratory burst in eosinophils and neutrophils. The effect of cytokines and the involvement of CLC3 in the regulation of NADPH-dependent oxidative stress and on cytokine-mediated migration of eosinophils are not known. Human peripheral blood eosinophils were isolated from healthy individuals and from individuals with asthma by negative selection. Real-time PCR was used to detect the expression of NADPH oxidases in eosinophils. Intracellular reactive oxygen species (ROS) measurement was done with flow cytometry. Superoxide generation was measured with transforming growth factor (TGF)-β, eotaxin, and CLC3 blockers. CLC3 dependence of eosinophils in TGF-β- and eotaxin-induced migration was also examined. The messenger RNA (mRNA) transcripts of NADPH oxidase (NOX) 2, dual oxidase (DUOX) 1, and DUOX2 were detected in blood eosinophils, with very low expression of NOX1, NOX3, and NOX5 and no NOX4 mRNA. The level of NOX2 mRNA transcripts increased with disease severity in the eosinophils of subjects with asthma compared with healthy nonatopic volunteers. Change in granularity and size in eosinophils, but no change in intracellular ROS, was observed with phorbol myristate acetate (PMA). PMA, TGF-β, and eotaxin used the CLC3-dependent pathway to increase superoxide radicals. TGF-β and eotaxin induced CLC3-dependent chemotaxis of eosinophils. These findings support the requirement of CLC3 in the activation and migration of human blood eosinophils and may provide a potential novel therapeutic target to regulate eosinophil hyperactivity in allergic airway inflammation in asthma.
International Nuclear Information System (INIS)
Adan, L.; Rebollo, D. V.
1978-01-01
The design for the construction of a generator 113 S n -113m l n is described. A systematic assay for de adequate adsorbents has been made, to obtain solutions of high radiochemical purity, as it is required for the radiopharmaceutical preparations. The control of purity is carried on by qualitative and quantitative analysis of the solutions, complemented by radiochemical techniques. The following physico-chemical parameters has been determinate; consecutive equilibrium constants, pH, distribution constants, separation factors and electrophoretic factors. It has been considered the measure of these parameters for the best quality In the preparation of the radiopharmaceutical compounds. (Author) 53 refs
Kinetics and thermodynamics of aluminium dissolution in 1.0M sulphuric acid containing chloride ions
Energy Technology Data Exchange (ETDEWEB)
Abdel-Gaber, A.M. [Department of Chemistry, Faculty of Science, Alexandria University, P.O. Box 426, Ibrahimia, Alexandria 21321 (Egypt)]. E-mail: ashrafmoustafa@yahoo.com; Abd-El-Nabey, B.A. [Department of Chemistry, Faculty of Science, Alexandria University, P.O. Box 426, Ibrahimia, Alexandria 21321 (Egypt); Sidahmed, I.M. [Department of Chemistry, Faculty of Science, Alexandria University, P.O. Box 426, Ibrahimia, Alexandria 21321 (Egypt); El-Zayady, A.M. [Department of Chemistry, Faculty of Science, Alexandria University, P.O. Box 426, Ibrahimia, Alexandria 21321 (Egypt); Saadawy, M. [Department of Chemistry, Faculty of Science, Alexandria University, P.O. Box 426, Ibrahimia, Alexandria 21321 (Egypt)
2006-08-01
The dissolution of aluminium in 1M sulphuric acid solutions containing different chloride ion concentrations (0.01-0.06M) were studied at 25, 30, 35 and 40deg. C using electrochemical impedance spectroscopy (EIS) technique and polarization curves measurements. The kinetic rate equation, under the experimental condition described, was derived and found to verify the following relationship:V=k{sub obs}K{sub 2}C{sub Cl{sup -}}{sup n}1+K{sub 2}C{sub Cl{sup -}}{sup n}where V is the corrosion rate, k{sub obs} and K{sub 2} are the dissolution rate constant of aluminium oxide-chloride complex and the equilibrium constant of chloride ions adsorbed at aluminium oxide surface, respectively. The kinetic and thermodynamic energy parameters were calculated and their values indicate that chloride ions are chemisorbed onto the aluminium oxide surface and the formation of oxide-chloride complex is the rate-determining step.
STS-107 M.S. Laurel Clark takes a break during TCDT M113 training
2002-01-01
KENNEDY SPACE CENTER, FLA. -- STS-107 Mission Specialist Laurel Clark takes a break during training on the operation of an M113 armored personnel carrier during Terminal Countdown Demonstration Test activities, a standard part of launch preparations. STS-107 is a mission devoted to research and will include more than 80 experiments that will study Earth and space science, advanced technology development, and astronaut health and safety. Launch is planned for Jan. 16, 2003, between 10 a.m. and 2 p.m. EST aboard Space Shuttle Columbia.
Energy Technology Data Exchange (ETDEWEB)
Ryan, J.; Cooper, M.; Loberg, M.; Harvey, E.; Sikorski, S.
1977-10-01
An easily formulated, stable kit preparation of technetium-99m HIDA, suitable for use in humans, was developed and tested in mice and dogs. The tracer was cleared rapidly from the blood and excreted predominantly by the liver in both species. In dogs, the hepatobiliary clearance of Tc-99m HIDA was significantly greater than that of C-14 HIDA and Sn-113 HIDA. The LD/sub 50/ for HIDA in mice, 168 mg/kg, exceeded the average human dose by a factor of 1000 on a per-weight basis. Blood clearance curves for Tc-99m HIDA in 12 normal subjects were biexponential with half-times of 4.6 +- 1.0 min and 31.5 +- 7.0 min, and cumulative 90-min urine samples contained 14.2 +- 1.8% of the injected dose. Images in normal subjects and nonjaundiced patients showed rapid concentration of tracer by the liver and activity was present within the biliary system in 10 to 20 min. In jaundiced patients, the tracer blood clearance was delayed and urinary excretion increased, but intestinal activity, indicating biliary patency, was imaged in those patients without complete focal obstruction of the common duct. Technetium-99m HIDA is a nontoxic radiopharmaceutical useful for clinical evaluation of hepatobiliary disorders in humans.
Directory of Open Access Journals (Sweden)
Ghahremanzadeh Zahra
2014-09-01
Full Text Available The size and number of chloride cells and serum ion concentrations in kutum, Rutillus frisii kutum Nordman, from brackish (Caspian Sea and fresh water (Khoshkrood River environments were studied to gain a better understanding of osmoregulation in this species. Twenty mature kutum specimens were collected from the Caspian Sea (Anzali coasts, 8.49 ppt salinity and 12.4°C temperature and 20 specimens from Khoshkrood River (0.18 ppt salinity and 18°C temperature. Gill samples were analyzed histologically and concentrations of Na+, Cl- , K+, and Mg2+ ions were determined in the blood serum. Concentrations of Na+, Cl- , K+, and Mg2+ ions and osmotic pressure in mature kutum from brackish water were significantly higher than in specimens from fresh water. The average size and number of chloride cells in the fish from seawater were considerably larger than those from fresh water. The mean size of chloride cells was 6.89 ± 1.16 μm in brackish water samples and 5.1 ± 0.81 μm in river samples. The average number of chloride cells in brackish and river water samples were 16.92 and 6.57, respectively. The density and size of chloride cells increased with increases in salinity
Directory of Open Access Journals (Sweden)
Thiago M. Aquino
Full Text Available In this paper we report the results of an in vitro study involving the influence of biflorin (an o-quinone isolated from Capraria biflora L. that has potent antimicrobial activity on the Tc-99m labeling of red blood cells, plasma protein, cells protein, and lymphocytes. Blood was withdrawn from Wistar rats and incubated with various concentrations of biflorin, and solutions of stannous chloride and Tc-99m were added. Plasma (P and red blood cells (RBC were isolated, precipitated, and centrifuged, and soluble (SF and insoluble (IF fractions were isolated. The results show that the highest concentration (100% of biflorin is able to reduce the uptake of Tc-99m (%ATI on RBC and the fixation on IF-P. To study the influence of biflorin on 99mTc lymphocyte labeling, human blood was submitted to a technique with Ficoll-Hypac and centrifuged, and white cells were isolated. Lymphocytes (2.5 mL; 1.0 x 10(6 cells/mL were obtained and a 0.2 mL solution was incubated with biflorin (0.1 mL. Solutions of stannous chloride and 99mTc were added. Lymphocytes were separated and the %ATI bound in these cells was evaluated. A reduction in %ATI (from 97.85 ± 0.99 to 88.86 ± 5 was observed for RBC and for IF-P (73.24 ± 5.51 to 20.72 ± 6.95. In this case the results showed no decrease in %ATI for the lymphocytes with biflorin.
The influence of zirconium on the labelling stability of albumin macroaggregates with indium-113m
International Nuclear Information System (INIS)
Caro, R.A.; Ciscato, V.A.; Ihlo, J.E.; Nicolini, J.O.; Palcos, M.C.; Radicella, R.
1975-01-01
Physicochemical and biological studies are described to standardize the preparation of sup(113m)In labelled albumin macroaggregates (MAA), for its utilization as a tracer in lung scintiscannings. It was demonstrated that the presence of 20 μg of Zr(IV) and 4 mg of Na 2 PO 4 H per milliliter of suspension are necessary in order to fix the sup(113m)In to the MAA and to minimize its separation ''in vivo'' owing to the presence of plasma transferrin. (author)
Labeling of red blood cells with Tc-99m after oral administration of SnCl2. Concise communication
International Nuclear Information System (INIS)
Patel, M.C.; Parab, P.B.; Samuel, A.M.; Ganatra, R.D.
1979-01-01
In vivo labeling of red blood cells with Tc-99m was possible after prior oral administration of SnCl 2 , both in rats and human volunteers. Absorption of oral SnCl 2 was low but sufficient for more than 95% labeling efficiency. Prior i.v. administration of stannous chloride is known to induce in vivo labeling of red blood cells with pertechnetate. We have observed that such labeling is possible even after oral administration of stannous chloide. Nearly 95% of the circulating radioactivity and 93.7% of the administered radioactivity was in RBCs 30 min after i.v. injection of /sup 99m/TcO 4 - in rats that were fed 5 mg of stannous chloride (3.13 mg Sn 2+ ion) 2 hr before injection. Red blood cells from four human volunteers could bind pertechnetate, both in vitro and in vivo, after oral administration of 100 mg of SnCl 2 . We have obtained a blood-pool image of the human heart by labeling the RBCs in vivo by this method. We have also studied various parameters affecting the in vivo binding of RBCs with Tc-99m - such as the amount of orally administered SnCl 2 , the time of injection of radionuclide after oral SnCl 2 , and the optimum time for the imaging
Directory of Open Access Journals (Sweden)
Shaymaa Abdul Hadi Kadhum
2017-12-01
Full Text Available Aluminum exists in numerous produced foods, medicines and likewise added to drinking water for refining purpose. Its existence has so heavily contaminated with the surroundings that exposed to, it is almost inescapable. This survey was aimed at evaluating the possible effects that Aluminum chloride could exposure have in the blood parameters and histopathology of spleen twenty four rats were used and divided into four groups; “first group was the control injected with normal saline, group II injected into subcutaneous with (240 ppm from Aluminum chloride (AlCl3, group III injected with (320 ppm from (AlCl3, group IV injected with (400 ppm from (AlCl3 for 45 days. This study showed a significant decrease (P<0.05 in red blood cell count, hemoglobin concentration, packed cell volume, mean corpuscular volume and mean corpuscular hemoglobin when compared to control group, while there was a significant increase (P<0.05 in total leucocyte count (TLC and Differential leucocytes count (DLC especially in lymphocyte. The results showed a significant elevated (P<0.05 in ESR value. Changes increased with increase in concentration of Aluminum chloride injected. Observation of blood parameters allows the most rapid detection of changes in wistar rats after the exposure of poisonous(AlCl3”
International Nuclear Information System (INIS)
Lima-Filho, Guilherme L.; Freitas, Rosimeire S.; Moreno, Silvana R.F.; Boasquevisque, Edson M.; Bernardo-Filho, Mario; Lima, Glaydes M.T.; Catanho, Maria T.J.A.
2002-01-01
Blood elements labeled with technetium-99m ( 99m Tc) have been used in various procedures in nuclear medicine. We have investigated if phytic acid (PHY) could alter the labeling of blood elements with 99m Tc. Blood was incubated with different concentrations of PHY. Stannous chloride and 99m Tc, as sodium pertechnetate, were added. Blood was centrifuged and plasma (P) and blood cell (BC) were isolated. Samples of P and BC were also precipitated with trichloroacetic acid and centrifuged, and insoluble (IF) and soluble (SF) fractions were separated. The percentages of radioactivity (%ATI) in BC, IF-P and IF-BC were calculated. The %ATI decreased significantly (p 99m Tc with possible undesirable effects, it is relevant to verify the necessity to repeat the examination and to evaluate the increase of the radiation dose to the patient. (author)
... metabolic acidosis ) or when a person hyperventilates (causing respiratory alkalosis ). A decreased level of blood chloride (called hypochloremia) ... disease , emphysema or other chronic lung diseases (causing respiratory ... metabolic alkalosis). An increased level of urine chloride can indicate ...
International Nuclear Information System (INIS)
Servian, J.; Robles, A.
1975-06-01
Techniques for the preparation and control of already known and new sup(113m)In-radiopharmaceuticals were investigated. New rapid procedures for the control and preparation of a number of radiopharmaceuticals were developed and standardized. After biological distribution studies and clinical tests, new techniques for the preparation of the following indium-113 radiopharmaceuticals were adopted: a) Indium - labelled colloids of: S, Al(OH) 3 , Fe(OH) 3 and AlPO 4 for liver and spleen scintigraphy. b) Indium labelled chelates using the ligands EDTA, DTPA, TTHA (Triethylene-tetramine-hexaacetic acid) and DHPTA (Diamino-hydroxy-propane-tetraacetic acid) for brain scintigraphy. c) Indium labelled Fe(OH) 3 macroaggregates and microspheres for lung scintigraphy. d) Several complexes of sup(113m)In with different ligands (fluoride, tartrate, pyrophosphate, tripolyphosphate, trimetaphosphate, EHDP (or ethane-1-hydroxy-1, 1-diphosphonate), ethylendiamine-pyrophosphate were synthesized and its potential use as bone-scanning agents were evaluated. It was found that the complexes with tartrate, tripolyphosphate and EHDP show appreciable skeletal uptake (bone/muscle ratio are 9.0, 5.5, and 4.7 respectively), although they are inferior to the sup(99m)Tc bone-scanning agents. e) A new simple technique is proposed for the preparation of highly concentrated sup(113m)In solutions. The technique is based on the precipitation of In(OH) 3 , millipore filtration and redissolution in a small volume of 0.05 N HCl
Directory of Open Access Journals (Sweden)
Kakali De
Full Text Available Bacopa monnieri (L. Wettst. (BM, a traditional Ayurvedic medicine, used for centuries as a memory enhancing, anti-inflammatory, antipyretic, sedative and antiepileptic agent. BM extract have been extensively investigated by several authors for their neuropharmacological effects. In nuclear medicine, red blood cells (RBC labeled with technetium-99m (99mTc have several clinical applications. However, data have demonstrated that synthetic or natural drugs could modify the labeling of RBC with 99mTc. As Bacopa monnieri is extensively used in medicine, we evaluated its influence on the labeling of RBC and plasma proteins using technetium-99m (99mTc. This labeling procedure depends on a reducing agent and usually stannous chloride is used. Blood was incubated with BM extracts. Stannous chloride solution and 99mTc were added. Blood was centrifuged and plasma (P and blood cells (BC were isolated. Samples of P or BC were also precipitated, centrifuged and insoluble fraction (IF and soluble fraction (SF were separated. The percentage of radioactivity (%ATI in BC, IF-BC and IF-P were calculated. The %ATI significantly decreased on BC from 95.53±0.45 to 35.41±0.44, on IF-P from 80.20±1.16 to 7.40±0.69 and on IF-BC from 73.31±1.76 to 21.26±1.40. The morphology study of RBC revealed important morphological alterations due to treatment with BM extracts. We suggest that the BM extract effect could be explained by an inhibition of the stannous and pertechnetate ions or oxidation of the stannous ion or by damages induced in the plasma membrane.
Liver scanning using indium-113m at the University Teaching Hospital, Lusaka, Zambia
Energy Technology Data Exchange (ETDEWEB)
Mulaisho, C [Nuclear Medicine Unit, Department of Medicine, University of Zambia, Lusaka, Zambia; Mumba, K N [Radio-isotope Research Unit, National Council for Scientific Research, Lusaka, Zambia
1981-11-21
Liver scanning using the radio-isotope indium-113m, can now be routinely perfomed at the University Teaching Hospital, Lusaka, Zambia. The dose used is 1 - 4 mCi. Liver scans have been performed on 48 subjects, including 10 healthy individuals 16 patients with histologically proven hepatocellular carcinoma, 11 with clinical and laboratory evidence of portal hypertension and 11 with miscellaneous illnesses. Seven representative scans are illustrated. The procedure is easy, and gives a fairly accurate functional estimate of Kupffer cell mass. In hepatoma the scan may be either larger than or smaller than normal and reflects more accurately the residual function of the Kupffer cells. In cirrhosis of the liver with portal hypertention, residual Kupffer cell mass is small. Consequently, most of the indium-113m is taken up by the splenic reticulo-endothelial system, resulting in a large spleen scan. This technique, although fraught with major limitations, is a useful additional diagnostic tool in the management of chronic liver disease.
Study of new 113mIn-BAT complexes for myocardial imaging agents
International Nuclear Information System (INIS)
Zhu Lin; Liu Boli; Kojima, M.
1991-01-01
Some new BAT derivatives are designed and synthesized in order to find some ideal myocardial imaging agents. These ligands form pentacoordinated complexes with indium cation. The structures of ligand BAT-TE and complexes In-BAT-TE and In-BAT-ETE are determined by X-ray crystallography at first. Biodistribution shows that the higher lipophilicity of complex induces apparently higher myocardial accumulation. Up to date, complex B is the best 113m In-labeled myocardial imaging agent. It is also suited to 111 In
STS-110 M.S. Ross and Smith in M-113 personnel carrier during TCDT
2002-01-01
KENNEDY SPACE CENTER, FLA. -- With STS-110 Mission Specialists Jerry Ross (far left) and Steven Smith (third from left) on board, Commander Michael Bloomfield scatters dust as he practices driving the M-113 armored personnel carrier. The driving is part of Terminal Countdown Demonstration Test activities, which include emergency egress training and a simulated launch countdown. The TCDT is held at KSC prior to each Space Shuttle flight. Scheduled for launch April 4, the 11-day mission will feature Shuttle Atlantis docking with the International Space Station (ISS) and delivering the S0 truss, the centerpiece-segment of the primary truss structure that will eventually extend over 300 feet.
Directory of Open Access Journals (Sweden)
Adriano Caldeira-de-Araujo
2012-11-01
Full Text Available Radiopharmaceuticals are employed in patient diagnostics and disease treatments. Concerning the diagnosis aspect, technetium-99m (99mTc is utilized to label radiopharmaceuticals for single photon computed emission tomography (SPECT due to its physical and chemical characteristics. 99mTc fixation on pharmaceuticals depends on a reducing agent, stannous chloride (SnCl2 being the most widely-utilized. The genotoxic, clastogenic and anegenic properties of the 99mTc-MDP(methylene diphosphonate used for bone SPECT and SnCl2 were evaluated in Wistar rat blood cells using the Comet assay and micronucleus test. The experimental approach was to endovenously administer NaCl 0.9% (negative control, cyclophosphamide 50 mg/kg b.w. (positive control, SnCl2 500 μg/mL or 99mTc-MDP to animals and blood samples taken immediately before the injection, 3, and 24 h after (in the Comet assay and 36 h after, for micronucleus test. The data showed that both SnCl2 and 99mTc-MDP-induced deoxyribonucleic acid (DNA strand breaks in rat total blood cells, suggesting genotoxic potential. The 99mTc-MDP was not able to induce a significant DNA strand breaks increase in in vivo assays. Taken together, the data presented here points to the formation of a complex between SnCl2 in the radiopharmaceutical 99mTc-MDP, responsible for the decrease in cell damage, compared to both isolated chemical agents. These findings are important for the practice of nuclear medicine.
Sorption of sulphur dioxide in calcium chloride and nitrate chloride liquids
International Nuclear Information System (INIS)
Trzepierczynska, I.; Gostomczyk, M.A.
1989-01-01
Flue gas desulphurization via application of suspensions has one inherent disadvantage: fixation of sulphur dioxide is very poor. This should be attributed to the low content of calcium ions which results from the solubility of the sorbing species. The solubility of sparingly soluble salts (CaO, CaCO 3 ) may be increased by decreasing the pH of the solution; yet, there is a serious limitation in this method: the corrosivity of the scrubber. The objective of this paper was to assess the sorbing capacity of two soluble calcium salts, calcium chloride and calcium nitrate, as a function of calcium ion concentration in the range of 20 to 82 kg/m 3 . It has been found that sorbing capacity increases with the increasing calcium ion concentration until the calcium concentration in the calcium chloride solution reaches the level of 60 kg/m 3 which is equivalent to the chloride ion content of ∼ 110 kg/m 3 . Addition of calcium hydroxide to the solutions brings about an increase in the sorbing capacity up to 1.6 kg/m 3 and 2.2 kg/m 3 for calcium chloride and calcium nitrate, respectively, as a result of the increased sorbent alkalinity. The sorption capacity of the solutions is considerably enhanced by supplementing them by acetate ions (2.8 to 13.9 kg/m 3 ). Increase in the sorption capacity of calcium nitrate solutions enriched with calcium acetate was approximately 30% as high as that of the chloride solutions enriched with calcium acetate was approximately 30% as high as that of the chloride solutions supplemented in the same way. (author). 12 refs, 7 refs, 4 tabs
Energy Technology Data Exchange (ETDEWEB)
Costa, Maria Regina de Macedo; Ribeiro, Camila Godinho; Santos-Filho, Sebastiao David; Neves, Rosane de Figueiredo; Catanho, Maria Teresa Jansem de Almeida [Universidade Federal do Rio Grande do Norte, Natal, RN (Brazil). Centro de Ciencias da Saude]. E-mail: mariaregina.mr@terra.com.br; Fonseca, Adenilson de Souza da; Bernardo-Filho, Mario [Universidade do Estado do Rio de Janeiro (UERJ), Rio de Janeiro, RJ (Brazil). Inst. de Biologia Roberto Alcantara Gomes. Dept. de Biofisica e Biometria
2007-09-15
The development of experimental assays to study properties of herbal medicine is worthwhile. Vitex agnus castus (VAC) is utilized in popular medicine and some actions have been attributed to its extract. Blood cells (BC) and plasma proteins are labeled with technetium-99m (Tc-99m) and have been used in nuclear medicine, as in basic research. This procedure uses a reducing agent and stannous ion is utilized. There are reports that drugs can alter this labeling process. The aim of this work was to evaluate the influence of an aqueous extract of VAC on the labeling of blood constituents with Tc-99m. Blood was incubated with VAC, stannous chloride and Tc-99m, as sodium pertechnetate, and centrifuged. Samples of BC and plasma were separated, aliquots of BC and plasma were also precipitated with trichloroacetic acid to obtain soluble and insoluble fractions and the percentage of radioactivity (%ATI) was determined. The results show a statistical (p<0.05) alteration in the %ATI on blood compartments and on the insoluble fractions of plasma and BC. Probably, this extract would have chemical compounds with oxidant properties. (author)
International Nuclear Information System (INIS)
Costa, Maria Regina de Macedo; Ribeiro, Camila Godinho; Santos-Filho, Sebastiao David; Neves, Rosane de Figueiredo; Catanho, Maria Teresa Jansem de Almeida; Fonseca, Adenilson de Souza da; Bernardo-Filho, Mario
2007-01-01
The development of experimental assays to study properties of herbal medicine is worthwhile. Vitex agnus castus (VAC) is utilized in popular medicine and some actions have been attributed to its extract. Blood cells (BC) and plasma proteins are labeled with technetium-99m (Tc-99m) and have been used in nuclear medicine, as in basic research. This procedure uses a reducing agent and stannous ion is utilized. There are reports that drugs can alter this labeling process. The aim of this work was to evaluate the influence of an aqueous extract of VAC on the labeling of blood constituents with Tc-99m. Blood was incubated with VAC, stannous chloride and Tc-99m, as sodium pertechnetate, and centrifuged. Samples of BC and plasma were separated, aliquots of BC and plasma were also precipitated with trichloroacetic acid to obtain soluble and insoluble fractions and the percentage of radioactivity (%ATI) was determined. The results show a statistical (p<0.05) alteration in the %ATI on blood compartments and on the insoluble fractions of plasma and BC. Probably, this extract would have chemical compounds with oxidant properties. (author)
Energy Technology Data Exchange (ETDEWEB)
Adan, L; Rebollo, D V
1978-07-01
The design for the construction of a generator 113{sup S}n -113m{sup l}n is described. A systematic assay for de adequate adsorbents has been made, to obtain solutions of high radiochemical purity, as it is required for the radiopharmaceutical preparations. The control of purity is carried on by qualitative and quantitative analysis of the solutions, complemented by radiochemical techniques. The following physico-chemical parameters has been determinate; consecutive equilibrium constants, pH, distribution constants, separation factors and electrophoretic factors. It has been considered the measure of these parameters for the best quality In the preparation of the radiopharmaceutical compounds. (Author) 53 refs.
International Nuclear Information System (INIS)
Kuikka, Jyrki.
1976-05-01
Single detector arrangements are used to measure heart radioactivity curves in healthy subjects and in patients with various heart failures. A method is developed from a modified gamma function to determine the cardiopulmonary parameters from the radiocardiograms: systemic flow, pulmonary flow, right to left shunting flow, left to right shunting flow, regurgitant fractions, stroke volume, atrial blood volumes, ventricular end-diastolic volumes, pulmonary blood volume and ejection fractions. The method is well suited to clinical routine and requires only a desk calculator or a mini-computer for data handling. The cardiopulmonary parameters were measured from 70 healthy subjects with following results: cardiac index 3.46+-0.72 l/min/m 2 , stroke index 49+-9 ml/b/m 2 , right atrial blood volume 35+-13 ml/m 2 , right ventricular end-diastolic volume 76+-15 ml/m 2 , pulmonary blood volume 250+-51 ml/m 2 , left atrial blood volume 41+-15 ml/m 2 , left ventricular end-diastolic volume 75+-15 ml/m 2 , right heart ejection fraction 0.64+-0.11, left heart ejection fraction 0.66+-0.12. These values agree closely with the data accumulated from more elaborate methods. (author)
International Nuclear Information System (INIS)
Cho, S.H.; Moon, H.; Kim, D.S.; Cho, S.S.
1985-01-01
Uteroplacental blood flow studies in preeclampsia are of special interest since the vascular changes reported in this disease might constitute a structural basis for a reduction of blood flow. Evidence has also been given for a decreased uteroplacental blood flow in preeclampsia. Among the various methods to estimate the maternal placental blood flow, the one most frequently reported in the literature during the last years has been the time activity analysis of short lived radiotracer such as technetium-99m or indium-113m injected intravenously. Only few studies with the above mentioned technique comparing normal and preeclampsia cases have been undertaken. In clinical practice we frequently experience difficuly in finding the optimal time to get the delivery in preeclampsia patients. The aim of this study was first to measure uteroplacental blood flow in preeclamptic pregnancies using a computer-linked gamma camera method for the time-activity analysis of technetium-99m and second to discuss the possibility of clinical application of these measurements for determination of fetal well-being and the timing of the delivery in these patients. Uteroplacental blood flow was measured from 13 preeclamptic patients and 19 pregnancies without any complication after 35 completed weeks of gestation from Jan. 1983 to Sep. 1983 at Obstetrics department of Hanyang University Hospital. (Author)
Energy Technology Data Exchange (ETDEWEB)
Cho, S.H.; Moon, H.; Kim, D.S.; Cho, S.S.
1985-05-01
Uteroplacental blood flow studies in preeclampsia are of special interest since the vascular changes reported in this disease might constitute a structural basis for a reduction of blood flow. Evidence has also been given for a decreased uteroplacental blood flow in preeclampsia. Among the various methods to estimate the maternal placental blood flow, the one most frequently reported in the literature during the last years has been the time activity analysis of short lived radiotracer such as technetium-99m or indium-113m injected intravenously. Only few studies with the above mentioned technique comparing normal and preeclampsia cases have been undertaken. In clinical practice we frequently experience difficuly in finding the optimal time to get the delivery in preeclampsia patients. The aim of this study was first to measure uteroplacental blood flow in preeclamptic pregnancies using a computer-linked gamma camera method for the time-activity analysis of technetium-99m and second to discuss the possibility of clinical application of these measurements for determination of fetal well-being and the timing of the delivery in these patients. Uteroplacental blood flow was measured from 13 preeclamptic patients and 19 pregnancies without any complication after 35 completed weeks of gestation from Jan. 1983 to Sep. 1983 at Obstetrics department of Hanyang University Hospital. (Author).
Reactivity of solvent alcohol on degradation of CFC113
International Nuclear Information System (INIS)
Nakagawa, Seiko
2003-01-01
1,1,2-Trichloro-trifluoroethane (CFC113) was dissolved in alkaline 1-butanol, 2-butanol, iso-butyl alcohol, and phenyl ethyl alcohol and irradiated with 60 Co gamma rays after purged with pure nitrogen gas. In all these solvents, the concentration of CFC113 and hydroxide ion decreased and that of chloride ion increased with a dose observed in 2-propanol solution. The reaction efficiency increases in order of 1-butanol< iso-butyl alcohol< phenyl ethyl alcohol<2-butanol<2-propanol. The solvent effect will depend on the binding energy of the αC-H of the alcohol molecule and electron affinity and dipole moment of the ketones or aldehydes produced from the alcohols
Influence of Momordica charantia L. on the red and white blood cells labeling with 99mTc
International Nuclear Information System (INIS)
Brandao, Jose Odinilson de Caldas; Souza, Grace M. Lima de; Catanho, Maria T. Jansem de Almeida
2008-01-01
Full text: Momordica charantia L. is popularly known in Brazil as bitter melon and it's commonly used to treat several diseases as cancer, diabetes and to heal skin injuries. Many papers have been published showing the potential radio pharmacological activity of this plant due to its linkage with 99m Tc through some protein fractions of the extract. In this study, it was evaluated the influence of Momordica charantia L extract , labeling ( in vitro) of blood elements with sodium pertechnetate (Na 99m TcO 4 ). In the labeling of red blood cells (in vitro), blood samples were obtained from Wistar rats and incubated with different concentrations of M. charantia, for control group was used NaCl 0.9% and added stannous chloride (SnCl 2 ) and 99m Tc. The plasma fractions (P) and the cells (C) were separated and, also, precipitated with trichloroacetic acid at 5%, obtaining the soluble (SF) and insoluble (IF) fractions. The radioactivity rate (%ATl) of each fraction was calculated. The same methodology was applied for white blood cells but these cells were separated in advance by centrifugation at 1800 rpm during 15 minutes. There weren't alterations in the labeling of red blood cells in the concentrations tested of the extract when compared with the rate of the control group neither in the insoluble fractions. However, on the white blood cells it was noticed an increase in 99m Tc uptake in the presence of M. charantia extract. So its possible to conclude, based on previous results obtained by our group, that the M. charantia L. could be used to evaluate inflammatory processes. (author)
Energy Technology Data Exchange (ETDEWEB)
Uchida, T; Yoshida, H; Matsuda, S; Kimura, H; Miura, N [Fukushima Medical Coll. (Japan)
1978-02-01
Using a labeling method with sup(99m)Tc-pertechnetate to red blood cells (RBC), circulating blood volume was measured in comparison with that from /sup 51/Cr-labeled RBC method. The technique is easier than already published methods, because CIS kit for sup(99m)Tc-RBC labeling (TCK-11) became to be available recently. Two mls of ACD-anticoagulated blood were withdrawn and 0.5 ml of reducing reagent prepared just before use was added to blood, waiting 5 minutes and discarding the serum after centrifugation, then adding 100 ..mu..Ci of sup(99m)Tc. After washing the labeled cells by isotonic saline, cells were re-suspended in 10 ml of saline and injected to the subject. Blood specimen was obtained 10, 30, 60 and 120 minutes after infusion and blood volume was calculated by the usual way. Circulating blood volume by sup(99m)Tc was well correlated with that by /sup 51/Cr (=0.98, p 0.01), however, the value calculated from sup(99m)Tc were 4.8 percent higher than those by /sup 51/Cr, which suggested the elution of sup(99m)Tc from labeled RBC. sup(99m)Tc method has the advantages that higher radioactivity can be obtained in small amount of blood, which is useful in the determination of blood volume in children or in small animals in the laboratory. The measurement of blood volume of the mouse was done by using sup(99m)Tc method. The results were 1.70 +- 0.06 ml (6.35 +- 0.18%/gm), which coincided with the values reported previously. Because of it's short half life and low radiation dosage to the patients, sup(99m)Tc method will be recommended in the field of pediatrics or in patients with polycythemia or congestive heart failure, who are requested the repeated measurement of blood volume.
Rapid measurement of blood leakage during regional chemotherapy
Energy Technology Data Exchange (ETDEWEB)
Alexander, C. (Universitaet des Saarlandes, Homburg/Saar (Germany). Abt. fuer Nuklearmedizin); Omlor, G.; Gross, G.; Feifel, G. (Universitaet des Saarlandes, Homburg/Saar (Germany). Abt. fuer Allgemeine Chirurgie); Berberich, R. (Staedtische Klinik Wuppertal (Germany). Abt. fuer Nuklearmedizin)
1993-03-01
A method using technetium-99m in vivo red blood cell (RBC) labelling is reported that provides results within 3 min. Blood samples drawn from the systemic and the extracorporeal circulation were measured for [sup 99m]Tc activity using a mobile well counter, and the leakage values calculated. The mean result was 7.6%[+-]6.5%/15 min (n=209). The corresponding flow rate was 100.2[+-]85.7 ml/15 min. The values for isolation perfusion of the upper and the lower extremities are compared. The leakage results using [sup 99m]Tc RBC labelling were correlated with other blood pool markers. Iodine-125 human serum albumin and indium-113 m transferrin were administered in subgroups of 4 and 19 patients simultaneously. Using linear regression, the coefficient of correlation was 0.72 for [sup 99m]Tc/[sup 113m]In and 0.58 for [sup 99m]Tc/[sup 125]I. Comparison with the alternatives suggests that the method can be considered one of the most practicable and reliable methods available. (orig.).
Grieme, Caleb V; Voss, Dena R; Davis, Scott R; Krasowski, Matthew D
2017-03-01
The prevalence of hemolysis, icterus, and lipemia (HIL) was determined for residual whole blood specimens analyzed for clinical chemistry parameters on blood gas analyzers. The frequency and potential impact of exogenous interference from iodide, salicylate, and thiocyanate (metabolite of sodium nitroprusside) on analysis of whole blood chloride was also assessed. Over an approximately two month period at an academic medical center, indices for HIL were determined on Roche cobas c502 analyzers for 1,986 residual whole blood specimens that had been previously analyzed for clinical chemistry parameters on Radiometer ABL90 FLEX blood gas analyzers. To examine exogenous interferences, retrospective analysis was performed over multiple years to ascertain whether patient samples analyzed for whole blood chloride were potentially affected by interference from iodide, salicylate, or thiocyanate. Some degree of hemolysis (defined as hemolysis index of greater than 60) was present in 9.7% of the whole blood specimens. Increasing rates of hemolysis were associated with higher whole blood potassium concentrations. Nearly 60% of specimens with potassium concentrations between 6.0 and 6.9 mEq/L had hemolysis indices of 100 or greater, and 75% of specimens with a potassium concentration of 7.0 mEq/L or greater were severely hemolyzed (hemolysis index of 300 or greater). In contrast to the hemolysis results, icterus and lipemia were determined to have minimal impact on patient results. For the exogenous interferences, we did not identify any patient samples where elevated salicylate levels or pharmaceutical iodide administration overlapped with whole blood chloride analysis (out of 75,887 and 169,229 total chloride measurements, respectively). We did, however, find that for patients receiving nitroprusside therapy in the inpatient setting, whole blood chloride concentrations were significantly higher during nitroprusside therapy [106.7 +/- 6.2 mEq/L (mean, SD)] compared to before
Abdulrzag, Ehmeeda M.; Nur Kristina, Tri; Suwondo, Ari; Sunoko, Henna Rya
2018-02-01
When people are exposed to mercury chloride, it can produce a variety of health effects in the blood and liver. Coconut water contains Zn, Fe, Vit. C, Vit B11, Vit. B6, and Se to reduce mercury chloride level in the blood and improve blood profile and liver cells. Aim of this study was to analysis the effect of green coconut water supplementation in overcoming the toxic effect of Hg chlorid in the blood and liver of Sprague dawley rats exposed to Hg chloride. Samples were randomly about 36 animals rats exposed to HgCl2 through forced feeding by 20 mg/kgBW sondage per day for 14 days, which divided into control group, and intervention groups were given fresh green coconut water in each by 6, 8, and 10 mL/kgBW for intervention 7 and 17 days. The result of this study showed that there is a significant effect and the decrease in mercury levels in the blood. There is no significant affect on the hemoglobin level, hematocrit level and platelet count with the treatment of green coconut water in the mice with exposure Hg. There is no significant effect between treatments using green coconut water with SGPT levels; there is a decrease in SGPT levels at the increasing number of doses of green coconut water and the length of treatment.
The Plasmodium protein P113 supports efficient sporozoite to liver stage conversion in vivo.
Offeddu, Vittoria; Rauch, Manuel; Silvie, Olivier; Matuschewski, Kai
2014-02-01
Invasive stages of Plasmodium parasites possess distinct integral and peripheral membrane proteins that mediate host cell attachment and invasion. P113 is an abundant protein in detergent-resistant high molecular weight complexes in Plasmodium schizonts, but is unusual since expression extends to gametocytes and sporozoites. In this study, we tested whether P113 performs important functions for parasite propagation in Plasmodium berghei. We show that pre-erythrocytic expression of P113 displays key signatures of upregulated in infectious sporozoites (UIS) genes, including control by the liver stage master regulator SLARP. Targeted gene deletion resulted in viable blood stage parasites that displayed no signs of blood stage growth defects. p113(-) parasites propagated normally through the life cycle until mature sporozoites, but displayed defects during natural sporozoite transmission, leading to a delay to patency in infected animals. By comparative in vitro and in vivo analysis of pre-erythrocytic development and using a xeno-diagnostic test we show that ablation of P113 results in lower sporozoite to liver stage conversion and, as a consequence, reduced merozoite output in vivo, without delaying liver stage development. We conclude that p113 is dispensable for Plasmodium life cycle progression and plays auxiliary roles during pre-erythrocytic development. Copyright © 2014 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Lewis, S.M.; Yin, J.A.L.
1986-01-01
The use of dilution analysis with such radioisotopes as 51 Cr, 32 P, sup(99m)Tc and sup(113m)In for measuring red cell volume is reviewed briefly. The use of 125 I and 131 I for plasma volume studies is also considered and the subsequent determination of total blood volume discussed, together with the role of the splenic red cell volume. Substantial bibliography. (UK)
Emiralioğlu, Nagehan; Özçelik, Uğur; Yalçın, Ebru; Doğru, Deniz; Kiper, Nural
2016-01-01
Sweat test with Gibson Cooke (GC) method is the diagnostic gold standard for cystic fibrosis (CF). Recently, alternative methods have been introduced to simplify both the collection and analysis of sweat samples. Our aim was to compare sweat chloride values obtained by GC method with other sweat test methods in patients diagnosed with CF and whose CF diagnosis had been ruled out. We wanted to determine if the other sweat test methods could reliably identify patients with CF and differentiate them from healthy subjects. Chloride concentration was measured with GC method, chloride meter and sweat test analysis system; also conductivity was determined with sweat test analysis system. Forty eight patients with CF and 82 patients without CF underwent the sweat test, showing median sweat chloride values 98.9 mEq/L with GC method, 101 mmol/L with chloride meter, 87.8 mmol/L with sweat test analysis system. In non-CF group, median sweat chloride values were 16.8 mEq/L with GC method, 10.5 mmol/L with chloride meter, and 15.6 mmol/L with sweat test analysis system. Median conductivity value was 107.3 mmol/L in CF group and 32.1 mmol/L in non CF group. There was a strong positive correlation between GC method and the other sweat test methods with a statistical significance (r=0.85) in all subjects. Sweat chloride concentration and conductivity by other sweat test methods highly correlate with the GC method. We think that the other sweat test equipments can be used as reliably as the classic GC method to diagnose or exclude CF.
International Nuclear Information System (INIS)
Santos-Filho, S.D.; Dire, G.L.; Lima, E.; Pereira, M.; Bernardo-Filho, M.
2002-01-01
The use of natural products, as medicinal plants, is very frequent in the world. Mentha crispa L. (M. crispa) is utilized in herbal medicine. Blood elements labeled with technetium-99m (99mTc) are used in nuclear medicine procedures and this labeling process may be altered by drugs. We have investigated the possibility of M. crispa extract being capable to alter the labeling of blood elements with 99mTc. Blood was incubated with M. crispa extract in various concentrations (6.25, 12.5, 25, 50 and 100%). Stannous chloride solution and Tc-99m, as sodium pertechnetate, were added. Blood was centrifuged and plasma (P) and blood cells (BC) were isolated. Samples of P and BC were also precipitated, centrifuged and insoluble (IF) and soluble (SF) separated. The percentage of radioactivity (%ATI) in BC, IF-P and IF-BC was calculated. Histological evaluations of the red blood cells (RBC) were performed with blood samples treated with various concentrations of M. Crispa L. and the morphology of the RBC was observed under optical microscope. Important morphological alterations expressed by mean of the perimeter/area of the RBC treated with M. crispa: 6.25% (0.67 ± 0.02), 12.5% (0.77 ± 0.03), 25% (0.73 ± 0.04), 50% (0.76 ± 0.04), 100% (0.69 ± 0.08) and the control cells (0.67 ± 0.05). The %ATI decreased: (i) on BC from 97.3 ± 1.92 to 60.0 ± 2.44; (ii) on IF-P from 74.8 ± 3.78 to 9.99 ± 3.61; (iii) on IF-BC from 88.6 ± 5.41 to 58.4 ± 11.55. The perimeter/area of the RBC showed significant differences (P>0.01) when compared 6.25% and 12.5%, and when compared 6.25% and 50% of M. Crispa L. extract. These findings could also justify the decrease of the labeling of BC with 99mTc in presence of M. Crispa extract
International Nuclear Information System (INIS)
Adam, H. M.; Agab, H.
2006-01-01
Poly aluminium chloride (PAC) is an urban drinking water purification substance that was introduced recently in Sudan and used to substitute polymer poly diallyl dimethyl aluminium chloride (DADMAC) and aluminium sulphate in water purification treatments. This study was conducted to determine its effects on fish health, which is is considered a biological indicator and an essential component of fresh water ecosystem. In this experiment, PAC was used in three different concentrations (0.1, 0.2 and 0.3 ml/1) in experimental tanks to achieve the desirable doses for the study. The tanks were populated by Nile Tilapia fingerlings (Oreochromis niloticus) with an average weight ranging between 70 and 100 grams. Exposure of this fish to PAC resulted in an immediate signification reduction (P<0.01) in haemoglobin concentration, erythrocytes count, packed cell volume, mean corpuscular volume and mean corpuscular haemoglobin concentration of experimental fingerlings blood. The degree of reduction in these parameters was directly proportional to the concentration of PAC used. (Author)
Ueda, Yu; Odunayo, Adesola; Mann, F A
2013-01-01
To determine whether heparinized saline would be more effective in maintaining the patency of peripheral IV catheters in dogs compared to 0.9% sodium chloride. Prospective blinded randomized study. University Veterinary Teaching Hospital. Thirty healthy purpose bred dogs, intended for use in the junior surgery laboratory, were utilized. The dogs were randomized into 1 of 3 groups, 2 treatment groups and a control group. An 18-Ga cephalic catheter was placed in the cephalic vein of each dog. Each dog in the treatment group had their catheter flushed with either 10 IU/mL heparinized saline or 0.9% sodium chloride every 6 hours for 42 hours. The dogs in the control group did not have their catheters flushed until the end of the study period. Immediately prior to flushing catheters, each catheter was evaluated for patency by aspiration of blood and the catheter site was evaluated for phlebitis. All dogs in the heparinized saline and 0.9% sodium chloride group had catheters that flushed easily at each evaluation point. More dogs in the saline group had catheters from which blood could not be aspirated, but there was no significant difference between these groups. All dogs in the control group had catheters that flushed easily at the end of the assigned 6 hour interval except in 1 dog. Phlebitis was not detected in any dog. Flushes of 0.9% sodium chloride were found to be as effective as 10 IU/mL heparinized saline flushes in maintaining patency of 18-Ga peripheral venous catheters in dogs for up to 42 hours. For peripheral catheters placed with the intention of performing serial blood draws, heparinized flushes may be warranted. © Veterinary Emergency and Critical Care Society 2013.
Energy Technology Data Exchange (ETDEWEB)
Magnata, Simey S.L.P. [Pernambuco Univ., Recife, PE (Brazil). Dept. de Energia Nuclear]. E-mail: sfmagnata@terra.com.br; Correia, Marilia B.L.; Brandao, Jose Odinilson C.; Souza, Grace M.L.; Catanho, Maria Teresa J.A. [Pernambuco Univ., Recife, PE (Brazil). Dept. de Biofisica e Radiobiologia; Terra, Daniele A.; Amorim, Lucia F. [Rio Grande do Norte Univ., Natal, RN (Brazil). Dept. de Fisiologia
2005-07-01
The use of natural products in the treatment physiopathology awaken the interest in the inquiry of the action mechanisms. The Momordica charantia, Melao de Sao Caetano, is used in the Caribbean and Orient for the diseases as stomatitis, cancer and diabetes. This work aims to verify the effect of the Momordica charantia's aqueous extract leaves on osmotic fragility and on labeling red blood cells (RBC) and plasmatic proteins with {sup 99m}Tc in vitro. To evaluate the osmotic fragility, samples of heparinized blood (500 mL) was incubed for 1 hour with brut extract (500 mL) in different concentrations (0; 10; 50 and 100% v/v); after centrifugation, the RCB were submitted the incubation (1 hour) with a gradient of NaCl (0;0,1;0,25;0,4;0,7 and 0.9%), the OD of supernatant was determined. With regards to label red blood cells and plasmatic proteins with {sup 99m}Tc in vitro was carried out by incubating of anticoagulant whole blood (500 mL) for 1 hour with brut extract (500 mL) in different concentrations (0; 10; 50 and 100% v/v). A stannous chloride solution of 1,2 {mu}g/mL was added the incubation for 60 minutes. After this the {sup 99m}Tc (3,7 MBq) was added and the incubation was continued for another 10 minutes. Those were centrifuged, precipitated with trichloroacetic acid 5% and mensured in a counter. The results shows that with regard to osmotic fragility, only the extract in the concentration of 100% provoked hemolysis. The Momordica charantia's extract is an agent who modify the fixation of {sup 99m}Tc in red blood cells. The results show with regard to osmotic fragility, only the extract in the quantity 100% provoked hemolysis. It is concluded that the Momordica charantia's extract is an agent who unchains the cellular fragility and {sup 99m}Tc fixation, showing a reduction effect. (author)
International Nuclear Information System (INIS)
Magnata, Simey S.L.P.; Correia, Marilia B.L.; Brandao, Jose Odinilson C.; Souza, Grace M.L.; Catanho, Maria Teresa J.A.; Terra, Daniele A.; Amorim, Lucia F.
2005-01-01
The use of natural products in the treatment physiopathology awaken the interest in the inquiry of the action mechanisms. The Momordica charantia, Melao de Sao Caetano, is used in the Caribbean and Orient for the diseases as stomatitis, cancer and diabetes. This work aims to verify the effect of the Momordica charantia's aqueous extract leaves on osmotic fragility and on labeling red blood cells (RBC) and plasmatic proteins with 99m Tc in vitro. To evaluate the osmotic fragility, samples of heparinized blood (500 mL) was incubed for 1 hour with brut extract (500 mL) in different concentrations (0; 10; 50 and 100% v/v); after centrifugation, the RCB were submitted the incubation (1 hour) with a gradient of NaCl (0;0,1;0,25;0,4;0,7 and 0.9%), the OD of supernatant was determined. With regards to label red blood cells and plasmatic proteins with 99m Tc in vitro was carried out by incubating of anticoagulant whole blood (500 mL) for 1 hour with brut extract (500 mL) in different concentrations (0; 10; 50 and 100% v/v). A stannous chloride solution of 1,2 μg/mL was added the incubation for 60 minutes. After this the 99m Tc (3,7 MBq) was added and the incubation was continued for another 10 minutes. Those were centrifuged, precipitated with trichloroacetic acid 5% and mensured in a counter. The results shows that with regard to osmotic fragility, only the extract in the concentration of 100% provoked hemolysis. The Momordica charantia's extract is an agent who modify the fixation of 99m Tc in red blood cells. The results show with regard to osmotic fragility, only the extract in the quantity 100% provoked hemolysis. It is concluded that the Momordica charantia's extract is an agent who unchains the cellular fragility and 99m Tc fixation, showing a reduction effect. (author)
Blood cell labeling with technetium-99m, (2)
International Nuclear Information System (INIS)
Uchida, Tatsumi; Yoshida, Hiroshi; Matsuda, Shin; Kimura, Hideo; Miura, Nobuo
1978-01-01
Using a labeling method with sup(99m)Tc-pertechnetate to red blood cells (RBC), circulating blood volume was measured in comparison with that from 51 Cr-labeled RBC method. The technique is easier than already published methods, because CIS kit for sup(99m)Tc-RBC labeling (TCK-11) became to be available recently. Two mls of ACD-anticoagulated blood were withdrawn and 0.5 ml of reducing reagent prepared just before use was added to blood, waiting 5 minutes and discarding the serum after centrifugation, then adding 100 μCi of sup(99m)Tc. After washing the labeled cells by isotonic saline, cells were re-suspended in 10 ml of saline and injected to the subject. Blood specimen was obtained 10, 30, 60 and 120 minutes after infusion and blood volume was calculated by the usual way. Circulating blood volume by sup(99m)Tc was well correlated with that by 51 Cr (=0.98, p 0.01), however, the value calculated from sup(99m)Tc were 4.8 percent higher than those by 51 Cr, which suggested the elution of sup(99m)Tc from labeled RBC. sup(99m)Tc method has the advantages that higher radioactivity can be obtained in small amount of blood, which is useful in the determination of blood volume in children or in small animals in the laboratory. The measurement of blood volume of the mouse was done by using sup(99m)Tc method. The results were 1.70 +- 0.06 ml (6.35 +- 0.18%/gm), which coincided with the values reported previously. Because of it's short half life and low radiation dosage to the patients, sup(99m)Tc method will be recommended in the field of pediatrics or in patients with polycythemia or congestive heart failure, who are requested the repeated measurement of blood volume. (auth.)
Bone marrow scintigraphy with 111In-chloride
International Nuclear Information System (INIS)
Aburano, Tamio; Ueno, Kyoichi; Sugihara, Masami; Tada, Akira; Tonami, Norihisa
1977-01-01
It is assumed that 111 In-chloride is bound to serum transferrin and then transported into reticulocyte in erythropoietic marrow. However, several biochemical differences between radioiron and 111 In have been reported since these years. In present study, clinical usefulness of 111 In-chloride bone marrow scintigraphy was examined especially by comparing 111 In-chloride image with sup(99m)Tc-colloid. Obtained results are as follows: 1) In most cases, both 111 In-chloride and sup(99m)Tc-colloid images showed similar bone marrow distributions. 2) In three out of 7 cases with hypoplastic anemia and two patients with bone marrow irradiation (700-1,000 rad), the central marrow or irradiated marrow showed marked decreased uptake of 111 In, and showed normal uptake of sup(99m)Tc. 3) In two out of 3 cases with chronic myelogenous leucemia, central marrow showed normal uptake of 111 In, and showed decreased uptake of sup(99m)Tc. From the present study, the same dissociation findings as those between radioiron and radiocolloid could be obtained in hypoplastic anemia and bone marrow irradiation. 111 In-chloride would appear to be a useful erythropoietic imaging agent, although further study of exact comparison with radioiron should be necessary. (auth.)
The {sup 99m}Tc generator using poly zirconium chloride (PZC)
Energy Technology Data Exchange (ETDEWEB)
Wan Awang, Wan Anuar; Dahalan, Rehir; Kasim, Shaaban [Medical Technology Div., Malaysian Inst. for Nuclear Technology Research (MINT), Selangor (Malaysia)
1998-10-01
The {sup 99m}Tc generator system has been prepared using poly zirconium chloride (PZC) to replace alumina (Al{sub 2}O{sub 3}) as a adsorbent. The Mo-98 (MoO{sub 3}) was irradiated using our 1 MW TRIGA MARK II research reactor. The amount of Mo-99 adsorbed to the PZC has been studied and the yield from the elution was about 20%. (author)
Erp, van P.J.; Houba, V.J.G.; Reijneveld, J.A.; Beusichem, van M.L.
2001-01-01
A multinutrient soil extraction procedure in routine soil testing is attractive. Therefore, it has been suggested to convert conventional soil testing programs into a 0.01 M calcium chloride (CaCl2) multinutrient soil testing program using the relationship between test values of the 0.01 M CaCl2
Pourbaix Diagrams for Copper in 5 m Chloride Solution
International Nuclear Information System (INIS)
Beverskog, Bjoern; Pettersson, Sven-Olof
2002-12-01
Pourbaix diagrams for the copper in 5 molal chlorine at 5-100 deg C have been calculated. Predominance diagrams for dissolved copper containing species have also been calculated. Two different total concentrations of dissolved copper, 10 -4 and 10 -6 molal, have been used in the calculations. ChIoride is the predominating chlorine species in aqueous solutions. Therefore Pourbaix diagrams for chlorine can be used to discuss the effect of chloride solutions on the corrosion behavior of a metal. Presence of chloride increases the corrosion regions of copper at the expense of the immunity and passivity regions in the Pourbaix diagrams. Copper corrodes in 5 molal chloride by formation Of CuCl 3 2- in acid and alkaline solutions. At higher potentials in acid solutions CuCl 3 2- is oxidized to CuCl 2 (aq), which at increasing potentials can form CuCI + , Cu 2+ or CuClO 3 + . Copper passivates by formation of Cu 2 O(cr), CuO(cr), or CUO 2 3 Cu(OH) 2 (s). Cu 2 O(cr) does not form at [Cu(aq)] tot = 10 -6 molal in 5 m C1-, which results in a corrosion area between the immunity and passivity areas. Copper at the anticipated repository potentials and pH corrodes at 100 deg C at [Cu(aq)] tot = 10 -4 molal and at 80-100 deg C at [Cu(aq)] tot = 10 -6 molal. Copper at the anticipated repository potentials and pH can corrode at 80 deg C at [Cu(aq)] tot = 10 -4 molal and at 50 deg C at [Cu(aq)] tot = 10 -6 molal. The bentonite clay and copper canisters in the deep repository can be considered as a 'closed' system from macroscopic point of view. The clay barrier limits both inward diffusion of oxygen and aggressive anions as well as outward diffusion of corrosion products from the canisters. Both diffusion phenomena will drive the corrosion potential into the immunity area of the Pourbaix diagram for copper. The corrosion will thereby stop by an automatic mechanism. However, this is only valid if no macro cracks occur in the clay. The auto-stop is valid for the initial, main and
Indium-111 chloride imaging in the detection of infected prostheses
International Nuclear Information System (INIS)
Sayle, B.A.; Fawcett, H.D.; Wilkey, D.J.; Cierny, G. III; Mader, J.T.
1985-01-01
Thirty-three patients with painful joint prostheses and a suspicion of infection were imaged with [ 111 In]chloride. A final diagnosis was established by culture in 19. Of these, 12 were categorized as true positives and three as true negatives. There were two false-positive studies, occurring in patients with knee prostheses. In both, the culture was obtained by aspiration. The sensitivity was 86%, specificity 60%, and accuracy 79%. Seventeen of the proven cases had bone imaging prior to [ 111 In]chloride imaging. All 17 static images were positive and were not helpful in differentiating loosening from infection. Using increased uptake on the blood-pool image as a criteria for infection, the sensitivity was 89%, but the specificity was 0. Adding flow studies made little difference in interpreting the blood-pool images. This study shows that [ 111 In]chloride imaging is more accurate in evaluating infection in prosthesis than bone imaging
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB113 (Link to dictyBase) - - - Contig-U16478-1 VFB113P (Link... to Original site) VFB113F 584 VFB113Z 643 VFB113P 1227 - - Show VFB113 Library VF (Link to library) Clone ID VFB113 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16478-1 Original site URL http://dict...rlstttrlptttrlptttrlstttr lptttrlptttrlptttrlptttrlsttrlstttrlstswctswctswictrygswissr llcwynhs*l*t*c*sfkksn...sequence. 42 5e-29 8 U03413 |U03413.1 Dictyostelium discoideum AX2 calcium binding protein mRNA, complete cd
Anodic Behavior of Alloy 22 in Calcium Chloride and in Calcium Chloride Plus Calcium Nitrate Brines
International Nuclear Information System (INIS)
Evans, K.J.; Day, S.D.; Ilevbare, G.O.; Whalen, M.T.; King, K.J.; Hust, G.A.; Wong, L.L.; Estill, J.C.; Rebak, R.B.
2003-01-01
Alloy 22 (UNS N60622) is a nickel-based alloy, which is extensively used in aggressive industrial applications, especially due to its resistance to localized corrosion and stress corrosion cracking in high chloride environments. The purpose of this work was to characterize the anodic behavior of Alloy 22 in concentrated calcium chloride (CaCl 2 ) brines and to evaluate the inhibitive effect of nitrate, especially to localized corrosion. Standard electrochemical tests such as polarization resistance and cyclic polarization were used. Results show that the corrosion potential of Alloy 22 was approximately -360 mV in the silver-silver chloride (SSC) scale and independent of the tested temperature. Cyclic polarization tests showed that Alloy 22 was mainly susceptible to localized attack in 5 M CaCl 2 at 75 C and higher temperatures. The addition of nitrate in a molar ratio of chloride to nitrate equal to 10 increased the onset of localized corrosion to approximately 105 C. The addition of nitrate to the solution also decreased the uniform corrosion rate and the passive current of the alloy
Bone marrow scintigraphy with 111In-chloride
International Nuclear Information System (INIS)
Fujishima, Mamoru; Hiraki, Yoshio; Takeda, Yoshihiro; Kohno, Yoshihiro; Niiya, Harutaka; Aono, Kaname; Yorimitsu, Seiichi; Takahashi, Isao
1988-01-01
Bone marrow scintigraphy with indium chloride ( 111 In) was performed in fifty-one patients with the hematological diseases. The results of the investigation were that 1) in all patients, as well as in patients with aplastic anemia, no correlation was there between the degree of the indium chloride accumulation and peripheral blood counts, 2) in patients with aplastic anemia and pure red cell aplasia (PRCA) a tendency to reduction in uptake of indium chloride in bone marrow, 3) in patients with these two good correlation between the degree of indium chloride accumulation and histology of the erythroid bone marrow, but in patients with chronic myelocytic leukemia (CML) and atypical leukemia no correlation between the two, so it seemed unlikely that indium chloride should reflect the effective production of erythrocytes, 4) four patients with leukemia were studied with indium chloride bone marrow imaging two times to evaluate their responses to chemotherapy, and peripheral expansion was no change or reduced in two patients with acute myelocytic leukemia (AML) and one patient with acute lymphocytic leukemia (ALL) who obtained complete remission, but on the other hand, it enlarged in one patient with acute myelocytic leukemia who obtained partial remission, and 5) in two patients with chronic myelocytic leukemia it enlarged up to the ankle joints, which was considerably specific. (author)
The effect of glucantime on the labeling of blood constituents with technetium-99m
Energy Technology Data Exchange (ETDEWEB)
Holanda, Cecilia Maria Carvalho Xavier [Universidade Federal do Rio Grande do Norte (UFRN), Natal, RN (Brazil). Centro de Biociencias. Dept. de Microbiologia e Parasitologia]. E-mail: cechol@ufrnet.br; Leite, Rodrigo Carvalho Holanda [Universidade Federal do Rio Grande do Norte (UFRN), Natal, RN (Brazil). Curso Medico; Catanho, Maria Teresa Jansem; Souza, Grace Maria Lima [Universidade Federal de Pernambuco (UFPE), Recife, PE (Brazil). Dept. de Biofisica e Radiobiologia; Universidade Federal do Rio Grande do Norte (UFRN), Natal, RN (Brazil). Programa de Pos-Graduacao em Ciencias da Saude; Bernardo Filho, Mario [Universidade do Estado do Rio de Janeiro (UERJ), RJ (Brazil). Inst. de Biologia Roberto Alcantara Gomes; Universidade Federal do Rio Grande do Norte (UFRN), Natal, RN (Brazil). Programa de Pos-Graduacao em Ciencias da Saude
2005-07-01
Purpose: The labeling of red blood cells (C) with {sup 99m}Tc is employed in clinical nuclear medicine for a variety of diagnostic procedures. Drugs can alter this labeling method and modify the disposition of the radiopharmaceuticals. In this paper, the influence of glucan time on the labeling of blood constituents with {sup 99m}Tc was reported. Methods: Blood was withdrawn from rats and incubated with glucan time. Stannous chloride and {sup 99m}Tc were added. After centrifugation, plasma (P) and (C) were isolated. Samples of P and C were precipitated with TCA 5%, centrifuged and insoluble (IF) and soluble fractions (SF) separated. The percentages of total activity injected (%ATI) in C, IF-P and IF-C were calculated (p<0.05). Results: The %ATI on C decreased from control to following concentrations of glucan time (6.25%;12.5%;25%;50%;100%), respectively: 94.06{+-}1.29 (control) to 77.15{+-}2.79; to 76.68 {+-}1.88; to 75.15{+-}2.79; to 72.64{+-}4.40 and to 63.05{+-}3.84. On IF-C the %ATI decreased from control to all the concentrations of glucan time (3.125%;6.25%;12.5%;25%;50%; 100%), respectively: 93.34{+-}1.18 (control) to 78.81{+-}2.76; to 74.76{+-}4.82; to 74.02{+-}5.32; to 64.35{+-}4.82; to 62.81{+-}1.97 and to 54.55{+-}3.58. Conclusions: This effect was probably due to products present in this drug that may complex with ions (Sn{sup +2} and {sup 99m}TcO{sub 4}{sup -}) or have a direct or indirect effect on intracellular stannous ion concentration. (author)
International Nuclear Information System (INIS)
Oliveira, H.H.P.; Ribeiro, C.A.O.; Rouleau, Claude; Desbiens, Isabelle; Pelletier, Emillien
2016-01-01
Tissue distributions of 14 C-BaP and 113 Sn-TBT, individually and together, were compared in mummichog by WBARG, after forced-feeding or intraperitoneal injection. Electron differential absorption (EDA) by metal foil was tested to visualize the distribution of 14 C and 113 Sn in tissue sections of animals exposed to both radiochemicals. Distribution of 14 C and 113 Sn in fish did not differ as a function of exposure route, but 14 C liver/blood and bile/ blood concentration ratios were lower in fish dosed with BaP + TBT. EDA allowed a clear differentiation of 14 C and 113 Sn signals and could be used to image other radionuclides pairs. (author)
Chloride equilibrium potential in salamander cones
Directory of Open Access Journals (Sweden)
Bryson Eric J
2004-12-01
Full Text Available Abstract Background GABAergic inhibition and effects of intracellular chloride ions on calcium channel activity have been proposed to regulate neurotransmission from photoreceptors. To assess the impact of these and other chloride-dependent mechanisms on release from cones, the chloride equilibrium potential (ECl was determined in red-sensitive, large single cones from the tiger salamander retinal slice. Results Whole cell recordings were done using gramicidin perforated patch techniques to maintain endogenous Cl- levels. Membrane potentials were corrected for liquid junction potentials. Cone resting potentials were found to average -46 mV. To measure ECl, we applied long depolarizing steps to activate the calcium-activated chloride current (ICl(Ca and then determined the reversal potential for the current component that was inhibited by the Cl- channel blocker, niflumic acid. With this method, ECl was found to average -46 mV. In a complementary approach, we used a Cl-sensitive dye, MEQ, to measure the Cl- flux produced by depolarization with elevated concentrations of K+. The membrane potentials produced by the various high K+ solutions were measured in separate current clamp experiments. Consistent with electrophysiological experiments, MEQ fluorescence measurements indicated that ECl was below -36 mV. Conclusions The results of this study indicate that ECl is close to the dark resting potential. This will minimize the impact of chloride-dependent presynaptic mechanisms in cone terminals involving GABAa receptors, glutamate transporters and ICl(Ca.
Corrosion cracking of 03N18K1M3TYu and 02N12Kh5M3 maraging steels in chloride solutions
Energy Technology Data Exchange (ETDEWEB)
Pavlov, V.N.; Chumalo, G.V.; Vereshchagin, A.N.; Melekhov, R.K.
1987-07-01
The authors investigate the electrochemical behavior in 0.5% NaCl solution and 42% MgCl/sub 2/ solution and the tendency toward corrosion cracking was determined in boiling 0.5% chloride solution of the cobalt-containing maraging steels in the title. Weld specimens and specimens of the base metal of 03N18K1M3TYu steel were tested in 3% NaCl solution for resistance to corrosion cracking. Additional investigations were made of specimens of that steel with previously created fatigue cracks of the base metal and the weld specimens in 3% NaCl solutions, since that steel is a promising material for structures operating in sea water and low concentration chloride solutions.
Łukasik-Głębocka, Magdalena; Sommerfeld, Karina; Hanć, Anetta; Grzegorowski, Adam; Barałkiewicz, Danuta; Gaca, Michał; Zielińska-Psuja, Barbara
2014-01-01
A serious case of barium intoxication from suicidal ingestion is reported. Oral barium chloride poisoning with hypokalemia, neuromuscular and cardiac toxicity, treated with intravenous potassium supplementation and hemodialysis, was confirmed by the determination of barium concentrations in gastric contents, blood, serum and urine using the inductively coupled plasma mass spectrometry method. Barium concentrations in the analyzed specimens were 20.45 µg/L in serum, 150 µg/L in blood, 10,500 µg/L in urine and 63,500 µg/L in gastric contents. Results were compared with barium levels obtained from a non-intoxicated person. © The Author 2014. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Energy Technology Data Exchange (ETDEWEB)
Van den Bossche, P; Van Den Abbeele, J; De Deken, R [Veterinary and Parasitology Departments, Prince Leopold Institute of Tropical Medicine, Nationalestraat 155, 2000 Antwerp (Belgium)
2012-07-15
A repercussion of the release of large numbers of sterile male tsetse flies is the sudden increase in the number of disease vectors. To avoid the potential creation of a trypanosomosis epidemic, studies were conducted aimed at reducing the vectorial capacity of male tsetse flies by offering them a single bloodmeal containing the prophylactic trypanocidal drug isometamidium chloride. Experiments using the pair G. m. morsitans and T. congolense or T. b. brucei showed that a single treatment with isometamidium chloride protected flies from infection with susceptible and resistant trypanosomes for up to 5 days post-treatment. Starvation of isometamidium-treated flies increased their susceptibility to infection with T. congolense. Studies evaluating in vitro feeding of infected flies on citrated bovine blood showed that this feeding regime adversely affected the capacity of trypanosomes to develop in the fly. (author)
Pourbaix Diagrams for Copper in 5 m Chloride Solution
Energy Technology Data Exchange (ETDEWEB)
Beverskog, Bjoern [OECD Halden Reactor Project (Norway); Pettersson, Sven-Olof [ChemIT, Nykoeping (Sweden)
2002-12-01
Pourbaix diagrams for the copper in 5 molal chlorine at 5-100 deg C have been calculated. Predominance diagrams for dissolved copper containing species have also been calculated. Two different total concentrations of dissolved copper, 10{sup -4} and 10{sup -6} molal, have been used in the calculations. ChIoride is the predominating chlorine species in aqueous solutions. Therefore Pourbaix diagrams for chlorine can be used to discuss the effect of chloride solutions on the corrosion behavior of a metal. Presence of chloride increases the corrosion regions of copper at the expense of the immunity and passivity regions in the Pourbaix diagrams. Copper corrodes in 5 molal chloride by formation Of CuCl{sub 3}{sup 2-} in acid and alkaline solutions. At higher potentials in acid solutions CuCl{sub 3}{sup 2-} is oxidized to CuCl{sub 2}(aq), which at increasing potentials can form CuCI{sup +}, Cu{sup 2+} or CuClO{sub 3}{sup +}. Copper passivates by formation of Cu{sub 2}O(cr), CuO(cr), or CUO{sub 2} 3 Cu(OH){sub 2}(s). Cu{sub 2}O(cr) does not form at [Cu(aq)]{sub tot} = 10{sup -6} molal in 5 m C1-, which results in a corrosion area between the immunity and passivity areas. Copper at the anticipated repository potentials and pH corrodes at 100 deg C at [Cu(aq)]{sub tot} = 10{sup -4} molal and at 80-100 deg C at [Cu(aq)]{sub tot} = 10{sup -6} molal. Copper at the anticipated repository potentials and pH can corrode at 80 deg C at [Cu(aq)]{sub tot} = 10{sup -4} molal and at 50 deg C at [Cu(aq)]{sub tot} = 10{sup -6} molal. The bentonite clay and copper canisters in the deep repository can be considered as a 'closed' system from macroscopic point of view. The clay barrier limits both inward diffusion of oxygen and aggressive anions as well as outward diffusion of corrosion products from the canisters. Both diffusion phenomena will drive the corrosion potential into the immunity area of the Pourbaix diagram for copper. The corrosion will thereby stop by an automatic
International Nuclear Information System (INIS)
Galatzeanu, I.
1974-01-01
The obtained results on radiochemical and radionuclidic purities determination of sup(99m)Tc and sup(113m)In-radiopharmaceuticals proved to be a good tool for small hospital units and laboratories in satisfying their duty to improve the quality control. The complicated behaviour of technetium in aqueous solutions during the preparation of radiopharmaceuticals, needs further research work to elucidate the mechanisms of interaction of reduced species with media and their disproportionation
International Nuclear Information System (INIS)
Yang Yuqing; Luo Shunzhong; Wang Guanquan; He Jiaheng; Bing Wenzeng; Pu Manfei; Wei Hongyuan; Wang Wenjin
2004-01-01
Apparent partition coefficient in octanol-water and binding percentage to BSA of 153 Sm-NTMP, 153 Sm-HEDTMP, 153 Sm-DCTMP, 153 Sm-EDTMP, 153 Sm-DTPMP, 113,117 Sn m -EDTMP, 113,117 Sn m -HEDTMP, 113,117 Sn m -DTPMP are measured. The results show that there is a linear relationship between the relative magnitude of the apparent partition coefficient in octanol-water and the relative magnitude of the binding percentage to BSA of these 153 Sm( 113,117 Sn m ) complexes. This linear relationship provides a new method for determination of the apparent partition coefficient in octanol-water of 153 Sm( 113,117 Sn m ) complexes of this kind. This linear relationship also implicates that hydrophobic force plays an important role in the binding of 153 Sm( 113,117 Sn m ) complexes to BSA
International Nuclear Information System (INIS)
Santos-Filho, Sebastiao David; Bernardo-Filho, Mario
2005-01-01
Purpose: To evaluate the effect of a hypericum extract (Hypericum perforatum) on the labeling of blood elements with technetium- 99m ( 99m Tc) and in the bioavailability of the radiopharmaceutical sodium pertechnetate in Wistar rats. Methods: Blood (heparinized) withdrawn from Wistar rats is incubated with a hypericum extract, with a stannous chloride and with 99m Tc, as sodium pertechnetate ( 99m TcO Na). Plasma (P) and cells (C) are isolated by centrifugation. Samples of P and C are also precipitated with trichloroacetic acid (TCA 5%) and soluble (FS-P; FS-C) and insoluble (FI-P; FI-C) fractions are separated. In the bioavailability analysis, the extract or NaCl 0.9% solution is administrated into Wistar rats (gavage) during 15 days. Sodium pertechnetate was administered and after 10 min, the animals are sacrificed, the organs were isolated, the radioactivity determined in a well counter, and the percentages of radioactivity per gram (%ATI/g) in the organs are calculated. Results: The hypericum extract decreased significantly (P 99m Tc on the erythrocytes and plasma and cellular proteins. Moreover, it could produce metabolic alterations with influence in the uptake of the radiopharmaceutical 99m TcO 4 Na in bone, muscle, pancreas and thyroid. (author)
Redetermination of 1-carboxycyclohexan-1-aminium chloride
Directory of Open Access Journals (Sweden)
Teresa González
2009-02-01
Full Text Available The crystal structure of the title compound, C7H14NO2+·Cl−, was reported previously [Chacko, Srinivasan & Zand (1975. J. Cryst. Mol. Struct. 5, 353–357] from Weissenberg photographic data with R = 0.113. It has now been redetermined, providing a significant increase in the precision of the derived geometric parameters, viz. mean σ(C—C = 0.003 Å in the present work compared with 0.021 Å for the previous work. The complete cation is generated by crystallographic mirrror symmetry, with three C atoms, two O atoms and the N atom lying on the reflecting plane; the chloride anion also has m site symmetry. The crystal structure is established by a two-dimensional network of O—H...Cl and N—H...Cl hydrogen bonds, generating C12(4 and C12(7 chains, and R24(8 and R24(14 rings.
International Nuclear Information System (INIS)
Jimenez R, M.; Solache R, M.J.; Ramirez G, J.J.; Rojas H, A.
1997-01-01
With the purpose to complete information about the lutetium (III) hydrolysis constants here is used the potentiometric method to determine those in the middle of ion force 1M sodium chloride at 303 K. (Author)
International Nuclear Information System (INIS)
Dolgov, A.G.; Stroganova, L.I.; Chirkin, N.I.
1980-01-01
Results of radioisotope investigation of cerebral blood circulation in 202 children with different pathology of central nervous system are presented. Velocity of cerebral blood flow and time of semiaccumulation and semimoving a preparate were investigated by means of sup(113m)In. It is established that radiocirculography shows clearly the changes in the system of cerebral blood supply and in such diseases as vegetovascular distonia and hypertension syndrome, the radiocirculography data pass ahead the clinical picture
Biochemical changes in rats under the influence of cesium chloride
Directory of Open Access Journals (Sweden)
N. M. Melnikova
2013-04-01
Full Text Available Cesium is lately accumulated actively in the environment, but its influence on human and animal organism is the least studied among heavy metals. It is shown that the action of cesium chloride in rats caused significant changes in blood chemistry, which are characterized by a decrease of total protein content, pH, an increase in the level of urea, creatinine, glucose and total hemoglobin. The results showed that potassium content in all the studied organs and tissues of poisoned rats decreases under the action of cesium chloride. Histological examination of the heart tissue in rats poisoned with cesium chloride indicates the onset of pathology of cardiovascular system. It was found out that use of the drug “Asparkam” reduces the negative effect of cesium chloride on the body of rats.
Chiaraluce, R.; Gianese, G.; Angelaccio, S.; Florio, R.; Lieshout, van J.F.T.; Oost, van der J.; Consalvi, V.
2005-01-01
The family 16 endo-b-1,3 glucanase from the extremophilic archaeon Pyrococcus furiosus is a laminarinase, which in 7.9 M GdmCl (guanidinium chloride) maintains a significant amount of tertiary structure without any change of secondary structure. The addition of calcium to the enzyme in 7.9 M GdmCl
International Nuclear Information System (INIS)
Berdonosov, P.S.; Olenev, A.V.; Dolgikh, V.A.; Lightfoot, P.
2007-01-01
Two new alkaline-earth Nd selenite chlorides MNd 10 (SeO 3 ) 12 Cl 8 (M=Ca, Sr) were obtained using crystal growth from alkaline-earth chloride melts in quartz tubes. These new compounds crystallize in the orthorhombic system in space group C cca (no. 68). The compounds were studied by energy dispersive X-ray spectroscopy (EDX) and X-ray diffraction. It was shown that both compounds adopt the same structure type, constructed by complex [M 11 (SeO 3 ) 12 ] 8+ slabs separated by chloride anion layers perpendicular to the longest cell parameter. The SeO 3 groups show a pyramidal shape and may be described as SeO 3 E tetrahedra. Such SeO 3 groups decorate the Nd-O skeletons forming the [M 11 (SeO 3 ) 12 ] 8+ slabs. - Graphical abstract: Two new alkaline-earth Nd selenite chlorides MNd 10 (SeO 3 ) 12 Cl 8 (M=Ca, Sr) were synthesized. These structures are constructed by [M 11 (SeO 3 ) 12 ] 8+ slabs separated by chloride anion layers
Konda, Venugopala Rao; Eerike, Madhavi; Chary, R Prasanth; Arunachalam, Ruckmani; Yeddula, Venkata Ramana; Meti, Vinayak; Devi, T Sobita
2017-01-01
The objectives of the study were to assess evaluate the effects of aluminum chloride (AlCl 3 ) on blood glucose and lipid levels in normal, diabetic, and glibenclamide-treated diabetic rats. Forty-two male Wistar rats were divided into seven groups of six each. Group I was normal control, Groups II and III were given AlCl 3 50 and 100 mg/kg, and Group IV to VII were administered with streptozotocin (STZ) (60 mg/kg) intraperitoneally. Group IV was diabetic control, Group V in addition was given AlCl 3 50 mg/kg, Group VI glibenclamide (10 mg/kg), and Group VII glibenclamide and AlCl 3 (50 mg/kg) per-oral daily for 28 days. Blood glucose and lipid levels were estimated at base line, after diabetes was set in and on the last day of study. Histopathological changes in pancreas, liver, and kidney were studied. No significant change was observed in blood glucose and lipid levels in Group I. Group II and III showed a dose-dependent significant increase in blood glucose was observed. Group V had a reduction in blood glucose but not to the nondiabetic level. Group VI had significant reduction in blood sugar. In Group VII, treated with glibenclamide and AlCl 3 , there was no significant change in blood glucose reduction compared to Group VI. Lipid levels were reduced in groups treated with AlCl 3 and glibenclamide and not in other groups. Gross tissue damage was seen in pancreas in STZ group and in liver and kidney in AlCl 3 groups. AlCl 3 administration in Wistar rats caused in significant hyperglycemia in normal rats, hypoglycemia in diabetic rats, and did not influenced hypoglycemic effect of glibenclamide and in addition, resulted in reduction in lipid levels.
International Nuclear Information System (INIS)
Thrall, J.H.; Freitas, J.E.; Swanson, D.; Rogers, W.L.; Clare, J.M.; Brown, M.L.; Pitt, B.
1978-01-01
Technetium-99m red blood cells (Tc-RBC) labeled by an in vivo technique were compared with two preparations of Tc-99m human serum albumin (HSA) for cardiac blood-pool imaging. Relative distribution of the tracers was analyzed on end-diastolic frames of gated blood-pool studies and on whole-body (head to mid-thigh) anterior pinhole images. The Tc-RBC demonstrated greater relative percentage localization in the cardiac blood pool, higher target-to-background ratios in the left ventricle, and less liver concentration. For cardiac blood-pool imaging, Tc-RBC labeled by the in vivo approach appears to be superior to the two Tc-HSA preparations studied
International Nuclear Information System (INIS)
Zolotarev, K.I.; Zolotarev, P.K.
2013-12-01
Cross section data for the 54 Fe(n,p) 54 Mn, 58 Ni(n,2n) 57 Ni, 67 Zn(n,p) 67 Cu, 92 Mo(n,p) 92m Nb, 93 Nb(n,γ) 94 Nb, 113 In(n,n') 113m In, 115 In(n,γ) 116m In, 169 Tm(n,3n) 167 Tm reactions are needed to solve a wide spectrum of scientific and technical tasks. Activation detectors based on these reactions may be used in the field of reactor dosimetry. Furthermore, the 54 Fe(n,p) 54 Mn reaction is often used in experimental nuclear physics as a monitor reaction for measurements of unknown cross sections by means of the activation method over the neutron energy range from 5 to 15 MeV. The 93 Nb(n,γ) 94 Nb reaction is also very promising for using in retrospective neutron dosimetry for determination of total neutron fluence during a campaign of a reactor. In the existing version of the International Reactor Dosimetry File and the new extended version named as IRDFF data for excitation functions of 67 Zn(n,p) 67 Cu, 92 Mo(n,p) 92m Nb, 113 In(n,n') 113m In, and 169 Tm(n,3n) 167 Tm reactions are absent. Data for these reactions are also absent in the JENDL/D-99 dosimetry file. Excitation functions of 67 Zn(n,p) 67 Cu and 169 Tm(n,3n) 167 Tm are presented in the TENDL-2012, EAF-2010, JENDL-4.0, JEFF-3.1/A, MENDL-2 libraries. Cross section data for the 67 Zn(n,p) 67 Cu reaction up to 20 MeV are given also in the JENDL/HE-2007 library. Excitation functions of the 92 Mo(n,p) 92m Nb and 113 In(n,n') 113m In reactions are evaluated in the EAF-2010 and JEFF-3.1/A libraries. Cross section data for the 113 In(n,n') 113m In reaction are given also in the TENDL-2010 library. It is necessary to note that neutron data in the JEFF-3.1/A and JENDL-4.0 libraries were evaluated up to 20 MeV. Neutron data in the TENDL-2012, EAF-2010, MENDL-2 and TENDL-2010 libraries had been evaluated up to 30 MeV, 60 MeV, 100 MeV and 200 MeV, respectively. Neutron cross sections in the MENDL-2, TENDL-2010 and TENDL-2012 libraries had been obtained on the basis of pure theoretical model calculations
Quantitative assessment of limb blood flow using Tc-99m labeled red blood cells
International Nuclear Information System (INIS)
Itoh, Kazuo; Shougase, Takashi; Kawamura, Naoyuki; Tsukamoto, Eriko; Nakada, Kunihiro; Sakuma, Makoto; Furudate, Masayori
1987-01-01
A quantitative assessment of limb blood flow using a non-diffusible radioindicator, Tc-99m labeled red blood cells, was reported. This was an application of venous occlusion plethysmography using radionuclide which was originally proposed by M. Fukuoka et al. The peripheral blood flow (mean ± s.e.) of 30 legs in a normal control group was 1.87 ± 0.08 ml/100 ml/min. In heart diseases (46 legs), it was 1.49 ± 0.13 ml/100 ml/min. The limb blood flow between a control group and heart diseases was statistically significant (p < 0.01) in the t-test. The peripheral blood flow at rest between diseased legs and normal legs in occlusive arterial disorders was also statistically significant (p < 0.01) in a paired t-test. RAVOP was done after the completion of objective studies such as radionuclide angiography or ventriculography. Technique and calculation of a blood flow were very easy and simple. RAVOP study which was originally proposed by Fukuoka et al. was reappraised to be hopeful for quantitative measurement of limb blood flow as a non-invasive technique using Tc-99m labeled red blood cells. (author)
Directory of Open Access Journals (Sweden)
Silvana Ramos Farias Moreno
2008-12-01
Full Text Available The influence (in vivo and in vitro of an Uncaria tomentosa extract (Cats claw on the labeling of red blood cells (RBCs and plasma and cellular proteins with technetium-99m (Tc-99m was evaluated. For the in vivo treatment, animals were treated with Cats claw. For the in vitro treatment, heparinized blood was incubated with Cats claw before the addition of stannous chloride (SnCl2 and Tc-99m. Samples of plasma (P and RBCs were separated and also precipitated with trichloroacetic acid. The soluble and insoluble fractions of P and RBCs were isolated. The analysis of the results of the in vivo study, indicates that there is no significant alteration on the uptake of Tc-99m by the blood constituents, but it significantly decrease (pO objetivo do presente estudo foi avaliar a influência (in vivo e in vitro de um extrato de Uncaria tomentosa (unha de gato na marcação de hemácias e proteínas plasmáticas e celulares com tecnécio-99m (Tc-99m. Para o estudo in vivo, animais foram tratados com um extrato de unha de gato. Para o estudo in vitro, sangue heparinizado foi incubado com o extrato de unha de gato antes da adição de cloreto estanoso (SnCl2 e Tc-99m. Amostras de plasma e células foram separadas e também precipitadas com ácido tricloracético. As frações solúveis e insolúveis foram isoladas. A análise dos resultados do estudo in vivo, indica que não houve alteração significante na captação de Tc-99m pelos constituintes sanguíneos, entretanto, no tratamento in vitro, ocorreu redução significante da marcação de constituintes sanguíneos. Esses efeitos poderiam ser justificados por quelação dos íons estanoso e pertecnetato e bloqueio dos sítios de ligação do Tc-99m.
International Nuclear Information System (INIS)
Lima, E.A.C.; Dire, G.; Mattos, D.M.M.; Gomes, M.L.; Freitas, R.S.; Bernardo Filho, M.; Instituto Nacional do Cancer, Rio de Janeiro, RJ
2001-01-01
The radiation dose that a patient receives is also associated with the number of expositions to radiation sources. The labeling of blood elements with technetium-99m can be reduced by vegetable extracts and it can determine the repetition of the exam. The labeling procedure depends on a reducing agent and stannous chloride is used. We have evaluated the influence of an extract of cauliflower (leaf) on the labeling of blood elements with technetium-99m the and the results showed that this extract was not capable to alter the labeling procedure, suggesting that the studied extract does not have redox activity sufficiently to oxidize the stannous ions. Moreover, although, other natural extracts might alter this labeling, increasing the radiation dose to the patient, this fact would not occur to the cauliflower. (author)
[Forensic Analysis for 54 Cases of Suxamethonium Chloride Poisoning].
Zhao, Y F; Zhao, B Q; Ma, K J; Zhang, J; Chen, F Y
2017-08-01
To observe and analyze the performance of forensic science in the cases of suxa- methonium chloride poisoning, and to improve the identification of suxamethonium chloride poisoning. Fifty-four cases of suxamethonium chloride poisoning were collected. The rules of determination of suxamethonium chloride poisoning were observed by the retrospective analysis of pathological and toxicological changes as well as case features. The pathological features of suxamethonium chloride poisoning were similar to the general changes of sudden death, which mainly included acute pulmonary congestion and edema, and partly showed myocardial disarray and fracture. Suxamethonium chloride could be detected in the heart blood of all cases and in skin tissue of part cases. Suxa-methonium chloride poisoning has the characteristics with fast death and covert means, which are difficult to rescue and easily miss inspection. For the cases of sudden death or suspicious death, determination of suxamethonium chloride should be taken as a routine detection index to prevent missing inspection. Copyright© by the Editorial Department of Journal of Forensic Medicine
International Nuclear Information System (INIS)
Yakovleva, L.Ya.; Volkov, A.A.; Granov, A.M.; Borisov, A.E.
1985-01-01
Combined application of dynamic and static scintigraphy is recommended by use of /sup 99m/Tc-pertechnetate, /sup 113m/In-chloride, /sup 99m/Tc-sulphur colloid, /sup 119m/In-colloid, and 67 Ga-citrate, respectively, to detect diffuse and focal affections of the liver. In patients with abscesses, echinococcus, or a cyst of the liver the blood supply in the tumor decreased tremendously or was not perceivable at all. In primary or secondary tumors the blood supply was decreased in focus, the half-life period of the preparation storage was extended, and the reception speed was decreased by 50% at most. The alteration of quantitative blood supply values by 150 - 200% and the prevalence of arterial components in liver blood supply for all segments can be considered a sign of cirrhotic liver damage. (author)
International Nuclear Information System (INIS)
Zolotarev, K.I.
2014-10-01
Cross section data for "2"8Si(n,p)"2"8Al, "3"1P(n,p)"3"1Si and "1"1"3In(n,γ)"1"1"4"mIn reactions are needed for solving a wide spectrum of scientific and technical tasks. The excitation function of "2"8Si(n,p)"2"8Al reaction refers to the nuclear data involved in fusion reactor design calculations. The "2"8Si(n,p)"2"8Al reaction is interesting also as the monitor reaction for measurements at fusion facilities. Activation detectors on the basis of the 31P(n,p)31Si reaction are commonly used in the reactor dosimetry. The "1"1"3In(n,γ)"1"1"4"mIn reaction is promising regarding reactor dosimetry application for two reasons. First, due to the "1"1"4"mIn decay parameters which are rather suitable for activation measurements. Half-life of "1"1"4"mIn is equal to T_1/_2 = (49.51 ± 0.01) days and gamma spectrum accompanying decay has only one line with energy 190.27 keV and intensity (15.56 ± 0.15)%. Second, the "1"1"3In(n,γ)"1"1"4"mIn reaction rate may be measured by using one activation detector simultaneously with the "1"1"5In(n,γ)"1"1"6"mIn reaction. Preliminary analysis of existing evaluated excitation functions for "2"8Si(n,p)"2"8Al, "3"1P(n,p)"3"1Si and "1"1"3In(n,γ)"1"1"4"mIn reactions show that new evaluations are needed for all above mentioned reactions. This report is devoted to the preparation of the new evaluations of cross sections data and related covariance matrixes of uncertainties for the "2"8Si(n,p)"2"8Al, "3"1P(n,p)"3"1Si and "1"1"3In(n,γ)"1"1"4"mIn reactions.
Graminske, Sharon; Puca, Kathleen; Schmidt, Anna; Brooks, Scott; Boerner, Amanda; Heldke, Sybil; de Arruda Indig, Monika; Brucks, Mark; Kossor, David
2018-05-01
Di(2-ethylhexyl)phthalate (DEHP) makes polyvinyl chloride flexible for use in blood bags and stabilizes the red blood cell (RBC) membrane preventing excessive hemolysis. DEHP migrates into the blood product and rodent studies have suggested that DEHP exposure may be associated with adverse health effects albeit at high dosages. Although structurally and functionally similar to DEHP, di(2-ethylhexyl)terephthalate (DEHT; or Eastman 168 SG [Eastman Chemical Company]) is metabolically distinct with a comprehensive and benign toxicology profile. This study evaluated RBC stability in DEHT-plasticized bags with AS-1 and PAGGSM compared to conventional DEHP-plasticized bags with AS-1. Thirty-six whole blood units were collected into CPD solution, leukoreduced, centrifuged, and divided into RBCs and plasma. To limit donor-related variability, three ABO-identical RBCs were mixed together and then divided equally and stored among the three different plasticizer and additive solution combinations. RBCs from 12 trios were analyzed for a standard panel of in vitro variables on Day 0 and after storage. No individual bag on Day 42 exceeded the US 1.0% hemolysis criteria. While hemolysis during storage was higher in the DEHT bags, the PAGGSM RBCs were close to the control RBCs (0.38% vs. 0.32%, respectively). ATP retention was higher than 70% and potassium levels were similar regardless of plasticizer. Additional RBC variables exhibited some significant differences but were not viewed as clinically important. DEHT/PAGGSM provides similar hemolysis protection to that of DEHP/AS-1. Although hemolysis values with DEHT and AS-1 are higher than that of DEHP, DEHT is a potential DEHP alternative. © 2018 AABB.
determination of serum chloride ion concentration in pregnant
African Journals Online (AJOL)
Yusif
ABSTRACT. Serum chloride ion level in blood samples of pregnant women attending ante-natal care clinic in Minjibir was investigated. The mean and standard deviation of the ion in the samples is 100.51+ 4.89mmol/L. The distribution is skewed towards high frequency of low concentrations and could be attributed to.
Hu, J.; Koleva, D.A.; Van Breugel, K.
2011-01-01
This paper reports the main results from the influence of the initially admixed nano-aggregates (0.5 g/l PEO113-b-PS70 micelles previously dissolved in demi-water) on microstructural alterations of the reinforced mortar subjected to chloride induced corrosion. The morphology of hydration/corrosion
Intrathoracic Pressure Regulator for Blood Loss
2016-05-24
hepatitis A antibody, and human immunodeficiency virus antibody), urine tests (drug screen I-abuse, marijuana, and a pregnancy test), and a 12-lead... sodium chloride; 250 mL over 2.5 minutes) were administered if systolic BP < 85 mmHg. Blood pressure, other hemodynamics, UO, and total amount of
The permeability of red blood cells to chloride, urea and water
DEFF Research Database (Denmark)
Brahm, Jesper
2013-01-01
This study extends permeability (P) data on chloride, urea and water in red blood cells (RBC), and concludes that the urea transporter (UT-B) does not transport water. P of chick, duck, Amphiuma means, dog and human RBC to (36)Cl(-), (14)C-urea and (3)H2O was determined under self....... Temperature dependence, as measured by apparent activation energy, EA, of PCl is 117.8 (duck), 74.9 (Amphiuma) and 89.6 kJ mol(-1) (dog). The EA of Purea is 69.6 (duck) and 53.3 kJ mol(-1) (Amphiuma), and that of Pd is 34.9 (duck) and 32.1 kJ mol(-1) (Amphiuma). The present and previous RBC studies indicate......-exchange conditions. At 25°C and pH 7.2-7.5, PCl is 0.94×10(-4)-2.15×10(-4) cm s(-1) for all RBC species at [Cl]=127-150 mmol l(-1). In chick and duck RBC, Purea is 0.84×10(-6) and 1.65×10(-6) cm s(-1), respectively, at [urea]=1-500 mmol l(-1). In Amphiuma, dog and human RBC, Purea is concentration dependent (1...
Peripheral blood volume influenced by various external factors
Energy Technology Data Exchange (ETDEWEB)
Ittner, A; Scheibe, J; Stoll, W [Friedrich-Schiller-Universitaet, Jena (German Democratic Republic). Bereich Medizin
1982-01-01
The dependence of the peripheral blood volume upon various exogenous factors was studied in male sports students using /sup 113m/InCl. The results obtained revealed that whole-body exertions and local muscular activity produce an increase of the blood volume in the lower extremities associated with increased blood circulation. The passive measures applied caused also an increase of the blood volume, but not in all of the subjects examined. Isometric concentrations led to a highly significant reduction of the peripheral blood volume. The scintigraphic method for the visualization of the blood volume in peripheral regions of the body can be regarded as suitable for the study of hemodynamics and for the substantiation of the efficiency of measures promoting restoration.
Büyükuslu, Nihal; Ovalı, Sema; Altuntaş, Şükriye Leyla; Batırel, Saime; Yiğit, Pakize; Garipağaoğlu, Muazzez
2017-10-01
Omega-3 fatty acids (n-3 FA), specifically DHA, are associated with fetal growth and development. We aimed to determine the levels of DHA and EPA in cord serum after n-3 FA supplementation during the last trimester of pregnancy. Among 55 women, 23 were administered daily one capsule of n-3 FA supplement, involving DHA/EPA in a ratio of 1/1.3. Twenty nine women were enrolled as control group. Blood samples were collected at 22-24 weeks of gestation and at delivery. Fatty acids were analyzed with the method of GC-MS. Cord DHA level increased and EPA level decreased in both groups between the days of 22-24 and delivery. However, decrease in cord EPA level was significant in control group (p 0.05). Supplementation of DHA/EPA in a ratio of 1/1.3 during the last trimester of pregnancy caused higher cord EPA level compared to control group indicating an accumulation in umbilical cord. Copyright © 2017 Elsevier Ltd. All rights reserved.
Topical ethyl chloride fine spray. Does it have any antimicrobial activity?
International Nuclear Information System (INIS)
Burney, K.; Bowker, K.; Reynolds, R.; Bradley, M.
2006-01-01
Aim: The aim of this study was to assess whether ethyl chloride fine spray (Cryogesic[reg]) has antimicrobial activity. Material and methods: Blood agar plates supplemented with 5% horse blood were inoculated with five different organisms, coagulase-negative staphylococci (CNS), methicillin-sensitive Staphylococcus aureus (MSSA), methicillin-resistant S. aureus (MRSA), Streptococcus pyogenes and Enterococcus faecalis. The plates were assessed for growth inhibition at 24 and 48 h by the microbiologist and compared with the non-sprayed control plates. Results: The model showed a highly significant (p < 0.0001) reduction in bacterial count for the plates treated with fine ethyl chloride spray. The estimate of the percentage of bacteria remaining after spraying with ethyl chloride was 42.7%, with a 95% confidence interval of 35.9-50.9%. There was no evidence that the effect of ethyl chloride fine spray was different for the different organisms (p = 0.49). Conclusion: The use of ethyl chloride shows bacterial count reduction but the clinical implication of this needs to be determined. The authors postulate that any statistically significant reduction can only be helpful in reducing the infection rates. This coupled with the already proven local anaesthetic effects of ethyl chloride will make it an important tool for procedures like arthrocentesis and venepunctures
Topical ethyl chloride fine spray. Does it have any antimicrobial activity?
Energy Technology Data Exchange (ETDEWEB)
Burney, K.; Bowker, K.; Reynolds, R.; Bradley, M
2006-12-15
Aim: The aim of this study was to assess whether ethyl chloride fine spray (Cryogesic[reg]) has antimicrobial activity. Material and methods: Blood agar plates supplemented with 5% horse blood were inoculated with five different organisms, coagulase-negative staphylococci (CNS), methicillin-sensitive Staphylococcus aureus (MSSA), methicillin-resistant S. aureus (MRSA), Streptococcus pyogenes and Enterococcus faecalis. The plates were assessed for growth inhibition at 24 and 48 h by the microbiologist and compared with the non-sprayed control plates. Results: The model showed a highly significant (p < 0.0001) reduction in bacterial count for the plates treated with fine ethyl chloride spray. The estimate of the percentage of bacteria remaining after spraying with ethyl chloride was 42.7%, with a 95% confidence interval of 35.9-50.9%. There was no evidence that the effect of ethyl chloride fine spray was different for the different organisms (p = 0.49). Conclusion: The use of ethyl chloride shows bacterial count reduction but the clinical implication of this needs to be determined. The authors postulate that any statistically significant reduction can only be helpful in reducing the infection rates. This coupled with the already proven local anaesthetic effects of ethyl chloride will make it an important tool for procedures like arthrocentesis and venepunctures.
Crevice corrosion of alloy 22 in fluoride and chloride containing solutions
International Nuclear Information System (INIS)
Carranza, Ricardo M.; Rodriguez, Martin A.
2005-01-01
Alloy 22 (N06022) is highly resistant to localized corrosion. Alloy 22 may be susceptible to crevice corrosion in pure chloride (Cl - ) solutions under aggressive environmental conditions. The effect of the fluoride (F - ) on the susceptibility to crevice corrosion induced by chloride ions is still not well established. The objective of the present work was to explore the crevice corrosion resistance of this alloy to different mixtures of fluorides and chlorides. Cyclic potentiodynamic polarization (CPP) tests were conducted in deaerated aqueous solutions of pure halide ions and also in different mixtures of chloride and fluoride at 90 C degrees and pH 6. The range of chloride concentration [Cl - ] was 0.001 M ≤ [Cl - ] ≤ 1 M and the range of molar fluoride to chloride ratio [F - ]/[Cl - ] was 0.1≤ [F - ]/[Cl - ] ≤ 10. Results showed that Alloy 22 was susceptible to crevice corrosion in all the pure chloride solutions but not in the pure fluoride solutions. A molar ratio [F - ]/[Cl - ] ranging from 5 to 10 was required for the inhibition of crevice corrosion to be complete in the halide mixtures. A moderate or nil inhibitive effect was observed for molar ratios [F - ]/[Cl - ] [es
Effects of in utero tributyltin chloride exposure in the rat on pregnancy outcome.
Adeeko, Adedayo; Li, Daming; Forsyth, Don S; Casey, Valerie; Cooke, Gerard M; Barthelemy, Johanna; Cyr, Daniel G; Trasler, Jacquetta M; Robaire, Bernard; Hales, Barbara F
2003-08-01
Tributyltin, an organotin, is ubiquitous in the environment. The consumption of contaminated marine species leads to human dietary exposure to this compound. Tributyltin is an endocrine disruptor in many wildlife species and inhibits aromatase in mammalian placental and granulosa-like tumor cell lines. We investigated the effects of tributyltin chloride exposure on pregnancy outcome in the Sprague-Dawley rat. Timed pregnant rats were gavaged either with vehicle (olive oil) or tributyltin chloride (0.25, 2.5, 10, or 20 mg/kg) from days 0-19 or 8-19 of gestation. On gestational day 20, dams were sacrificed, and pregnancy outcome was determined. Tributyltin and its metabolites (dibutyltin, monobutyltin) were measured in maternal blood by gas chromatography. Both tributyltin and dibutyltin were present in maternal blood at approximately equal concentrations, whereas monobutyltin contributed minimally to total organotins. Organotin concentrations increased in a dose-dependent pattern in dams, independent of the window of exposure. Tributyltin chloride administration significantly reduced maternal weight gain only at the highest dose (20 mg/kg); a significant increase in post-implantation loss and decreased litter sizes, in addition to decreased fetal weights, was observed in this group. Tributyltin chloride exposure did not result in external malformations, nor was there a change in sex ratios. However, exposure to 0.25, 2.5, or 10 mg/kg tributyltin chloride from gestation days (GD) 0-19 resulted in a significant increase in normalized anogenital distances in male fetuses; exposure from days 8-19 had no effect. There was a dramatic increase in the incidence of low weight (exposure to 20 mg/kg tributyltin chloride. Delayed ossification of the fetal skeleton was observed after in utero exposure to either 10 mg/kg or 20 mg/kg tributyltin chloride. Serum thyroxine and triiodothyronine levels were reduced significantly in dams exposed to 10 and 20 mg/kg tributyltin chloride
Amperometric Sensor for Detection of Chloride Ions†
Trnkova, Libuse; Adam, Vojtech; Hubalek, Jaromir; Babula, Petr; Kizek, Rene
2008-01-01
Chloride ion sensing is important in many fields such as clinical diagnosis, environmental monitoring and industrial applications. We have measured chloride ions at a carbon paste electrode (CPE) and at a CPE modified with solid AgNO3, a solution of AgNO3 and/or solid silver particles. Detection limits (3 S/N) for chloride ions were 100 μM, 100 μM and 10 μM for solid AgNO3, solution of AgNO3 and/or solid silver particles, respectively. The CPE modified with silver particles is the most sensitive to the presence chloride ions. After that we approached to the miniaturization of the whole electrochemical instrument. Measurements were carried out on miniaturized instrument consisting of a potentiostat with dimensions 35 × 166 × 125 mm, screen printed electrodes, a peristaltic pump and a PC with control software. Under the most suitable experimental conditions (Britton-Robinson buffer, pH 1.8 and working electrode potential 550 mV) we estimated the limit of detection (3 S/N) as 500 nM. PMID:27873832
Amperometric Sensor for Detection of Chloride Ions.
Trnkova, Libuse; Adam, Vojtech; Hubalek, Jaromir; Babula, Petr; Kizek, Rene
2008-09-15
Chloride ion sensing is important in many fields such as clinical diagnosis, environmental monitoring and industrial applications. We have measured chloride ions at a carbon paste electrode (CPE) and at a CPE modified with solid AgNO₃, a solution of AgNO₃ and/or solid silver particles. Detection limits (3 S/N) for chloride ions were 100 μM, 100 μM and 10 μM for solid AgNO₃, solution of AgNO₃ and/or solid silver particles, respectively. The CPE modified with silver particles is the most sensitive to the presence chloride ions. After that we approached to the miniaturization of the whole electrochemical instrument. Measurements were carried out on miniaturized instrument consisting of a potentiostat with dimensions 35 × 166 × 125 mm, screen printed electrodes, a peristaltic pump and a PC with control software. Under the most suitable experimental conditions (Britton-Robinson buffer, pH 1.8 and working electrode potential 550 mV) we estimated the limit of detection (3 S/N) as 500 nM.
Directory of Open Access Journals (Sweden)
Raquel Terra Agostinho
2008-12-01
Full Text Available This study evaluated effects of an aqueous extract of Ganoderma lucidum (reishi on the labeling of blood constituents with technetium-99m (99mTc and on the survival of cultures of Escherichia coli treated with stannous chloride. Blood samples from Wistar rats were treated with reishi extract, radiolabeling procedure was performed, plasma (P, blood cells (BC and insoluble (IF and soluble (SF fractions of P and BC were separated. The radioactivity was counted for the determination of the percentages of radioactivity (%ATI. Cultures of Escherichia coli AB1157 were treated with stannous chloride in the presence and absence of reishi extract. Blood samples and bacterial cultures treated with NaCl 0.9% were used as controls. Data indicated that reishi extract altered significantly (pEste estudo avaliou efeitos de um extrato de Ganoderma lucidum (reishi na marcação de constituintes sangüíneos com tecnécio-99m (99mTc e na sobrevivência de culturas de Escherichia coli tratadas com cloreto estanoso. Amostras de sangue de ratos Wistar foram tratadas com extrato de reishi, o procedimento de radiomarcação foi realizado, plasma (P, células sangüíneas (CS e frações insolúvel (FI e solúvel (FS de P e CS foram separadas e a radioatividade foi contada para determinação das porcentagens de radioatividade (%ATI. Culturas de Escherichia coli AB1157 foram tratadas com cloreto estanoso na presença e ausência do extrato de reishi. Amostras de sangue e culturas bacterianas tratadas com NaCl 0.9% foram usadas como controles. Dados indicaram que o extrato de reishi alterou significativamente (p<0,05 a %ATI de P, CS, FI-P, FS-P, FI-CS e FS-CS, bem como, aumentou a sobrevivência de culturas bacterianas tratadas com cloreto estanoso. Nossos resultados sugerem que o extrato de reishi poderia apresentar ação redox/quelante alterando a marcação de constituintes sangüíneos com 99mTc e protegendo culturas bacterianas contra lesões oxidativas induzidas
Effect of α-naphthylisothiocyanate on blood clearance of 99mTc-phytate in dogs
International Nuclear Information System (INIS)
Shibata, Hiroshi; Kohno, Masahiro; Katoh, Hirotake
1989-01-01
The effect of α-naphthylisothiocyanate (ANIT) on blood clearance of 99m Tc-phytate ( 99m Tc-P) in dogs was examined, and blood clearance test of 99m Tc-P was compared with the cases of serum transaminase test or serum bilirubin test. Serum transaminase and bilirubin levels in dogs increased after ANIT administration, however, the degree of increase in these parameters was much lower than the cases in rats. The disappearance rate of 99m Tc-P from blood in dogs decreased with the increase in dose of ANIT and with the passage of time after the ANIT administration. Changes of the blood clearance of 99m Tc-P after ANIT treatment in dogs may be influenced by the disorder in the hepatocytes rather than in the bile ductule cells. The blood clearance test of 99m Tc-P in dogs showed a sensitive reaction for the acute hepatic dysfunction induced by ANIT equally to the serum transaminase test or the serum bilirubin test. (author)
Ratner, Martha A; Decker, Sarah E; Aller, Stephen G; Weber, Gerhard; Forrest, John N
2006-03-01
In the shark rectal gland, basolateral membrane proteins have been suggested as targets for mercury. To examine the membrane polarity of mercury toxicity, we performed experiments in three preparations: isolated perfused rectal glands, primary monolayer cultures of rectal gland epithelial cells, and Xenopus oocytes expressing the shark cystic fibrosis transmembrane conductance regulator (CFTR) chloride channel. In perfused rectal glands we observed: (1) a dose-dependent inhibition by mercury of forskolin/3-isobutyl-1-methylxanthine (IBMX)-stimulated chloride secretion; (2) inhibition was maximal when mercury was added before stimulation with forskolin/IBMX; (3) dithiothrietol (DTT) and glutathione (GSH) completely prevented inhibition of chloride secretion. Short-circuit current (Isc) measurements in monolayers of rectal gland epithelial cells were performed to examine the membrane polarity of this effect. Mercuric chloride inhibited Isc more potently when applied to the solution bathing the apical vs. the basolateral membrane (23 +/- 5% and 68 +/- 5% inhibition at 1 and 10 microM HgCl2 in the apical solution vs. 2 +/- 0.9% and 14 +/- 5% in the basolateral solution). This inhibition was prevented by pre-treatment with apical DTT or GSH; however, only the permeant reducing agent DTT reversed mercury inhibition when added after exposure. When the shark rectal gland CFTR channel was expressed in Xenopus oocytes and chloride conductance was measured by two-electrode voltage clamping, we found that 1 microM HgCl2 inhibited forskolin/IBMX conductance by 69.2 +/- 2.0%. We conclude that in the shark rectal gland, mercury inhibits chloride secretion by interacting with the apical membrane and that CFTR is the likely site of this action. Copyright 2006 Wiley-Liss, Inc.
9 CFR 113.201 - Canine Distemper Vaccine, Killed Virus.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Canine Distemper Vaccine, Killed Virus... REQUIREMENTS Killed Virus Vaccines § 113.201 Canine Distemper Vaccine, Killed Virus. Canine Distemper Vaccine... canine distemper susceptible dogs (20 vaccinates and 5 controls) shall be used as test animals. Blood...
The peripheral blood volume influenced by various external factors
International Nuclear Information System (INIS)
Ittner, A.; Scheibe, J.; Stoll, W.
1982-01-01
The dependence of the peripheral blood volume upon various exogenous factors was studied in male sports students using /sup 113m/InCl. The results obtained revealed that whole-body exertions and local muscular activity produce an increase of the blood volume in the lower extremities associated with increased blood circulation. The passive measures applied caused also an increase of the blood volume, but not in all of the subjects examined. Isometric concentrations led to a highly significant reduction of the peripheral blood volume. The scintigraphic method for the visualization of the blood volume in peripheral regions of the body can be regarded as suitable for the study of hemodynamics and for the substantiation of the efficiency of measures promoting restoration. (author)
Evaluation of hepatic blood flow using 99mTc-GSA in rats with hepatic blood flow manipulation
International Nuclear Information System (INIS)
Hiraguchi, Etsuo
1995-01-01
Blood clearance and hepatic uptake parameters of 99m Tc-DTPA-galactosyl human serum albumin ( 99m Tc-GSA) were evaluated in two groups of rats, normal liver group and CCl 4 induced chronic liver injury group. In each group, four subgroups were classified as follows: simple laparotomy (LAP), hepatic artery ligation (HAL), portal vein ligation (PVL) and both hepatic artery and portal vein ligation (HAL+PVL). 99m Tc-GSA was intravenously injected (50 μg/100 g B.W.) to rats. Heart and liver were targetted as region of interest and time activity curves (TACs) were obtained. The blood clearance parameters (HH4 and Kd) and the hepatic uptake parameters (LHL4 and Ku) were calculated from these TACs. In normal liver group, the mean HH4 of LAP was significantly different from those of PVL and HAL+PVL. Similarly, the other three parameters (LHL4, Kd and Ku) of LAP were significantly different from those of PVL and HAL+PVL. CCl 4 induced chronic liver injury group showed significant difference on all four parameters in four subgroups. Hepatic tissue blood flow rates (HTBFR) calculated by Laser Doppler flowmeter correlated well with 99m Tc-GSA parameters in both groups. These results suggest that 99m Tc-GSA is useful to estimate hepatic blood flow not only in rats with normal liver, but also in rats with CCl 4 induced chronic liver injury. (author)
Riyanto; Prawidha, A. D.
2018-01-01
Electrochemical degradation of methylene blue using Carbon-Chitosan-Polyvinyl Chloride (CC-PVC) electrode in sodium chloride have been done. The aim of this work was to degradation of methylene blue using Carbon-Chitosan-Polyvinyl Chloride (CC-PVC). Carbon chitosan composite electrode was preparing by Carbon and Chitosan powder and PVC in 4 mL tetrahydrofuran (THF) solvent and swirled flatly to homogeneous followed by drying in an oven at 100 °C for 3 h. The mixture was placed in stainless steel mould and pressed at 10 ton/cm2. Sodium chloride was used electrolyte solution. The effects of the current and electrolysis time were investigated using spectrophotometer UV-Visible. The experimental results showed that the carbon-chitosan composite electrode have higher effect in the electrochemical degradation of methylene blue in sodium chloride. Based on UV-visible spectra analysis shows current and electrolysis time has high effect to degradation of methylene blue in sodium chloride. Chitosan and polyvinyl chloride can strengthen the bond between the carbons so that the material has the high stability and conductivity. As conclusions is Carbon-Chitosan-Polyvinyl Chloride (CC-PVC) electrode have a high electrochemical activity for degradation of methylene blue in sodium chloride.
Stability of 2 mg/mL Adenosine Solution in Polyvinyl Chloride and Polyolefin Infusion Bags.
DeAngelis, Michael; Ferrara, Alexander; Gregory, Kaleigh; Zammit, Kimberly; Zhao, Fang
2018-04-01
Adenosine is a potent endogenous mediator of vasodilation. Compounded sterile solutions of adenosine are used in cardiac catheterization lab to perform stress tests on the heart. These tests are used to determine the fractional flow reserve (FFR) and are commonly used in the management and diagnosis of cardiovascular conditions. The purpose of this study was to assess the physical and chemical stability of 2 mg/mL adenosine in 0.9% Sodium Chloride Injection, USP in polyvinyl chloride [PVC]) and polyolefin infusion bags stored at room temperature (20°C-25°C) and under refrigeration (2°C-8°C). The compounding and analytical methods used in this study were very similar to those described in the prior publications from the authors' laboratory. To ensure a uniform starting concentration of all stability samples, a batch of 2 mg/mL adenosine solution was prepared and then packaged into empty PVC and polyolefin infusion bags. These stability samples were prepared in triplicate for each bag type and storage temperature (a total of 12 samples). The infusion bag samples were assessed for stability immediately after preparation and after 1 day, 3 days, 7 days, and 14 days. At each time point, the infusion bags were first visually inspected against a light background for color change, clarity, and particulates. Aliquots were drawn from each sample at each time point for pH analysis and high-performance liquid chromatography (HPLC) analysis. Over 14 days of storage at room temperature or refrigeration, no considerable change in visual appearance or pH was observed in any bags. All samples retained 90% to 110% of the initial drug concentration. No significant degradation peaks were observed in the HPLC chromatograms.
Chloride removal from plutonium alloy
International Nuclear Information System (INIS)
Holcomb, H.P.
1983-01-01
SRP is evaluating a program to recover plutonium from a metallic alloy that will contain chloride salt impurities. Removal of chloride to sufficiently low levels to prevent damaging corrosion to canyon equipment is feasible as a head-end step following dissolution. Silver nitrate and mercurous nitrate were each successfully used in laboratory tests to remove chloride from simulated alloy dissolver solution containing plutonium. Levels less than 10 ppM chloride were achieved in the supernates over the precipitated and centrifuged insoluble salts. Also, less than 0.05% loss of plutonium in the +3, +4, or +6 oxidation states was incurred via precipitate carrying. These results provide impetus for further study and development of a plant-scale process to recover plutonium from metal alloy at SRP
Acetylsalicylic acid and labeling of blood constituents with technetium-99m
Energy Technology Data Exchange (ETDEWEB)
Fonseca, Adenilson de Souza da [Universidade do Estado, Rio de Janeiro, RJ (Brazil). Dept. de Farmacologia e Psicobiologia; Frydman, Jacques Natan Grinapel; Rocha, Vanessa Camara da; Bernardo-Filho, Mario [Universidade do Estado, Rio de Janeiro, RJ (Brazil). Inst. de Biologia Roberto Alcantara Gomes. Dept. de Biofisica e Biometria
2005-10-15
Acetylsalicylic acid is the drug most used an anti-inflammatory agent and for secondary prevention of thrombotic phenomenon. Drugs can modify the labeling of blood constituents with technetium-99m (99m Tc). The aim of this work was to evaluate the effect of in vitro or in vivo assays with acetylsalicylic acid on the labeling of the blood constituents with 99m Tc. In vitro assay was performed with samples of whole blood from Wistar rats incubated with acetylsalicylic acid (1.0 mg/ml) for one hour before the 99m Tc-labeling process. For in vivo assay, Wistar rats were treated with acetylsalicylic acid (1.5 mg/kg) during one hour, and the whole blood was withdrawn for the 99m Tc-labeling process. Saline was used in control groups. Data showed that the fixation of 99m Tc to the blood constituents was not significantly (p>0.05) modified in in vitro and in vivo assays with acetylsalicylic acid, at least not when the experiments were carried out with the doses normally used in human beings. (author)
Amperometric Sensor for Detection of Chloride Ions
Directory of Open Access Journals (Sweden)
Rene Kizek
2008-09-01
Full Text Available Chloride ion sensing is important in many fields such as clinical diagnosis, environmental monitoring and industrial applications. We have measured chloride ions at a carbon paste electrode (CPE and at a CPE modified with solid AgNO3, a solution of AgNO3 and/or solid silver particles. Detection limits (3 S/N for chloride ions were 100 μM, 100 μM and 10 μM for solid AgNO3, solution of AgNO3 and/or solid silver particles, respectively. The CPE modified with silver particles is the most sensitive to the presence chloride ions. After that we approached to the miniaturization of the whole electrochemical instrument. Measurements were carried out on miniaturized instrument consisting of a potentiostat with dimensions 35 × 166 × 125 mm, screen printed electrodes, a peristaltic pump and a PC with control software. Under the most suitable experimental conditions (Britton-Robinson buffer, pH 1.8 and working electrode potential 550 mV we estimated the limit of detection (3 S/N as 500 nM.
Denson, D D; Crews, J C; Grummich, K W; Stirm, E J; Sue, C A
1991-03-01
The stability of methadone hydrochloride in 0.9% sodium chloride injection in flexible polyvinyl chloride containers was studied. Commercially available methadone hydrochloride 20 mg/mL and 25-mL single-dose bags of 0.9% sodium chloride injection were used. Six samples each were prepared at methadone hydrochloride concentrations of 1, 2, and 5 mg/mL. The solutions were stored at room temperature and were not protected from light. Immediately after preparation and after two, three, and four weeks of storage, each of the 18 samples was divided into three aliquots, each of which was analyzed in duplicate for methadone hydrochloride concentration by gas chromatography. There was less than 10% change in methadone hydrochloride concentration in any sample throughout the four-week study period. Methadone hydrochloride at concentrations of 1, 2, and 5 mg/mL prepared in commercially available flexible polyvinyl chloride containers of 0.9% sodium chloride injection and stored at room temperature without deliberate protection from light is stable for at least four weeks.
Labelling of red blood cells with 99m pertechnetate
International Nuclear Information System (INIS)
Vyth, A.; Raam, C.F.
1979-07-01
This paper describes a method for labelling red blood cells with 99mTc in vitro, using electrolytically generated stannous ions as the reducing agent for 99mTc-pertechnetate. A labelling of 95% was found. A method for the in vivo labelling of red blood cells is also reported. This involves an injection of a stanno-DTPA-complex followed 20 minutes later by a 99mTc-pertechnetate solution scintillation camera images show more background activity when the in vivo method of labelling is used
Pitting corrosion of Inconel 600 in chloride and sulfate solutions at low temperature
International Nuclear Information System (INIS)
Chang Mingyu; Yu Geping
1993-01-01
Pitting corrosion of Inconel 600 was examined in chloride and sulfate solutions through usage of potentiodynamic polarization techniques. The effects of chloride and sulfate concentration were investigated in the range of 0.0001 to 0.1 M. Increasing chloride concentrations resulted in active shifts of the pit nucleation potential. Immunity to pitting corrosion was evident at a chloride level below 0.005 M. Increasing sulfate concentrations resulted in improved pitting resistance of Inconel 600 in chloride solutions. Detrimental effects associated with pitting were evident with low-level sulfate being added to dilute chloride media. The density of pits increased with increasing chloride concentrations or temperature between room temperature and 70 C. Systematic trends for the depth of pits were not evident. The observations of pitting corrosion in open immersion were consistent with those in polarization methods. Corrosion products contained in the pits were enriched in nickel, chromium and iron with a small amount of titanium and silicon. The enrichment of chlorine or sulfur was still, however, not found. (orig.)
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Recruitment. 113.310 Section 113... Discrimination on the Basis of Sex in Admission and Recruitment Prohibited § 113.310 Recruitment. (a) Nondiscriminatory recruitment. A recipient to which §§ 113.300 through 113.310 apply shall not discriminate on the...
Pseudo-Bartter syndrome in an infant with congenital chloride diarrhoea.
Igrutinović, Zoran; Peco-Antić, Amira; Radlović, Nedeljko; Vuletić, Biljana; Marković, Slavica; Vujić, Ana; Rasković, Zorica
2011-01-01
Pseudo-Bartter syndrome encompasses a heterogenous group of disorders similar to Bartter syndrome. We are presenting an infant with pseudo-Bartter syndrome caused by congenital chloride diarrhoea. A male newborn born in the 37th gestational week (GW) to young healthy and non-consanguineous parents. In the 35th GW a polyhydramnios with bowel dilatation was verified by ultrasonography. After birth he manifested several episodes of hyponatremic dehydration with hypochloraemia, hypokalaemia and metabolic alkalosis, so as Bartter syndrome was suspected treatment with indomethacin, spironolactone and additional intake of NaCl was initiated. However, this therapy gave no results, so that at age six months he was rehospitalized under the features of persistent watery diarrhoea, vomiting, dehydration and acute renal failure (serum creatinine 123 micromol/L). The laboratory results showed hyponatraemia (123 mmol/L), hypokalaemia (3.1 mmol/L), severe hypochloraemia (43 mmol/L), alcalosis (blood pH 7.64, bicarbonate 50.6 mmol/L), high plasma renin (20.6 ng/ml) and aldosterone (232.9 ng/ml), but a low urinary chloride concentration (2.1 mmol/L). Based on these findings, as well as the stool chloride concentration of 110 mmol/L, the patient was diagnosed congenital chloride diarrhoea. In further course, the patient was treated by intensive fluid, sodium and potassium supplementation which resulted in the normalization of serum electrolytes, renal function, as well as his mental and physical development during 10 months of follow-up. Persistent watery diarrhoea with a high concentration of chloride in stool is the key finding in the differentiation of congenital chloride diarrhoea from Bartter syndrome. The treatment of congenital chloride diarrhoea consists primarily of adequate water and electrolytes replacement.
Advanced intermediate temperature sodium copper chloride battery
Yang, Li-Ping; Liu, Xiao-Min; Zhang, Yi-Wei; Yang, Hui; Shen, Xiao-Dong
2014-12-01
Sodium metal chloride batteries, also called as ZEBRA batteries, possess many merits such as low cost, high energy density and high safety, but their high operation temperature (270-350 °C) may cause several issues and limit their applications. Therefore, decreasing the operation temperature is of great importance in order to broaden their usage. Using a room temperature ionic liquid (RTIL) catholyte composed of sodium chloride buffered 1-ethyl-3-methylimidazolium chloride-aluminum chloride and a dense β″-aluminates solid electrolyte film with 500 micron thickness, we report an intermediate temperature sodium copper chloride battery which can be operated at only 150 °C, therefore alleviating the corrosion issues, improving the material compatibilities and reducing the operating complexities associated with the conventional ZEBRA batteries. The RTIL presents a high ionic conductivity (0.247 S cm-1) at 150 °C and a wide electrochemical window (-2.6 to 2.18 vs. Al3+/Al). With the discharge plateau at 2.64 V toward sodium and the specific capacity of 285 mAh g-1, this intermediate temperature battery exhibits an energy density (750 mWh g-1) comparable to the conventional ZEBRA batteries (728-785 mWh g-1) and superior to commercialized Li-ion batteries (550-680 mWh g-1), making it very attractive for renewable energy integration and other grid related applications.
Biodistribution of 99m technetium labeled creatinine in healthy rats
International Nuclear Information System (INIS)
Yilmaz, O.; Soylu, A.; Kavukcu, S.; Lambrecht, F. Yurt; Durkan, K.
2007-01-01
The distribution of creatinine, one of the toxic guanidine compounds, in various tissues has not been studied in detail by using radiolabeled creatinine. Our objective was to investigate the biodistribution of creatinine labeled with 99m technetium ( 99m Tc) by the stannous (II) chloride method in healthy male Wistar rats. Quality controls were carried out by radio thin layer chromatography, high-performance liquid chromatography, and paper electrophoresis. The labeling yield was 85 ± 2% under optimum conditions (pH 7 and 100 μg stannous chloride). Rats (N 12) were injected intravenously with 99m Tc creatinine and their blood and visceral organs were evaluated for 99m Tc-creatinine uptake as percent of the injected dose per gram wet weight of each tissue (%ID/g). The lowest amount of uptake was detected in the brain and testis. When the rate of uptake was evaluated, only the kidney showed increasing rates of uptake of 99m Tc-creatinine throughout the study. Kidneys showed the highest amount of uptake throughout the study (P < 0.001 compared to all other organs), followed by liver, spleen and lung tissue. (author)
Changes in Biochemical Properties of the Blood in Winter Swimmers.
Teleglow, Aneta; Marchewka, Jakub; Marchewka, Anna; Kulpa, Jan
The aim of the study was to investigate the effects of winter swimming on biochemical indicators of the blood. The subjects - winter swimmers - belonged to the Krakow Walrus Club "Kaloryfer" - "The Heater". The study group consisted of 11 men, aged 30-50 years, 'walrusing' throughout the whole season from November to March. Statistically significant changes throughout the 'walrusing' season were observed for the following biochemical parameters: a decrease in sodium (mmol/1), chloride (mmol/1), alpha-2 globulin(g/1), gamma globulin (g/1), IgG (g/1), and an increase in albumin (g/1), indicator A/G, IgA (g/l ), Herpes simplex virus IgM. Seasonal effort of winter swimmers has a positive influence on biochemical blood parameters.
Energy Technology Data Exchange (ETDEWEB)
Kostic, Danijela, E-mail: dkostic@tmf.bg.ac.rs [Innovation Center of the Faculty of Technology and Metallurgy (Serbia); Vidovic, Srđan, E-mail: srdjanhi@gmail.com; Obradovic, Bojana, E-mail: bojana@tmf.bg.ac.rs [University of Belgrade, Faculty of Technology and Metallurgy (Serbia)
2016-03-15
A stepwise experimental and mathematical modeling approach was used to assess silver release from nanocomposite Ag/alginate microbeads in wet and dried forms into water and into normal saline solution chosen as a simplified model for certain biological fluids (e.g., blood plasma, wound exudates, sweat, etc). Three phenomena were connected and mathematically described: diffusion of silver nanoparticles (AgNPs) within the alginate hydrogel, AgNP oxidation/dissolution and reaction with chloride ions, and diffusion of the resultant silver-chloride species. Mathematical modeling results agreed well with the experimental data with the AgNP diffusion coefficient estimated as 1.3 × 10{sup −18} m{sup 2} s{sup −1}, while the first-order kinetic rate constant of AgNP oxidation/dissolution and diffusivity of silver-chloride species were shown to be inversely related. In specific, rapid rehydration and swelling of dry Ag/alginate microbeads induced fast AgNP oxidation/dissolution reaction with Cl{sup −} and AgCl precipitation within the microbeads with the lowest diffusivity of silver-chloride species compared to wet microbeads in normal saline. The proposed mathematical model provided an insight into the phenomena related to silver release from nanocomposite Ca-alginate hydrogels relevant for use of antimicrobial devices and established, at the same time, a basis for further in-depth studies of AgNP interactions in hydrogels in the presence of chloride ions.
Directory of Open Access Journals (Sweden)
Maria Regina de Macedo Costa
2007-09-01
Full Text Available The development of experimental assays to study properties of herbal medicine is worthwhile. Vitex agnus castus (VAC is utilized in popular medicine and some actions have been attributed to its extract. Blood cells (BC and plasma proteins are labeled with technetium-99m (Tc-99m and have been used in nuclear medicine, as in basic research. This procedure uses a reducing agent and stannous ion is utilized. There are reports that drugs can alter this labeling process. The aim of this work was to evaluate the influence of an aqueous extract of VAC on the labeling of blood constituents with Tc-99m. Blood was incubated with VAC, stannous chloride and Tc-99m, as sodium pertechnetate, and centrifuged. Samples of BC and plasma were separated, aliquots of BC and plasma were also precipitated with trichloroacetic acid to obtain soluble and insoluble fractions and the percentage of radioactivity (%ATI was determined. The results show a statistical (pModelos experimentais são relevantes no estudo de propriedades de plantas medicinais. Vitex agnus castus (VAC é usado na medicina popular. Células sanguíneas (CS e proteínas plasmáticas são marcadas com tecnécio-99m (Tc-99m com aplicações na medicina nuclear e em pesquisa. Esse procedimento utiliza um agente redutor e o íon estanoso é usado. Drogas podem alterar esse processo de marcação. O objetivo desse trabalho foi avaliar a influência de um extrato aquoso de VAC na marcação de constituintes sanguíneos com Tc-99m. Sangue foi incubado com VAC, cloreto estanoso e Tc-99m, como pertecnetato de sódio e centrifugado. Amostras de CS e plasma foram separadas, alíquotas de CS e plasma foram também precipitadas com ácido tricloroacético para obtenção de frações solúvel (FS e insolúvel (FI e a percentagem de radioatividade (%ATI foi determinada. Os resultados mostraram uma alteração estatística (p<0.05 na %ATI dos compartimentos sanguíneos e nas FI do plasma e CS. Provavelmente, esse
Determination of chloride content in crystalline silicotitanate
International Nuclear Information System (INIS)
Wilmarth, W.R.
1999-01-01
Crystalline Silicotitanate (CST) is one of three options under evaluation to replace the In-Tank Precipitation process. This Salt Disposition Alternatives team identified three options for pretreatment of High Level Waste supernate: non-elutable ion exchange, precipitation with sodium tetraphenylborate or direct disposal in grout. The ion exchange option would use crystalline silicotitanate (CST). Researchers at Texas A and M and Sandia National Laboratory developed CST. The engineered form of CST was procured from UOP LLC under the trade name IONSIVreg s ign IE-911. Review of vendor literature and discussions with UOP personnel led to speculation concerning the fate of chloride ion during the manufacture process of IE-911. Walker proposed tests to examine the chloride content of CST and removal methods. This report describes the results of tests to determine the chloride levels in as received CST and washed CST
Pseudo-Bartter syndrome in an infant with congenital chloride diarrhoea
Directory of Open Access Journals (Sweden)
Igrutinović Zoran
2011-01-01
Full Text Available Introduction. Pseudo-Bartter syndrome encompasses a heterogenous group of disorders similar to Bartter syndrome. We are presenting an infant with pseudo-Bartter syndrome caused by congenital chloride diarrhoea. Case Outline. A male newborn born in the 37th gestational week (GW to young healthy and non-consanguineous parents. In the 35th GW a polyhydramnios with bowel dilatation was verified by ultrasonography. After birth he manifested several episodes of hyponatremic dehydration with hypochloraemia, hypokalaemia and metabolic alkalosis, so as Bartter syndrome was suspected treatment with indomethacin, spironolactone and additional intake of NaCl was initiated. However, this therapy gave no results, so that at age six months he was rehospitalized under the features of persistent watery diarrhoea, vomiting, dehydration and acute renal failure (serum creatinine 123 μmol/L. The laboratory results showed hyponatraemia (123 mmol/L, hypokalaemia (3.1 mmol/L, severe hypochloraemia (43 mmol/L, alcalosis (blood pH 7.64, bicarbonate 50.6 mmol/L, high plasma renin (20.6 ng/ml and aldosterone (232.9 ng/ml, but a low urinary chloride concentration (2.1 mmol/L. Based on these findings, as well as the stool chloride concentration of 110 mmol/L, the patient was diagnosed congenital chloride diarrhoea. In further course, the patient was treated by intensive fluid, sodium and potassium supplementation which resulted in the normalization of serum electrolytes, renal function, as well as his mental and physical development during 10 months of follow-up. Conclusion. Persistent watery diarrhoea with a high concentration of chloride in stool is the key finding in the differentiation of congenital chloride diarrhoea from Bartter syndrome. The treatment of congenital chloride diarrhoea consists primarily of adequate water and electrolytes replacement.
Energy Technology Data Exchange (ETDEWEB)
Santos-Filho, Sebastiao David [Universidade do Estado do Rio de Janeiro (UERJ), RJ (Brazil). Inst. de Biologia Roberto Alcantara Gomes. Lab. de Radiofarmacia Experimental; Universidade Federal do Rio Grande do Norte (UFRN), Natal, RN (Brazil)]. E-mail: santos-filho@uerj.br; Fonseca, Adenilson de Souza da [Universidade do Estado do Rio de Janeiro (UERJ), RJ (Brazil). Inst. de Biologia Roberto Alcantara Gomes. Lab. de Radiofarmacia Experimental; Bernardo-Filho, Mario [Instituto Nacional do Cancer, Rio de Janeiro, RJ (Brazil). Coordenadoria de Pesquisa
2007-09-15
Hypericum perforatum (hiperico) is a plant that has been used to treat diseases and also inhibits rat and human vas deferens contractility. In nuclear medicine, stannous chloride (SnCl{sub 2}) is used as a reducing agent to obtain radiopharmaceuticals labeling with technetium-99m. As the SnCl{sub 2} seems to have adverse effects related with the reproductive performance of male rabbits as well as the human consumption of hiperico might affect sexual function. In the present work, consistent results show significant changes on the blood constituents labeled by technetium-99m obtained from young rats under the effect of an hiperico extract as opposed to blood samples equally treated taken from elderly rat. Supposedly, this extract could protect the male reproductive system against action of SnCl{sub 2} at least in young rats. The findings described in this work allow introducing a simple assay to evaluate the action of products that could interfere with the male reproductive system. (author)
International Nuclear Information System (INIS)
Santos-Filho, Sebastiao David; Fonseca, Adenilson de Souza da; Bernardo-Filho, Mario
2007-01-01
Hypericum perforatum (hiperico) is a plant that has been used to treat diseases and also inhibits rat and human vas deferens contractility. In nuclear medicine, stannous chloride (SnCl 2 ) is used as a reducing agent to obtain radiopharmaceuticals labeling with technetium-99m. As the SnCl 2 seems to have adverse effects related with the reproductive performance of male rabbits as well as the human consumption of hiperico might affect sexual function. In the present work, consistent results show significant changes on the blood constituents labeled by technetium-99m obtained from young rats under the effect of an hiperico extract as opposed to blood samples equally treated taken from elderly rat. Supposedly, this extract could protect the male reproductive system against action of SnCl 2 at least in young rats. The findings described in this work allow introducing a simple assay to evaluate the action of products that could interfere with the male reproductive system. (author)
International Nuclear Information System (INIS)
Ha-Kawa, Sang Kil; Suga, Yutaka; Kouda, Katsuyasu; Ikeda, Koshi; Tanaka, Yoshimasa
1997-01-01
We investigated a curve-fitting method for the rate of blood retention of 99m Tc-galactosyl serum albumin (GSA) as a substitute for the blood sampling method. Seven healthy volunteers and 27 patients with liver disease underwent 99m Tc-GSA scanning. After normalization of the y-intercept as 100 percent, a biexponential regression curve for the precordial time-activity curve provided the percent injected dose (%ID) of 99m Tc-GSA in the blood without blood sampling. The discrepancy between %ID obtained by the curve-fitting method and that by the multiple blood samples was minimal in normal volunteers 3.1±2.1% (mean±standard deviation, n=77 sampling). Slightly greater discrepancy was observed in patients with liver disease (7.5±6.1%, n=135 sampling). The %ID at 15 min after injection obtained from the fitted curve was significantly greater in patients with liver cirrhosis than in the controls (53.2±11.6%, n=13; vs. 31.9±2.8%, n=7, p 99m Tc-GSA and the plasma retention rate for indocyanine green (r=-0.869, p 99m Tc-GSA and could be a substitute for the blood sampling method. (author)
... this page: //medlineplus.gov/ency/article/002417.htm Chloride in diet To use the sharing features on this page, please enable JavaScript. Chloride is found in many chemicals and other substances ...
Monteleone, Melisa C.; Billi, Silvia C.; Brocco, Marcela A.; Frasch, Alberto C.
2017-01-01
Membrane neuronal glycoprotein M6a is highly expressed in the brain and contributes to neural plasticity promoting neurite growth and spine and synapse formation. We have previously showed that chronic stressors alter hippocampal M6a mRNA levels in rodents and tree shrews. We now show that M6a glycoprotein can be detected in mouse blood. M6a is a transmembrane glycoprotein and, as such, unlikely to be free in blood. Here we demonstrate that, in blood, M6a is transported in extracellular vesic...
Wang, Guoshun
2016-09-01
Phagocytes, such as neutrophils and macrophages, engulf microbes into phagosomes and launch chemical attacks to kill and degrade them. Such a critical innate immune function necessitates ion participation. Chloride, the most abundant anion in the human body, is an indispensable constituent of the myeloperoxidase (MPO)-H2 O2 -halide system that produces the potent microbicide hypochlorous acid (HOCl). It also serves as a balancing ion to set membrane potentials, optimize cytosolic and phagosomal pH, and regulate phagosomal enzymatic activities. Deficient supply of this anion to or defective attainment of this anion by phagocytes is linked to innate immune defects. However, how phagocytes acquire chloride from their residing environment especially when they are deployed to epithelium-lined lumens, and how chloride is intracellularly transported to phagosomes remain largely unknown. This review article will provide an overview of chloride protein carriers, potential mechanisms for phagocytic chloride preservation and acquisition, intracellular chloride supply to phagosomes for oxidant production, and methods to measure chloride levels in phagocytes and their phagosomes. © 2016 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.
Blood cell labeling with technetium-99m, (3)
International Nuclear Information System (INIS)
Uchida, Tatsumi; Akizuki, Tsuyoshi; Tanaka, Tetsugoro; Yui, Tokuo; Miura, Nobuo
1978-01-01
Spleen scintigraphy was performed by the use of sup(99m)Tc-labeled red blood cells which were prepared with a kit (TCK-11 produced by CIS) and were damaged by heating for 15 min at 49.0 +- 0.5 0 C or damaged chemically by treating with bromomerculi hydroxy propane (BMHP) 1.5 mg/2 ml of blood. The images obtained by scanner and scintillation camera were both favorable, and the author decided that this method is applicable to clinical spleen scintigraphy. The spleen scintigraphy with sup(99m)Tc-labeled red blood cells has many merits such as it gives a less exposure dose to patients under the examination so that it makes capable of repeated examinations, it uses a less volume of blood for labeling, and the procedure is not so complicated compared with the usual methods of 51 Cr-heating or 203 Hg- (or 197 Hg-) MHP. Therefore, this method is preferable to the other usual methods. (Ueda, J.)
Direct RNA-based detection of CTX-M β-lactamases in human blood samples.
Stein, Claudia; Makarewicz, Oliwia; Pfeifer, Yvonne; Brandt, Christian; Pletz, Mathias W
2015-05-01
Bloodstream infections with ESBL-producers are associated with increased mortality, which is due to delayed appropriate treatment resulting in clinical failure. Current routine diagnostics for detection of bloodstream infections consists of blood culture followed by species identification and susceptibility testing. In attempts to improve and accelerate diagnostic procedures, PCR-based methods have been developed. These methods focus on species identification covering only a limited number of ESBL coding genes. Therefore, they fail to cover the steadily further evolving genetic diversity of clinically relevant β-lactamases. We have recently designed a fast and novel RNA targeting method to detect and specify CTX-M alleles from bacterial cultures, based on an amplification-pyrosequencing approach. We further developed this assay towards a diagnostic tool for clinical use and evaluated its sensitivity and specificity when applied directly to human blood samples. An optimized protocol for mRNA isolation allows detection of specific CTX-M groups from as little as 100 CFU/mL blood via reverse transcription, amplification, and pyrosequencing directly from human EDTA blood samples as well as from pre-incubated human blood cultures with a turnaround time for test results of <7 h. Copyright © 2015 Elsevier GmbH. All rights reserved.
Biodistribution of {sup 99m} technetium labeled creatinine in healthy rats
Energy Technology Data Exchange (ETDEWEB)
Yilmaz, O. [Dokuz Eylul University, Narlidere, Izmir (Turkey). Medical Faculty. Dept. of Animal Research Center; Soylu, A.; Kavukcu, S. [Dokuz Eylul University, Narlidere, Izmir (Turkey). Medical Faculty. Dept. of Pediatrics; Lambrecht, F. Yurt; Durkan, K. [Ege University, Bornova, Izmir (Turkey). Institute of Nuclear Sciences. Dept. of Nuclear Applications]. E-mail: s.kavukcu@deu.edu.tr
2007-06-15
The distribution of creatinine, one of the toxic guanidine compounds, in various tissues has not been studied in detail by using radiolabeled creatinine. Our objective was to investigate the biodistribution of creatinine labeled with {sup 99m}technetium ({sup 99m} Tc) by the stannous (II) chloride method in healthy male Wistar rats. Quality controls were carried out by radio thin layer chromatography, high-performance liquid chromatography, and paper electrophoresis. The labeling yield was 85 {+-} 2% under optimum conditions (pH 7 and 100 {mu}g stannous chloride). Rats (N 12) were injected intravenously with {sup 99m} Tc creatinine and their blood and visceral organs were evaluated for {sup 99m} Tc-creatinine uptake as percent of the injected dose per gram wet weight of each tissue (%ID/g). The lowest amount of uptake was detected in the brain and testis. When the rate of uptake was evaluated, only the kidney showed increasing rates of uptake of {sup 99m} Tc-creatinine throughout the study. Kidneys showed the highest amount of uptake throughout the study (P < 0.001 compared to all other organs), followed by liver, spleen and lung tissue. (author)
Directory of Open Access Journals (Sweden)
Adriano B. Carregaro
2015-01-01
Full Text Available The study aimed to compare the effects of intraosseous infusion of lactated Ringer's and 0.9% sodium chloride solutions on the electrolytes and acid-base balance in pigeons submitted to humerus osteosynthesis. Eighteen pigeons were undergoing to isoflurane anesthesia by an avalvular circuit system. They were randomly assigned into two groups (n=9 receiving lactated Ringer's solution (LR or 0.9% sodium chloride (SC, in a continuous infusion rate of 20mL/kg/h, by using an intraosseous catheter into the tibiotarsus during 60-minute anesthetic procedure. Heart rate (HR, and respiratory rate (RR were measured every 10 min. Venous blood samples were collected at 0, 30 and 60 minutes to analyze blood pH, PvCO2, HCO3 -, Na+ and K+. Blood gases and electrolytes showed respiratory acidosis in both groups during induction, under physical restraint. This acidosis was evidenced by a decrease of pH since 0 min, associated with a compensatory response, observed by increasing of HCO3 - concentration, at 30 and 60 min. It was not observed any changes on Na+ and K+ serum concentrations. According to the results, there is no reason for choosing one of the two solutions, and it could be concluded that both fluid therapy solutions do not promote any impact on acid-base balance and electrolyte concentrations in pigeons submitted to humerus osteosynthesis.
International Nuclear Information System (INIS)
Morgan, R.M.
1981-01-01
The main objectives of this study were (1) to gain insight into sensitivities of vital organs systems after treatments with cadmium chloride (CdCl 2 ), gamma ( 60 Co) radiation, and combined CdCl 2 -gamma radiation; (2) to determine physiological and cellular/molecular changes after these same treatments; and (3) to develop a summary of biochemical/hematological indicators for each insult individually, as well as for the co-insult treatment. Three lethality studies, Acute CdCl 2 , Chronic CdCl 2 , and Acute Radiation, wwere used to determine sublethal doses for the fourth study (Co-insult), which utilized various combinations of CdCl 2 and gamma radiation and from which the hematological and biochemical data were derived. Radiation groups exhibited statistically significant decreases in the total number of leukocytes, lymphocytes, and polyneutrophils. Significant increases were seen in serum iron, lactate dehydrogenase (LDH), alkaline phosphatase, and triglycerides. Cadmium groups had increased total numbers of leukocytes, polyneutrophils, and serum glutamic oxaloacetate transminase (SGOT). Decreases were seen in lymphocytes, hemoglobin, hematocrit, total red blood cell counts, and total protein. When co-insult treatments were used, significant decreases were seen in the total number of leukocytes, polyneutrophils, lymphocytes, hemoglobin, total red blood cells, and serum iron
Suppression of adenosine-activated chloride transport by ethanol in airway epithelia.
Directory of Open Access Journals (Sweden)
Sammeta V Raju
Full Text Available Alcohol abuse is associated with increased lung infections. Molecular understanding of the underlying mechanisms is not complete. Airway epithelial ion transport regulates the homeostasis of airway surface liquid, essential for airway mucosal immunity and lung host defense. Here, air-liquid interface cultures of Calu-3 epithelial cells were basolaterally exposed to physiologically relevant concentrations of ethanol (0, 25, 50 and 100 mM for 24 hours and adenosine-stimulated ion transport was measured by Ussing chamber. The ethanol exposure reduced the epithelial short-circuit currents (I(SC in a dose-dependent manner. The ion currents activated by adenosine were chloride conductance mediated by cystic fibrosis transmembrane conductance regulator (CFTR, a cAMP-activated chloride channel. Alloxazine, a specific inhibitor for A(2B adenosine receptor (A(2BAR, largely abolished the adenosine-stimulated chloride transport, suggesting that A(2BAR is a major receptor responsible for regulating the chloride transport of the cells. Ethanol significantly reduced intracellular cAMP production upon adenosine stimulation. Moreover, ethanol-suppression of the chloride secretion was able to be restored by cAMP analogs or by inhibitors to block cAMP degradation. These results imply that ethanol exposure dysregulates CFTR-mediated chloride transport in airways by suppression of adenosine-A(2BAR-cAMP signaling pathway, which might contribute to alcohol-associated lung infections.
Antioxidant effect of Arabic gum against mercuric chloride-induced nephrotoxicity
Directory of Open Access Journals (Sweden)
Gado AM
2013-10-01
Full Text Available Ali M Gado,1 Badr A Aldahmash21Forensic Medicine and Clinical Toxicology Department, College of Medicine, Tanta University, Tanta, Egypt; 2Medical Laboratory Department, College of Health Sciences, King Saud University, Riyadh, Saudi ArabiaAbstract: The effects of Arabic gum (AG against nephrotoxicity of mercury (Hg, an oxidative-stress inducing substance, in rats were investigated. A single dose of mercuric chloride (5 mg/kg intraperitoneal injection induced renal toxicity, manifested biochemically by a significant increase in serum creatinine, blood urea nitrogen, thiobarbituric acid reactive substances, and total nitrate/nitrite production in kidney tissues. In addition, reduced glutathione, glutathione peroxidase, and catalase enzymes in renal tissues were significantly decreased. Pretreatment of rats with AG (7.5 g/kg/day per oral administration, starting 5 days before mercuric chloride injection and continuing through the experimental period, resulted in a complete reversal of Hg-induced increase in creatinine, blood urea nitrogen, thiobarbituric acid reactive substances, and total nitrate/nitrite to control values. Histopathologic examination of kidney tissues confirmed the biochemical data; pretreatment of AG prevented Hg-induced degenerative changes of kidney tissues. These results indicate that AG is an efficient cytoprotective agent against Hg-induced nephrotoxicity by a mechanism related at least in part to its ability to decrease oxidative and nitrosative stress and preserve the activity of antioxidant enzymes in kidney tissues.Keywords: mercury, acacia gum, oxidative stress, lipid per oxidation, kidney toxicity
Thermodynamic properties of molten mixtures of lithium, rubidium, cesium and beryllium chlorides
International Nuclear Information System (INIS)
Zarubitskij, O.G.; Podafa, B.P.; Dubovoj, P.G.
1982-01-01
e. m. f. in binary systems of beryllium chloride with rubidium and cesium chlorides were measured. Concentration dependences of thermodynamic functions (mixing entropy Gibbs free energy) of beryllium chloride in the systems as well as with the participation of lithium chloride were analysed
Muradov, Johongir M.
2013-01-01
Abstract Vasospasm, hemorrhage, and loss of microvessels at the site of contusive or compressive spinal cord injury lead to infarction and initiate secondary degeneration. Here, we used intravenous injection of endothelial-binding lectin followed by histology to show that the number of perfused microvessels at the injury site is decreased by 80–90% as early as 20 min following a moderate T9 contusion in adult female rats. Hemorrhage within the spinal cord also was maximal at 20 min, consistent with its vasoconstrictive actions in the central nervous system (CNS). Microvascular blood flow recovered to up to 50% of normal volume in the injury penumbra by 6 h, but not at the epicenter. A comparison with an endothelial cell marker suggested that many microvessels fail to be reperfused up to 48 h post-injury. The ischemia was probably caused by vasospasm of vessels penetrating the parenchyma, because repeated Doppler measurements over the spinal cord showed a doubling of total blood flow over the first 12 h. Moreover, intravenous infusion of magnesium chloride, used clinically to treat CNS vasospasm, greatly improved the number of perfused microvessels at 24 and 48 h. The magnesium treatment seemed safe as it did not increase hemorrhage, despite the improved parenchymal blood flow. However, the treatment did not reduce acute microvessel, motor neuron or oligodendrocyte loss, and when infused for 7 days did not affect functional recovery or spared epicenter white matter over a 4 week period. These data suggest that microvascular blood flow can be restored with a clinically relevant treatment following spinal cord injury. PMID:23302047
Chloride Transport in Heterogeneous Formation
Mukherjee, A.; Holt, R. M.
2017-12-01
The chloride mass balance (CMB) is a commonly-used method for estimating groundwater recharge. Observations of the vertical distribution of pore-water chloride are related to the groundwater infiltration rates (i.e. recharge rates). In CMB method, the chloride distribution is attributed mainly to the assumption of one dimensional piston flow. In many places, however, the vertical distribution of chloride will be influenced by heterogeneity, leading to horizontal movement of infiltrating waters. The impact of heterogeneity will be particularly important when recharge is locally focused. When recharge is focused in an area, horizontal movement of chloride-bearing waters, coupled with upward movement driven by evapotranspiration, may lead to chloride bulges that could be misinterpreted if the CMB method is used to estimate recharge. We numerically simulate chloride transport and evaluate the validity of the CMB method in highly heterogeneous systems. This simulation is conducted for the unsaturated zone of Ogallala, Antlers, and Gatuna (OAG) formations in Andrews County, Texas. A two dimensional finite element model will show the movement of chloride through heterogeneous systems. We expect to see chloride bulges not only close to the surface but also at depths characterized by horizontal or upward movement. A comparative study of focused recharge estimates in this study with available recharge data will be presented.
Zhong, Sheng; Navaratnam, Dhasakumar; Santos-Sacchi, Joseph
2014-01-01
Chloride is the major anion in cells, with many diseases arising from disordered Cl- regulation. For the non-invasive investigation of Cl- flux, YFP-H148Q and its derivatives chameleon and Cl-Sensor previously were introduced as genetically encoded chloride indicators. Neither the Cl- sensitivity nor the pH-susceptibility of these modifications to YFP is optimal for precise measurements of Cl- under physiological conditions. Furthermore, the relatively poor photostability of YFP derivatives hinders their application for dynamic and quantitative Cl- measurements. Dynamic and accurate measurement of physiological concentrations of chloride would significantly affect our ability to study effects of chloride on cellular events. In this study, we developed a series of YFP derivatives to remove pH interference, increase photostability and enhance chloride sensitivity. The final product, EYFP-F46L/Q69K/H148Q/I152L/V163S/S175G/S205V/A206K (monomeric Cl-YFP), has a chloride Kd of 14 mM and pKa of 5.9. The bleach time constant of 175 seconds is over 15-fold greater than wild-type EYFP. We have used the sensor fused to the transmembrane protein prestin (gerbil prestin, SLC26a5), and shown for the first time physiological (mM) chloride flux in HEK cells expressing this protein. This modified fluorescent protein will facilitate investigations of dynamics of chloride ions and their mediation of cell function. Modifications to YFP (EYFP-F46L/Q69K/H148Q/I152L/V163S/S175G/S205V/A206K (monomeric Cl-YFP) results in a photostable fluorescent protein that allows measurement of physiological changes in chloride concentration while remaining minimally affected by changes in pH.
Directory of Open Access Journals (Sweden)
Sheng Zhong
Full Text Available Chloride is the major anion in cells, with many diseases arising from disordered Cl- regulation. For the non-invasive investigation of Cl- flux, YFP-H148Q and its derivatives chameleon and Cl-Sensor previously were introduced as genetically encoded chloride indicators. Neither the Cl- sensitivity nor the pH-susceptibility of these modifications to YFP is optimal for precise measurements of Cl- under physiological conditions. Furthermore, the relatively poor photostability of YFP derivatives hinders their application for dynamic and quantitative Cl- measurements. Dynamic and accurate measurement of physiological concentrations of chloride would significantly affect our ability to study effects of chloride on cellular events.In this study, we developed a series of YFP derivatives to remove pH interference, increase photostability and enhance chloride sensitivity. The final product, EYFP-F46L/Q69K/H148Q/I152L/V163S/S175G/S205V/A206K (monomeric Cl-YFP, has a chloride Kd of 14 mM and pKa of 5.9. The bleach time constant of 175 seconds is over 15-fold greater than wild-type EYFP. We have used the sensor fused to the transmembrane protein prestin (gerbil prestin, SLC26a5, and shown for the first time physiological (mM chloride flux in HEK cells expressing this protein. This modified fluorescent protein will facilitate investigations of dynamics of chloride ions and their mediation of cell function.Modifications to YFP (EYFP-F46L/Q69K/H148Q/I152L/V163S/S175G/S205V/A206K (monomeric Cl-YFP results in a photostable fluorescent protein that allows measurement of physiological changes in chloride concentration while remaining minimally affected by changes in pH.
Metabolic Imaging of Patients with Prostate Cancer Using Hyperpolarized [1-13C]Pyruvate
Nelson, Sarah J.; Kurhanewicz, John; Vigneron, Daniel B.; Larson, Peder E. Z.; Harzstark, Andrea L.; Ferrone, Marcus; van Criekinge, Mark; Chang, Jose W.; Bok, Robert; Park, Ilwoo; Reed, Galen; Carvajal, Lucas; Small, Eric J.; Munster, Pamela; Weinberg, Vivian K.; Ardenkjaer-Larsen, Jan Henrik; Chen, Albert P.; Hurd, Ralph E.; Odegardstuen, Liv-Ingrid; Robb, Fraser J.; Tropp, James; Murray, Jonathan A.
2014-01-01
This first-in-man imaging study evaluated the safety and feasibility of hyperpolarized [1-13C]pyruvate as an agent for noninvasively characterizing alterations in tumor metabolism for patients with prostate cancer. Imaging living systems with hyperpolarized agents can result in more than 10,000-fold enhancement in signal relative to conventional magnetic resonance (MR) imaging. When combined with the rapid acquisition of in vivo 13C MR data, it is possible to evaluate the distribution of agents such as [1-13C]pyruvate and its metabolic products lactate, alanine, and bicarbonate in a matter of seconds. Preclinical studies in cancer models have detected elevated levels of hyperpolarized [1-13C]lactate in tumor, with the ratio of [1-13C]lactate/[1-13C]pyruvate being increased in high-grade tumors and decreased after successful treatment. Translation of this technology into humans was achieved by modifying the instrument that generates the hyperpolarized agent, constructing specialized radio frequency coils to detect 13C nuclei, and developing new pulse sequences to efficiently capture the signal. The study population comprised patients with biopsy-proven prostate cancer, with 31 subjects being injected with hyperpolarized [1-13C]pyruvate. The median time to deliver the agent was 66 s, and uptake was observed about 20 s after injection. No dose-limiting toxicities were observed, and the highest dose (0.43 ml/kg of 230 mM agent) gave the best signal-to-noise ratio for hyperpolarized [1-13C]pyruvate. The results were extremely promising in not only confirming the safety of the agent but also showing elevated [1-13C]lactate/[1-13C]pyruvate in regions of biopsy-proven cancer. These findings will be valuable for noninvasive cancer diagnosis and treatment monitoring in future clinical trials. PMID:23946197
International Nuclear Information System (INIS)
Ripoll-Hamer, E.; Paula, E.F. de; Bernardo Filho, M.; Freitas, L.C.; Fonseca, L.M.; Gutfilen, B.
1995-01-01
Using an in vitro model, it was evaluated the effect of cyclophosphamide on percent radioactivity of 99m Tc O - 4 and methylene diphosphonic acid ( 99m Tc-MDP) bound to isolated blood elements. Blood samples were incubated with the two radiopharmaceuticals, plasma and blood cells were separated and precipitated, and soluble and insoluble fractions were separated. To evaluate the effect of cyclophosphamide, blood was incubated with this drug 1 h prior to the addition of the radiopharmaceuticals. The fraction of 99m Tc O - 4 radioactivity was slightly higher in plasma (61.2 to 53.8%) than in blood cells (38.8 to 46.2%) up to 6 h. The amount of 99m Tc - MDP radioactivity was higher in plasma (91.1 to 87.2%) than in blood cells (8.9 to 12.8%) up to 24 h. The binding of 99m Tc O - 4 to the insoluble fraction of plasma (4.9 to 6.1%) was low. But a small blockade (9.8 to 4.8%) was observed at 24 h. From 3 h on, cyclophosphamide slightly inhibited 99m Tc O - 4 binding to blood cells (23.1 to 16.6%) and increased it at 24 h (31.2 to 14.3%). The effect of cyclophosphamide was strongest at 24 h, with decreased radioactivity binding to the insoluble fraction of plasma (47.6 to 27.0%) and blood cells (51.2 to 23.2%). The fact that cyclophosphamide can bind to plasma proteins and/or cross the cell membrane explains in part the results obtained. (author). 20 refs., 2 tabs
International Nuclear Information System (INIS)
Jan, S.; Hamayun, M.
2016-01-01
The current work was designed to test the effect of sodium chloride on germination, seedling establishment, vegetative growth, yield, chemical contents and ionic composition of eggplant. The consequences of foliar application of ascorbic acid (AA) on mitigation of adverse effects of sodium chloride were also tested. The seeds of Solanum melongena were germinated using NaCl (60 mM, 100 mM) and ascorbic acid (100 and 200 mM). High levels of salinity significantly affected the seed germination and seedling fresh and dry weights. Plants grown under salinity stress with foliar application of ascorbic acid showed significant increase in germination percentage and seedlings growth as compare to control plants. Sodium chloride stress showed adverse effects on plant height, root length, number of leaves, leaf area, fresh and dry biomass, total chlorophyll, carbohydrates and proteins as compared to untreated plants. The relative water content, electrolyte leakage were increased and Na+ and K+ ions balance was disturbed in different plant parts. Ascorbic acid (100 and 200ppm) enhanced all the growth parameters affected adversely by sodium chloride stress. (author)
Antioxidant Potential of Momordica Charantia in Ammonium Chloride-Induced Hyperammonemic Rats
Directory of Open Access Journals (Sweden)
A. Justin Thenmozhi
2011-01-01
Full Text Available The present study was aimed to investigate the antioxidant potential of Momordica charantia fruit extract (MCE in ammonium chloride-induced (AC hyperammonemic rats. Experimental hyperammonemia was induced in adult male Wistar rats (180–200 g by intraperitoneal injections of ammonium chloride (100 mg kg−1 body weight thrice a week. The effect of oral administration (thrice a week for 8 consecutive weeks of MCE (300 mg kg−1 body weight on blood ammonia, plasma urea, serum liver marker enzymes and oxidative stress biomarkers in normal and experimental animals was analyzed. Hyperammonemic rats showed a significant increase in the activities of thiobarbituric acid reactive substances, hydroperoxides and liver markers (alanine transaminase, aspartate transaminase and alkaline phosphatase, and the levels of glutathione peroxidase, superoxide dismutase, catalase and reduced glutathione were decreased in the liver and brain tissues. Treatment with MCE normalized the above-mentioned changes in hyperammonemic rats by reversing the oxidant-antioxidant imbalance during AC-induced hyperammonemia, and offered protection against hyperammonemia. Our results indicate that MCE exerting the antioxidant potentials and maintaining the cellular integrity of the liver tissue could offer protection against AC-induced hyperammonemia. However, the exact underlying mechanism is yet to be investigated, and examination of the efficacy of the active constituents of the M. charantia on hyperammonemia is desirable.
2010-07-01
... 32 National Defense 5 2010-07-01 2010-07-01 false Application. 724.113 Section 724.113 National... Definitions § 724.113 Application. In the context of this Manual, a written application to the NDRB for the... must be used for the application. ...
46 CFR 151.50-34 - Vinyl chloride (vinyl chloride monomer).
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Vinyl chloride (vinyl chloride monomer). 151.50-34... chloride (vinyl chloride monomer). (a) Copper, aluminum, magnesium, mercury, silver, and their alloys shall... equipment that may come in contact with vinyl chloride liquid or vapor. (b) Valves, flanges, and pipe...
Zhong, Sheng; Navaratnam, Dhasakumar; Santos-Sacchi, Joseph
2014-01-01
Background Chloride is the major anion in cells, with many diseases arising from disordered Cl− regulation. For the non-invasive investigation of Cl− flux, YFP-H148Q and its derivatives chameleon and Cl-Sensor previously were introduced as genetically encoded chloride indicators. Neither the Cl− sensitivity nor the pH-susceptibility of these modifications to YFP is optimal for precise measurements of Cl− under physiological conditions. Furthermore, the relatively poor photostability of YFP derivatives hinders their application for dynamic and quantitative Cl− measurements. Dynamic and accurate measurement of physiological concentrations of chloride would significantly affect our ability to study effects of chloride on cellular events. Methodology/Principal Findings In this study, we developed a series of YFP derivatives to remove pH interference, increase photostability and enhance chloride sensitivity. The final product, EYFP-F46L/Q69K/H148Q/I152L/V163S/S175G/S205V/A206K (monomeric Cl-YFP), has a chloride Kd of 14 mM and pKa of 5.9. The bleach time constant of 175 seconds is over 15-fold greater than wild-type EYFP. We have used the sensor fused to the transmembrane protein prestin (gerbil prestin, SLC26a5), and shown for the first time physiological (mM) chloride flux in HEK cells expressing this protein. This modified fluorescent protein will facilitate investigations of dynamics of chloride ions and their mediation of cell function. Conclusions Modifications to YFP (EYFP-F46L/Q69K/H148Q/I152L/V163S/S175G/S205V/A206K (monomeric Cl-YFP) results in a photostable fluorescent protein that allows measurement of physiological changes in chloride concentration while remaining minimally affected by changes in pH. PMID:24901231
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Containers. 113.60 Section 113.60 Food and Drugs... CONSUMPTION THERMALLY PROCESSED LOW-ACID FOODS PACKAGED IN HERMETICALLY SEALED CONTAINERS Control of Components, Food Product Containers, Closures, and In-Process Materials § 113.60 Containers. (a) Closures...
Chloride is essential for contraction of afferent arterioles after agonists and potassium
DEFF Research Database (Denmark)
Jensen, B L; Ellekvist, Peter; Skøtt, O
1997-01-01
to norepinephrine, angiotensin II (ANG II), and potassium were measured after chloride depletion and compared with controls. Chloride depletion did not change arteriolar diameters, but the response to norepinephrine was markedly reduced when chloride was substituted with gluconate (n = 6) or isethionate (n = 6......). Reintroduction of chloride fully restored the sensitivity to norepinephrine. Contractions after ANG II and potassium were totally abolished in the absence of chloride (n = 6). In additional experiments (n = 7), the arteriolar contraction to 100 mM potassium was abolished only 1 min after removal of extracellular......A depolarizing chloride efflux has been suggested to activate voltage-dependent calcium channels in renal afferent arteriolar smooth muscle cells in response to vasoconstrictors. To test this proposal, rabbit afferent arterioles were microperfused, and the contractile dose responses...
Effects of haemodialysis on taste for salt in relation to changes in blood constituents.
Farleigh, C A; Shepherd, R; Jevons, S; Pryor, J S
1987-11-01
Taste sensitivity and preference for sodium chloride in bread and pea soup were assessed before and after haemodialysis in 12 female chronic renal failure patients. Blood samples were also taken pre- and post-dialysis and analysed for zinc, sodium and renin. The patients demonstrated an increased sensitivity to, and decreased preference for, sodium chloride in both bread and pea soup following dialysis. These taste changes were found to correlate with pre- to post-dialysis changes in the zinc levels in the blood. Patients receiving a more severely sodium-restricted diet showed a greater sensitivity to the taste of sodium chloride in the foods tested. Renin levels dropped in all patients following dialysis, the size of the change correlating with the size of the change in body weight.
International Nuclear Information System (INIS)
Kim, Hong Jae
1976-06-01
This book contains polyvinyl chloride resin industry with present condition such as plastic industry and polyvinyl chloride in the world and Japan, manufacture of polyvinyl chloride resin ; suspension polymerization and solution polymerization, extruding, injection process, hollow molding vinyl record, vacuum forming, polymer powders process, vinyl chloride varnish, vinyl chloride latex, safety and construction on vinyl chloride. Each chapter has descriptions on of process and kinds of polyvinyl chloride resin.
Influence of Chloride-Ion Adsorption Agent on Chloride Ions in Concrete and Mortar
Directory of Open Access Journals (Sweden)
Gai-Fei Peng
2014-04-01
Full Text Available The influence of a chloride-ion adsorption agent (Cl agent in short, composed of zeolite, calcium aluminate hydrate and calcium nitrite, on the ingress of chloride ions into concrete and mortar has been experimentally studied. The permeability of concrete was measured, and the chloride ion content in mortar was tested. The experimental results reveal that the Cl agent could adsorb chloride ions effectively, which had penetrated into concrete and mortar. When the Cl agent was used at a dosage of 6% by mass of cementitious materials in mortar, the resistance to the penetration of chloride ions could be improved greatly, which was more pronounced when a combination of the Cl agent and fly ash or slag was employed. Such an effect is not the result of the low permeability of the mortar, but might be a result of the interaction between the Cl agent and the chloride ions penetrated into the mortar. There are two possible mechanisms for the interaction between the Cl agent and chloride ion ingress. One is the reaction between calcium aluminate hydrate in the Cl agent and chloride ions to form Friedel’s salt, and the other one is that calcium aluminate hydrate reacts with calcium nitrite to form AFm during the early-age hydration of mortar and later the NO2− in AFm is replaced by chloride ions, which then penetrate into the mortar, also forming Friedel’s salt. More research is needed to confirm the mechanisms.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Employment. 113.500 Section 113... Discrimination on the Basis of Sex in Employment in Education Programs Or Activities Prohibited § 113.500 Employment. (a) General. (1) No person shall, on the basis of sex, be excluded from participation in, be...
Akinrinde, A S; Oyagbemi, A A; Omobowale, T O; Asenuga, E R; Ajibade, T O
2016-07-01
The protective abilities of the chloroform extract of Ocimum gratissimum (COG) and gallic acid against cobalt chloride (CoCl2) - induced cardiac and renal toxicity were evaluated. Rats were exposed to CoCl2 (350ppm) for 7 days, either alone, or in combination with COG (100 and 200mg/kg) or gallic acid (120mg/kg). CoCl2 given alone, caused significant increases (pgallic acid treatment significantly reduced (pgallic acid by modulation of CoCl2-induced alterations in blood pressure, antioxidant status and pro-apoptotic caspase 8 in Wistar rats. Copyright © 2016 Elsevier GmbH. All rights reserved.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Housing. 113.405 Section 113.405... Discrimination on the Basis of Sex in Education Programs Or Activities Prohibited § 113.405 Housing. (a... different fees or requirements, or offer different services or benefits related to housing, except as...
International Nuclear Information System (INIS)
Wan Anuar Wan Awang; Zulkifli Mohd Hashim; Saaban Kassim
2004-01-01
We report on the performance test of column 99m Tc generator utilizing poly zirconium chloride as an adsorbent. Natural molybdenum trioxide was irradiated for 2 hrs at a neutron flux of about 1.5 x 10 12 n/cm 2 /s. A total fourteen generators have been prepared from the experiments. Yield of 99m Tc has been 60-93% and measured 99 Mo content in eluates is 0.20-0.44 %. The adsorption efficiency of 99 Mo on PZC column is between 85 - 92 %. The flow rates from the elution are relatively very poor and take about 5 minutes to finish the elution of 1 ml saline. (author)
Can mHealth improve access to safe blood for transfusion during obstetric emergency?
Directory of Open Access Journals (Sweden)
Rahman A
2017-04-01
introduction of BIMA, the median duration between the identified need for blood and blood transfusion reduced from 152 to 122 minutes (P<0.05. For PPH specifically, the reduction was from 175 to 113 minutes (P<0.05. After introducing BIMA and after adjusting for criteria such as maternal age, education, parity, duty roster of providers, and reasons for blood transfusion, a 24 minute reduction in the time was observed between the identified need for blood and transfusion (P<0.001.Conclusion: BIMA was effective in reducing delays in blood transfusion for emergency obstetric patients. This pilot study suggests that implementing BIMA is one mechanism that has the potential to streamline blood transfusion systems in Bangladesh. Keywords: blood transfusion, online application, postpartum hemorrhage, mhealth, Bangladesh
Stadler, Susanne; Osenbruck, Karsten; Duijnisveld, Wilhelmus H M; Schwiede, Martin; Bottcher, Jurgen
2010-09-01
In the framework of the investigation of enrichment processes of nitrate in groundwater of the Kalahari of Botswana near Serowe, recharge processes were investigated. The thick unsaturated zone extending to up to 100 m of mostly unconsolidated sediments and very low recharge rates pose a serious challenge to study solute transport related to infiltration and recharge processes, as this extends past the conventional depths of soil scientific investigations and is difficult to describe using evidence from the groundwater due to the limitations imposed by available tracers. To determine the link between nitrate in the vadose zone and in the uppermost groundwater, sediment from the vadose zone was sampled up to a depth of 15-20 m (in one case also to 65 m) on several sites with natural vegetation in the research area. Among other parameters, sediment and water were analysed to determine chloride and nitrate concentration depth profiles. Using the chloride mass balance method, an estimation of groundwater infiltration rates produced values of 0.2-4 mm a(-1). The uncertainty of these values is, however, high. Because of the extreme thickness of the vadose zone, the travel time in the unsaturated zone might reach extreme values of up to 500 years and more. For investigations using groundwater, we applied the chlorofluorocarbons CFC-113, CFC-12, sulphur hexafluoride (SF(6)) and tritium to identify potential recharge, and found indications for some advective transport of the CFCs and SF(6), which we accounted for as constituting potential active localised recharge. In our contribution, we show the potential and limitations of the applied methods to determine groundwater recharge and coupled solute transport in semi-arid settings, and compare travel time ranges derived from soil science and groundwater investigations.
International Nuclear Information System (INIS)
Anderson, R.J.; Cambria, R.A.; Dikdan, G.; Lysz, T.W.; Hobson, R.W. II
1990-01-01
Limiting the rate of reperfusion blood flow has been shown to be beneficial locally in models of ischemia-reperfusion injury. We investigated the effects of this on eicosanoids (thromboxane B2, 6-keto-PGF1 alpha, and leukotriene B4), white blood cell activation, and skeletal muscle injury as quantitated by triphenyltetrazolium chloride and technetium-99m pyrophosphate after ischemia-reperfusion injury in an isolated gracilis muscle model in 16 anesthetized dogs. One gracilis muscle in each dog was subjected to 6 hours of ischemia followed by 1 hour of limited reperfusion and then by a second hour of normal reperfusion. The other muscle was subjected to 6 hours of ischemia followed by 2 hours of normal reperfusion. Six dogs each were used as normal reperfusion controls (NR) and limited reperfusion controls (LR), with 5 dogs being treated with a thromboxane synthetase inhibitor (LR/TSI) and another five with a leukotriene inhibitor (LR/LI). LR in all three groups (LR, LR/TSI, and LR/LI) showed a benefit in skeletal muscle injury as measured by triphenyltetrazolim chloride and technetium-99m pyrophosphate when compared with NR. However, there was no significant difference between the groups with LR regarding eicosanoid levels and white blood cell activation when compared with NR. These results demonstrate that LR produces benefits by mechanisms other than those dependent upon thromboxane A2, prostacyclin, or white blood cell activation
Chloride Ingress in Chemically Activated Calcined Clay-Based Cement
Directory of Open Access Journals (Sweden)
Joseph Mwiti Marangu
2018-01-01
Full Text Available Chloride-laden environments pose serious durability concerns in cement based materials. This paper presents the findings of chloride ingress in chemically activated calcined Clay-Ordinary Portland Cement blended mortars. Results are also presented for compressive strength development and porosity tests. Sampled clays were incinerated at a temperature of 800°C for 4 hours. The resultant calcined clay was blended with Ordinary Portland Cement (OPC at replacement level of 35% by mass of OPC to make test cement labeled PCC35. Mortar prisms measuring 40 mm × 40 mm × 160 mm were cast using PCC35 with 0.5 M Na2SO4 solution as a chemical activator instead of water. Compressive strength was determined at 28th day of curing. As a control, OPC, Portland Pozzolana Cement (PPC, and PCC35 were similarly investigated without use of activator. After the 28th day of curing, mortar specimens were subjected to accelerated chloride ingress, porosity, compressive strength tests, and chloride profiling. Subsequently, apparent diffusion coefficients (Dapp were estimated from solutions to Fick’s second law of diffusion. Compressive strength increased after exposure to the chloride rich media in all cement categories. Chemically activated PCC35 exhibited higher compressive strength compared to nonactivated PCC35. However, chemically activated PCC35 had the least gain in compressive strength, lower porosity, and lower chloride ingress in terms of Dapp, compared to OPC, PPC, and nonactivated PCC35.
Incoloy 800 anodic behavior in sulfate and chloride solutions at high temperature
International Nuclear Information System (INIS)
Lafont, C.; Alvarez, M.G.
1992-01-01
The anodic behavior and pitting corrosion resistance of Incoloy 800 in concentrated aqueous chloride and sulphate solutions has been studied by means of electrochemical techniques. The effect of different environmental variables, such as temperature (in the 100 0 C to 280 0 C range) and sulphate ion concentration (0.02 M to 2 M), was evaluated. In another set of experiments, the influence of sulphate ions additions on the pitting resistance and pitting morphology of Incoloy 800 in chloride solutions at high temperature was also examined. (author)
Quantitation of cerebral blood volume by 99mTc-DTPA-HSA SPECT
International Nuclear Information System (INIS)
Inoue, Yusuke; Machida, Kikuo; Momose, Toshimitsu
1992-01-01
The characteristics of technetium-99m diethylenetriaminepentaacetic acid human serum albumin ( 99m Tc-DTPA-HSA) as an agent for quantitation of cerebral blood volume (CBV) were examined. The radioactivity after decay correction as a percentage of the activity at 10 minutes was 84.3±1.3% at 120 minutes after the injection of 99m Tc-DTPA-HSA. Radioactivity was found exclusively in plasma, with little in blood cells. The blood retention of 99m Tc-DTPA-HSA is sufficient, and its use in the quantitation of CBV omits the need for centrifugation of the blood sample. CBV quantified using the tracer and a SPECT system with a single-head rotating gamma camera was 4.09±0.60 ml/100g brain, similar to values reported previously. Two serial SPECT scans provided similar images, and the CBV values determined by the two scans were closely correlated (p 99m Tc-DTPA-HSA has useful properties for quantitative CBV measurement and that quantitation of CBV by 99m Tc-DTPA-HSA SPECT is feasible using a system with a single-head rotating gamma camera. (author)
Evaluation of hepatic hemangioma by Tc-99 m red blood cell hepatic blood pool scan
International Nuclear Information System (INIS)
Sohn, Myung Hee
2005-01-01
Hemangioma is the most common benign tumor of the liver, with a prevalence estimated as high as 7%. Tc-99m red blood cell (RBC) hepatic blood pool scan with single photon emission computed tomography (SPECT) imaging is extremely useful for the confirmation or exclusion of hepatic hemangiomas. The classic finding of absent or decreased perfusion and increased blood pooling ('perfusion/blood pool mismatch') is the key diagnostic element in the diagnosis of hemangiomas. The combination of early arterial flow and delayed blood pooling ('perfusion/blood pool match') is shown uncommonly. In giant hemangioma, filling with radioactivity appears first in the periphery, with progressive central fill-in on sequential RBC blood pool scan. However, the reverse filling pattern, which begins first in the center with progressive peripheral filling, is also rarely seen. Studies with false-positive blood pooling have been reported infrequently in nonhemangiomas, including hemangiosarcoma, hepatocellular carcinoma, hepatic adenoma, and metastatic carcinomas (adenocarcinma of the colon, small cell carcinoma of the lung, neruroendocrine carcinoma). False-negative results have been also reported rarely except for small hemagniomas that are below the limits of spatial resolution of gamma camera
Beaudry, Francis; Guénette, Sarah Annie; Winterborn, Andrew; Marier, Jean-Francois; Vachon, Pascal
2005-09-15
A rapid, selective and sensitive method was developed for the determination of propofol concentration using an off-line dansyl chloride derivatization step to enhance signal intensity. The method consisted of a protein precipitation extraction followed by derivatization with dansyl chloride and analysis by liquid chromatography ionspray tandem mass spectrometry (LC-ESI/MS/MS). The separation was achieved using a 100 mm x 2 mm C8 analytical column combined with an isocratic mobile phase composed of 80:20 acetonitrile: 0.5% formic acid in water. Signal intensity of the propofol-dansyl chloride derivative was increased up to 200-fold as compared to the underivatized propofol in positive electrospray mode. An analytical range of 20-20,000 ng/mL was used in the calibration curve of plasma and blood samples. The novel method met all requirements of specificity, sensitivity, linearity, precision, accuracy and stability. A pharmacokinetic study was performed in rats and the novel analytical method was used as a routine analysis to provide enhanced measurements of plasma and blood concentrations of propofol. Blood and plasma pharmacokinetic results show that a very important fraction of propofol distributes into red blood cells. In conclusion, a rapid and sensitive LC-ESI/MS/MS method using a derivatization agent was developed to enhance signal intensity of propofol. Routine analysis with the novel method provided accurate results and enhanced the detection levels of plasma and blood concentrations of propofol to better characterize the in vivo biodisposition of propofol.
Reaction of calcium chloride with alkali metal chlorides in melts
International Nuclear Information System (INIS)
Savin, V.D.; Mikhajlova, N.P.
1984-01-01
Thermochemical characteristics of CaCl 2 reaction with sodium, potassium, rubidium and cesium chlorides in melts at 890 deg C are determined. The values of formation enthalpies of infinitely diluted by CaCl 2 solutions (ΔH) in the chloride row increase from -22 in NaCl to -47 kJ/mol of CaCl 2 in CsCl. With increasing the concentration of calcium chloride in the solution the ΔH values decrease. The regularities of separation from the solution of the CaCl 2 -CsCl system at 890 deg C of the CaCl 2 x CsCl in solid are studied. Formation enthalpies under the given conditions constitutes -70+-3 kJ/mol
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Marketing. 1220.113 Section 1220.113 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS... CONSUMER INFORMATION Soybean Promotion and Research Order Definitions § 1220.113 Marketing. The term...
Cadmium in blood and hypertension
Energy Technology Data Exchange (ETDEWEB)
Eum, Ki-Do; Lee, Mi-Sun [Department of Environmental Health, Graduate School of Public Health and Institute of Health and Environment, Seoul National University, Seoul (Korea, Republic of); Paek, Domyung [Department of Environmental Health, Graduate School of Public Health and Institute of Health and Environment, Seoul National University, Seoul (Korea, Republic of)], E-mail: paekdm@snu.ac.kr
2008-12-15
Objectives:: This study is to examine the effect of cadmium exposure on blood pressure in Korean general population. Methods:: The study population consisted of 958 men and 944 women who participated in the 2005 Korean National Health and Nutrition Examination Survey (KNHANES), in which blood pressure and blood cadmium were measured from each participant. Results:: The mean blood cadmium level was 1.67 {mu}g/L (median level 1.55). The prevalence of hypertension was 26.2%. The blood cadmium level was significantly higher among those subjects with hypertension than those without (mean level 1.77 versus 1.64 {mu}g/dL). After adjusting for covariates, the odds ratio of hypertension comparing the highest to the lowest tertile of cadmium in blood was 1.51 (95% confidence interval 1.13 to 2.05), and a dose-response relationship was observed. Systolic, diastolic, and mean arterial blood pressure were all positively associated with blood cadmium level, and this effect of cadmium on blood pressure was markedly stronger when the kidney function was reduced. Conclusions:: Cadmium exposures at the current level may have increased the blood pressure of Korean general population.
Cadmium in blood and hypertension
International Nuclear Information System (INIS)
Eum, Ki-Do; Lee, Mi-Sun; Paek, Domyung
2008-01-01
Objectives:: This study is to examine the effect of cadmium exposure on blood pressure in Korean general population. Methods:: The study population consisted of 958 men and 944 women who participated in the 2005 Korean National Health and Nutrition Examination Survey (KNHANES), in which blood pressure and blood cadmium were measured from each participant. Results:: The mean blood cadmium level was 1.67 μg/L (median level 1.55). The prevalence of hypertension was 26.2%. The blood cadmium level was significantly higher among those subjects with hypertension than those without (mean level 1.77 versus 1.64 μg/dL). After adjusting for covariates, the odds ratio of hypertension comparing the highest to the lowest tertile of cadmium in blood was 1.51 (95% confidence interval 1.13 to 2.05), and a dose-response relationship was observed. Systolic, diastolic, and mean arterial blood pressure were all positively associated with blood cadmium level, and this effect of cadmium on blood pressure was markedly stronger when the kidney function was reduced. Conclusions:: Cadmium exposures at the current level may have increased the blood pressure of Korean general population
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Publications. 66.113 Section 66.113 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES FELLOWSHIPS, INTERNSHIPS, TRAINING NATIONAL RESEARCH SERVICE AWARDS Direct Awards § 66.113 Publications. Publication, distribution, and...
Prasad, K J; Oberoi, J K; Goel, N; Wattal, C
2015-01-01
Enteric fever is a major public health problem in developing countries like India. An early and accurate diagnosis is necessary for a prompt and effective treatment. We have evaluated the diagnostic accuracy of two Rapid Salmonella-IgM tests (Typhidot-IgM and Enteroscreen-IgM) as compared to blood culture in rapid and early diagnosis of enteric fever. A total of 2,699 patients' serum samples were tested by Rapid Salmonella-IgM tests and blood culture. Patients were divided into two groups. Test group - patients with enteric fever and blood culture positives for Salmonella Typhi; and three types of Controls, i.e. patients with non-enteric fever illnesses, normal healthy controls and patients positive for S. Paratyphi- A. In addition to this we have also evaluated the significance of positive Salmonella-IgM tests among blood culture-negative cases. The overall sensitivity, specificity, positive predictive value (PPV) and negative predictive value (NPV) of the Typhidot-IgM test and Enteroscreen-IgM test considering blood culture as gold standard were 97.29% and 88.13%, 97.40% and 87.83%, 98.18% and 92.03%, 96.15% and 82.27%, respectively. Typhidot-IgM test was found to be significantly more sensitive and specific as compared to Enteroscreen-IgM. Among blood culture-negative patients, Rapid Salmonella-IgM tests detected 72.25% additional cases of enteric fever. Although the Rapid Salmonella-IgM tests are meant to diagnose S. Typhi only, but these tests detect S. Paratyphi- A also. Thirty-eight patients who were blood culture-positive for S. Paratyphi- A were also positive by Rapid Salmonella-IgM tests. Rapid Salmonella-IgM tests offer an advantage of increased sensitivity, rapidity, early diagnosis and simplicity over blood culture.
Effects of neutron irradiation on red blood cell labeling with technetium-99m
International Nuclear Information System (INIS)
Eng, R.R.; Conklin, J.J.; Grissom, M.P.
1982-01-01
The effects of in vivo and in vitro neutron irradiation on red blood cell radiolabeling with technetium-99m (Tc-99m) were studied. Blood from three dogs was irradiated with neutrons (725 rads, free in air dose) followed by radiolabeling with Tc-99m. The three dogs were subsequently whole body, neutron irradiated (250 rads, midline dose); and blood samples were drawn for radiolabeling at 24, 48, 72 and 96 hours post-irradiation. Blood from three control dogs was also drawn and radiolabeled on each day for comparison. The results show that there were no significant differences between the radiolabeling capacities of in vivo or in vitro neutron irradiated and control RBCs
Directory of Open Access Journals (Sweden)
H. Guan
2010-05-01
Full Text Available Chloride is commonly used as an environmental tracer for studying water flow and solute transport in the environment. It is especially useful for estimating groundwater recharge based on the commonly used chloride mass balance (CMB method. Strong spatial variability in chloride deposition in coastal areas is one difficulty encountered in appropriately applying the method. A high-resolution bulk chloride deposition map in the coastal region is thus needed. The aim of this study is to construct a chloride deposition map in the Mount Lofty Ranges (MLR, a coastal hilly area of approximately 9000 km2 spatial extent in South Australia. We examined geographic (related to coastal distance, orographic, and atmospheric factors that may influence chloride deposition, using partial correlation and regression analyses. The results indicate that coastal distance, elevation, as well as terrain aspect and slope, appear to be significant factors controlling chloride deposition in the study area. Coastal distance accounts for 70% of spatial variability in bulk chloride deposition, with elevation, terrain aspect and slope an additional 15%. The results are incorporated into a de-trended residual kriging model (ASOADeK to produce a 1 km×1 km resolution bulk chloride deposition and concentration maps. The average uncertainty of the deposition map is about 20–30% in the western MLR, and 40–50% in the eastern MLR. The maps will form a useful basis for examining catchment chloride balance for the CMB application in the study area.
Beaudry, Francis; Guénette, Sarah Annie; Vachon, Pascal
2006-11-01
A rapid, selective and sensitive method was developed for the determination of eugenol concentration using an off-line dansyl chloride derivatization step to enhance signal intensity. The method consisted of a protein precipitation extraction followed by derivatization with dansyl chloride and analysis by full scan liquid chromatography electrospray quadrupole ion trap mass spectrometry (LC-ESI-QIT). The separation was achieved using a 100 x 2 mm C(8) analytical column combined with an isocratic mobile phase composed of 75:25 acetonitrile: 0.1% formic acid in water set at a flow rate of 0.25 mL/min. Signal intensity of the eugenol-dansyl chloride derivative was increased up to 100-fold as compared with the underivatized eugenol in positive electrospray mode. An analytical range of 100-20,000 ng/mL was used in the calibration curve of plasma and blood samples. The LOD observed was 0.5 pg injected on column. The novel method met all requirements of specificity, sensitivity, linearity, precision, accuracy and stability. In conclusion, a rapid and sensitive LC-ESI/MS/MS method using a derivatization agent was developed to enhance signal intensity of eugenol. Copyright (c) 2006 John Wiley & Sons, Ltd.
2010-07-01
... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Counseling. 551.113 Section 551.113... Pretrial Inmates § 551.113 Counseling. (a) When consistent with institution security and good order, pretrial inmates may be allowed the opportunity to receive counseling services with convicted inmates. (b...
Go, Maybelle K; Malabanan, M Merced; Amyes, Tina L; Richard, John P
2010-09-07
Bovine serum albumin (BSA) in D(2)O at 25 degrees C and pD 7.0 was found to catalyze the deuterium exchange reactions of [1-(13)C]glycolaldehyde ([1-(13)C]GA) to form [1-(13)C,2-(2)H]GA and [1-(13)C,2,2-di-(2)H]GA. The formation of [1-(13)C,2-(2)H]GA and [1-(13)C,2,2-di-(2)H]GA in a total yield of 51 +/- 3% was observed at early reaction times, and at later times, [1-(13)C,2-(2)H]GA was found to undergo BSA-catalyzed conversion to [1-(13)C,2,2-di-(2)H]GA. The overall second-order rate constant for these deuterium exchange reactions [(k(E))(P)] equals 0.25 M(-1) s(-1). By comparison, (k(E))(P) values of 0.04 M(-1) s(-1) [Go, M. K., Amyes, T. L., and Richard, J. P. (2009) Biochemistry 48, 5769-5778] and 0.06 M(-1) s(-1) [Go, M. K., Koudelka, A., Amyes, T. L., and Richard, J. P. (2010) Biochemistry 49, 5377-5389] have been determined for the wild-type- and K12G mutant TIM-catalyzed deuterium exchange reactions of [1-(13)C]GA, respectively, to form [1-(13)C,2,2-di-(2)H]GA. These data show that TIM and BSA exhibit a modest catalytic activity toward deprotonation of the alpha-hydroxy alpha-carbonyl carbon. We suggest that this activity is intrinsic to many globular proteins, and that it must be enhanced to demonstrate meaningful de novo design of protein catalysts of proton transfer at alpha-carbonyl carbon.
Radiochemical determination of methylmercury chloride Part 1
International Nuclear Information System (INIS)
Stary, J.; Prasilova, J.
1976-01-01
The isotope exchange between methylmercury species and an excess of inorganic radiomercury in sulphuric acid medium has been used for the simple determination of methylmercury chloride down to 0.01 ppm. The determination is not influenced by the presence of a great excess of other metals, however, chlorides, bromides and iodides interfere in higher concentrations. It has been found that the isotope exchange between CH 3 HgCl and 203 HgCl 4 2- (or 203 HgCl 2 ) in 0.01-3M hydrochloric acid is extremely slow, for the bimolecular reaction the rate constant is lower than 10 -3 mol -1 s -1 at 25 deg C. The isotope exchange rate between methylmercury chloride and mercuric-nitrate 0n on 0.5M sulphuric acid is higher. The isotope exchange is a bimolecular reaction with a rate constant k=0.050+-0.004 mol -1 s -1 at 25 deg C. (T.I.)
International Nuclear Information System (INIS)
Rosenspire, K.C.; Rumsey, W.L.; Jurisson, S.; Hirth, W.; Narra, R.K.
1993-01-01
Studies were performed in vitro and in vivo to evaluate the binding properties and metabolism of [ 99m Tc]Cl(CDO) 3 BMe (Teboroxime) and [ 99m Tc]Cl(DMG) 3 B2MP in blood and target issues of rats. Both radiopharmaceuticals displayed rapid binding (within 1-3 min) with high affinity to plasma proteins and blood cells. The amounts of radioactivity associated with blood components became progressively greater with time of exposure to either compound. There was a higher proportion of the radiopharmaceuticals associated with blood components during in vivo conditions, likely due, at least in part, to clearance of the free fraction from the plasma pool. Exposure of both compounds to blood results in axial ligand exchange of the chloro atom to a hydroxyl. The results suggest that it is the free species that is extracted primarily by tissues. (Author)
International Nuclear Information System (INIS)
Rosenspire, K.C.; Rumsey, W.L.; Jurisson, S.; Hirth, W.; Narra, R.K.
1993-01-01
Studies were performed in vitro and in vivo to evaluate the binding properties and metabolism of [ 99m Tc]Cl(CDO) 3 BMe (Teboroxime) and [ 99m Tc]Cl(DMG) 3 B2MP in blood and target tissues of rats. Both radiopharmaceuticals displayed rapid binding (within 1-3 min) with high affinity to plasma proteins and blood cells. The amounts of radioactivity associated with blood components became progressively greater with time of exposure to either compound. There was a higher proportion of the radiopharmaceuticals associated with blood components during in vivo conditions, likely due, at least in part, to clearance of the free fraction from the plasma pool. Exposure of both compounds to blood results in axial ligand exchange of the chloro atom to a hydroxyl. The results suggest that it is the free species that is extracted primarily by tissues. (author)
Chloride absorption by root, leaf and floral tissues of Petunia
International Nuclear Information System (INIS)
Jooste, J.H.
1980-01-01
Chloride absorption by root, leaf and floral tissues of Petunia was compared at two temperatures (30 and 2 degrees Celcius), employing different absorption periods, and in the presence and absence of a desorption treatment. All treatments revealed highest absorption by floral tissue. This was further confirmed by the absorption of chloride by the various tissues from solutions in the low (0-1 mM) and high (1-50 mM) concentration ranges. The results offer a possible explanation for the observed effects of organic and inorganic solutes on the longevity of cut flowers [af
Similarities and differences of alkali metal chlorides applied in organic light-emitting diodes
International Nuclear Information System (INIS)
Lü, Zhaoyue; Deng, Zhenbo; Hou, Ying; Xu, Haisheng
2012-01-01
The similarities and differences of alkali metal chlorides (sodium chloride (NaCl), potassium chloride (KCl), rubidium chloride (RbCl) and cesium chloride (CsCl)) applied in organic light-emitting diodes (OLEDs) are investigated. The behavior is similar for the OLEDs with these four chlorides as electron injection layer (EIL). Their maximum luminance and efficiency at 100 mA/cm 2 are within the ranges of 18 550 ± 600 (cd/m 2 ) with an error of 3.23% and 4.09 ± 0.15 (cd/A) within an error of 3.67%, respectively. The similar performance is due to almost identical electron injection barrier for NaCl, KCl, RbCl and CsCl as EIL. Interestingly, the properties are different for devices with chlorides inserted inside tris (8-hydroxyquinoline) aluminum at the position of 20 nm away from aluminum cathode, labeled as NaCl-, KCl-, RbCl- and CsCl- devices. The relation of luminance is CsCl- > RbCl- = KCl- > NaCl-, where “>” and “=” mean “better than” and “the same as”, respectively. And the device efficiencies are decreased from CsCl to NaCl. That is, the sort order of the efficiencies is CsCl- > RbCl- > KCl- > NaCl-. The mechanism is explained by tunneling model in terms of various energy gaps estimated by optical electronegativity of NaCl, KCl, RbCl and CsCl. - Highlights: ► Effects of NaCl, KCl, RbCl and CsCl in organic light-emitting diodes are compared. ► The similar performance is due to almost identical electron injection barrier. ► The different behavior of chlorides inside Alq 3 is explained by tunneling model. ► The different behavior is attributed to various energy gaps of different chlorides. ► The efficiency of device with chlorides inside Alq 3 is decreased from CsCl to NaCl.
Yates, Christopher J.; Masuyer, Geoffrey; Schwager, Sylva L. U.; Akif, Mohd; Sturrock, Edward D.; Acharya, K. Ravi
2014-01-01
Somatic angiotensin-converting enzyme (sACE), a key regulator of blood pressure and electrolyte fluid homeostasis, cleaves the vasoactive angiotensin-I, bradykinin, and a number of other physiologically relevant peptides. sACE consists of two homologous and catalytically active N- and C-domains, which display marked differences in substrate specificities and chloride activation. A series of single substitution mutants were generated and evaluated under varying chloride concentrations using isothermal titration calorimetry. The x-ray crystal structures of the mutants provided details on the chloride-dependent interactions with ACE. Chloride binding in the chloride 1 pocket of C-domain ACE was found to affect positioning of residues from the active site. Analysis of the chloride 2 pocket R522Q and R522K mutations revealed the key interactions with the catalytic site that are stabilized via chloride coordination of Arg522. Substrate interactions in the S2 subsite were shown to affect chloride affinity in the chloride 2 pocket. The Glu403-Lys118 salt bridge in C-domain ACE was shown to stabilize the hinge-bending region and reduce chloride affinity by constraining the chloride 2 pocket. This work demonstrated that substrate composition to the C-terminal side of the scissile bond as well as interactions of larger substrates in the S2 subsite moderate chloride affinity in the chloride 2 pocket of the ACE C-domain, providing a rationale for the substrate-selective nature of chloride dependence in ACE and how this varies between the N- and C-domains. PMID:24297181
Chloride channels regulate chondrogenesis in chicken mandibular mesenchymal cells.
Tian, Meiyu; Duan, Yinzhong; Duan, Xiaohong
2010-12-01
Voltage gated chloride channels (ClCs) play an important role in the regulation of intracellular pH and cell volume homeostasis. Mutations of these genes result in genetic diseases with abnormal bone deformation and body size, indicating that ClCs may have a role in chondrogenesis. In the present study, we isolated chicken mandibular mesenchymal cells (CMMC) from Hamburg-Hamilton (HH) stage 26 chick embryos and induced chondrocyte maturation by using ascorbic acid and β-glycerophosphate (AA-BGP). We also determined the effect of the chloride channel inhibitor NPPB [5-nitro-2-(3-phenylpropylamino) benzoic acid] on regulation of growth, differentiation, and gene expression in these cells using MTT and real-time PCR assays. We found that CLCN1 and CLCN3-7 mRNA were expressed in CMMC and NPPB reduced expression of CLCN3, CLCN5, and CLCN7 mRNA in these cells. At the same time, NPPB inhibited the growth of the CMMC, but had no effect on the mRNA level of cyclin D1 and cyclin E (P>0.05) with/without AA-BGP treatment. AA-BGP increased markers for early chondrocyte differentiation including type II collagen, aggrecan (Ptype X collagen. NPPB antagonized AA-BGP-induced expression of type II collagen and aggrecan (Ptype X collagen (PType X collagen might function as a target of chloride channel inhibitors during the differentiation process. Copyright © 2010 Elsevier Ltd. All rights reserved.
Bone marrow scintigraphy with /sup 111/In-chloride. A clinical value for the hematological diseases
Energy Technology Data Exchange (ETDEWEB)
Fujishima, Mamoru; Hiraki, Yoshio; Takeda, Yoshihiro; Kohno, Yoshihiro; Niiya, Harutaka; Aono, Kaname; Yorimitsu, Seiichi; Takahashi, Isao
1988-10-01
Bone marrow scintigraphy with indium chloride (/sup 111/In) was performed in fifty-one patients with the hematological diseases. The results of the investigation were that 1) in all patients, as well as in patients with aplastic anemia, no correlation was there between the degree of the indium chloride accumulation and peripheral blood counts, 2) in patients with aplastic anemia and pure red cell aplasia (PRCA) a tendency to reduction in uptake of indium chloride in bone marrow, 3) in patients with these two good correlation between the degree of indium chloride accumulation and histology of the erythroid bone marrow, but in patients with chronic myelocytic leukemia (CML) and atypical leukemia no correlation between the two, so it seemed unlikely that indium chloride should reflect the effective production of erythrocytes, 4) four patients with leukemia were studied with indium chloride bone marrow imaging two times to evaluate their responses to chemotherapy, and peripheral expansion was no change or reduced in two patients with acute myelocytic leukemia (AML) and one patient with acute lymphocytic leukemia (ALL) who obtained complete remission, but on the other hand, it enlarged in one patient with acute myelocytic leukemia who obtained partial remission, and 5) in two patients with chronic myelocytic leukemia it enlarged up to the ankle joints, which was considerably specific.
Cation exchange process for recovery of plutonium from laboratory solutions containing chloride
International Nuclear Information System (INIS)
Gray, L.W.
1978-10-01
A cation exchange technique was developed for the separation of plutonium from laboratory solutions containing either Pu(III) or Pu(III)--Pu(IV) mixtures in acidic solutions containing chloride ions. The procedure consists of adjusting the acid concentration to less than one molar and adjusting the valence of the plutonium ion to the (III) state, if necessary. The adjusted solution is fed to a cation exchange column and washed with distilled water to remove residual chlorides from the column. Plutonium is then eluted from the column with 5M nitric acid containing 0.34M sulfamic acid. This procedure was used to separate plutonium from 1.2M chloride solution on a production-scale column. Typical plutonium recovery was 99.97%, while greater than 96% of the original chloride was rejected
International Nuclear Information System (INIS)
Calmanovici, G.; Salgueiro, M.J.; Pernas, L.; Collia, N.; Leonardi, N.; Zubillaga, M.
2005-01-01
Full text: Red blood cells (RBCs) labeled with 99m Tc are commonly used in the evaluation of cardiac function, gastrointestinal tract bleeding, red blood cell volume or splenic sequestration. Generally stannous ion is used as reducing agent. A proposed mechanism is that once the stannous ion (Sn) and the pertechnetate ( 99m Tc) reach the interior of the RBC, the radionuclide is mainly house in the β-chain of hemoglobin. The aim of this study was to determine if hemoglobin content reduction, an indicator of iron deficiency anemia, could affect the efficiency of RBC labeling and the biological distribution of this radiopharmaceutical. We studied 30 rats fed for 3 weeks after weaning with diets with iron contents of 6.5 ppm (group A), 18 ppm (group B) and 100 ppm (control). For all groups, the labeling yields were always higher than 97%; the percentage of radioactivity was mostly founded in blood with almost negligible radioactivity the rest of the studied organs. We can conclude that the decrease in hemoglobin content, an indicator of iron deficiency anemia, does not interfere neither in the labeling nor in the biodistribution of red blood cells labeled with 99m Tc. (author)
Studies on derivatives of bat chelates labelled with 67Ca, 113mIn and 201Tl: Pt. 1
International Nuclear Information System (INIS)
Meng Min; Jin Yutai; Liu Boli; Zhu Lin
1989-01-01
The use of 3, 3, 10, 10-tetraethy 1-1, 2-dithio-5, 8-diazacyclodecane (BAT-TE) and 3, 3, 6, 6, 10, 10-hexamethyl-1, 2-dithio-5, 8-diazacy-clodecane (BAT-HM) as new ligands for the preparation of M-BAT-TE (M = Ca 3+ , In 3+ ) and M-BAT-HM (M = Ca 3+ , In 3+ , Tl 3+ ) were investigated. The chelating reactions with high labelling yield are fairly simple and rapid. The biodistribution of BAT derivative chelates in mice exhibited considerable myocardial uptake and good selectivity. Slow washout in heart and high heart-to-blood ratios were observed during the period from 2 min to 30 min after intravenous injection. Based on these experimental results, M-BAT-TE (M = Ca 3+ , In 3+ ) and M-BAT-HM (M = Ca 3+ , IN 3+ , Tl 3+ ) are considered as potential myocardial imaging agents, and particularly Tl-BAT-HM is likely a promising imaging agent
48 CFR 49.113 - Cost principles.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Cost principles. 49.113 Section 49.113 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACT MANAGEMENT TERMINATION OF CONTRACTS General Principles 49.113 Cost principles. The cost principles and procedures in the...
2010-04-01
... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.113 Cocoa. (a) Description. Cocoa is the food that conforms to the definition and standard of identity, and is subject to the... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Cocoa. 163.113 Section 163.113 Food and Drugs FOOD...
23 CFR 660.113 - Construction.
2010-04-01
... 23 Highways 1 2010-04-01 2010-04-01 false Construction. 660.113 Section 660.113 Highways FEDERAL... (DIRECT FEDERAL) Forest Highways § 660.113 Construction. (a) No construction shall be undertaken on any FH... construction of FHs will be performed by the contract method, unless construction by the FHWA, the FS, or a...
Pharmacokinetics of vinyl chloride in the rat
International Nuclear Information System (INIS)
Bolt, H.M.; Laib, R.J.; Kappus, H.; Buchter, A.
1977-01-01
When rats are exposed to [ 14 C]vinyl chloride in a closed system, the vinyl chloride present in the atmosphere equilibrates with the animals' organism within 15 min. The course of equilibration could be determined using rats which had been given 6-nitro-1,2,3-benzothiadiazole. This compound completely blocks metabolism of vinyl chloride. The enzymes responsible for metabolism of vinyl chloride are saturated at an atmospheric concentration of vinyl chloride of 250 ppm. Pharmacokinetic analysis shows that no significant cumulation of vinyl chloride or its major metabolites is to be expected on repeated administration of vinyl chlorides. This may be consistent with the theory that a reactive, shortly living metabolite which occurs in low concentration only, may be responsible for the toxic effects of vinyl chloride
Masuyer, Geoffrey; Yates, Christopher J; Sturrock, Edward D; Acharya, K Ravi
2014-10-01
Somatic angiotensin-I converting enzyme (sACE) has an essential role in the regulation of blood pressure and electrolyte fluid homeostasis. It is a zinc protease that cleaves angiotensin-I (AngI), bradykinin, and a broad range of other signalling peptides. The enzyme activity is provided by two homologous domains (N- and C-), which display clear differences in substrate specificities and chloride activation. The presence of chloride ions in sACE and its unusual role in activity was identified early on in the characterisation of the enzyme. The molecular mechanisms of chloride activation have been investigated thoroughly through mutagenesis studies and shown to be substrate-dependent. Recent results from X-ray crystallography structural analysis have provided the basis for the intricate interactions between ACE, its substrate and chloride ions. Here we describe the role of chloride ions in human ACE and its physiological consequences. Insights into the chloride activation of the N- and C-domains could impact the design of improved domain-specific ACE inhibitors.
Decreases in Casz1 mRNA by an siRNA Complex Do not Alter Blood Pressure in Mice.
Ji, Su-Min; Shin, Young-Bin; Park, So-Yon; Lee, Hyeon-Ju; Oh, Bermseok
2012-03-01
Recent genomewide association studies of large samples have identified genes that are associated with blood pressure. The Global Blood Pressure Genetics (Global BPgen) and Cohorts for Heart and Aging Research in Genome Epidemiology (CHARGE) consortiums identified 14 loci that govern blood pressure on a genomewide significance level, one of which is CASZ1 confirmed in both Europeans and Asians. CASZ1 is a zinc finger transcription factor that controls apoptosis and cell fate and suppresses neuroblastoma tumor growth by reprogramming gene expression, like a tumor suppressor. To validate the function of CASZ1 in blood pressure, we decreased Casz1 mRNA levels in mice by siRNA. Casz1 siRNA reduced mRNA levels by 59% in a mouse cell line. A polyethylenimine-mixed siRNA complex was injected into mouse tail veins, reducing Casz1 mRNA expression to 45% in the kidney. However, blood pressure in the treated mice was unaffected, despite a 55% reduction in Casz1 mRNA levels in the kidney on multiple siRNA injections daily. Even though Casz1 siRNA-treated mice did not experience any significant change in blood pressure, our study demonstrates the value of in vivo siRNA injection in analyzing the function of candidate genes identified by genomewide association studies.
Low-cost and reagent-free paper-based device to detect chloride ions in serum and sweat.
Cinti, Stefano; Fiore, Luca; Massoud, Renato; Cortese, Claudio; Moscone, Danila; Palleschi, Giuseppe; Arduini, Fabiana
2018-03-01
The recent goal of sustainability in analytical chemistry has boosted the development of eco-designed analytical tools to deliver fast and cost-effective analysis with low economic and environmental impact. Due to the recent focus in sustainability, we report the use of low-cost filter paper as a sustainable material to print silver electrodes and to load reagents for a reagent-free electrochemical detection of chloride in biological samples, namely serum and sweat. The electrochemical detection of chloride ions was carried out by exploiting the reaction of the analyte (i.e. chloride) with the silver working electrode. During the oxidation wave in cyclic voltammetry the silver ions are produced, thus they react with chloride ions to form AgCl, while in the reduction wave, the following reaction occurs: AgCl + e - -->Ag + Cl - . These reactions at the electrode surface resulted in anodic/cathodic peaks directly proportional to the chloride ions in solution. Chloride ions were detected with the addition of only 10μL of the sample on the paper-based electrochemical cell, obtaining linearity up to 200mM with a detection limit equal to 1mM and relative standard deviation lower than 10%. The accuracy of the sensor was evaluated in serum and sweat samples, with percentage recoveries between 93 ± 10 and 108 ± 8%. Moreover, the results achieved with the paper-based device were positively compared with those obtained by using the gold standard method (Ion Selective Electrode) adopted in routine clinical analyses. Copyright © 2017 Elsevier B.V. All rights reserved.
Guerra, Lorenzo; D'Oria, Susanna; Favia, Maria; Castellani, Stefano; Santostasi, Teresa; Polizzi, Angela M; Mariggiò, Maria A; Gallo, Crescenzio; Casavola, Valeria; Montemurro, Pasqualina; Leonetti, Giuseppina; Manca, Antonio; Conese, Massimo
2017-07-01
The Cystic Fibrosis Transmembrane Conductance Regulator (CFTR) potentiator ivacaftor (Kalydeco®) improves clinical outcome in G551D cystic fibrosis (CF) patients. Here, we have investigated whether ivacaftor has a clinical impact on non-G551D gating mutations and function of circulating leukocytes as well. Seven patients were treated with ivacaftor and evaluated at baseline, and at 1-3 and 6 months. Besides clinical and systemic inflammatory parameters, circulating mononuclear cells (MNC) were evaluated for CFTR-dependent chloride efflux by spectrofluorimetry, neutrophils for oxidative burst by cytofluorimetry and HVCN1 mRNA expression by real time PCR. Ivacaftor determined a significant decrease in sweat chloride concentrations at all time points during treatment. Body mass index (BMI), FEV 1 , and FVC showed an increasing trend. While C-reactive protein decreased significantly at 2 months, the opposite behavior was noticed for circulating monocytes. CFTR activity in MNC was found to increase significantly at 3 and 6 months. Neutrophil oxidative burst peaked at 2 months and then decreased to baseline. HVCN1 mRNA expression was significantly higher than baseline at 1-3 months and decreased after 6 months of treatment. The chloride efflux in MNC correlated positively with both FEV 1 and FVC. On the other hand, sweat chloride correlated positively with CRP and WBC, and negatively with both respiratory function tests. A cluster analysis confirmed that sweat chloride, FEV 1 , FVC, BMI, and MNC chloride efflux behaved as a single entity over time. In patients with non-G551D mutations, ivacaftor improved both chloride transport in sweat ducts and chloride efflux in MNC, that is, functions directly imputed to CFTR. © 2017 Wiley Periodicals, Inc.
Effect of different ions on the anodic behaviour of alloy 800 chloride solutions at high temperature
International Nuclear Information System (INIS)
Lafont, C.J.; Alvarez, M.G.
1993-01-01
The anodic behaviour and passivity breakdown of alloy 800 in sodium bicarbonate and sodium phosphate aqueous solutions were studied in the temperature range from 100 degrees C to 280 degrees C by means of electrochemical techniques. The effect of phosphate or bicarbonate additions on the pitting susceptibility and pitting morphology of the alloy in chloride solutions was also examined. Experiments were performed in the following solutions: 0.1M NaHCO 3 , at 100 degrees C, 200 degrees C, 280 degrees C; 0.06M NaH 2 PO 4 + 0.04M Na 2 HPO 4 , at 100 degrees C, 200 degrees C and 280 degrees C, and 0.1M NaCl with different additions of bicarbonate ion (0.02M, 0.05M and 0.1M) and phosphate ion (0.01M, 0.05M and 0.1M) at 100 degrees C and 280 degrees C. The anodic polarization curves of alloy 800 in deaerated 0.1M NaHCO 3 and 0.06M NaH 2 PO 4 + 0.04M Na 2 HPO 4 solutions exhibited a similar shape at all the tested temperatures. No localized or generalized corrosion was detected on the metallic surface after polarization. The results obtained in chloride plus bicarbonate and chloride plus phosphate mixtures showed that the pitting potential of alloy 800 in chloride solutions was increased by the presence of bicarbonate or phosphate ions. In those solutions where the inhibitor concentration in the mixture is equal or higher than the chloride concentration , the behaviour of the alloy is similar to the one observed in the absence of chlorides. Changes in pitting morphology were found in phosphate containing solutions, while the pits found in bicarbonate containing solutions were similar to those formed in pure chloride solutions. (author). 3 refs., 4 figs
Compatibility of butorphanol and droperidol in 0.9% sodium chloride injection.
Chen, Fu-Chao; Fang, Bao-Xia; Li, Peng; Yang, Jin-Guo; Zhou, Ben-Hong
2013-03-15
The compatibility and stability of butorphanol tartrate and droperidol in polyvinyl chloride (PVC) bags and glass bottles stored at 4°C and 25°C for up to 15 days were studied. Admixtures were assessed initially and for 15 days after preparation in PVC bags and glass bottles using 0.9% sodium chloride injection as a diluent and stored at 4°C and 25°C. The initial drug concentrations were 0.08 mg/mL for butorphanol tartrate and 0.05 mg/mL for droperidol. Samples were withdrawn from each container immediately after preparation and at predetermined intervals (2, 4, 8, 24, 48, 72, 120, 168, 240, and 360 hours after preparation). The solutions were visually inspected for precipitation, cloudiness, and discoloration at each sampling interval. Drug concentrations were determined using a validated high-pressure liquid chromatography method. After 15 days of storage, all formulations tested retained >98% of the initial concentrations of both drugs. The drug mixtures were clear in appearance, and no color change or precipitation was observed. Throughout this period, pH values remained stable. Admixtures of butorphanol tartrate 0.08 mg/mL and droperidol 0.05 mg/mL in 0.9% sodium chloride injection were stable for at least 360 hours when stored in PVC bags or glass bottles at 4°C and 25°C and protected from light.
International Nuclear Information System (INIS)
Komarov, V.E.; Borodina, N.P.
1981-01-01
Diffusion coefficients of U 3+ ions are measured by chronopotentiometric method in chloride 3LiCl-2KCl and in mixed chloride fluoride 3LiCl(LiF)-2KCl melts in the temperature range 633-1235 K. It is shown It is shown that experimental values of diffusion-coefficients are approximated in a direct line in lg D-1/T coordinate in chloride melt in the whole temperature range and in chloride-fluoride melt in the range of 644-1040 K. Experimental values of diffusion coefficients diviate from Arrhenius equation in the direction of large values in chloride-fluoride melt at further increase of temperature up to 1235 K. Possible causes of such a diviation are considered [ru
49 CFR 194.113 - Information summary.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Information summary. 194.113 Section 194.113... Response Plans § 194.113 Information summary. (a) The information summary for the core plan, required by... state(s). (b) The information summary for the response zone appendix, required in § 194.107, must...
Energy Technology Data Exchange (ETDEWEB)
Frysz, C.A. [Wilson Greatbatch, Ltd., Clarence, NY (United States); Shui, X.; Chung, D.D.L. [State Univ. of New York, Buffalo, NY (United States). Composite Materials Research Lab.
1995-12-31
Submicron carbon filaments used in place of carbon black as porous reduction electrodes in carbon limited lithium batteries in plate and jellyroll configurations with the BCX (bromine chloride in thionyl chloride) catholyte gave a specific capacity (at 2 V cut-off) of up to 8,700 mAh/g carbon, compared to a value of up to 2,900 mAh/g carbon for carbon black. The high specific capacity per g carbon (demonstrating superior carbon efficiency) for the filament electrode is partly due to the filaments` processability into sheets as thin as 0.2 mm with good porosity and without a binder, and partly due to the high catholyte absorptivity and high rate of catholyte absorption of the filament electrode.
[Regional blood flow and bone uptake of methylene-diphosphonate-technetium-99m].
Vattimo, A; Martini, G; Pisani, M
1983-05-30
Sudeck's atrophy of the foot is an acute, patchy osteoporosis that, on bone scan, shows an increase in both bone blood flow and local bone uptake of bone-seeking radionuclides. The purpose of this study was to evaluate the relationship between bone uptake of 99mTc-MDP and local bone blood flow. In some patients with Sudeck's atrophy of one foot we measured local bone blood flow and bone uptake of 99mTc-MDP. External counting of radioactivity, with a count-rate of 1 second was performed for 60 minutes after i.v. injection of a known dose of 99mTc-MDP in some patients with Sudeck's atrophy of the foot. The regions of interest (ROI) were selected on the basis of a bone scan performed 24 hours earlier. We assumed that the data recorded during the first seconds (7-10) reflect local blood flow and the data at 60 minutes reflect the bone uptake. The ratio between the local blood flow in the involved and healthy foot was higher than the local bone uptake ratio. The ratio between bone uptake and local bone blood flow was higher in the normal foot than in the affected one. These results suggest that the bone avidity for bone-seeking radionuclides is lower in Sudeck's atrophy than in normal bone.
Hossain, Mirza Akram; Friciu, Mihaela; Aubin, Sebastien; Leclair, Grégoire
2014-04-15
The stability of penicillin G sodium solutions stored in polyvinyl chloride (PVC) bags or elastomeric pump containers was studied. Test samples were prepared by diluting powdered penicillin G sodium (10 million units/10-mL vial) to solutions of 2,500 or 50,000 units/mL with 0.9% sodium chloride injection or 5% dextrose injection. The preparations were transferred to 250-mL PVC bags and elastomeric pump containers. All samples were prepared in triplicate and stored at 5°C. Chemical stability was measured by a stability-indicating high-performance liquid chromatographic (HPLC) assay and by pH evaluation. Particulate matter was evaluated according to compendial standards using a light-obscuration particle count test. Preparations were visually examined throughout the study. After 21 days of storage, all test samples remained chemically stable, with an HPLC assay recovery value of more than 90% of the initial value. After 28 days, all samples prepared with either diluent and stored in PVC bags, as well as the samples diluted to 2,500 units/mL with sodium chloride injection and stored in elastomeric pump containers, did not meet the recovery acceptance limit. For all test samples, the mean pH consistently decreased during storage, from about 6.4 to about 5.5. Particle counts remained acceptable throughout the study, and no change in appearance was observed. Penicillin G for injection (2,500 and 50,000 units/mL) diluted in 0.9% sodium chloride injection or 5% dextrose injection and stored at 5°C in PVC containers or elastomeric pump containers was physically and chemically stable for a period of at least 21 days.
Cerium(terbium, erbium)chloride-choline chloride aqueous systems
International Nuclear Information System (INIS)
Gajfutdinova, R.K.; Zhuravlev, E.F.; Bikbaeva, G.G.; Domrachev, V.N.; Vanskova, G.I.
1985-01-01
To clarify the effect of rare earth nature on mutual solubility of rare earth salts and amines the solubility of solid phases in the systems, consisting of choline chloride, water and cerium, terbium, erbium chlorides, has been studied. It is established, that solubility isotherms of all the systems, testify to the formation of new solid phases of the composition: Ce(Tb, Er)xCl 3 x2C 5 H 14 ONClx3H 2 O. Individuality of new solid phases is proved by DTA method, the composition is confirmed by chemical analysis and data of PMR spectra, for choline chloride and its complexes with rare earth chlorides of the given composition PMR and IR spectra are studied
Effects of the small molecule HERG activator NS1643 on Kv11.3 channels.
Directory of Open Access Journals (Sweden)
Arne Bilet
Full Text Available NS1643 is one of the small molecule HERG (Kv11.1 channel activators and has also been found to increase erg2 (Kv11.2 currents. We now investigated whether NS1643 is also able to act as an activator of Kv11.3 (erg3 channels expressed in CHO cells. Activation of rat Kv11.3 current occurred in a dose-dependent manner and maximal current increasing effects were obtained with 10 µM NS1643. At this concentration, steady-state outward current increased by about 80% and the current increase was associated with a significant shift in the voltage dependence of activation to more negative potentials by about 15 mV. In addition, activation kinetics were accelerated, whereas deactivation was slowed. There was no significant effect on the kinetics of inactivation and recovery from inactivation. The strong current-activating agonistic effect of NS1643 did not result from a shift in the voltage dependence of Kv11.3 channel inactivation and was independent from external Na(+ or Ca(2+. At the higher concentration of 20 µM, NS1643 induced clearly less current increase. The left shift in the voltage dependence of activation reversed and the voltage sensitivity of activation dramatically decreased along with a slowing of Kv11.3 channel activation. These data show that, in comparison to other Kv11 family members, NS1643 exerts distinct effects on Kv11.3 channels with especially pronounced partial antagonistic effects at higher concentration.
7 CFR 1710.113 - Loan security.
2010-01-01
... 7 Agriculture 11 2010-01-01 2010-01-01 false Loan security. 1710.113 Section 1710.113 Agriculture... GENERAL AND PRE-LOAN POLICIES AND PROCEDURES COMMON TO ELECTRIC LOANS AND GUARANTEES Loan Purposes and Basic Policies § 1710.113 Loan security. (a) RUS makes loans only if, in the judgment of the...
Chloride Transport in Undersea Concrete Tunnel
Directory of Open Access Journals (Sweden)
Yuanzhu Zhang
2016-01-01
Full Text Available Based on water penetration in unsaturated concrete of underwater tunnel, a diffusion-advection theoretical model of chloride in undersea concrete tunnel was proposed. The basic parameters including porosity, saturated hydraulic conductivity, chloride diffusion coefficient, initial water saturation, and moisture retention function of concrete specimens with two water-binder ratios were determined through lab-scale experiments. The variation of chloride concentration with pressuring time, location, solution concentration, initial saturation, hydraulic pressure, and water-binder ratio was investigated through chloride transport tests under external water pressure. In addition, the change and distribution of chloride concentration of isothermal horizontal flow were numerically analyzed using TOUGH2 software. The results show that chloride transport in unsaturated concrete under external water pressure is a combined effect of diffusion and advection instead of diffusion. Chloride concentration increased with increasing solution concentration for diffusion and increased with an increase in water pressure and a decrease in initial saturation for advection. The dominant driving force converted with time and saturation. When predicting the service life of undersea concrete tunnel, it is suggested that advection is taken into consideration; otherwise the durability tends to be unsafe.
Energy Technology Data Exchange (ETDEWEB)
Gillis, Patricia L., E-mail: patty.gillis@ec.gc.ca [National Water Research Institute, Environment Canada, 867 Lakeshore Road, Burlington, ON L7R-4A6 (Canada)
2011-06-15
Chloride concentrations in surface waters have increased significantly, a rise attributed to road salt use. In Canada, this may be a concern for endangered freshwater mussels, many with ranges limited to southern Ontario, Canada's most road-dense region. The acute toxicity of NaCl was determined for glochidia, the mussel's larval stage. The 24 h EC50s of four (including two Canadian endangered) species ranged from 113-1430 mg Cl L{sup -1} (reconstituted water, 100 mg CaCO{sub 3} L{sup -1}). To determine how mussels would respond to a chloride pulse, natural river water (hardness 278-322 mg CaCO{sub 3} L{sup -1}) was augmented with salt. Lampsilis fasciola glochidia were significantly less sensitive to salt in natural water (EC50s 1265-1559 mg Cl L{sup -1}) than in reconstituted water (EC50 285 mg L{sup -1}). Chloride data from mussel habitats revealed chloride reaches levels acutely toxic to glochidia (1300 mg L{sup -1}). The increased salinization of freshwater could negatively impact freshwater mussels, including numerous species at risk. - Highlights: > Compared to other aquatic organisms glochidia are very sensitive to chloride. > Glochidia were less sensitive to salt in natural water than in reconstituted water. > Glochidia were less sensitive to salt in hard water than in soft water. > Road salt runoff may pose a threat to the reproduction of freshwater mussels. > Salinization of freshwater could negatively impact numerous species at risk. - Freshwater mussel larvae were acutely sensitive to sodium chloride, such that chloride levels in some Canadian rivers may pose a threat to the survival of this early life stage.
International Nuclear Information System (INIS)
Gillis, Patricia L.
2011-01-01
Chloride concentrations in surface waters have increased significantly, a rise attributed to road salt use. In Canada, this may be a concern for endangered freshwater mussels, many with ranges limited to southern Ontario, Canada's most road-dense region. The acute toxicity of NaCl was determined for glochidia, the mussel's larval stage. The 24 h EC50s of four (including two Canadian endangered) species ranged from 113-1430 mg Cl L -1 (reconstituted water, 100 mg CaCO 3 L -1 ). To determine how mussels would respond to a chloride pulse, natural river water (hardness 278-322 mg CaCO 3 L -1 ) was augmented with salt. Lampsilis fasciola glochidia were significantly less sensitive to salt in natural water (EC50s 1265-1559 mg Cl L -1 ) than in reconstituted water (EC50 285 mg L -1 ). Chloride data from mussel habitats revealed chloride reaches levels acutely toxic to glochidia (1300 mg L -1 ). The increased salinization of freshwater could negatively impact freshwater mussels, including numerous species at risk. - Highlights: → Compared to other aquatic organisms glochidia are very sensitive to chloride. → Glochidia were less sensitive to salt in natural water than in reconstituted water. → Glochidia were less sensitive to salt in hard water than in soft water. → Road salt runoff may pose a threat to the reproduction of freshwater mussels. → Salinization of freshwater could negatively impact numerous species at risk. - Freshwater mussel larvae were acutely sensitive to sodium chloride, such that chloride levels in some Canadian rivers may pose a threat to the survival of this early life stage.
Influence of granular strontium chloride as additives on some ...
Indian Academy of Sciences (India)
Influence of granular strontium chloride as additives on some electrical and mechanical properties for pure polyvinyl alcohol. A B Elaydy M Hafez ... Keywords. Polyvinyl-alcohol (PVA); granular strontium chloride, SrCl2; a.c. electrical conductivity; dielectric constant; dielectric loss; Young's modulus; creep relaxation curve.
In vitro evaluation of canine leukocytes radiolabeled in whole blood with 99mTc stannous colloid
International Nuclear Information System (INIS)
Abushhiwa, Mohamed H.; Salehi, Nouria S.; Whitton, Robert C.; Charles, Jennifer A.; Finnin, Peter J.; Lording, Peter M.; Caple, Ivan W.; Parry, Bruce W.
2008-01-01
Introduction: Technetium-99m stannous colloid ( 99m TcSnC)-labeled leukocytes are used to investigate a variety of inflammatory diseases in human medicine. The present study investigates the in vitro behavior of canine leukocytes labeled in whole blood with 99m TcSnC. Methods: Blood samples from 10 healthy dogs were labeled with 99m TcSnC using a standard procedure. The distribution of radioactivity among blood components (plasma, leukocyte layers and erythrocytes) was measured following separation of the radiolabeled samples across Histopaque density gradients. Phagocytic function of labeled and unlabeled leukocytes was estimated using zymosan particles. Labeling retention by leukocytes was determined at 1, 3, 4 and 7 h postlabeling. Results: The mean±standard error percentage of radioactivity associated with plasma, erythrocyte and leukocyte fractions was 2.0±0.21%, 55.5±0.60% and 42.5±0.54%, respectively (the last comprising 70.2±0.83% in polymorphonuclear leukocytes and 29.8±0.83% in mononuclear leukocytes). Labeled canine leukocytes had a phagocytic activity of 91.3±0.28% (control, 91.7±0.26%). The radiolabeled canine leukocytes retained 94.1±0.30% of radioactivity at 7 h postlabeling. Conclusions: Radiolabeling of canine leukocytes in whole blood with 99m TcSnC has minor adverse effect on their phagocytic function. The radiolabeled canine leukocytes retained a large percentage of radioactivity for at least 7 h postlabeling
Synthesis and animal experiment of 99mTc-labeled hepatobiliary imaging agents
International Nuclear Information System (INIS)
Zhou Xirui; Chen Shaoliang; Chen Guohui; Xu Qinfeng
1993-01-01
Six new compounds based on the principle of isosterism and hybridization had been synthesized. Methobrofenin was prepared by reduction of nitro mesitylene, followed by bromination and acylation with nitrilotriacetic acid. The 99m Tc-complexes of these compounds were prepared by stannous chloride reduction of sodium pertechnetate in aqueous solution. These labeled compounds, being similar to 99m Tc-mebrofenin, all were quick in the uptake by the liver cells, rapidly cleared off from the blood in mice, and had higher cumulative hepatobiliary excretion rates than Tc-99m-EHIDA
Corrosion behavior of sodium-exposed stainless steels in chloride-containing aqueous solutions
International Nuclear Information System (INIS)
Wu, P.C.S.; Grundy, B.R.; Miller, R.L.
1979-01-01
The corrosion behavior of sodium-exposed stainless steels in chloride-containing aqueous solutions was investigated. Results showed that sodium-corroded Type 316 stainless steel (prototypic Liquid Metal Fast Breeder Reactor (LMFBR) fuel cladding) maintains its integrity after five months exposure in these solutions at 82 0 C and with chloride content up to 500 ppM. In contrast, sensitized and sodium mass transfer deposit-containing Type 304 stainless steel failed in the high chloride solution (500 ppM) within ten days at the same temperature. The failure was initiated by pitting and subsequently accelerated by intergranular attack. The results also show that high pH tends to reduce the susceptibility to failure while procedures commonly used for sodium removal have no significant effect on the water corrosion behavior of the test material. Based on the current results, it is concluded that water shortage is feasible for spent fuels in a LMFBR reprocessing plant
In vivo and in vitro study of the 99mTc-DMSA radiopharmaceutical connection to blood elements
International Nuclear Information System (INIS)
Freitas, Rosimeire de S.; Gomes, Maria L.; Mattos, Deise M.M.; Moreno, Silvana R.F.; Dire, Glaucio F.; Lima, Elaine A.; Lima-Filho, Guilherme L.; Aleixo, Luiz Claudio; Bernardo-Filho, Mario; Instituto Nacional do Cancer, Rio de Janeiro
2002-01-01
Radiopharmaceuticals are widely used in nuclear medicine. The comprehension of their uptake mechanism in target organs, as well as their clearance may depend on the elucidation of their biochemical characteristics, for instance, their binding to blood elements. The reported precipitating studies of blood with radiopharmaceuticals have shown that the results can not be easily compared. Then, we decide evaluate of the binding proteins on the blood elements using trichloroacetic acid (TCA) to determine the radioactivity of the dimercaptosuccinic acid with technetium-99m (99mTc-DMSA) present in precipitating plasma (P) and blood cells (BC). Depending on the TCA concentration we have determined different values in the insoluble fractions of the plasma when the in vivo and in vitro evaluations were carried out. (author)
Cowley, M J; Mantle, J A; Rogers, W J; Russell, R O; Rackley, C E; Logic, J R
1979-06-01
It has been suggested that diffuse Tc-99m pyrophosphate precordial activity may be due to persistent blood-pool activity in routine delayed views during myocardial imaging. To answer this question, we reviewed myocardial scintigrams recorded 60--90 min following the injection of 12--15 mCi of Tc-99m pyrophosphate for the presence of diffuse precordial activity, and compared these with early images of the blood pool in 265 patients. Diffuse activity in the delayed images was identified in 48 patients: in 20 with acute myocardial infarction and in 28 with no evidence of it. Comparison of these routine delayed images with early views of the blood pool revealed two types of patterns. In patients with acute infarction, 95% had delayed images that were distinguishable from blood pool either because the activity was smaller than the early blood pool, or by the presence of localized activity superimposed on diffuse activity identical to blood pool. In those without infarction, 93% had activity distribution in routine delayed views matching that in the early blood-pool images. The usefulness of the diffuse TcPPi precordial activity in myocardial infarction is improved when early blood-pool imaging is used to exclude persistence of blood-pool activity as its cause. Moreover, it does not require additional amounts of radioactivity nor complex computer processing, a feature that may be of value in the community hospital using the technique to "rule out" infarction 24--72 hr after onset of suggestive symptoms.
Melissa, Mohammad Hirman; Azmi, Sarriff
2013-07-01
The concentrated potassium chloride injection is a high-alert medication and replacing it with a pre-mixed formulation can reduce the risks associated with its use. The aim of this study was to determine the clinical characteristics of patients receiving different potassium chloride formulations available at a private institution. The study also assessed the effectiveness and safety of pre-mixed formulations in the correction of hypokalaemia. This was a retrospective observational study consisting of 296 cases using concentrated and pre-mixed potassium chloride injections in 2011 in a private hospital in Kuching, Sarawak, Malaysia. There were 135 (45.6%) cases that received concentrated potassium chloride, and 161 (54.4%) cases that received pre-mixed formulations. The patients' clinical characteristics that were significantly related to the utilization of the different formulations were diagnosis (P < 0.001), potassium serum blood concentration (P < 0.05), and fluid overload risk (P < 0.05). The difference observed for the cases that achieved or maintained normokalaemia was statistically insignificant (P = 0.172). Infusion-related adverse effects were seen more in pre-mixes compared to concentrated formulations (6.8% versus 2.2%, P < 0.05). This study provides insight into the utilization of potassium chloride injections at this specific institution. The results support current recommendations to use pre-mixed formulations whenever possible.
Determination of low chloride values in Rocky Flats scrub alloy solutions and other complex matrices
International Nuclear Information System (INIS)
Holcomb, H.P.
1985-01-01
A turbidimetric method, using silver chloride, has been developed to determine low ppM quantities of chloride in Rocky Flats scrub alloy (RFSA) dissolver solutions. This analytical technique has also been applied to other complex matrices such as process 50% caustic and neutralized Purex low heat liquid waste concentrate. A controlled-pH precipitation with NaOH, during which chloride remains in solution, is used to pretreat samples to minimize salt effects from acids, bases, and/or hydrolyzable ions. Control of pH with bromocresol purple indicator also provides a more consistent pH for silver chloride formation, aiding in turbidity reproducibility. Disodium ethylenediaminetetraacetic acid is employed to negate covalent bonding by Hg(II) with chloride. The average standard deviation was +-17% for turbidity reproducibility in simulated sample aliquots containing a total of 10 to 100 μg chloride. For actual RFSA samples, the relative standard deviation ranged from +-14% to +-26%, depending on initial chloride values. 8 refs., 1 fig
2010-07-01
... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Data breach. 75.113 Section 75.113 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS (CONTINUED) INFORMATION SECURITY MATTERS Data Breaches § 75.113 Data breach. Consistent with the definition of data breach in § 75.112 of this subpart, a data breach...
Our experience of blood flow measurements using radioactive tracers
International Nuclear Information System (INIS)
Danet, Bernard.
1974-01-01
A critical study of blood flow measuring methods is proposed. After a review of the various diffusible and non-diffusible radioactive tracers and the corresponding detector systems, the principles which allow to measure blood flow from the data so obtained, are studied. There is a different principle of flow measurement for each type of tracer. The theory of flow measurement using non-diffusible tracers (human serum albumin labelled with 131 I or sup(99m)Tc, 113 In-labelled siderophiline) and its application to cardiac flow measurement are described first. Then the theory of flow measurement using diffusible tracers ( 133 Xe, 85 Kr) and its application to measurement of blood flow through tissues (muscles and kidney particularly) are described. A personal experience of this various flow measurements is reported. The results obtained, the difficulties encountered and the improvments proposed are developed [fr
27 CFR 40.113 - Change in location to another region.
2010-04-01
... another region. 40.113 Section 40.113 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND... Products Changes in Location of Factory § 40.113 Change in location to another region. Whenever a manufacturer of tobacco products intends to remove his factory to another region, the manufacturer shall...
Flow film boiling heat transfer in water and Freon-113
International Nuclear Information System (INIS)
Liu, Qiusheng; Shiotsu, Masahiro; Sakurai, Akira
2002-01-01
Experimental apparatus and method for film boiling heat transfer measurement on a horizontal cylinder in forced flow of water and Freon-113 under pressurized and subcooled conditions were developed. The experiments of film boiling heat transfer from single horizontal cylinders with diameters ranging from 0.7 to 5 mm in saturated and subcooled water and Freon-113 flowing upward perpendicular to the cylinders were carried out for the flow velocities ranging from 0 to 1 m/s under system pressures ranging from 100 to 500 kPa. Liquid subcoolings ranged from 0 to 50 K, and the cylinder surface superheats were raised up to 800 K for water and 400 K for Freon-113. The film boiling heat transfer coefficients obtained were depended on surface superheats, flow velocities, liquid subcoolings, system pressures and cylinder diameters. The effects of these parameters were systematically investigated under wider ranges of experimental conditions. It was found that the heat transfer coefficients are higher for higher flow velocities, subcoolings, system pressures, and for smaller cylinder diameters. The observation results of film boiling phenomena were obtained by a high-speed video camera. A new correlation for subcooled flow film boiling heat transfer was derived by modifying authors' correlation for saturated flow film boiling heat transfer with authors' experimental data under wide subcooled conditions. (author)
Electrochemical chloride extraction of a beam polluted by chlorides after 40 years in the sea
BOUTEILLER, Véronique; LAPLAUD, André; MALOULA, Aurélie; MORELLE, René Stéphane; DUCHESNE, Béatrice; MORIN, Mathieu
2006-01-01
A beam element, naturally polluted by chlorides after 40 years of a marine tidal exposure, has been treated by electrochemical chloride extraction. The chloride profiles, before and after treatment, show that free chlorides are extrated with an efficiency of 70 % close to the steel, 50 % in the intermediate cover and only 5 % at the concrete surface. From the electrochemical characterizations (before, after, 1, 2 and 17 months after treatment), the steel potential values can, semehow, indicat...
Determination of chloride in MOX samples using chloride ion selective electrode
Energy Technology Data Exchange (ETDEWEB)
Govindan, R; Das, D K; Mallik, G K; Sumathi, A; Patil, Sangeeta; Raul, Seema; Bhargava, V K; Kamath, H S [Bhabha Atomic Research Centre, Tarapur (India). Advanced Fuel Fabrication Facility
1997-09-01
The chloride present in the MOX fuel is separated from the matrix by pyrohydrolysis at a temperature of 950 {+-} 50 degC and is then analyzed by chloride ion selective electrode (Cl-ISE). The range covered is 0.4-4 ppm with a precision of better than {+-}5% R.S.D. (author). 4 refs., 1 tab.
Shin, Sue; Roh, Eun Youn; Oh, Sohee; Song, Eun Young; Kim, Eui Chong; Yoon, Jong Hyun
2017-01-24
Cord blood units (CBUs) for transplantation should be free of communicable disease and must contain a specific amount of total nucleated cells and CD34+ cells. Although posttransplantation cytomegalovirus (CMV) infections are from latent infection in patients, ensuring CMV-free CBUs by performing CMV-specific IgM and nucleic acid amplification testing (NAT) is one of the mandatory procedures for the safety of CBUs. However, the exclusion policies (based on these test results) vary among nations and institutions. We tested 28,000 processed CBUs between May 2006 and June 2014. The cord blood leukocytes from CMV IgM-positive samples were then subjected to NAT. The total nucleated cell and CD34+ cell counts were measured for each CBU, and the results were compared to the CMV IgM and IgG results. The seroprevalence of CMV among pregnant women was 98.1% (18,459/18,818) for IgG and 1.7% (441/25,293) for IgM. The concentration and the total number of CD34+ cells were significantly higher in CBUs from IgM-negative mothers compared to those from IgM-positive mothers (72.4/μl vs. 57.2/μl, respectively, p < 0.0001; 1.45 × 106/unit vs. 1.15 × 106/unit, respectively, p < 0.0001). Among CBUs with positive CMV IgM in their mothers' plasma or cord blood plasma, only 0.58% of the samples (3/517) had a positive NAT. The number of excluded CBUs from inventory due to positive CMV IgM in the cord blood was 54 of 18,326 (0.3%). For inventory purposes, it is appropriate to remove CBUs with positive cord blood CMV IgM findings irrespective of the NAT status as well as positive maternal CMV IgM in South Korea.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Advertising. 113.540 Section 113.540 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION IN FINANCIAL... Advertising. A recipient shall not in any advertising related to employment indicate preference, limitation...
Detection of gastrointestinal blood loss with 99mTc-labeled, heat-treated red blood cells
International Nuclear Information System (INIS)
Som, P.; Oster, Z.H.; Atkins, H.L.; Goldman, A.G.; Sacker, D.F.; Harold, W.H.; Fairchild, R.G.; Richards, P.; Brill, A.B.
1981-01-01
Studies in dogs showed that heat-treated 99mTc-labeled red blood cells (HT/RBC) afford a highly sensitive means of detecting gastrointetinal bleeding as low as 0.12 ml/min., which could not be seen with unheated 99mTc-RBC, 99mTc-sulfur colloid, or 99mTc-DTPA. In addition, as the right upper quadrant and epigastrium remained free of activity, only one fifth to one tenth of the dose of 99mTc was needed. The safety of HT/RBC in humans has been documented, and the experiments in dogs suggest that it may have advantages over other agents in detecting gastrointestinal bleeding
Study on the preparation of methylene diphosphonate (MDP) labeling with 99mTc for bone scintigraphy
International Nuclear Information System (INIS)
Nguyen Thi Thu; Le Van So; Vo Thi Cam Hoa; Bui Van Cuong; Mai Phuoc Tho; Pham Ngoc Dien; Duong Van Dong; Chu Van Khoa
2005-01-01
The 99m Tc-MDP kit was prepared by using aseptic technique. The composition of MDP invivo kit including 5 mg MDP, 0.5 mg stannous chloride, 0.5 mg ascorbic acid and 5 mg sodium chloride. The kit produces 99m Tc-MDP with more than 95% labelling efficiency at pH 6-7 when mixed with requisite amount of 99m Tc-pertechnetate. The preparation has been found sterity, pyrogen free, to be sufficiency stable invitro as well as invivo, blood clearance. After intravenous administrations abound 50% of the dose is accumulated and retained by the skeleton. The kit provides quality product in high yield, more stable than other phosphonate kit, high bone uptake. High avidity of 99m Tc-MDP for bone imaging makes it a promising agent for the detection of bone diseases. (author)
/sup 99m/Tc dextran: a new blood-pool-labeling agent for radionuclide angiocardiography
International Nuclear Information System (INIS)
Henze, E.; Robinson, G.D.; Kuhl, D.E.; Schelbert, H.R.
1982-01-01
We have explored the possibility of imaging the cardiac blood pool with dextran (Dx) labeled with /sup 99m/Tc (Tc) after Sn2+ reduction. Stannous dextran (SnDx) kits were prepared in advance and labeling was performed by adding /sup 99m/Tc. The labeling efficiency was greater than 95%. /sup 99m/Tc dextran (TcDx) was highly stable both in vivo and in vitro. In seven dogs we compared the quality of blood-pool images obtained with TcDx of different molecular weights (4 X 10(4) . Dx-40; 5 X 10(5) . Dx-500; 2 X 10(6) . Dx-2000) and with /sup 99m/Tc red blood cells (TcRBC) labeled in vitro, and determined the organ distribution of this new agent by whole-body scanning and blood sampling. TcDx provided high-quality cardiac blood-pool images up to 60 min after injection. The heart-to-lung ratios averaged 3.7 for TcDx-40, 3.9 for TcDx-500, and 5.4 for TcRBC at 60 min. Whereas TcDx-40 showed a relatively rapid initial urinary excretion and TcDx-2000 was degraded rapidly, TcDx-500 demonstrated the best kinetics for blood-pool imaging. Thus, TcDx is a new radiopharmaceutical with high labeling efficiency and stability. It overcomes a number of the limitations of currently used blood-labeling agents and may become useful for blood-pool imaging in man
International Nuclear Information System (INIS)
Ryan, J.; Cooper, M.; Loberg, M.; Harvey, E.; Sikorski, S.
1977-01-01
An easily formulated, stable kit preparation of technetium-99m HIDA, suitable for use in humans, was developed and tested in mice and dogs. The tracer was cleared rapidly from the blood and excreted predominantly by the liver in both species. In dogs, the hepatobiliary clearance of Tc-99m HIDA was significantly greater than that of C-14 HIDA and Sn-113 HIDA. The LD 50 for HIDA in mice, 168 mg/kg, exceeded the average human dose by a factor of 1000 on a per-weight basis. Blood clearance curves for Tc-99m HIDA in 12 normal subjects were biexponential with half-times of 4.6 +- 1.0 min and 31.5 +- 7.0 min, and cumulative 90-min urine samples contained 14.2 +- 1.8% of the injected dose. Images in normal subjects and nonjaundiced patients showed rapid concentration of tracer by the liver and activity was present within the biliary system in 10 to 20 min. In jaundiced patients, the tracer blood clearance was delayed and urinary excretion increased, but intestinal activity, indicating biliary patency, was imaged in those patients without complete focal obstruction of the common duct. Technetium-99m HIDA is a nontoxic radiopharmaceutical useful for clinical evaluation of hepatobiliary disorders in humans
Omanwar, S; Saidullah, B; Ravi, K; Fahim, M
2013-01-01
Mercury exposure induces endothelial dysfunction leading to loss of endothelium-dependent vasorelaxation due to decreased nitric oxide (NO) bioavailability via increased oxidative stress. Our aim was to investigate whether acute treatment with methyl mercury chloride changes the endothelium-dependent vasodilator response and to explore the possible mechanisms behind the observed effects. Wistar rats were treated with methyl mercury chloride (5 mg/kg, po.). The methyl mercury chloride treatment resulted in an increased aortic vasorelaxant response to acetylcholine (ACh). In methyl-mercury-chloride-exposed rats, the % change in vasorelaxant response of ACh in presence of Nω-Nitro-L-arginine methyl ester hydrochloride (L-NAME; 10(-4) M) was significantly increased, and in presence of glybenclamide (10(-5) M), the response was similar to that of untreated rats, indicating the involvement of NO and not of endothelium-derived hyperpolarizing factor (EDHF). In addition, superoxide dismutase (SOD) + catalase treatment increased the NO modulation of vasodilator response in methyl-mercury-chloride-exposed rats. Our results demonstrate an increase in the vascular reactivity to ACh in aorta of rats acutely exposed to methyl mercury chloride. Methyl mercury chloride induces nitric oxide synthase (NOS) and increases the NO production along with inducing oxidative stress without affecting the EDHF pathway.
Directory of Open Access Journals (Sweden)
S. Omanwar
2013-01-01
Full Text Available Mercury exposure induces endothelial dysfunction leading to loss of endothelium-dependent vasorelaxation due to decreased nitric oxide (NO bioavailability via increased oxidative stress. Our aim was to investigate whether acute treatment with methyl mercury chloride changes the endothelium-dependent vasodilator response and to explore the possible mechanisms behind the observed effects. Wistar rats were treated with methyl mercury chloride (5 mg/kg, po.. The methyl mercury chloride treatment resulted in an increased aortic vasorelaxant response to acetylcholine (ACh. In methyl-mercury-chloride-exposed rats, the % change in vasorelaxant response of ACh in presence of Nω-Nitro-L-arginine methyl ester hydrochloride (L-NAME; 10-4 M was significantly increased, and in presence of glybenclamide (10-5 M, the response was similar to that of untreated rats, indicating the involvement of NO and not of endothelium-derived hyperpolarizing factor (EDHF. In addition, superoxide dismutase (SOD + catalase treatment increased the NO modulation of vasodilator response in methyl-mercury-chloride-exposed rats. Our results demonstrate an increase in the vascular reactivity to ACh in aorta of rats acutely exposed to methyl mercury chloride. Methyl mercury chloride induces nitric oxide synthase (NOS and increases the NO production along with inducing oxidative stress without affecting the EDHF pathway.
International Nuclear Information System (INIS)
Konstom, M.A.; Tu'meh, S.; Wynne, J.; Beck, J.R.; Kozlowski, J.; Holman, B.L.
1982-01-01
The effects of exercise on blood radiotracer concentration after technetium-99m in vivo red blood cell labeling was studied. After red blood cell labeling, 13 subjects underwent maximal supine bicycle exercise. Radioactivity, analyzed with a well counter, was measured in heparinized venous blood samples drawn at rest and during peak exercise. Changes in activity were compared with changes in erythrocyte count. Activity and erythrocyte counts increased in erythrocyte count (r=0.78), but did not correlate with either duration of exercise or maximal heart rate. Twenty minutes after termination of exercise, activity and erythrocyte count had decreased from peak exercise values but remained higher than preexercise values. In nine nonexercised control subjects, samples drawn 20 minutes apart showed no change in activity or in erythrocyte count. It was concluded that exercise increases blood activity, primarily because of an increase in erythrocyte count. During radionuclide ventriculography, blood activity must be measured before and after any intervention, particularly exercise, before a change in left ventricular activity can be attributed to a change in left ventricular volume
14 CFR 1240.113 - Financial accounting.
2010-01-01
... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Financial accounting. 1240.113 Section 1240.113 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION INVENTIONS AND CONTRIBUTIONS Awards for Scientific and Technical Contributions § 1240.113 Financial accounting. (a) An Award Check...
Simulation of specific conductance and chloride concentration in Abercorn Creek, Georgia, 2000-2009
Conrads, Paul; Roehl, Edwin A.; Davie, Steven R.
2011-01-01
chloride concentrations at the intake. To accommodate these concerns, two ANN chloride models were developed for the intake. The first model (ANN M1e) used all the data. The second model (ANN M2e) only used data when specific conductance at Interstate 95 was less than 175 microsiemens per centimeter at 25 degrees Celsius. Deleting the conductivity data greater than 175 microsiemens per centimeter removed the "plateau" effect observed in the data. The chloride simulations with the ANN M1 model have a low sensitivity to specific conductance (salinity) at Interstate 95, whereas the chloride simulations with the ANN M2 model have a high sensitivity to salinity at Interstate 95. The two modeling approaches (Tetra Tech's EFDC model and the one described in this report) were integrated into a decision support system (DSS) that combines the historical database, output from EFDC, ANN models, ANN model simulation controls, streaming graphics, and model output. The DSS was developed as a Microsoft ExcelTM/Visual Basic for Applications program, which allowed the DSS to be prototyped, easily modified, and distributed in a familiar spreadsheet format. The EFDC and ANN models were used to simulate various harbor deepening scenarios. To accommodate the geometry changes in the harbor, the ANN models used the EFDC model-simulated salinity changes for a historical condition as input. The DSS uses a graphical user interface and allows the user to interrogate the ANN models and EFDC output. Two scenarios were simulated using the Savannah Chloride Model DSS to demonstrate different input options. One scenario decreased winter streamflows to a constant streamflow for 45 days. Streamflows during the period January 1 to February 15 were set to a constant 3,600 cubic feet per second for the simulation period of October 1, 2006, to October 1, 2009. The decreased winter streamflow resulted in predictions of increased specific conductance by as much as 50 microsiemens per centimeter and chlorid
International Nuclear Information System (INIS)
Cowley, M.J.; Mantle, J.A.; Rogers, W.J.; Russell, R.O. Jr.; Rackley, C.E.; Logic, J.R.
1979-01-01
It has been suggested that diffuse 99m Tc pyrophosphate precordial activity may be due to persistent blood-pool activity in routine delayed views during myocardial imaging. To answer this question, we reviewed myocardial scintigrams recorded 60 to 90 min following the injection of 12 to 15 mCi of 99m Tc pyrophosphate for the presence of diffuse precordial activity, and compared these with early images of the blood pool in 265 patients. Diffuse activity in the delayed images was identified in 48 patients: in 20 with acute myocardial infarction and in 28 with no evidence of it. Comparison of these routine delayed images with early views of the blood pool revealed two types of patterns. In patients with acute infarction, 95% had delayed images that were distinguishable from blood pool either because the activity was smaller than the early blood pool, or by the presence of localized activity superimposed on diffuse activity identical to blood pool. In those without infarction, 93% had activity distribution in routine delayed views matching that in the early blood-pool images. The usefulness of the diffuse TcPPi precordial activity in myocardial infarction is improved when early blood-pool imaging is used to exclude persistence of blood-pool activity as its cause. Moreover, it does not require additional amounts of radioactivity nor complex computer processing, a feature that may be of value in the community hospital using the technique to rule out infarction 24 to 72 hr after onset of suggestive symptoms
Chloride Ingress in Concrete with Different Age at Time of First Chloride Exposure
DEFF Research Database (Denmark)
Hansen, Esben Østergaard; Iskau, Martin Riis; Hasholt, Marianne Tange
2016-01-01
Concrete structures cast in spring have longer time to hydrate and are therefore denser and more resistant to chloride ingress when first subjected to deicing salts in winter than structures cast in autumn. Consequently, it is expected that a spring casting will have a longer service life....... This hypothesis is investigated in the present study by testing drilled cores from concrete cast in 2012 and 2013 on the Svendborgsund Bridge. The cores are subject to petrographic examination and mapping of chloride profiles. Moreover, chloride migration coefficients have been measured. The study shows...
99mTc-HMPAO SPECT thalamic blood flow study in migraine
International Nuclear Information System (INIS)
Zhang Zhijian; Steiner, T.J.
1995-01-01
The changes of blood flow in the thalamic of migraineurs by 99m Tc-HMPAO SPECT imaging are investigated. 60 cases with migraine were performed by Novo 810 high-resolution SPECT 30 minutes after injection of 99m Tc-HMPAO. The quantitative analysis of SPECT data was based on the irregular ROI% uptake normalized to total slice method. There were significantly increased mean % uptake values in migraine with aura (259.1 +-17.1), and more significantly in those who experienced hemisensory symptoms and hemiparesis during aura (263.8 +- 17.2), compared to that of migraine without aura (249.1 +- 14.9), but there were not statistically significant difference between migraine with only visual disturbance during aura (255.1 +- 16.4) and without aura. The possible explanations for the increased mean % uptake values in migraineurs who experienced hemisensory symptoms and hemiparesis during aura are: (1) the reactive postischemic hyperemia. (2) excepting thalamus, the regional blood flow was decreased. (3) the secondary phenomenon to the various neurogenic and chemical stimuli
Karlage, Kelly; Earhart, Zachary; Green-Boesen, Kelly; Myrdal, Paul B
2011-08-15
The stability of midazolam hydrochloride injection 1-mg/mL solutions in polyvinyl chloride (PVC) and polyolefin bags under varying conditions was evaluated. Triplicate solutions of midazolam hydrochloride 1-mg/mL were prepared in polyolefin and PVC i.v. bags by diluting midazolam hydrochloride injection 5 mg/mL with 5% dextrose injection. Bags were then stored under refrigeration (3-4 °C), exposed to light at room temperature (20-25 °C), or protected from light in amber bags at room temperature. Samples were taken immediately after preparation (day 0) and on days 1, 2, 3, 6, 13, 20, and 27 for analysis with a stability-indicating high-performance liquid chromatography assay in order to determine solution concentration. Stability was defined as retention of at least 90% of the initial drug concentration. The pH of each solution was also measured weekly. Sterility of the i.v. bags was determined at the end of the study by microbiological testing with culture in growth media. Differences in concentrations under the various storage conditions and bags used were analyzed using analysis of variance. All solutions retained over 98% of the initial midazolam hydrochloride concentration, with no statistically significant (p ≥ 0.05) change in concentration over the four-week period. Stability was not affected by temperature, exposure to light, or bag type. The pH of all solutions remained between 3.2 and 3.4 throughout the study. Sterility after 28 days was retained. Midazolam hydrochloride 1-mg/mL solutions diluted in 5% dextrose injection remained stable over 27 days in both polyolefin and PVC i.v. bags, regardless of storage condition.
Chloride Transport in OPC Concrete Subjected to the Freeze and Thaw Damage
Directory of Open Access Journals (Sweden)
Ki Yong Ann
2017-01-01
Full Text Available To predict the durability of a concrete structure under the coupling degradation consisting of the frosting and chloride attack, microstructural analysis of the concrete pore structure should be accompanied. In this study, the correlation between the pore structure and chloride migration for OPC concrete was evaluated at the different cement content in the concrete mix accounting for 300, 350, and 400 kg/m3 at 0.45 of a free water cement ratio. The influence of frosting damage on the rate of chloride transport was assessed by testing with concrete specimens subjected to a rapid freezing and thawing cyclic environment. As a result, it was found that chloride transport was accelerated by frost damage, which was more influential at the lower cement content. The microscopic examination of the pore structure showed that the freezing environment increased the volume of the large capillary pore in the concrete matrix.
DEFF Research Database (Denmark)
Frederiksen, Jens Mejer; Geiker, Mette Rica
2008-01-01
Prediction of chloride ingress into concrete is an important part of durability design of reinforced concrete structures exposed to chloride containing environment. This paper presents experimentally based design parameters for Portland cement concretes with and without silica fume and fly ash...... in marine atmospheric and submersed South Scandinavian environment. The design parameters are based on sequential measurements of 86 chloride profiles taken over ten years from 13 different types of concrete. The design parameters provide the input for an analytical model for chloride profiles as function...... of depth and time, when both the surface chloride concentration and the diffusion coefficient are allowed to vary in time. The model is presented in a companion paper....
Lifescience Database Archive (English)
Full Text Available CH (Link to library) CHC113 (Link to dictyBase) - - - Contig-U15579-1 CHC113P (Link... to Original site) CHC113F 198 CHC113Z 396 CHC113P 574 - - Show CHC113 Library CH (Link to library) Clone ID CHC113 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dict...nif*KLENIIKKRNKLIFNYK KK--- ---GFGCLAIPKNCNDNDPCTTDHCDPAIGCYYDKFDNCDACNAVDTCITNDLCFPRECN PRGNPPCLINPINCTSTDPCIFSYCENGVCIPTYICT...KK--- ---GFGCLAIPKNCNDNDPCTTDHCDPAIGCYYDKFDNCDACNAVDTCITNDLCFPRECN PRGNPPCLINPINCTSTDPCIFSYCENGVCIPTYICTPTPS
42 CFR 56.113 - Grantee accountability.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Grantee accountability. 56.113 Section 56.113 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GRANTS GRANTS FOR MIGRANT HEALTH SERVICES General Provisions § 56.113 Grantee accountability. (a) Accounting for grant award...
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Athletics. 113.450 Section 113.450 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION IN FINANCIAL ASSISTANCE... female teams if a recipient operates or sponsors separate teams will not constitute noncompliance with...
International Nuclear Information System (INIS)
Neves, Rosane de Figueiredo; Rebello, Bernardo Machado; Medeiros, Aldo da Cunha; Moreno, Silvana Ramos Farias; Fonseca, Adenilson de Souza da; Caldas, Luiz Querino de Araujo; Bernardo-Filho, Mario
2007-01-01
Arctium lappa (burdock) has been used to treat inflammatory processes. Blood constituents labeled with technetium-99m ( 99m Tc) have been utilized in nuclear medicine. It was evaluated the influence of a burdock extract on the labeling of blood constituents with 99m Tc and on the morphometry of red blood cells. Blood samples from Wistar rats were incubated with burdock extract and the radiolabeling procedure was carried out. Plasma and blood cells, soluble and insoluble fractions of plasma and blood cells were separated. The radioactivity in each fraction was counted and the percentages of radioactivity (%ATI) were determined. Morphology and morphometric (perimeter/area ratio) measurements of red blood cells (RBC) were performed. The incubation with burdock extract significantly (p 99m Tc obtained in this study. (author)
24 CFR 27.113 - Foreclosure costs.
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Foreclosure costs. 27.113 Section 27.113 Housing and Urban Development Office of the Secretary, Department of Housing and Urban... Single Family Mortgages § 27.113 Foreclosure costs. A commission may be allowed to the foreclosure...
10 CFR 71.113 - Document control.
2010-01-01
... 10 Energy 2 2010-01-01 2010-01-01 false Document control. 71.113 Section 71.113 Energy NUCLEAR....113 Document control. The licensee, certificate holder, and applicant for a CoC shall establish measures to control the issuance of documents such as instructions, procedures, and drawings, including...
International Nuclear Information System (INIS)
Rabin, B.M.; Hunt, W.A.; Lee, J.
1988-01-01
The preexposure paradigm was utilized to evaluate the similarity of ionizing radiation, lithium chloride and ethanol as unconditioned stimuli for the acquisition of a conditioned taste aversion. Three unpaired preexposures to lithium chloride (3.0 mEq/kg, IP) blocked the acquisition of a taste aversion when a novel sucrose solution was paired with either the injection of the same dose of lithium chloride or exposure to ionizing radiation (100 rad). Similar pretreatment with radiation blocked the acquisition of a radiation-induced aversion, but had no effect on taste aversions produced by lithium chloride (3.0 or 1.5 mEq/kg). Preexposure to ethanol (4 g/kg, PO) disrupted the acquisition of an ethanol-induced taste aversion, but not radiation- or lithium chloride-induced aversions. In contrast, preexposure to either radiation or lithium chloride attenuated an ethanol-induced taste aversion in intact rats, but not in rats with lesions of the area postrema. The results are discussed in terms of relationships between these three unconditioned stimuli and in terms of implications of these results for understanding the nature of the proximal unconditioned stimulus in taste aversion learning
Effect of the chloride ions on the hydrolysis of praseodymium in a 2M ion force media
International Nuclear Information System (INIS)
Lopez G, H.; Jimenez R, M.; Solache R, M.; Rojas H, A.
2004-01-01
The constants of the product of solubility and the first of hydrolysis were determined of the Praseodymium in media 2M of NaClO 4 and 2M of NaCl, to 303 K and under conditions free of CO 2 . The diagram of solubility was obtained (pPr (ac) - pC H ), by means of a radiochemical method and with it was established the pC H that limit the saturation and non saturation areas; that diagram allowed, also, to calculate the constant of the product of solubility. Also, it was adjusted with the polynomial of solubility equation, that it allowed to determine and to check the values of the constants of the product of solubility and the first of hydrolysis. Independently, it was determined the first constant of hydrolysis of the element, by means of potentiometric titrations whose data were treated with the computer program named SUPERQUAD and with the adjustment of the equation of the average number of bonds. It was also calculates the log constant β Pr,Cl of the specie PrCI 2+ starting from the hydrolysis constants obtained in the perchlorate and chloride media. (Author)
International Nuclear Information System (INIS)
Simoes, Susana B.E.; Oliveira, Marcia B.N. de; Gutfilen, Bianca; Bernardo-Filho, Mario; Alves, Andreia Coelho; Machado-Silva, Jose R.
1996-01-01
The 5-ethyl-5-phenylbarbituric acid (phenobarbital) is used as a sedative, hypnotic and anticonvulsant drug. We decided to label it with technetium-99m. In order to determine the optimal conditions, different concentrations of this drug were incubated with various stannous chloride solutions. Then, 99m Tc was added and chromatography was performed using 0.9% NaCl solution, acetone and n-butyl alcohol as the mobile phase. Using a solution of 0.01 mg/ml stannous chloride and 1.0 mg/ml phenobarbital over 92% of the radioactivity bound to phenobarbital 99m Tc-phenobarbital. In the biodistribution study, 99m Tc-phenobarbital was administered in mice intraperitoneal. The main uptake of the labeled drug was in the liver, blood, kidneys, spleen and stomach. The phenobarbital is also used as anesthetic drug in animals. Earlier studies confirm that this drug can dislocate the adult worms of Schistosoma mansoni to mesenteric vein towards the liver and portal vein, so that we used infected animals, radioactivity was not found in isolated worms and we can conclude that the phenobarbital has an indirect action in relation to the displacement of the worms. (author)
Evaluation of Electrochemical Treatment of Chloride Contaminated Mortar Containing GGBS
Directory of Open Access Journals (Sweden)
Ki Hong Lee
2017-01-01
Full Text Available The present study concerns the influence of cementitious binder on electrochemical treatment of steel embedded in salt contaminated mortar. As binder, ordinary Portland cement (OPC and ground granulated blast furnace slag (GGBS were used and the current density of 250–750 mA/m2 was applied for 4 weeks to complete electrochemical chloride extraction. To evaluate the effect of electrochemical treatment the chloride profile and corrosion behaviour covering chloride concentration, galvanic current density, linear polarization resistance, open circuit potential, and mass loss were measured. An increase in the applied direct current density resulted in a decrease in the chloride concentration at the vicinity of steel, accompanying the mitigated corrosion damage. The performance of electrochemical treatment was more remarkable in mortar containing GGBS presumably due to binding mechanism. However, corrosion damage was more detrimental in GGBS rather than OPC at a given potential, while GGBS had superior corrosion resistance to a corrosive environment and treatment conditions. Therefore, the electrochemical treatment should be conducted prudently to evaluate the corrosion state of embedded steel depending on binder type.
9 CFR 113.7 - Multiple fractions.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Multiple fractions. 113.7 Section 113... § 113.7 Multiple fractions. (a) When a biological product contains more than one immunogenic fraction, the completed product shall be evaluated by tests applicable to each fraction. (b) When similar...
21 CFR 113.5 - Current good manufacturing practice.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Current good manufacturing practice. 113.5 Section... CONTAINERS General Provisions § 113.5 Current good manufacturing practice. The criteria in §§ 113.10, 113.40..., methods, practices, and controls used by the commercial processor in the manufacture, processing, or...
Directory of Open Access Journals (Sweden)
See-Ziau Hoe
2011-01-01
Full Text Available INTRODUCTION: Gynura procumbens has been shown to decrease blood pressure via inhibition of the angiotensinconverting enzyme. However, other mechanisms that may contribute to the hypotensive effect have not been studied. OBJECTIVES: To investigate the cardiovascular effects of a butanolic fraction of Gynura procumbens in rats. METHODS: Anaesthetized rats were given intravenous bolus injections of butanolic fraction at doses of 2.5-20 mg/kg in vivo. The effect of butanolic fraction on vascular reactivity was recorded in isolated rat aortic rings in vitro. RESULTS: Intravenous administrations of butanolic fraction elicited significant (p<0.001 and dose-dependent decreases in the mean arterial pressure. However, a significant (p<0.05 decrease in the heart rate was observed only at the higher doses (10 and 20 mg/kg. In isolated preparations of rat aortic rings, phenylephrine (1×10-6 M- or potassium chloride (8×10-2 M-precontracted endothelium-intact and -denuded tissue; butanolic fraction (1×10-6-1×10-1 g/ml induced similar concentration-dependent relaxation of the vessels. In the presence of 2.5×10-3 and 5.0×10-3 g/ml butanolic fraction, the contractions induced by phenylephrine (1×10-9-3×10-5 M and potassium chloride (1×10-2-8×10-2 M were significantly antagonized. The calcium-induced vasocontractions (1×10-4-1×10-2 M were antagonized by butanolic fraction concentration-dependently in calcium-free and high potassium (6×10-2 M medium, as well as in calcium- and potassium-free medium containing 1×10-6 M phenylephrine. However, the contractions induced by noradrenaline (1×10-6 M and caffeine (4.5×10-2 M were not affected by butanolic fraction. CONCLUSION: Butanolic fraction contains putative hypotensive compounds that appear to inhibit calcium influx via receptor-operated and/or voltage-dependent calcium channels to cause vasodilation and a consequent fall in blood pressure.
mRNA profiling for the identification of blood-Results of a collaborative EDNAP exercise
DEFF Research Database (Denmark)
Haas, Cordula; Hanson, E; Bär, W
2010-01-01
of the laboratories had no prior experience with RNA. Despite some expected variation in sensitivity between laboratories, the method proved to be reproducible and sensitive using different analysis strategies. The results of this collaborative exercise support the potential use of mRNA profiling as an alternative......A collaborative exercise on mRNA profiling for the identification of blood was organized by the European DNA Profiling Group (EDNAP). Seven blood samples and one blood dilution series were analyzed by the participating laboratories for the reportedly blood-specific markers HBB, SPTB and PBGD, using...
mRNA profiling for the identification of blood--Results of a collaborative EDNAP exercise
DEFF Research Database (Denmark)
Haas, C.; Hanson, E.; Bär, W.
2011-01-01
of the laboratories had no prior experience with RNA. Despite some expected variation in sensitivity between laboratories, the method proved to be reproducible and sensitive using different analysis strategies. The results of this collaborative exercise support the potential use of mRNA profiling as an alternative......A collaborative exercise on mRNA profiling for the identification of blood was organized by the European DNA Profiling Group (EDNAP). Seven blood samples and one blood dilution series were analyzed by the participating laboratories for the reportedly blood-specific markers HBB, SPTB and PBGD, using...
2010-07-01
... Pollution Contingency Plan and identified in approved Regional Oil and Hazardous Substances Pollution Contingency Plans. (h) Oil means oil of any kind or in any form, including but not limited to, petroleum, fuel... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Definitions. 113.3 Section 113.3...
International Nuclear Information System (INIS)
Ehrlich, C.P.; Papanicolaou, N.; Treves, S.; Hurwitz, R.A.; Richards, P.
1982-01-01
Ten children underwent splenic imaging with heat-denatured red blood cells labeled with technetium-99m (Tc-99m DRBC). The presenting problems included the heterotaxia syndrome, recurrent idiopathic thrombocytopenic purpura following splenectomy, mass in the left posterior hemithorax, and blunt abdominal trauma. In nine patients, the presence or absence of splenic tissue was established. A splenic hematoma was identified in the tenth patient. All patients were initially scanned with Tc-99m sulfur colloid (Tc-99m SC), and were selected for Tc-99m DRBC scintigraphy only after the results of the SC scans failed to establish the clinical problem beyond doubt. The availability of kits containing stannous ions, essential for efficient and stable labeling of red blood cells with Tc-99m and requiring only a small volume of blood, make splenic scintigraphy in children a relatively simple and definitive diagnostic procedure, when identification of splenic tissue is of clinical importance
Energy Technology Data Exchange (ETDEWEB)
Ehrlich, C.P.; Papanicolaou, N.; Treves, S.; Hurwitz, R.A.; Richards, P.
1982-03-01
Ten children underwent splenic imaging with heat-denatured red blood cells labeled with technetium-99m (Tc-99m DRBC). The presenting problems included the heterotaxia syndrome, recurrent idiopathic thrombocytopenic purpura following splenectomy, mass in the left posterior hemithorax, and blunt abdominal trauma. In nine patients, the presence or absence of splenic tissue was established. A splenic hematoma was identified in the tenth patient. All patients were initially scanned with Tc-99m sulfur colloid (Tc-99m SC), and were selected for Tc-99m DRBC scintigraphy only after the results of the SC scans failed to establish the clinical problem beyond doubt. The availability of kits containing stannous ions, essential for efficient and stable labeling of red blood cells with Tc-99m and requiring only a small volume of blood, make splenic scintigraphy in children a relatively simple and definitive diagnostic procedure, when identification of splenic tissue is of clinical importance.
Catalytic Conversion of Cellulose to Levulinic Acid by Metal Chlorides
Directory of Open Access Journals (Sweden)
Beixiao Zhang
2010-08-01
Full Text Available The catalytic performance of various metal chlorides in the conversion of cellulose to levulinic acid in liquid water at high temperatures was investigated. The effects of reaction parameters on the yield of levulinic acid were also explored. The results showed that alkali and alkaline earth metal chlorides were not effective in conversion of cellulose, while transition metal chlorides, especially CrCl3, FeCl3 and CuCl2 and a group IIIA metal chloride (AlCl3, exhibited high catalytic activity. The catalytic performance was correlated with the acidity of the reaction system due to the addition of the metal chlorides, but more dependent on the type of metal chloride. Among those metal chlorides, chromium chloride was found to be exceptionally effective for the conversion of cellulose to levulinic acid, affording an optimum yield of 67 mol % after a reaction time of 180 min, at 200 °C, with a catalyst dosage of 0.02 M and substrate concentration of 50 wt %. Chromium metal, most of which was present in its oxide form in the solid sample and only a small part in solution as Cr3+ ion, can be easily separated from the resulting product mixture and recycled. Finally, a plausible reaction scheme for the chromium chloride catalyzed conversion of cellulose in water was proposed.
Temperature and sodium chloride effects on the solubility of anthracene in water
International Nuclear Information System (INIS)
Arias-Gonzalez, Israel; Reza, Joel; Trejo, Arturo
2010-01-01
The solubility of anthracene was measured in pure water and in sodium chloride aqueous solution (salt concentration, m/mol . kg -1 = 0.1006, 0.5056, and 0.6082) at temperatures between (278 and 333) K. Solubility of anthracene in pure water agrees fairly well with values reported in earlier similar studies. Solubility of anthracene in sodium chloride aqueous solutions ranged from (6 . 10 -8 to 143 . 10 -8 ) mol . kg -1 . Sodium chloride had a salting-out effect on the solubility of anthracene. The salting-out coefficients did not vary significantly with temperature over the range studied. The average salting-out coefficient for anthracene was 0.256 kg . mol -1 . The standard molar Gibbs free energies, Δ tr G o , enthalpies, Δ tr H o , and entropies, Δ tr S o , for the transfer of anthracene from pure water to sodium chloride aqueous solutions were also estimated. Most of the estimated Δ tr G o values were positive [(20 to 1230) J . mol -1 ]. The analysis of the thermodynamic parameters shows that the transfer of anthracene from pure water to sodium chloride aqueous solution is thermodynamically unfavorable, and that this unfavorable condition is caused by a decrease in entropy.
19 CFR 113.35 - Individual sureties.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Individual sureties. 113.35 Section 113.35 Customs... CUSTOMS BONDS Principals and Sureties § 113.35 Individual sureties. (a) Number required. If individuals...) Qualifications to act as surety—(1) Residency and citizenship. Each individual surety on a Customs bond must be...
Wang, Hong-Yan; Lin, Li; Fu, Wei; Yu, Hui-Yuan; Yu, Ning; Tan, Li-Si; Cheng, Jya-Wei; Pan, Ya-Ping
2017-08-29
P-113 (AKRHHGYKRKFH-NH2) is a 12-amino-acid histidine-rich peptide derived from histatin 5 that is highly degradable in high salt concentrations and biological fluids such as serum, plasma and saliva. Nal-P-113, a novel antimicrobial peptide whose histidine residues are replaced by the bulky amino acids β-naphthylalanine, causes the antimicrobial peptide to retain its bactericidal activity even in physiological environments. This study evaluated the effect of the novel antimicrobial peptide Nal-P-113 in a rat periodontitis model and the mechanisms of action of Nal-P-113 for suppressing periodontitis. Periodontitis was induced in mandibular first molars in rats receiving a ligature and infected with Porphyromonas gingivalis. Animals were randomly divided into six groups: a, P. gingivalis W83 alone; b, P. gingivalis W83 with 6.25 μg/mL of Nal-P-113; c, P. gingivalis W83 with 25 μg/mL of Nal-P-113; d, P. gingivalis W83 with 100 μg/mL of Nal-P-113; e, P. gingivalis W83 with 400 μg/mL of Nal-P-113; and f, control without P. gingivalis W83 or Nal-P-113. Morphometric analysis was used to evaluate alveolar bone loss. Microbiological assessment of the presence of Porphyromonas gingivalis and total bacteria was performed using absolute quantitative real-time PCR and scanning electron microscopy. Gingival tissue was collected for western blot and immunohistochemical assays of IL-1β and TNF-α levels. Alveolar bone loss was inhibited by 100 μg/mL or 400 μg/mL of Nal-P-113 compared to the control group (P periodontal tissue (P periodontitis in rats by limiting the amount of bacteria and modulating IL-1β and TNF-α production. The use of Nal-P-113 in vivo might serve as a beneficial preventive or therapeutic approach for periodontitis.
Impact of Wildfire Emissions on Chloride and Bromide Depletion in Marine Aerosol Particles.
Braun, Rachel A; Dadashazar, Hossein; MacDonald, Alexander B; Aldhaif, Abdulamonam M; Maudlin, Lindsay C; Crosbie, Ewan; Aghdam, Mojtaba Azadi; Hossein Mardi, Ali; Sorooshian, Armin
2017-08-15
This work examines particulate chloride (Cl - ) and bromide (Br - ) depletion in marine aerosol particles influenced by wildfires at a coastal California site in the summers of 2013 and 2016. Chloride exhibited a dominant coarse mode due to sea salt influence, with substantially diminished concentrations during fire periods as compared to nonfire periods. Bromide exhibited a peak in the submicrometer range during fire and nonfire periods, with an additional supermicrometer peak in the latter periods. Chloride and Br - depletions were enhanced during fire periods as compared to nonfire periods. The highest observed %Cl - depletion occurred in the submicrometer range, with maximum values of 98.9% (0.32-0.56 μm) and 85.6% (0.56-1 μm) during fire and nonfire periods, respectively. The highest %Br - depletion occurred in the supermicrometer range during fire and nonfire periods with peak depletion between 1.8-3.2 μm (78.8% and 58.6%, respectively). When accounting for the neutralization of sulfate by ammonium, organic acid particles showed the greatest influence on Cl - depletion in the submicrometer range. These results have implications for aerosol hygroscopicity and radiative forcing in areas with wildfire influence owing to depletion effects on composition.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Recruitment. 113.510 Section 113... Recruitment. (a) Nondiscriminatory recruitment and hiring. A recipient shall not discriminate on the basis of sex in the recruitment and hiring of employees. Where a recipient has been found to be presently...
2010-04-01
... general authority and powers of the Commissioner of Customs in requiring bonds, bond approval and... 19 Customs Duties 1 2010-04-01 2010-04-01 false Scope. 113.0 Section 113.0 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS BONDS...
34 CFR 668.113 - Request for review.
2010-07-01
... review determination in paragraph (a) of this section results from an administrative, accounting, or... 34 Education 3 2010-07-01 2010-07-01 false Request for review. 668.113 Section 668.113 Education... Program Review Determinations § 668.113 Request for review. (a) An institution or third-party servicer...
Gao, Xiaojian; Zhang, Jian; Yang, Yingzi; Deng, Hongwei
2010-01-01
One type of all-solid-state chloride sensor was fabricated using a MnO(2) electrode and a Ag/AgCl electrode. The potentiometric response of the sensor to chloride in synthetic concrete pore solutions was systematically studied, and the polarization performance was also evaluated. The results show a good linear relationship between the potential reading of the sensor and the logarithm of chloride activity (concentration ranges from 0.05 to 5.0 M), and the potential value remains stable with increasing immersion time. The existence of K(+), Ca(2+), Na(+) and SO(4) (2-) ions have little influence on the potentiometric response of the sensor to chloride, but the pH has a significant influence on the potential value of the sensor at low chloride concentration. The potential reading of the sensor increases linearly with the solution temperature over the range from 5 to 45 °C. Meanwhile, an excellent polarization behavior is proven by galvanostatic and potentiodynamic tests. All of the results reveal that the developed sensor has a great potential for monitoring chloride ions in concrete environments.
Fabrication and Performance of All-Solid-State Chloride Sensors in Synthetic Concrete Pore Solutions
Directory of Open Access Journals (Sweden)
Hongwei Deng
2010-11-01
Full Text Available One type of all-solid-state chloride sensor was fabricated using a MnO2 electrode and a Ag/AgCl electrode. The potentiometric response of the sensor to chloride in synthetic concrete pore solutions was systematically studied, and the polarization performance was also evaluated. The results show a good linear relationship between the potential reading of the sensor and the logarithm of chloride activity (concentration ranges from 0.05 to 5.0 M, and the potential value remains stable with increasing immersion time. The existence of K+, Ca2+, Na+ and SO42− ions have little influence on the potentiometric response of the sensor to chloride, but the pH has a significant influence on the potential value of the sensor at low chloride concentration. The potential reading of the sensor increases linearly with the solution temperature over the range from 5 to 45 °C. Meanwhile, an excellent polarization behavior is proven by galvanostatic and potentiodynamic tests. All of the results reveal that the developed sensor has a great potential for monitoring chloride ions in concrete environments.
Fluorinated tripodal receptors for potentiometric chloride detection in biological fluids.
Pankratova, Nadezda; Cuartero, Maria; Jowett, Laura A; Howe, Ethan N W; Gale, Philip A; Bakker, Eric; Crespo, Gastón A
2018-01-15
Fluorinated tripodal compounds were recently reported to be efficient transmembrane transporters for a series of inorganic anions. In particular, this class of receptors has been shown to be suitable for the effective complexation of chloride, nitrate, bicarbonate and sulfate anions via hydrogen bonding. The potentiometric properties of urea and thiourea-based fluorinated tripodal receptors are explored here for the first time, in light of the need for reliable sensors for chloride monitoring in undiluted biological fluids. The ion selective electrode (ISE) membranes with tren-based tris-urea bis(CF 3 ) tripodal compound (ionophore I) were found to exhibit the best selectivity for chloride over major lipophilic anions such as salicylate ( [Formula: see text] ) and thiocyanate ( [Formula: see text] ). Ionophore I-based ISEs were successfully applied for chloride determination in undiluted human serum as well as artificial serum sample, the slope of the linear calibration at the relevant background of interfering ions being close to Nernstian (49.8±1.7mV). The results of potentiometric measurements were confirmed by argentometric titration. Moreover, the ionophore I-based ISE membrane was shown to exhibit a very good long-term stability of potentiometric performance over the period of 10 weeks. Nuclear magnetic resonance (NMR) titrations, potentiometric sandwich membrane experiments and density functional theory (DFT) computational studies were performed to determine the binding constants and suggest 1:1 complexation stoichiometry for the ionophore I with chloride as well as salicylate. Copyright © 2017 Elsevier B.V. All rights reserved.
Stability of Dexmedetomidine in 0.9% Sodium Chloride in Two Types of Intravenous Infusion Bags.
Marquis, Kathleen; Hohlfelder, Benjamin; Szumita, Paul M
2017-01-01
Dexmedetomidine is a frequently used sedative in the critical care setting. It is commercially available as a 4-mg/mL premixed compound or as 200-mcg/2-mL vials that must be further diluted prior to administration. However, limited data exist regarding the stability of dexmedetomidine admixtures compounded from the 200-mcg/2-mL vials, particularly for durations greater than 48 hours. Therefore, we performed stability testing on compounded dexmedetomidine prepared in two types of intravenous infusion bags for 14 days. Dexmedetomidine is available as 200-mcg/2-mL vials for dilution, 80-mcg/20-mL single-dose vials, and as 200-mcg/50-mL and 400-mcg/100-mL glass bottles. The stability of dexmedetomidine admixtures has previously been tested for 48 hours. The purpose of this analysis was to test the stability of dexmedetomidine admixtures for 14 days. Six dexmedetomidine admixtures of 200 mcg/50 mL were compounded in polyvinyl chloride and non-polyvinyl chloride bags, three of which were stored under refrigeration and three of which were kept at room temperature. High-performance liquid chromatography testing was performed to determine the concentration at Days 1 through 14. Stability was determined by taking the mean concentration of samples taken from each bag. All samples were tested in duplicate. A sample was considered stable if the concentration was greater than 90% of the original concentration. All samples retained over 90% of the drug under their respective storage conditions for the duration of the study. At time 0, the concentration of dexmedetomidine was between 3.99 mcg/mL and 4.01 mcg/mL. On Day 14, the mean concentration was between 95.8% and 98.9%, depending on the bag type and storage condition. The pH remained between 4.7 and 5.8 during the study period as has previously been reported in the literature. Dexmedetomidine admixtures of 200 mcg/50 mL were stable in both polyvinyl chloride bags and non-polyvinyl chloride bags for 14 days under refrigeration
Energy Technology Data Exchange (ETDEWEB)
Neves, Rosane de Figueiredo; Rebello, Bernardo Machado; Medeiros, Aldo da Cunha [Universidade Federal do Rio Grande do Norte, Natal, RN (Brazil). Programa de Pos-graduacao em Ciencias da Saude]. E-mail: nevesrosane@yahoo.com.br; Moreno, Silvana Ramos Farias; Fonseca, Adenilson de Souza da [Universidade do Estado do Rio de Janeiro (UERJ), RJ (Brazil). Inst. de Biologia Roberto Alcantara Gomes. Lab. de Radiofarmacia Experimental; Caldas, Luiz Querino de Araujo [Universidade Federal Fluminense, Niteroi, RJ (Brazil). Programa de Pos-Graduacao em Ciencias Medicas; Bernardo-Filho, Mario [Instituto Nacional do Cancer (INCa), Rio de Janeiro, RJ (Brazil). Coordenadoria de Pesquisa
2007-09-15
Arctium lappa (burdock) has been used to treat inflammatory processes. Blood constituents labeled with technetium-99m ({sup 99m}Tc) have been utilized in nuclear medicine. It was evaluated the influence of a burdock extract on the labeling of blood constituents with {sup 99m}Tc and on the morphometry of red blood cells. Blood samples from Wistar rats were incubated with burdock extract and the radiolabeling procedure was carried out. Plasma and blood cells, soluble and insoluble fractions of plasma and blood cells were separated. The radioactivity in each fraction was counted and the percentages of radioactivity (%ATI) were determined. Morphology and morphometric (perimeter/area ratio) measurements of red blood cells (RBC) were performed. The incubation with burdock extract significantly (p<0.05) altered the %ATI on the blood compartments and the perimeter/area ratio of RBC, as well as, induced modifications on the shape of RBC. Alterations on membrane could justify the decrease of labeling of blood cells with {sup 99m}Tc obtained in this study. (author)
Development of Tc-99m-DTPA-HSA as a new blood pool scanning agent
Energy Technology Data Exchange (ETDEWEB)
Shirakami, Y; Matsumoto, Y; Yamauchi, Y; Kurami, M; Ueda, N; Hazue, M
1987-04-01
A new HSA preparation, Tc-99m-DTPA-HSA, was developed as a blood pool scanning agent. It shows higher labeling yield (more than 95 %) and higher blood retention (74.7 % I.D. at 1 hour post-injection) than Tc-99m-HSA prepared by directly labeling of HSA with Tc-99m. The introduction of DTPA, a strong bifunctional chelating agent, to HSA provides sites for the stable binding of Tc-99m. The preparation composed of 20 mCi of Tc-99m at calibration time and 10 mg of DTPA-HSA in a vial. After labeling, it had been stable for 24 hours at room temperature. In rats, most of Tc-99m-DTPA-HSA injected was metabolized and excreted in urine and feces. The cumulative radioactivity in urine and feces were 56.0 % and 13.7 % of injected dose, respectively, at 48 hours after injection. Metabolites observed in urine were Tc-99m-urea, Tc-99m-DTPA, reduced Tc-99m and so on. Tc-99m-DTPA-HSA proved, thus, a desirable feature for the blood pool scanning agent.
Diagnosis of primary and metastatic cancer of the thyroid using 201-thallium chloride
International Nuclear Information System (INIS)
Kasatkin, Yu.N.; Purizhanskij, I.I.; Vidyukov, V.I.; Aleshin, A.P.
1995-01-01
Thirty-nine patients with primary bulky formations, relapses, and metastases of thyroid cancer were examined using 201-thallium chloride and 99m Tc-pertechnetate; 13 patients were with benign tumors, 26 with malignant ones and metastases. 201-thallium chloride of 74 to 111 MBq activity was injected intravenously. Scintigraphy was carried out using emission gamma chambers Toshiba-GCA 90B (Japan) and Elscint. Visually the accumulation of 201-thallium chloride was assessed after static scintigraphy of the thyroid and was correlated to the visual pattern of 99m Tc-pertechnetate distribution. A focus of an increased accumulation of the radiopharmaceutical (hot node) was seen in all scintigrams of patients with thyroid cancer which were obtained using 201-thallium chloride, the contrast coefficient (CC) being 1,2 to 1,8. In benign tumors scintigraphy showed either a negligible accumulation of 201-thallium chloride, or none at all, the CC being less than 1 in such cases. 9 refs., 6 figs
6 CFR 11.3 - Demand for payment.
2010-01-01
... 6 Domestic Security 1 2010-01-01 2010-01-01 false Demand for payment. 11.3 Section 11.3 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY CLAIMS § 11.3 Demand for payment. (a) Notice requirements. Generally, before DHS starts the collection actions described in this subpart, DHS...
9 CFR 113.4 - Exemptions to tests.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Exemptions to tests. 113.4 Section 113.4 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... § 113.4 Exemptions to tests. (a) The test methods and procedures contained in all applicable Standard...
9 CFR 113.39 - Cat safety tests.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Cat safety tests. 113.39 Section 113... Procedures § 113.39 Cat safety tests. The safety tests provided in this section shall be conducted when... recommended for use in cats. (a) The cat safety test provided in this paragraph shall be used when the Master...
Procedure for the in vitro determination of ammonia in blood
International Nuclear Information System (INIS)
Jung, K.; Faust, H.
1985-01-01
The invention has been aimed at a procedure for the in vitro determination of ammonia in blood based on microdiffusion and isotope dilution analysis. A definite quantity of blood serum has been mixed with a definite quantity of ammonium chloride labelled with the stable isotope 15 N. The mixture has been subjected to the microdiffusion (K 2 CO 3 additives and absorption of released ammonia in sulphuric acid). The ammonia bound in sulphuric acid has been devoted to a isotope analysis and the ammonia concentration of blood has been determined according to the isotope dilution analysis equation
Moroni, Mirko; Biro, Istvan; Giugliano, Michele; Vijayan, Ranjit; Biggin, Philip C.; Beato, Marco; Sivilotti, Lucia G.
2011-01-01
In the vertebrate CNS, fast synaptic inhibition is mediated by GABA and glycine receptors. We recently reported that the time course of these synaptic currents is slower when intracellular chloride is high. Here we extend these findings to measure the effects of both extracellular and intracellular chloride on the deactivation of glycine and GABA currents at both negative and positive holding potentials. Currents were elicited by fast agonist application to outside-out patches from HEK293 cells expressing rat glycine or GABA receptors. The slowing effect of high extracellular chloride on current decay was detectable only in low intracellular chloride (4 mM). Our main finding is that glycine and GABA receptors “sense” chloride concentrations because of interactions between the M2 pore-lining domain and the permeating ions. This hypothesis is supported by the observation that the sensitivity of channel gating to intracellular chloride is abolished if the channel is engineered to become cation-selective, or if positive charges in the external pore vestibule are eliminated by mutagenesis. The appropriate interaction between permeating ions and channel pore is also necessary to maintain the channel voltage sensitivity of gating, which prolongs current decay at depolarized potentials. Voltage-dependence is abolished by the same mutations that suppress the effect of intracellular chloride and also by replacing chloride with another permeant ion, thiocyanate. These observations suggest that permeant chloride affects gating by a foot-in-the-door effect, binding to a channel site with asymmetrical access from the intracellular and extracellular sides of the membrane. PMID:21976494
Renal abnormalities in congenital chloride diarrhea
International Nuclear Information System (INIS)
Al-Hamad, Nadia M.; Al-Eisa, Amal A.
2004-01-01
Congenital chloride diarrhea CLD is a rare autosomal recessive disorder caused by a defect in the chloride/ bicarbonate exchange in the ileum and colon. It is characterized by watery diarrhea, abdominal distension, hypochloremic hypokalemic metabolic alkalosis with high fecal content of chloride >90 mmol/l. We report 3 patients with CLD associated with various renal abnormalities including chronic renal failure secondary to renal hypoplasia, nephrocalcinosis and congenital nephrotic syndrome. (author)
Effect of gamma radiation on glucose and sodium chloride solutions for injection
International Nuclear Information System (INIS)
Lakoza, G.N.; Grigor'eva, O.L.; Mart'yanova, B.M.; Vorob'eva, E.N.; Kuznetsova, R.M.
1976-01-01
Irradiation of 40% glucose solution with 0.5-4.0 Mrads di not affect the detoxicating properties of glucose or its ability to raise blood sugar levels. Such doses had no effect on the toxicological properties of 40% glucose solution and on 0.9% sodium chloride solution. The biological and physicochemical properties of 40% solution and 0.9% sodium chloride solutions irradiated with sterilizing doses showed no significant alterations during storage for one and three years, respectively. It is concluded that the solutions studied may be sterilized by radiation. (auth.)
9 CFR 113.33 - Mouse safety tests.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Mouse safety tests. 113.33 Section 113.33 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... Procedures § 113.33 Mouse safety tests. One of the mouse safety tests provided in this section shall be...
International Nuclear Information System (INIS)
Rocha, Gabrielle de Souza; Pereira, Marcia de Oliveira; Frydman, Jacques Natan Grinapel; Benarroz, Monica de Oliveira; Garcia-Pinto, Angelica Beatriz; Fonseca, Adenilson de Souza da; Bernardo-Filho, Mario; Pereira, Mario Jose
2008-01-01
This work evaluates effects of the sweetener with sucralose on the labeling of blood constituents with technetium- 99m ( 99m Tc), on the morphology of red blood cells (RBC) and on the biodistribution of sodium pertechnetate in Wistar rats. Animals were treated with sweetener for 8 days. Blood samples were withdrawn and the assay of labeling of blood constituents with 99m Tc was performed. Blood cells (BC) and plasma (P) were isolated. Aliquots of BC and P were also precipitated, soluble and insoluble fractions separated. The radioactivity in each fraction was counted and percentage of incorporated radioactivity (%ATI) determined. Blood smears were prepared, fixed, stained and the qualitative and quantitative morphology of the RBC was evaluated under optical microscopy. In biodistribution experiments, sodium pertechnetate was administrated, organs and tissues isolated, radioactivity was counted and percentage of incorporated radioactivity per gram (%ATI/g) determined. The data showed no significant alterations in %ATI, morphology of RBC and in %ATI/g in the studied organs. (author)
Energy Technology Data Exchange (ETDEWEB)
Rocha, Gabrielle de Souza; Pereira, Marcia de Oliveira; Frydman, Jacques Natan Grinapel [Universidade Federal do Rio Grande do Norte (UFRN), Natal, RN (Brazil). Centro de Ciencias da Saude; Benarroz, Monica de Oliveira; Garcia-Pinto, Angelica Beatriz; Fonseca, Adenilson de Souza da; Bernardo-Filho, Mario [Universidade do Estado do Rio de Janeiro (UERJ), RJ (Brazil). Instituto de Biologia Roberto Alcantara Gomes. Dept. de Biofisica e Biometria]. E-mail: adenilso@uerj.br; Pereira, Mario Jose [Universidade do Estado do Rio de Janeiro (UERJ), RJ (Brazil). Dept. de Fisiologia
2008-12-15
This work evaluates effects of the sweetener with sucralose on the labeling of blood constituents with technetium- 99m ({sup 99m}Tc), on the morphology of red blood cells (RBC) and on the biodistribution of sodium pertechnetate in Wistar rats. Animals were treated with sweetener for 8 days. Blood samples were withdrawn and the assay of labeling of blood constituents with {sup 99m}Tc was performed. Blood cells (BC) and plasma (P) were isolated. Aliquots of BC and P were also precipitated, soluble and insoluble fractions separated. The radioactivity in each fraction was counted and percentage of incorporated radioactivity (%ATI) determined. Blood smears were prepared, fixed, stained and the qualitative and quantitative morphology of the RBC was evaluated under optical microscopy. In biodistribution experiments, sodium pertechnetate was administrated, organs and tissues isolated, radioactivity was counted and percentage of incorporated radioactivity per gram (%ATI/g) determined. The data showed no significant alterations in %ATI, morphology of RBC and in %ATI/g in the studied organs. (author)
9 CFR 113.40 - Dog safety tests.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Dog safety tests. 113.40 Section 113... Procedures § 113.40 Dog safety tests. The safety tests provided in this section shall be conducted when... recommended for use in dogs. Serials which are not found to be satisfactory when tested pursuant to the...
Cord Blood Cells Responses to IL2, IL7 and IL15 Cytokines for mTOR Expression
Directory of Open Access Journals (Sweden)
Anahita Mohammadian
2017-04-01
Full Text Available Purpose: Mammalian target of rapamycin (mTORis important in hematopoiesis and affect cell growth,differentiation and survival. Although previous studies were identified the effect of cytokines on the mononuclear cells development however the cytokines effect on mTOR in cord blood mononuclear cells was unclear. The aim of this study was to evaluate mTOR expression in cord blood mononuclear and cord blood stem cells (CD34+ cells in culture conditions for lymphoid cell development. Methods: Isolation of The mononuclear cells (MNCs from umbilical cord blood were done with use of Ficollpaque density gradient. We evaluated cultured cord blood mononuclear and CD34+ cells in presece of IL2, IL7 and IL15 at distinct time points during 21 days by using flow cytometry. In this study, we presented the role of IL2, IL7 and IL15 on the expression of mTOR in cord blood cells. Results: mTOR expression were increased in peresence of IL2, IL7 and IL15 in day 14 and afterword reduced. However in persence of IL2 and IL15 expression of mTOR significantly reduced. mTOR expression in CD34+ cells decreased significantly from day7 to day 21 in culture. Conclusion: cytokines play important role in mTOR expression during hematopoiesis and development of cord blood mononuclear cells.
An automated system for selective fission product separations; decays of 113-115Pd
International Nuclear Information System (INIS)
Meikrantz, D.H.; Gehrke, R.J.; McIsaac, L.D.; Baker, J.D.; Greenwood, R.C.
1981-01-01
A microcomputer controlled radiochemical separation system has been developed for the isolation and study of fission products with half-lives of approx. >= 10 s. The system is based upon solvent extraction with three centrifugal contactors coupled in series, which provides both rapid and highly efficient separations with large decontamination factors. This automated system was utilized to study the radioactive decays of 113-115 Pd via solvent extraction of the Pd-dimethylglyoxime complex from 252 Cf fission products. As a result of this effort, γ-rays associated with the decay of approx. equal to 90-s sup(113,113m)Pd, 149-s 114 Pd and 47-s 115 Pd have been identified. The isotopic assignments to each of these Pd radioactivities have been confirmed from observation of the growth and decay curves of their respective Ag daughters. In addition, previously unreported Ag γ-rays have been assigned; one to the decay of 69-s 113 Ag, and two to the decay of 19-s 115 Ag. (orig.)
Immunomodulation by gadolinium chloride-induced Kupffer cell phagocytosis blockade
International Nuclear Information System (INIS)
Lazar, G.; Husztik, E.; Kiss, I.; Szakacs, J.; Olah, J.
1998-01-01
Gadolinium chloride (GdCl 3 ), a rare earth metal salt, depresses macrophage activity, and is commonly used to study the physiology of the reticuloendothelial system. In the present work, the effect of GdCl 3 -induced Kupffer cell blockade on the humoral immune response in mice to sheep red blood cells (SRBC) was investigated. Kupffer cell phagocytosis blockade was found to increase both the primary and secondary immune responses to SRBC. The primary immune response was significantly augmented in animals injected intravenously with GdCl 3 2, 3 or 4 days before injection of the cellular antigen, but GdCl 3 injected 7 days before the antigen did not modify the immune response. Increased secondary humoral immune responses were also observed. When GdCl 3 was injected 2 days before the second dose of antigen, the numbers of both IgM and IgG-producing plaque forming cells were augmented. GdCl 3 injected 2 days before the first dose of SRBC did not modify the humoral immune response. Earlier studies with 51 Cr-labelled foreign red blood cells suggested that the augmentation of the humoral immune response in GdCl 3 -pretreated mice is a consequence of the spillover of the antigen from the liver into the spleen and other extrahepatic reticuloendothelial organs. (orig.)
48 CFR 32.113 - Customary contract financing.
2010-10-01
... financing. 32.113 Section 32.113 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 32.113 Customary contract financing. The solicitation must specify the customary contract financing offerors may...
Quantitative cerebral blood flow patterns with the short lived isotope 195m Au
International Nuclear Information System (INIS)
Lindner, P.; Nickel, O.
1984-01-01
A previously reported theory for quantitative cerebral blood flow measurements using intravenously injected nondiffusible radiotracers has been applied on patients after stroke and on volunteers undergoing a mental stimulation exercise. Quantitative measurements of cerebral blood flow patterns (in ml/min/100g) not only in p.a. but also in lateral views of the brain are possible by using of the short-lived (30 sec) isotope Au 195m. The energy spectrum of the eluate of the generator shows two strong photon peaks, one at 68 keV and a second at 262 keV. The 68 keV peak is suitable for perfusion studies in lateral views of the hemispheres, no 'look through' effect is seen. The 262 keV peak is good for studies in p.a. positions. The studies last less than 1 minute and can be repeated after 3 minutes. Parametric images for quantitative regional cerebral blood flow can be generated. The area of occluded vessels in the case of stroke can be made visible. Quantitative activation patterns of cerebral blood flow during mental stimulation can be generated. After optical stimulation a clear increase of blood flow was seen in the visual cortex. The results prove that not only with freely diffusible (like Xenon) but also with nondiffusible indicators like 195m Au it is possible to measure quantitatively cerebral blood flow patterns. Au 195m is very advantageous for quantitative clinical investigations of cerebrovascular disease. (Author)
Antioxidant effect of Arabic gum against mercuric chloride-induced nephrotoxicity.
Gado, Ali M; Aldahmash, Badr A
2013-01-01
The effects of Arabic gum (AG) against nephrotoxicity of mercury (Hg), an oxidative-stress inducing substance, in rats were investigated. A single dose of mercuric chloride (5 mg/kg intraperitoneal injection) induced renal toxicity, manifested biochemically by a significant increase in serum creatinine, blood urea nitrogen, thiobarbituric acid reactive substances, and total nitrate/nitrite production in kidney tissues. In addition, reduced glutathione, glutathione peroxidase, and catalase enzymes in renal tissues were significantly decreased. Pretreatment of rats with AG (7.5 g/kg/day per oral administration), starting 5 days before mercuric chloride injection and continuing through the experimental period, resulted in a complete reversal of Hg-induced increase in creatinine, blood urea nitrogen, thiobarbituric acid reactive substances, and total nitrate/nitrite to control values. Histopathologic examination of kidney tissues confirmed the biochemical data; pretreatment of AG prevented Hg-induced degenerative changes of kidney tissues. These results indicate that AG is an efficient cytoprotective agent against Hg-induced nephrotoxicity by a mechanism related at least in part to its ability to decrease oxidative and nitrosative stress and preserve the activity of antioxidant enzymes in kidney tissues.
The Influence of Salt Water on Chloride Penetration in Geopolymer Concrete
Directory of Open Access Journals (Sweden)
Halim Like Novia
2017-01-01
Full Text Available This paper presents the influence of chloride ion penetration in geopolymer concrete. Fly ash as based material for geopolymer concrete was used in this mixture. Fly ash was mixed with sodium hydroxide (NaOH 8 M and sodium silicate (Na2SiO3 as the alkali solution. The sizes of cylindrical specimens were prepared with a diameter of 100 mm and 200 mm high. Some specimens were immersed in salt water at a concentration of 3.5%, and other control specimens were cured in tap water for 30, 60, 90, and 120 days. The mechanical properties were determined with compressive test which was conducted at 28, 30, 60, 90 and 120 days. Some durability tests were performed for porosity, chloride penetration, and pH measurement. It was found that geopolymer concrete has higher compressive strength than concrete made with Ordinary Portland cement (OPC. However, chloride penetration in geopolymer concrete is higher than OPC. The pH measurement showed that geopolymer concrete has less pH than OPC concrete. The porosity of concrete has been found to influence chloride penetration and pH of concrete.
Harte, P.T.; Trowbridge, P.R.
2010-01-01
Concentrations of chloride in excess of State of New Hampshire water-quality standards (230 mg/l) have been measured in watersheds adjacent to an interstate highway (I-93) in southern New Hampshire. A proposed widening plan for I-93 has raised concerns over further increases in chloride. As part of this effort, road-salt-contaminated groundwater discharge was mapped with terrain electrical conductivity (EC) electromagnetic (EM) methods in the fall of 2006 to identify potential sources of chloride during base-flow conditions to a small stream, Policy Brook. Three different EM meters were used to measure different depths below the streambed (ranging from 0 to 3 m). Results from the three meters showed similar patterns and identified several reaches where high EC groundwater may have been discharging. Based on the delineation of high (up to 350 mmhos/m) apparent terrain EC, seven-streambed piezometers were installed to sample shallow groundwater. Locations with high specific conductance in shallow groundwater (up to 2630 mmhos/m) generally matched locations with high streambed (shallow subsurface) terrain EC. A regression equation was used to convert the terrain EC of the streambed to an equivalent chloride concentration in shallow groundwater unique for this site. Utilizing the regression equation and estimates of onedimensional Darcian flow through the streambed, a maximum potential groundwater chloride load was estimated at 188 Mg of chloride per year. Changes in chloride concentration in stream water during streamflow recessions showed a linear response that indicates the dominant process affecting chloride is advective flow of chloride-enriched groundwater discharge. Published in 2010 by John Wiley & Sons, Ltd.
48 CFR 432.113 - Customary contract financing.
2010-10-01
... financing. 432.113 Section 432.113 Federal Acquisition Regulations System DEPARTMENT OF AGRICULTURE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 432.113 Customary contract financing. The contracting officer may determine the necessity for customary contract financing. The...
Temperature and sodium chloride effects on the solubility of anthracene in water
Energy Technology Data Exchange (ETDEWEB)
Arias-Gonzalez, Israel [Instituto Mexicano del Petroleo, Direccion de Investigacion y Posgrado, Programa de Ingenieria Molecular, Area de Investigacion en Termofisica, Eje Central Lazaro Cardenas Norte 152. 07730, Mexico D.F. (Mexico); Reza, Joel, E-mail: jreza@imp.m [Instituto Mexicano del Petroleo, Direccion de Investigacion y Posgrado, Programa de Ingenieria Molecular, Area de Investigacion en Termofisica, Eje Central Lazaro Cardenas Norte 152. 07730, Mexico D.F. (Mexico); Trejo, Arturo, E-mail: atrejo@imp.m [Instituto Mexicano del Petroleo, Direccion de Investigacion y Posgrado, Programa de Ingenieria Molecular, Area de Investigacion en Termofisica, Eje Central Lazaro Cardenas Norte 152. 07730, Mexico D.F. (Mexico)
2010-11-15
The solubility of anthracene was measured in pure water and in sodium chloride aqueous solution (salt concentration, m/mol . kg{sup -1} = 0.1006, 0.5056, and 0.6082) at temperatures between (278 and 333) K. Solubility of anthracene in pure water agrees fairly well with values reported in earlier similar studies. Solubility of anthracene in sodium chloride aqueous solutions ranged from (6 . 10{sup -8} to 143 . 10{sup -8}) mol . kg{sup -1}. Sodium chloride had a salting-out effect on the solubility of anthracene. The salting-out coefficients did not vary significantly with temperature over the range studied. The average salting-out coefficient for anthracene was 0.256 kg . mol{sup -1}. The standard molar Gibbs free energies, {Delta}{sub tr}G{sup o}, enthalpies, {Delta}{sub tr}H{sup o}, and entropies, {Delta}{sub tr}S{sup o}, for the transfer of anthracene from pure water to sodium chloride aqueous solutions were also estimated. Most of the estimated {Delta}{sub tr}G{sup o} values were positive [(20 to 1230) J . mol{sup -1}]. The analysis of the thermodynamic parameters shows that the transfer of anthracene from pure water to sodium chloride aqueous solution is thermodynamically unfavorable, and that this unfavorable condition is caused by a decrease in entropy.
Wang, Wei; Wang, Huasheng; Hu, Hongbo; Peng, Huasong; Zhang, Xuehong
2015-05-01
As a global regulatory gene in Streptomyces, afsR can activate the biosynthesis of many secondary metabolites. The effect of afsR on the biosynthesis of a phenazine metabolite, lomofungin, was studied in Streptomyces lomondensis S015. There was a 2.5-fold increase of lomofungin production in the afsR-overexpressing strain of S. lomondensis S015 N1 compared with the wild-type strain. Meanwhile, the transcription levels of afsR and two important genes involved in the biosynthesis of lomofungin (i.e., phzC and phzE) were significantly upregulated in S. lomondensis S015 N1. The optimization of metal chlorides was investigated to further increase the production of lomofungin in the afsR-overexpressing strain. The addition of different metal chlorides to S. lomondensis S015 N1 cultivations showed that CaCl2, FeCl2, and MnCl2 led to an increase in lomofungin biosynthesis. The optimum concentrations of these metal chlorides were obtained using response surface methodology. CaCl2 (0.04 mM), FeCl2 (0.33 mM), and MnCl2 (0.38 mM) gave a maximum lomofungin production titer of 318.0 ± 10.7 mg/l, which was a 4.1-fold increase compared with that of S. lomondensis S015 N1 without the addition of a metal chloride. This work demonstrates that the biosynthesis of phenazine metabolites can be induced by afsR. The results also indicate that metal chlorides addition might be a simple and useful strategy for improving the production of other phenazine metabolites in Streptomyces.
Detection of gastrointestinal blood loss with /sup 99m/Tc-labeled, heat-treated red blood cells
International Nuclear Information System (INIS)
Som, P.; Oster, Z.H.; Atkins, H.L.; Goldman, A.G.; Sacker, D.F.; Harold, W.H.; Fairchild, R.G.; Richards, P.; Brill, A.B.
1981-01-01
Studies in dogs showed that heat-treated /sup 99m/Tc-labeled red blood cells (HT/RBC) afford a highly sensitive means of detecting gastrointestinal bleeding as low as 0.12 ml/min, which could not be seen with unheated /sup 99m/Tc-RBC, /sup 99m/Tc-sulfur colloid, or /sup 99m/Tc-DTPA. In addition, as the right upper quadrant and epigastrium remained free of activity, only one fifth to one tenth of the dose of /sup 99m/Tc was needed. The safety of HT/RBC in humans has been documented, and the experiments in dogs suggest that it may have advantages over other agents in detecting gastrointestinal bleeding
Effect of tubular damage by mercuric chloride on kidney function and some urinary enzymes in the dog
Energy Technology Data Exchange (ETDEWEB)
Ellis, B G; Price, R G; Topham, J C
1973-01-01
Alkaline and acid phosphatases, ..beta..-glucosidase, ..beta..-galactosidase, N-acetyl-..beta..-glucosaminidase and lactate dehydrogenase were monitored in the urine and serum of dogs with renal tubular damage induced by a series of increasing doses of mercuric chloride. Evidence is presented that the assay of urinary alkaline and acid phosphatase is the most sensitive method of detecting renal tubular damage in the dog. The clearance of (/sup 14/C)-propranolol was compared before and after the administration of mercuric chloride. In the presence of tubular damage the blood half-life of propranolol and the rate of excretion of metabolites in the urine were increased. 35 references, 7 tables.
5 CFR 831.113 - Payments to children.
2010-01-01
... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Payments to children. 831.113 Section 831.113 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) RETIREMENT Administration and General Provisions § 831.113 Payments to children. For purposes of...
Estimating the chloride transport in cement paste
Directory of Open Access Journals (Sweden)
Princigallo, A.
2012-06-01
Full Text Available A method was developed to measure the diffusion coefficient of chloride ions in cement paste based on an analytical solution to Fick’s 2nd law in a cylindrical coordinate system. This natural method yielded diffusivity results within as little as a month. Testing time was reduced by exploiting the three-dimensional inward flux in the specimen. In an attempt to determine the saturation concentration, dense portland cement pastes were exposed to a concentrated chloride solution. The method proved to be useful for exploring cement hydration-induced changes in the diffusion coefficient of cement paste.
Se ha desarrollado un método para medir el coeficiente de difusión de los iones cloruro en la pasta de cemento, partiendo de una aplicación analítica de la segunda ley de Fick en un sistema de coordinadas cilíndrico. Este método, que es natural, demostró ser capaz de producir resultados de difusividad en tan solo un mes. Se consiguió reducir el tiempo de ensayo mediante el aprovechamiento de la tridimensionalidad del flujo desde el exterior al interior de la probeta.
A fin de determinar la concentración de saturación, se sometieron las pastas de cemento Portland a una disolución de cloruros concentrada. Este método resultó ser útil en el estudio de los cambios del coeficiente de difusión de la pasta de cemento provocados por las reacciones de hidratación que tienen lugar en esta.
International Nuclear Information System (INIS)
Konstam, M.A.; Tu'meh, S.; Wynne, J.; Beck, J.R.; Kozlowski, J.; Holman, B.L.
1982-01-01
We studied the effect of exercise on blood radiotracer concentration after /sup 99m/Tc in vivo red blood cell labeling. After red blood cell labeling, 13 subjects underwent maximal supine bicycle exercise. Radioactivity, analyzed with a well counter, was measured in heparinized venous blood samples drawn at rest and during peak exercise. Changes in activity were compared with changes in erythrocyte count. Activity and erythrocyte counts increased during exercise in all 13 subjects. Percent increase in activity correlated with percent increase in erythrocyte count (r . -0.78), but did not correlate with either duration of exercise or maximal heart rate. Twenty minutes after termination of exercise, activity and erythrocyte count had decreased from peak exercise values but remained higher than preexercise values. In nine nonexercised control subjects, samples drawn 20 minutes apart showed no change in activity or in erythrocyte count. We conclude that exercise increases blood activity, primarily because of an increase in erythrocyte count. During radionuclide ventriculography, blood activity must be measured before and after any intervention, particularly exercise, before a change in left ventricular activity can be attributed to a change in left ventricular volume
Blood cell mRNAs and microRNAs: optimized protocols for extraction and preservation.
Eikmans, Michael; Rekers, Niels V; Anholts, Jacqueline D H; Heidt, Sebastiaan; Claas, Frans H J
2013-03-14
Assessing messenger RNA (mRNA) and microRNA levels in peripheral blood cells may complement conventional parameters in clinical practice. Working with small, precious samples requires optimal RNA yields and minimal RNA degradation. Several procedures for RNA extraction and complementary DNA (cDNA) synthesis were compared for their efficiency. The effect on RNA quality of freeze-thawing peripheral blood cells and storage in preserving reagents was investigated. In terms of RNA yield and convenience, quality quantitative polymerase chain reaction signals per nanogram of total RNA and using NucleoSpin and mirVana columns is preferable. The SuperScript III protocol results in the highest cDNA yields. During conventional procedures of storing peripheral blood cells at -180°C and thawing them thereafter, RNA integrity is maintained. TRIzol preserves RNA in cells stored at -20°C. Detection of mRNA levels significantly decreases in degraded RNA samples, whereas microRNA molecules remain relatively stable. When standardized to reference targets, mRNA transcripts and microRNAs can be reliably quantified in moderately degraded (quality index 4-7) and severely degraded (quality index <4) RNA samples, respectively. We describe a strategy for obtaining high-quality and quantity RNA from fresh and stored cells from blood. The results serve as a guideline for sensitive mRNA and microRNA expression assessment in clinical material.
Karuppanan, Muthupillai; Krishnan, Manigandan; Padarthi, Pavankumar; Namasivayam, Elangovan
2014-01-01
To explore the antioxidant and hepatoprotective effect of ethanolic Mangifera indica (EMI) and methanolic Mangifera indica (MMI) leaf extracts in mercuric chloride (HgCl 2 ) induced toxicity in Swiss albino mice. Toxicity in mice was induced with HgCl 2 (5.0 mg/kg, i.p.), followed by oral intervention with EMI and MMI extracts (25 mg and 50 mg/kg. body wt.) for 30 days. The extent of liver damage was assessed from the extents of histopathological, morphological, antioxidant and liver enzymes. Mercuric chloride-induced mice showed an increased cellular damage whereas leaf extracts of EMI and MMI-treated mice showed recovery of damaged hepatocytes. Mercuric chloride intoxicated mice exhibited a significant (p Mangifera indica extract remarkably reduces hepatotoxicity in mice possibly through its antioxidant potentials. How to cite this article: Karuppanan M, Krishnan M, Padarthi P, Namasivayam E. Hepatoprotec-tive and Antioxidant Effect of Mangifera Indica Leaf Extracts against Mercuric Chloride-induced Liver Toxicity in Mice. Euroasian J Hepato-Gastroenterol 2014;4(1):18-24.
Sorption and leaching of benzalkonium chlorides in agricultural soils.
Khan, Adnan Hossain; Macfie, Sheila M; Ray, Madhumita B
2017-07-01
The adsorption and leaching characteristics of two commonly used benzalkonium chlorides (BACs), benzyl dimethyl dodecyl ammonium chloride (BDDA) and benzyl dimethyl tetradecyl ammonium chloride (BDTA) using three agricultural soils with varied proportions of silt, sand, clay, and organic matter were determined. BACs are cationic surfactants used in large quantities for sanitary and personal care products and are abundant in environmental samples. Adsorption isotherm data (aqueous concentration in the range of 25-150 mg L -1 ) fitted the Langmuir model better than the Freundlich model. BDTA with a longer alkyl chain adsorbed more to soil compared to BDDA, and the soil with the highest percentage of clay adsorbed the most. Column tests conducted using soils amended with lime stabilised biosolids and artificial rain water at a flow rate of 0.2 mL min -1 indicate very low leaching of BACs. Less than 1% of the available BDDA leached through sandy loam soil column with a depth of 9 cm. Therefore, the possibility of BACs to become bioavailable through leaching is very low at environmentally relevant concentrations. Copyright © 2017 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Li Xueming; Tang Libin; Li Lin; Mu Guannan; Liu Guangheng
2006-01-01
The corrosion inhibition of cold rolled steel in 0.5 M sulphuric acid in the presence of o-phenanthroline and sodium chloride (NaCl) has been investigated by using weight loss and electrochemical techniques. The experimental data suggest that the inhibition efficiency increases with increasing NaCl concentration in the presence of 0.0002 M o-phenanthroline, but decreases with increasing temperature. A synergistic effect is observed when o-phenanthroline and chloride ions are used together to prevent cold rolled steel corrosion in 0.5 M sulphuric acid. The polarization curves showed that the complex of o-phenanthroline and NaCl acts as a mixed type inhibitor. The experimental results suggested that the presence of chloride ions in the solution stabilized the adsorption of o-phenanthroline molecules on the metal surface and improved the inhibition efficiency of o-phenanthroline. The adsorption of the complex accords with the Langmuir adsorption isotherm. Some thermodynamic parameters such as adsorption heat, adsorption entropy and adsorption free energy have been calculated by employing thermodynamic equations. Kinetic parameters such as apparent activation energy and pre-exponential factor have been calculated and discussed
Chloride-induced shape transformation of silver nanoparticles in a water environment
International Nuclear Information System (INIS)
Zhang, Lan; Li, Xin; He, Rong; Wu, Lijun; Zhang, Liyun; Zeng, Jie
2015-01-01
The effects of chloride on dissolution and toxicity of silver nanoparticles (AgNPs) have been well studied. However, their intermediate shapes during the transition have not been illustrated to-date. Herein, the chloride-induced shape transformation process of AgNPs under long-term, low-concentration conditions is explored. A unique triangular Ag–AgCl heterostructure is observed. The structure then evolves into a symmetric hexapod and finally into a smaller AgNP. This transformation process could be affected by other environmental conditions, such as 0.4 mg/mL humic acid, 5% surfactants and 1 mg/mL bovine serum albumin protein. Our results offer new knowledge regarding the shape transformation process of AgNPs in the presence of chloride, which can be valuable in relevant studies concerning the effect of water chemistry on the behavior of AgNPs. - Highlights: • Several significant intermediate structures have been firstly observed during AgNPs shape transformation process. • These findings of intermediate shapes offer the new knowledge on understanding the environmental fate of AgNPs. • The effects of other environmental factors on shape transformation have been well explored. - Significant intermediate structures are discovered during the AgNPs environmental process, enriching the knowledge of understanding the environmental fate of AgNPs
International Nuclear Information System (INIS)
Zhuang Jing; Li Fan; Liu Xuan; Liu Zhiping; Lin Jianxian; Ge Yihong; Kaminski, Joseph M.; Summers, James Bradley; Wang Zhichong; Ge Jian; Yu Keming
2009-01-01
Lithium chloride is a therapeutic agent for treatment of bipolar affective disorders. Increasing numbers of studies have indicated that lithium has neuroprotective effects. However, the molecular mechanisms underlying the actions of lithium have not been fully elucidated. This study aimed to investigate whether lithium chloride produces neuroprotective function by improving DNA repair pathway in retinal neurocyte. In vitro, the primary cultured retinal neurocytes (85.7% are MAP-2 positive cells) were treated with lithium chloride, then cultured with serum-free media to simulate the nutrient deprived state resulting from ischemic insult. The neurite outgrowth of the cultured cells increased significantly in a dose-dependent manner when exposed to different levels of lithium chloride. Genomic DNA electrophoresis demonstrated greater DNA integrity of retinal neurocytes when treated with lithium chloride as compared to the control. Moreover, mRNA and protein levels of Ligase IV (involved in DNA non-homologous end-joining (NHEJ) pathway) in retinal neurocytes increased with lithium chloride. The end joining activity assay was performed to determine the role of lithium on NHEJ in the presence of extract from retinal neurocytes. The rejoining levels in retinal neurocytes treated with lithium were significantly increased as compared to the control. Furthermore, XRCC4, the Ligase IV partner, and the transcriptional factor, CREB and CTCF, were up-regulated in retinal cells after treating with 1.0 mM lithium chloride. Therefore, our data suggest that lithium chloride protects the retinal neural cells from nutrient deprivation in vitro, which may be similar to the mechanism of cell death in glaucoma. The improvement in DNA repair pathway involving in Ligase IV might have an important role in lithium neuroprotection. This study provides new insights into the neural protective mechanisms of lithium chloride.
46 CFR 113.25-6 - Power supply.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Power supply. 113.25-6 Section 113.25-6 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) ELECTRICAL ENGINEERING COMMUNICATION AND ALARM SYSTEMS AND EQUIPMENT General Emergency Alarm Systems § 113.25-6 Power supply. The emergency power source...
14 CFR 1214.113 - Allocation of risk.
2010-01-01
... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Allocation of risk. 1214.113 Section 1214.113 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION SPACE FLIGHT General....113 Allocation of risk. The U.S. Government will assume no risk for damages to the customer resulting...
International Nuclear Information System (INIS)
Cardoso, V.N.; Diniz, S.O.F.; Roca, M.; Martin-Comin, J.
2002-01-01
Objectives: To evaluate the possible influence of Propanolol, Ciclosporine, Adryamicine and Nifedipine on the labelling in vitro of red blood cells. Materials And Methods: 20 ml of blood were withdrawn from 40 healthy volunteers that have not used drug seven days before of experiments. 2,0ml aliquots of each sample were incubated at 37 deg. C for 30 min with different concentrations of drugs to the two labelling method used. In the simple method 60ml of stannous chloride solution (10,2 m g/ml) were added and the samples centrifuged at 1000g for 5 min and plasma and blood cells were isolated. After that, 2,0ml of saline, 0,2 ml of EDTA (2,2%) and 7,4 MBq of 99m Tc were also added. To the hypochlorite method the blood samples were incubated with SnCl 2 (10,2m g/ml) for 5 min. After this period of time, 40ml of NaClO solution (1%) and all the reagents mentioned to simple method were added. The samples were centrifuged and labelling yield was calculated to both methods. Conclusions: The analysis of the results shows that using the two methods described there are no significant differences on the in vitro labelling of RBC with 99m Tc at the used concentrations of all of these studied drugs. We can speculate that the interferences observed in vivo may be due the presence of active metabolites or interactions among different drugs
Kataoka, Hajime
2017-07-01
Body fluid volume regulation is a complex process involving the interaction of various afferent (sensory) and neurohumoral efferent (effector) mechanisms. Historically, most studies focused on the body fluid dynamics in heart failure (HF) status through control of the balance of sodium, potassium, and water in the body, and maintaining arterial circulatory integrity is central to a unifying hypothesis of body fluid regulation in HF pathophysiology. The pathophysiologic background of the biochemical determinants of vascular volume in HF status, however, has not been known. I recently demonstrated that changes in vascular and red blood cell volumes are independently associated with the serum chloride concentration, but not the serum sodium concentration, during worsening HF and its recovery. Based on these observations and the established central role of chloride in the renin-angiotensin-aldosterone system, I propose a unifying hypothesis of the "chloride theory" for HF pathophysiology, which states that changes in the serum chloride concentration are the primary determinant of changes in plasma volume and the renin-angiotensin-aldosterone system under worsening HF and therapeutic resolution of worsening HF. Copyright © 2017 Elsevier Ltd. All rights reserved.
Redox reactions in rare earth chloride molten electrolytes
International Nuclear Information System (INIS)
Khokhlov, V.A.; Novoselova, A.V.; Nikolaeva, E.V.; Tkacheva, O.Yu.; Salyulev, A.B.
2007-01-01
Rare earth (REM, Ln) solutions in chloride melts including MCI+LnCl 3 mixtures, where M - alkali metals, were investigated by potentiometry, voltammetry, conductometry in wide concentration and temperature intervals. Findings present complete and trusty information on the valent state of rare earths, structure and composition of complex ions affecting essentially on properties of electrolytes. It is demonstrated that the coexistence of rare earth ions with different oxidation level formed as a result of possible redox reactions: 2Ln 3+ + Ln ↔3Ln 2+ , Ln 2+ + Ln↔2Ln + and nM + + Ln↔nM + Ln n+ appears sharply in thermodynamic and transport properties of molten Ln-LnCl 3 and Ln-LnCl 3 -MCl systems [ru
Activity coefficients in (hydrogen chloride+holmium chloride) (aq) from T=(278.15 to 328.15) K
International Nuclear Information System (INIS)
Roy, Rabindra N.; Roy, Lakshmi N.; Tabor, Bennett J.; Richards, Sarah J.; Cummins, Mason P.; Himes, Curtis A.; Gibbs, Stephanie N.; Christiansen, Edward B.
2005-01-01
Activity coefficients of HCl in (hydrogen chloride+holmium chloride) (aq) have been calculated from the observed e.m.f.s using the Nernst equation. The temperatures ranged from (278.15 to 328.15) K at 5 K intervals and at constant total ionic strengths of (0.01, 0.025, 0.05, 0.1, 0.25, 0.5, 1.0, and 1.5) mol.kg -1 . Electromotive-force measurements were made on the cell without liquid junction of the type:Pt vertical bar H 2 (g,p=101.325kPa) vertical bar HCl(m A ),HoCl 3 (m B ) vertical bar AgCl(s), vertical bar Ag(s) The results of the activity coefficients of HCl for this mixed electrolyte mixture have been interpreted in terms of the simpler Harned's equations and the ion-interaction model of Pitzer. Results show that the quadratic term is sufficient for the full range of Y B (the ionic strength fraction of the salt) to 0.9 at all the ionic strengths studied. The Pitzer's mixing parameters S θH,Ho and Ψ H,Ho,Cl (including higher order electrostatic effects) and θ H,Ho and Ψ H,Ho,Cl (excluding higher order electrostatic effects) have been determined. These values at T=298.15 K are: S θH , Ho =0.115, Ψ H,Ho,Cl =-.071; and θ H,Ho =-.663, Ψ H,Ho,Cl =0.165. The parameters obtained in this study reproduce the activity coefficients of HCl in the mixtures within 0.015 over the entire range of ionic strengths and within 0.009 for I>=0.05 mol.kg -1 over the entire temperature range
Energy Technology Data Exchange (ETDEWEB)
Shibata, Hiroshi; Hisano, Tomoyuki; Kohno, Masahiro (Yamaguchi University, Ube (Japan). Faculty of Agriculture)
1989-10-01
The relation among the blood clearance of {sup 99m}Tc-phytake ({sup 99m}Tc-P), the hepatic uptake of {sup 99m}Tc-P and the severity of hepatic injury was investigated by using the rats with carbon tetrachloride (CCL{sub 4}), D-galactosamine (Gal N), alpha-naphthylisothiocyanate (ANIT) or DL-ethionine (EthN) induced hepatic injury. After the administration of CCL{sub 4}, GalN or ANIT, serum GPT activity increased significantly with the increase of dose level, and the degree of this increase was in the order: GalN>CCl{sub 4}>ANIT. However, the mild increase in serum GPT activity was observed after EthN administration. The blood clearance rate of {sup 99m}Tc-P and the hepatic uptake ratio of {sup 99m}Tc-P decreased with the increase of dose level after CCl{sub 4}, GalN or ANIT administration, but significant changes were not found after EthN administration. The degree of decrease in the blood clearance rate of {sup 99m}Tc-P was in the order: GalNapproxCCl{sub 4}>ANIT, and the degree of decrease in the hepatic uptake ratio of {sup 99m}Tc-P was in the order: GalNapproxCCl{sub 4}>ANIT. These results suggest that the disorder in the hepatocytes may be one of causes for inducing the decrease in the hepatic uptake of {sup 99m}Tc-P, and the consequence of this decrease may induce the decrease in the blood clearance of {sup 99m}Tc-P. (author).
Chloride supporting electrolytes for all-vanadium redox flow batteries.
Kim, Soowhan; Vijayakumar, M; Wang, Wei; Zhang, Jianlu; Chen, Baowei; Nie, Zimin; Chen, Feng; Hu, Jianzhi; Li, Liyu; Yang, Zhenguo
2011-10-28
This paper examines vanadium chloride solutions as electrolytes for an all-vanadium redox flow battery. The chloride solutions were capable of dissolving more than 2.3 M vanadium at varied valence states and remained stable at 0-50 °C. The improved stability appeared due to the formation of a vanadium dinuclear [V(2)O(3)·4H(2)O](4+) or a dinuclear-chloro complex [V(2)O(3)Cl·3H(2)O](3+) in the solutions over a wide temperature range. The all-vanadium redox flow batteries with the chloride electrolytes demonstrated excellent reversibility and fairly high efficiencies. Only negligible, if any, gas evolution was observed. The improved energy capacity and good performance, along with the ease in heat management, would lead to substantial reduction in capital cost and life-cycle cost, making the vanadium chloride redox flow battery a promising candidate for stationary applications. This journal is © the Owner Societies 2011
Buried chloride stereochemistry in the Protein Data Bank.
Carugo, Oliviero
2014-09-23
Despite the chloride anion is involved in fundamental biological processes, its interactions with proteins are little known. In particular, we lack a systematic survey of its coordination spheres. The analysis of a non-redundant set (pairwise sequence identity chloride anion shows that the first coordination spheres of the chlorides are essentially constituted by hydrogen bond donors. Amongst the side-chains positively charged, arginine interacts with chlorides much more frequently than lysine. Although the most common coordination number is 4, the coordination stereochemistry is closer to the expected geometry when the coordination number is 5, suggesting that this is the coordination number towards which the chlorides tend when they interact with proteins. The results of these analyses are useful in interpreting, describing, and validating new protein crystal structures that contain chloride anions.
International Nuclear Information System (INIS)
Brandao, Jose Odinilson de Caldas; Souza, Grace M. Lima de; Carvalho, E.B.; Catanho, Maria T. Jansem de Almeida
2008-01-01
Full text: Medicinal plants originate natural products that are biologically active and widely employed as an alternative source in health care. Mulher Ativa is a phyto medicine used in several gynecological pathologies composed of eight medicinal plants which exhibits estrogen properties in the reproductive tract. The objective of this work was determining the acute toxicity studies investigated of Mulher Ativa (Ma) were performed in mice and antioxidant properties on the labeling of blood cells and plasmatic protein with 99m Tc in vitro. For these studies, mice were divided in two groups, containing 05 animals each. The treated group received Ma in doses of 10, 100, 200, 300, 600, 1000, 2000, 3000 mg/kg of animal weight. Mice were carefully observed 0.5, 1, 2, 3, 4, 24, 48, and 72h after the treatment to assess possible clinical or toxicological symptoms. The second experiment was realized incubating heparin with blood carried out the experiments. Different concentrations of Mulher Ativa were chosen (200; 100; 50; 25; 12,5 mg/mL). A stannous chloride solution was also added and incubation was kept for 60 minutes. After this, 99m Tc was added and the incubation was continued for 10 minutes. The mixture was centrifuged, precipitated with thichloroacetic acid 5% and soluble (SF) and insoluble fractions (IF) were separated. The radioactivities in the groups P, BC, IF-P, SF-P, IF- BC, SF-BC were determined in counter. The analysis of radioactivity in the samples of P and BC isolated from samples of whole blood treated with Mulher Ativa showed decrease significant (*p 99m Tc in the TCA-insoluble fraction of plasma. It is also concluded that presents antioxidant properties. As part of this pharmacological study, the acute toxicity of Ma in mice was first investigated. In these doses, the median lethal dose LD 50 was determined to be higher than highest dose tested i.e 2.0 gkg -1 b.w. From this data, the estimated LD 50 was 2060.1 mg/kg. The product was classified as
Directory of Open Access Journals (Sweden)
Eko Malis
2015-05-01
Full Text Available A polymer monolithic column, poly-(methacrylatoethyltrimethylammonium chloride-co-vinylbenzyl chloride-co-ethylene dimethacrylate or poly-(MATE-co-VBC-co-EDMA was successfully prepared in the current study by one-step thermally initiated in situ polymerization, confined in a steel tubing of 0.5 mm i.d. and 1/16” o.d. The monoliths were prepared from methacrylatoethyltrimethylammonium chloride (MATE and vinylbenzyl chloride (VBC as monomer and ethylene dimethacrylate (EDMA as crosslinker using a binary porogen system of 1-propanol and 1,4-butanediol. The inner wall of steel tubing was pretreated with 3-methacryloxypropyl-trimethoxysilane (MAPS. In order to obtain monolith with adequate column efficiency and low flow resistance, some parameters such as total monomer concentration (%T and crosslinker concentration (%C were optimized. The morphology of this monolith was assessed by scanning electron microscopy (SEM. The properties of the monolithic column, such as permeability, binding capacity, and pore size distribution were also characterized in detail. From the results of the characterization of all monolith variation, monolith with %T 30 %C 50 and %T 35 %C 50 give the best characteristic. These monoliths have high permeability, adequate molecular recognition sites (represented with binding capacity value of over 20 mg/mL, and have over 80% flow through pores in their pore structure contribute to low flow resistance. The resulted monolithic columns have promising potential for dual mode liquid chromatography. MATE may contribute for anion-exchange while VBC may responsible for reversed-phase liquid chromatography.
In vivo/in vitro labeling of red blood cells with sup(99m)Tc and clinical applications
International Nuclear Information System (INIS)
Bauer, R.; Langhammer, H.; Pabst, H.W.; Bauer, U.; Sauer, E.
1981-01-01
A reliable and stabile in vivo/in vitro labeling technique of red blood cells (RBC) is described. The patients are injected 20% of the content of an unlabeled kit used for bone scintigraphy (TechneScan PYP, Byk-Mallinckrodt). 15 minutes later 3 ml blood are sampled in a heparinized syringe. The blood is incubated together with 30-40 mCi (1-1.5 GBq) sup(99m)Tc for 10 minutes in a water bath at 35-37 0 C. After centrifugation at 500 g a dose of 15-25 mCi (0.6-1 GBq) sup(99m)Tc labeled RBC may be withdrawn in a volume of 1-1.5 ml. Mean labeling efficiency is 88%, without using the first eluat of a Tc-generator the yield is as high as 92%. Due to the small volume, the labeled RBC may be reinjected as bolus and first pass radionuclide angiocardiography can be performed. Using labeled RBC, scintigraphy of the intravasal space is possible up to 20 hours without deterioration in contrast or accumulation of radioactivity in the extravasal space or in other organs. Evaluation of heart function can be performed up to 10 hours. In addition, labeled RBC are useful in detecting unknown gastrointestinal bleeding. (orig.) [de
Pargar, F.; Koleva, D.A.; van Breugel, K.
2017-01-01
This paper reports on the advantages and drawbacks of available test methods for the determination of chloride content in cementitious materials in general, and the application of Ag/AgCl chloride sensors in particular. The main factors that affect the reliability of a chloride sensor are presented.
Characterisation of the steel concrete interface submitted to chloride-induced corrosion
International Nuclear Information System (INIS)
L'Hostis, V.; Amblard, E.; Guillot, W.; Paris, C.; Bellot-Gurlet, L.
2013-01-01
This paper deals with the characterisation by means of electrochemical, gravimetric and analytical methods of chloride-induced-corrosion behaviour of steel coupons embedded in chloride-containing-cement pastes. Corrosion rates were estimated from electrochemical measurements as well as gravimetric ones. They vary from 2.6 to 5.7μm/year for 5 and 10 g/L chloride-containing cement pastes. Analytical characterisations (including optical and electron microscopy and Raman micro-spectroscopy) showed that corrosion patterns are not depending on the chloride content of the cement paste (5 and 10 g/L chloride in the interstitial solution). A localised corrosion pattern composed of pits growing inside the metallic substratum, a corrosion products layer (CPL) and a transformed medium (TM) was pointed out. CPL can be divided into two sub-layers (CPL1 and CPL2), characterised by the presence or absence of calcium coming from the cement matrix. (authors)
46 CFR 113.05-7 - Environmental tests.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Environmental tests. 113.05-7 Section 113.05-7 Shipping... SYSTEMS AND EQUIPMENT General Provisions § 113.05-7 Environmental tests. Communication, alarm system, control, and monitoring equipment must meet the environmental tests of— (a) Section 4-9-7, Table 9, of ABS...
Early actions of cadmium in the rat and domestic fowl. VI. Testicular and muscle blood flow changes
Energy Technology Data Exchange (ETDEWEB)
Johnson, A D; Turner, P C
1972-01-01
Male rats and domestic fowl were injected subcutaneously with 0.03 m-moles cadmium chloride (Cd)/kg body weight with some rats previously pre-treated with zinc acetate (Zn). Early relative blood flow changes were studied. In the fowl no blood flow changes were detected due to Cd. In the rat Cd resulted in a sharp increase in blood flow to the testis at 2.5 and 10 min after Cd followed by a return toward normal. Zn pre-treatment resulted in blood flow which was higher than in untreated rats. However, when this pre-treatment was followed by Cd the sharp changes in blood flow, found in rats treated with Cd but without Zn pre-treatment, were not manifest. This also resulted in a more rapid return to control levels. Cd acts on the vasculature of the testis of the rat but not that of the domestic fowl and Zn pre-treatment in the rat moderates the action of Cd on the vasculature. 15 references, 2 figures.
Chloride removal from vitrification offgas
Energy Technology Data Exchange (ETDEWEB)
Slaathaug, E.J. [Westinghouse Hanford Co., Richland, WA (United States)
1995-06-01
This study identified and investigated techniques of selectively purging chlorides from the low-level waste (LLW) vitrification process with the purge stream acceptable for burial on the Hanford Site. Chlorides will be present in high concentration in several individual feeds to the LLW Vitrification Plant. The chlorides are highly volatile in combustion type melters and are readily absorbed by wet scrubbing of the melter offgas. The Tank Waste Remediation System (TWRS) process flow sheets show that the resulting chloride rich scrub solution is recycled back to the melter. The chlorides must be purged from the recycle loop to prevent the buildup of excessively high chloride concentrations.
Chloride removal from vitrification offgas
International Nuclear Information System (INIS)
Slaathaug, E.J.
1995-01-01
This study identified and investigated techniques of selectively purging chlorides from the low-level waste (LLW) vitrification process with the purge stream acceptable for burial on the Hanford Site. Chlorides will be present in high concentration in several individual feeds to the LLW Vitrification Plant. The chlorides are highly volatile in combustion type melters and are readily absorbed by wet scrubbing of the melter offgas. The Tank Waste Remediation System (TWRS) process flow sheets show that the resulting chloride rich scrub solution is recycled back to the melter. The chlorides must be purged from the recycle loop to prevent the buildup of excessively high chloride concentrations
Directory of Open Access Journals (Sweden)
Alois Cizek
2013-09-01
Full Text Available In this study, a series of twenty-five ring-substituted 4-arylamino-7-chloroquinolinium chlorides were prepared and characterized. The compounds were tested for their activity related to inhibition of photosynthetic electron transport (PET in spinach (Spinacia oleracea L. chloroplasts and also primary in vitro screening of the synthesized compounds was performed against mycobacterial species. 4-[(2-Bromophenylamino]-7-chloroquinolinium chloride showed high biological activity against M. marinum, M. kansasii, M. smegmatis and 7-chloro-4-[(2-methylphenylamino]quinolinium chloride demonstrated noteworthy biological activity against M. smegmatis and M. avium subsp. paratuberculosis. The most effective compounds demonstrated quite low toxicity (LD50 > 20 μmol/L against the human monocytic leukemia THP-1 cell line within preliminary in vitro cytotoxicity screening. The tested compounds were found to inhibit PET in photosystem II. The PET-inhibiting activity expressed by IC50 value of the most active compound 7-chloro-4-[(3-trifluoromethylphenylamino]quinolinium chloride was 27 μmol/L and PET-inhibiting activity of ortho-substituted compounds was significantly lower than this of meta- and para-substituted ones. The structure-activity relationships are discussed for all compounds.
Electrochemical degradation of diuron in chloride medium using DSA® based anodes
International Nuclear Information System (INIS)
Pipi, Angelo R. F.; Aquino Neto, Sidney; Andrade, Adalgisa R. de
2013-01-01
This work presents a study of the electrochemical degradation of the herbicide diuron using Ti/Ru x Ti (1-x) O 2 and Ti/Ir x Ti (1-x) O 2 (x 0.3, 0.5 and 0.7) anodes. The investigation of the degradation was conducted in the presence and in the absence of chloride. The study of the herbicide removal as a function of the current density in the absence of chloride yielded 41 and 49% COD (chemical oxygen demand) removals and 10 and 14% TOC (total organic carbon) removal at 100 mA cm -2 , respectively. By keeping the electrolysis time constant (4 h), Ti/Ru 0.7 Ti 0.3 O 2 anode composition was determined as the most active for removal of diuron and its byproduct. The maximum removal value achieved after 4 h was 58%. Addition of chloride doubled the removal ratio, and 100% COD removal was obtained for Ti/Ru 0.3 Ti 0.7 O 2 . High-performance liquid chromatography (HPLC) analysis confirmed the total removal of the herbicide in chloride medium and indicated the formation of byproducts. The generated byproducts presented as function of the applied current density and the anode composition. Ir-based anodes promoted milder oxidation and furnished more byproducts in aqueous medium. (author)
Chemical and physical compatibility of an intravenous solution of epinephrine with calcium chloride.
Weeks, Phillip A; Teng, Yang; Wu, Lei; Sun, Mary; Yang, Zhen; Chow, Diana S-L
2014-01-01
An infusion of epinephrine combined with calcium chloride has been used historically as an intravenous inotropic solution to support critically ill heart failure patients with severe cardiogenic shock. There is no reliable data on the stability of this solution beyond three hours. This study was conducted to evaluate the chemical and physical compatibility of epinephrine (0.032 mg/mL) combined with calcium chloride (4 mg/mL) in a solution for intravenous administration up to 26 hours at room temperature. The chemical stability of epinephrine was monitored by measuring epinephrine concentrations using high-performance liquid chromatography. The physical compatibility of the mixture was determined by measuring spectrophotometric absorbance between 400 to 700 nm. Absorbance greater than 0.010 AU was considered an indicator of the presence of precipitation. The results showed epinephrine with calcium chloride was stable together in normal saline up to 26 hours at room temperature, irrespective of exposure to light. The absorbance of epinephrine throughout the study was less than 0.010 AU, indicating no significant precipitation. Conclusions indicate that epinephrine (0.032 mg/mL) combined with calcium chloride (4 mg/mL) in normal saline at room temperature is acceptably stable up to 26 hours for intravenous administration.
Bone marrow scintigraphy using 111Indium chloride in patients with aplastic anemia
International Nuclear Information System (INIS)
Mabuchi, Nobuhisa; Kumano, Machiko; Matsumoto, Fumiko; Arita, Shigehiro; Nakagawa, Kenichi; Fujii, Koichi; Yoshioka, Hiroyasu; Hamada, Tatsumi; Ishida, Osamu
1987-01-01
Bone marrow scintigraphy using 111 Indium chloride ( 111 In-chloride) was performed in 18 patients with aplastic anemia. The scintigrams were taken 48 hours after an intravenous injection of 111 In-chloride 3 mCi. The distribution patterns on scintigram were classified into 5 types: Type I (4 cases) showed no accumulation, Type II (6 cases) showed low accumulation in usual bone marrow sites. Type III (7 cases) showed island-like distribution in bone marrow sites. Type IV, although no case was included in the 18 patients, shows uneven distribution between pelvis and sternum or vertebrae. Type V (one case) showed almost normal accumulation in usual bone marrow sites. Bone marrow uptake of 111 In-chloride correlated well with the cellularity of bone marrow. There was a tendency for the cases of markedly increased saturated iron-binding capacity to show increased renal activity. In type III, both the percentage of cases who had been treated and the count of reticulocytes were higher than those in the other types, which suggested that island-like distribution on scintigram showed the regeneration responded to the therapy, and related to the erythropoietic function. (author)
International Nuclear Information System (INIS)
Kuriyama, Setsuro
1985-01-01
Using 99m Tc-Human-Serum-Albumin (HSA) accumulation curve we have studied the blood flow in the lower extremities of the hemiplegic patients. After injection of 5 - 10 mCi of 99m Tc-HSA into v. mediana cubiti by the Oldendolf method, we recorded the RI count from both knees. We have examined 68 hemiplegic patients (male: 26, female: 42, right: 31, left: 37, average age: 61.7 years, average Brunnstrom stage of the lower extremity: 3.73, average duration post-stroke: 20.2 months). We counted the accumulation of the isotope in both knees 1 and 30 minutes after injection, and calculated the percentage (partic side/right and left sides), and named them as ''1-minute value'' and ''30-minute value''. During the 15 months period after an attack, the paretic leg had more blood flow than the non-paretic leg. After 15 months after attack, on the contrary, the paretic leg had less blood flow than the non-paretic leg. This tendency is clear in the left-sided hemiplegic patients. There is no relation between the blood flow and age, and the Brunnstrom stage, and the ability to walk. Using digital plethysmography, we have studied the blood flow in the finger and toe, too. We have examined 57 hemiplegic patients. We have averaged the five hights of the wave (mV/V), and calculated the percentage involved (paretic side/right and left) and labled it ''the paretic blood flow value (of the finger and of the toe)''. During the 12 month period after an attack, the paretic side had more blood flow than the non-paratic side. After 15 month after an attack, on the contrary, the paretic side had less blood flow than the non-paretic side. This tendency is clear in the finger than the toe. There is no correlation between the blood flow and the age, and the Brunnstrom stage, and the ability to walk. (author)
Directory of Open Access Journals (Sweden)
Shi-Cong Cui
2001-10-01
Full Text Available The Baylis-Hillman reactions of various aryl aldehydes with methyl vinyl ketone at temperatures below -20oC using Lewis acids such as titanium (IV chloride, boron (III chloride or zirconium (IV chloride in the presence of a catalytic amount of selected amines used as a Lewis bases afford the chlorinated compounds 1 as the major product in very high yields. Acrylonitrile can also undergo the same reaction to give the corresponding chlorinated product in moderate yield. A plausible reaction mechanism is proposed. However, if the reaction was carried out at room temperature (ca. 20oC, then the Z-configuration of the elimination product 3, derived from 1, was formed as the major product.
9 CFR 113.55 - Detection of extraneous agents in Master Seed Virus.
2010-01-01
... Master Seed Virus. 113.55 Section 113.55 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Ingredient Requirements § 113.55 Detection of extraneous agents in Master Seed Virus...
Neutron Gauge Calibration Curve as Affected by Chloride Concentration and Bulk Density of Loam Soil
International Nuclear Information System (INIS)
AL-Hasani, A.A.; Fahad, A.A.; Shihab, R.M.
2010-01-01
chloride concentration and bulk density are considered among important factors affecting calibration curve of neutron gauge in the soil.The aim of this study was to investigate the effect of chloride concentration and bulk density of a loam soil on neutron gauge calibration curve.Sufficient amount of loam soil was air dried screened through a 2 mm sieve,and divided into three equal portions.Sodium chloride of 2.5 and 6.6g kg'-1 soil was added to the first and second portions,respectively.The third portion was left as a control.The soil then moistened and mixed well to make volumetric water content within the range of 0.01 to 0.24 cm 3 cm - 3. The moist soil was packed into an iron drum 0.80 m diameter and 1.00 m height to obtain bulk densities of 1.10 and 1.30 to 1.60 Mg m - 3 for uncompacted soil,respectively.Access tube 0.05 m inner diameter was installed in the center of the drum.Three readings from CPN 503 neutron gauge were taken at each 0.15,0.30, 0.45,and 0.75 m depth.Results indicated that the count (counts/standard count) for an aqueous solution decreased with the increase in chloride concentration.Similarly, the slope of the linear calibration curves of the investigated soil decreased with the increase in chloride concentration.Shifting of the curves was 9 to 10%for the uncompacted soil, whereas it was 12 to 14 % for the compacted of low and high concentration of chloride, respectively . Results of changing bulk density always reduced the slope value as compared with the uncorrected count ratio.
9 CFR 113.326 - Avian Pox Vaccine.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Avian Pox Vaccine. 113.326 Section 113... Vaccines § 113.326 Avian Pox Vaccine. Fowl Pox Vaccine and Pigeon Pox Vaccine shall be prepared from virus... established as follows: (1) Fowl pox susceptible birds all of the same age and from the same source, shall be...
46 CFR 113.10-9 - Power supply.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Power supply. 113.10-9 Section 113.10-9 Shipping COAST... SYSTEMS AND EQUIPMENT Fire and Smoke Detecting and Alarm Systems § 113.10-9 Power supply. (a) General... battery, the charger must be supplied from the final emergency power source. Upon loss of power to the...
46 CFR 113.43-5 - Power supply.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Power supply. 113.43-5 Section 113.43-5 Shipping COAST... SYSTEMS AND EQUIPMENT Steering Failure Alarm Systems § 113.43-5 Power supply. Each steering failure alarm system must be supplied by a circuit that: (a) Is independent of other steering gear system and steering...
International Nuclear Information System (INIS)
Hachiya, Takenori; Inugami, Atsushi; Iida, Hidehiro; Mizuta, Yoshihiko; Kawakami, Takeshi; Inoue, Minoru
1999-01-01
To measure regional cerebral blood flow (rCBF) by blood sampling using 99m Tc-ECD we devised a method of measuring the radioactive concentration in arterial blood sample with a gamma camera. In this method the head and a blood sample are placed within the same visual field to record the SPECT data of both specimens simultaneously. The results of an evaluation of the counting rate performance, applying the 30 hours decaying method using 99m Tc solution showed that this method is not comparable to the well-type scintillation counter and in clinical cases the active concentration in arterial blood sample remained well within the dynamic range. In addition, examination of the influence of scattered radiation from the brain by the dilution method showed that it was negligible at a distance of more than 7.5 cm between the brain and the arterial blood sample. In the present study we placed a head-shaped phantom next to the sample. The results of the examinations suggested that this method is suitable for clinical application, and because it does not require a well-type scintillation counter, it is expected to find wide application. (author)
13 CFR 113.410 - Comparable facilities.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Comparable facilities. 113.410... Discrimination on the Basis of Sex in Education Programs Or Activities Prohibited § 113.410 Comparable facilities. A recipient may provide separate toilet, locker room, and shower facilities on the basis of sex, but...
Crown Ether Complexes of Alkali-Metal Chlorides from SO2.
Reuter, Kirsten; Rudel, Stefan S; Buchner, Magnus R; Kraus, Florian; von Hänisch, Carsten
2017-07-18
The structures of alkali-metal chloride SO 2 solvates (Li-Cs) in conjunction with 12-crown-4 or 1,2-disila-12-crown-4 show strong discrepancies, despite the structural similarity of the ligands. Both types of crown ethers form 1:1 complexes with LiCl to give [Li(1,2-disila-12-crown-4)(SO 2 Cl)] (1) and [Li(12-crown-4)Cl]⋅4 SO 2 (2). However, 1,2-disila-12-crown-4 proved unable to coordinate cations too large for the cavity diameter, for example, by the formation of sandwich-type complexes. As a result, 12-crown-4 reacts exclusively with the heavier alkali-metal chlorides NaCl, KCl and RbCl. Compounds [Na(12-crown-4) 2 ]Cl⋅4 SO 2 (3) and [M(12-crown-4) 2 (SO 2 )]Cl⋅4 SO 2 (4: M=K; 5: M=Rb) all showed S-coordination to the chloride ions through four SO 2 molecules. Compounds 4 and 5 additionally exhibit the first crystallographically confirmed non-bridging O,O'-coordination mode of SO 2 . Unexpectedly, the disila-crown ether supports the dissolution of RbCl and CsCl in the solvent and gives the homoleptic SO 2 -solvated alkali-metal chlorides [MCl⋅3 SO 2 ] (6: M=Rb; 7: M=Cs), which incorporate bridging μ-O,O'-coordinating moieties and the unprecedented side-on O,O'-coordination mode. All compounds were characterised by single-crystal X-ray diffraction. The crown ether complexes were additionally studied by using NMR spectroscopy, and the presence of SO 2 at ambient temperature was revealed by IR spectroscopy of the neat compounds. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
2010-07-01
... dichloride, vinyl chloride and polyvinyl chloride plants. 61.65 Section 61.65 Protection of Environment... AIR POLLUTANTS National Emission Standard for Vinyl Chloride § 61.65 Emission standard for ethylene dichloride, vinyl chloride and polyvinyl chloride plants. An owner or operator of an ethylene dichloride...
Electrochemical Chloride extraction using external electrodes?
DEFF Research Database (Denmark)
Ottosen, Lisbeth M.; Pedersen, Anne Juul
2006-01-01
Electrochemical methods for the removal of chloride from concrete have been developed and the methods are primarily designed for situations where corrosion has started due to an increased chloride concentration in the vicinity of the reinforcement. In these methods the reinforcement is used...... as the cathode. However, some unwanted side effects can occur, including alkali-silica reaction and in some cases hydrogen embrittlement. It is also suggested also to use electrochemical chloride extraction in a preventive way in constructions where chloride induced corrosion is likely to be a problem after...... a period of time, i.e. remove the chlorides before the chloride front reaches the reinforcement. If the chlorides are removed from outer few centimetres from the surface, the chloride will not reach the reinforcement and cause damage. By using the electrochemical chloride removal in this preventive way...
Effects of sodium chloride on radiation protection and modification of gamma-ray treated rice seeds
International Nuclear Information System (INIS)
Wang Cailian; Zhao Kongnan; Shen Mei; Xu Gang; Chen Qiufang
1992-11-01
The radiation protection effect of sodium chloride on dormant and germinating rice seeds treated with gamma-rays, and modification effect of sodium chloride on mutation were studied. Results show that the radiation-damage effect on seedling growth, percentage of seedling growth, percentage of seedling growth and fertility in M 1 generation is significantly enhanced with the increasing of dose. However, the seedling growth, percentage of seedling growth and fertility can be improved if the irradiated seeds are pre-treated with sodium chloride solution having concentrations of 0.05, 0.10 and 0.20 mol/L. The difference between treated group and control group is very significant. Results also show that pre-treatment and post-treatment by sodium chloride can raise the mutation frequencies of chlorophyll deficient seedlings, especially, the mutation frequency of early heading date and height is more considerably. The conclusion is that the sodium chloride, as a radiation protection agent, combined with gamma-ray treatment could reduce the effect of radiation-damage on M 1 generation and raise the mutation frequency in M 2 generation, and this result will be helpful in rice breeding
Ueira-Vieira, C; Tavares, R R; Morelli, S; Pereira, B B; Silva, R P; Torres-Mariano, A R; Kerr, W E; Bonetti, A M
2013-06-20
In order to optimize preparations of bee metaphases, we tested cobalt chloride, which has been used as a metaphase inducer in other organisms, such as hamsters and fish. Four microliters of 65 mM cobalt chloride aqueous solution was topically applied to larval and pupal stages of the stingless bee Melipona scutellaris. The cerebral ganglion was removed after treatment and prepared for cytogenetic analysis. Identically manipulated untreated individuals were used as controls. The number of metaphases was increased 3-fold in treated individuals compared to controls. The micronucleus test showed no mutagenic effects of cobalt chloride on M. scutellaris cells. We concluded that cobalt chloride is a metaphase-inducing agent in M. scutellaris, thus being useful for cytogenetic analyses.
International Nuclear Information System (INIS)
Rabin, B.M.; Hunt, W.A.; Lee, J.
1987-01-01
These experiments were designed to determine whether treatment with two subthreshold doses of radiation or lithium chloride, either alone or in combination, could lead to taste aversion learning. The first experiment determined the thresholds for a radiation-induced taste aversion at 15-20 rad and for lithium chloride at 0.30-0.45 mEq/kg. In the second experiment it was shown that exposing rats to two doses of 15 rad separated by up to 3 hr produced a taste aversion. Treatment with two injections of lithium chloride (0.30 mEq/kg) did not produce a significant reduction in preference. Combined treatment with radiation and lithium chloride did produce a taste aversion when the two treatments were administered within 1 hr of each other. The results are discussed in terms of the implications of these findings for understanding the nature of the unconditioned stimuli leading to the acquisition of a conditioned taste aversion
International Nuclear Information System (INIS)
Liteplo, M.P.
1992-01-01
Compounds labeled with 99m Tc are widely used for imaging in diagnostic medicine to provide information on physiological functions of the body not obtainable with other imaging techniques that give primarily anatomical information, such as X-ray and magnetic resonance imaging. These radiopharmaceuticals are typically injected intravenously and allowed to distribute in the body; the patient is then imaged using a scintillation gamma camera. For example, in patients suspected of coronary artery disease, 99m Tc-Sestamibi (Cardiolite reg-sign) is injected into the blood stream during a stress test and is rapidly extracted by the heart muscle in proportion to its regional blood supply. The resulting images of the heart clearly distinguish areas of normal heart muscle form areas where the blood supply is compromised by coronary artery disease. In recent years, there has been considerable interest in the application of 99m Tc compounds to the diagnosis of brain diseases and disorders. This paper describes the development of 99m Tc-ethyl cysteinate dimer ( 99m Tc-ECD, Neurolite reg-sign) as a radiopharmaceutical for imaging the blood supply to the brain in patients with stroke or head trauma. In research, this agent is also useful in studying the effect of sensory stimuli, therapeutic drugs, and drugs of abuse on brain blood flow
Rief, Matthias; Hartmann, Lisa; Geisel, Dominik; Richter, Felicitas; Brenner, Winfried; Dewey, Marc
2018-07-01
To investigate DNA double-strand breaks (DSBs) in blood lymphocytes induced by two-day 99m Tc-MIBI myocardial perfusion scintigraphy (MPS) using y-H2AX immunofluorescence microscopy and to correlate the results with 99m Tc activity in blood samples. Eleven patients who underwent two-day MPS were included. DSB blood sampling was performed before and 5min, 1h and 24h after the first and second radiotracer injections. 99m Tc activity was measured in each blood sample. For immunofluorescence microscopy, distinct foci representing DSBs were quantified in lymphocytes after staining for the phosphorylated histone variant y-H2AX. The 99m Tc-MIBI activity measured on days one and two was similar (254±25 and 258±27 MBq; p=0.594). Compared with baseline DSB foci (0.09±0.05/cell), a significant increase was found at 5min (0.19±0.04/cell) and 1h (0.18±0.04/cell) after the first injection and at 5min and 1h after the second injection (0.21±0.03 and 0.19±0.04/cell, respectively; p=0.003 for both). At 24h after the first and second injections, the number of DSB foci had returned to baseline (0.06±0.02 and 0.12±0.05/cell, respectively). 99m Tc activity levels in peripheral blood samples correlated well with DSB counts (r=0.451). DSB counts reflect 99m Tc-MIBI activity after injection for two-day MPS, and might allow individual monitoring of biological effects of cardiac nuclear imaging. • Myocardial perfusion scintigraphy using 99m Tc induces time-dependent double-strand breaks (DSBs) • γ-H2AX immunofluorescence microscopy shows DSB as an early response to radiotracer injection • Activity measurements of 99m Tc correlate well with detected DSB • DSB foci induced by 99m Tc return to baseline 24h after radiotracer injection.
International Nuclear Information System (INIS)
Liang, J.; Srinivasan, P. Bala; Blawert, C.; Dietzel, W.
2010-01-01
The electrochemical degradation of a silicate- and a phosphate-based plasma electrolytic oxidation (PEO) coated AM50 magnesium alloy obtained using a pulsed DC power supply was investigated using potentiodynamic polarisation and electrochemical impedance spectroscopy (EIS) in NaCl solutions of different chloride ion concentrations viz., 0.01 M, 0.1 M, 0.5 M and 1 M. The surface of the PEO coated specimens after 50 h of immersion/EIS testing was examined by optical microscopy and scanning electron microscopy. The results showed that the corrosion deterioration of PEO coated magnesium alloy in NaCl solutions was significantly influenced by chloride ion concentration. The silicate-based coating was found to offer a superior corrosion resistance to the magnesium substrate than the phosphate-based coatings in lower chloride ion concentration NaCl solutions (0.01 M and 0.1 M NaCl). On the other hand both these PEO coatings were found to be highly susceptible to localized damage, and could not provide an effective corrosion protection to Mg alloy substrate in solutions containing higher chloride concentrations (0.5 M and 1 M). The extent of localized damage was observed to be more with increase in chloride concentration in both the cases.
Chloride regulates afferent arteriolar contraction in response to depolarization
DEFF Research Database (Denmark)
Hansen, P B; Jensen, B L; Skott, O
1998-01-01
-Renal vascular reactivity is influenced by the level of dietary salt intake. Recent in vitro data suggest that afferent arteriolar contractility is modulated by extracellular chloride. In the present study, we assessed the influence of chloride on K+-induced contraction in isolated perfused rabbit...... afferent arterioles. In 70% of vessels examined, K+-induced contraction was abolished by acute substitution of bath chloride. Consecutive addition of Cl- (30, 60, 80, 100, 110, and 117 mmol/L) restored the sensitivity to K+, and half-maximal response was observed at 82 mmol/L chloride. The calcium channel...... antagonist diltiazem (10(-6) mol/L) abolished K+-induced contractions. Bicarbonate did not modify the sensitivity to chloride. Norepinephrine (10(-6) mol/L) induced full contraction in depolarized vessels even in the absence of chloride. Iodide and nitrate were substituted for chloride with no inhibitory...
A quantitative study of cerebral blood flow in childhood using {sup 99m}Tc-ECD patlak-plot method
Energy Technology Data Exchange (ETDEWEB)
Yamamori, Hiroyuki; Kohira, Ryutaro; Fujita, Yukihiko [Nihon Univ., Tokyo (Japan). School of Medicine] (and others)
2001-12-01
Mean cerebral blood flow (mCBF) was measured by SPECT using the {sup 99m}Tc-ECD Patlak-Plot method in 54 subjects (age: 1 to 14 years). Regional cerebral blood flow (rCBF) values were obtained using Lassen's correction algorithm. The mCBF values were 52.2 ml/100 g/min in those aged 1-4 years, 49.3 ml/100 g/min in those aged 5-9 years, and 48.1 ml/100 g/min in those aged 10-14 years. There was a slight decrease with advancing age. The rCBF in the frontal region was lower than in other regions in those aged 1-4 years. The Patlak-Plot method is suitable for examination of children, because it does not require arterial blood sampling. (author)
Energy Technology Data Exchange (ETDEWEB)
Treiner, C. (Universite Pierre et Marie Curie, Paris (France)); Nortz, M.; Vaution, C. (Faculte de Pharmacie de Paris-sud, Chatenay-Malabry (France))
1990-07-01
The apparent partition coefficient P of barbituric acids between micelles and water has been determined in mixed binary surfactant solutions from solubility measurements in the whole micellar composition range. The binary systems chosen ranged from the strongly interacting system dodecyltrimethylammonium chloride + sodium dodecyl sulfate to weakly interacting systems such as benzyldimethyltetradecylammonium chloride + tetradecyltrimethyammonium chloride. In all cases studied, mixed micelle formation is unfavorable to micellar solubilization. A correlation is found between the unlike surfactants interaction energy, as measured by the regular solution parameter {beta} and the solute partition coefficient change upon surfactant mixing. By use of literature data on micellar solubilization in binary surfactant solutions, it is shown that the change of P for solutes which are solubilized by surface adsorption is generally governed by the sign and amplitude of the interaction parameter {beta}.
21 CFR 113.81 - Product preparation.
2010-04-01
...) Blanching by heat, when required in the preparation of food for canning, should be effected by heating the... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Product preparation. 113.81 Section 113.81 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR...
Lytvynenko, Anton S; Kolotilov, Sergey V; Kiskin, Mikhail A; Eremenko, Igor L; Novotortsev, Vladimir M
2015-02-28
The results of quantum chemical modeling of organic and metal-containing intermediates that occur in electrocatalytic dehalogenation reactions of organic chlorides are presented. Modeling of processes that take place in successive steps of the electrochemical reduction of representative C1 and C2 chlorides - CHCl3 and Freon R113 (1,1,2-trifluoro-1,2,2-trichloroethane) - was carried out by density functional theory (DFT) and second-order Møller-Plesset perturbation theory (MP2). It was found that taking solvation into account using an implicit solvent model (conductor-like screening model, COSMO) or considering explicit solvent molecules gave similar results. In addition to modeling of simple non-catalytic dehalogenation, processes with a number of complexes and their reduced forms, some of which were catalytically active, were investigated by DFT. Complexes M(L1)2 (M = Fe, Co, Ni, Cu, Zn, L1H = Schiff base from 2-pyridinecarbaldehyde and the hydrazide of 4-pyridinecarboxylic acid), Ni(L2) (H2L2 is the Schiff base from salicylaldehyde and 1,2-ethylenediamine, known as salen) and Co(L3)2Cl2, representing a fragment of a redox-active coordination polymer [Co(L3)Cl2]n (L3 is the dithioamide of 1,3-benzenedicarboxylic acid), were considered. Gradual changes in electronic structure in a series of compounds M(L1)2 were observed, and correlations between [M(L1)2](0) spin-up and spin-down LUMO energies and the relative energies of the corresponding high-spin and low-spin reduced forms, as well as the shape of the orbitals, were proposed. These results can be helpful for determination of the nature of redox-processes in similar systems by DFT. No specific covalent interactions between [M(L1)2](-) and the R113 molecule (M = Fe, Co, Ni, Zn) were found, which indicates that M(L1)2 electrocatalysts act rather like electron transfer mediators via outer-shell electron transfer. A relaxed surface scan of the adducts {M(L1)2·R113}(-) (M = Ni or Co) versus the distance between the
Meng, Lina; Nguyen, Cherwyn M; Patel, Samit; Mlynash, Michael; Caulfield, Anna Finley
2018-03-01
One institution's experience with use of peripheral i.v. (PIV) catheters for prolonged infusions of 3% sodium chloride injection at rates up to 100 mL/hr is described. A prospective, observational, 13-month quality assurance project was conducted at an academic medical center to evaluate frequencies of patient and catheter phlebitis among adult inpatients who received both an infusion of 3% sodium chloride injection for a period of ≥4 hours through a dedicated PIV catheter and infusions of routine-care solutions (RCSs) through separate PIV catheters during the same hospital stay. Sixty patients received PIV infusions through a total of 291 catheters during the study period. The majority of patients (78%) received infusions of 3% sodium chloride injection for intracranial hypertension, with 30% receiving such infusions in the intensive care unit. Phlebitis occurred in 28 patients (47%) during infusions of 3% sodium chloride and 26 patients (43%) during RCS infusions ( p = 0.19). Catheter phlebitis occurred in 73 catheters (25%), with no significant difference in the frequencies of catheter phlebitis with infusion of 3% sodium chloride versus RCSs (30% [32 of 106 catheters]) versus 22% [41 of 185 catheters]), p = 0.16). Patient and catheter phlebitis rates were not significantly different with infusions of 3% sodium chloride injection versus RCSs, suggesting that an osmolarity cutoff value of 900 mOsm/L for peripheral infusions of hypertonic saline solutions may not be warranted. Copyright © 2018 by the American Society of Health-System Pharmacists, Inc. All rights reserved.
Chlorides behavior in raw fly ash washing experiments
International Nuclear Information System (INIS)
Zhu Fenfen; Takaoka, Masaki; Oshita, Kazuyuki; Kitajima, Yoshinori; Inada, Yasuhiro; Morisawa, Shinsuke; Tsuno, Hiroshi
2010-01-01
Chloride in fly ash from municipal solid waste incinerators (MSWIs) is one of the obstructive substances in recycling fly ash as building materials. As a result, we have to understand the behavior of chlorides in recycling process, such as washing. In this study, we used X-ray absorption near edge structure (XANES) and X-ray diffraction (XRD) to study the chloride behavior in washed residue of raw fly ash (RFA). We found that a combination of XRD and XANES, which is to use XRD to identify the situation of some compounds first and then process XANES data, was an effective way to explain the chlorides behavior in washing process. Approximately 15% of the chlorine in RFA was in the form of NaCl, 10% was in the form of KCl, 51% was CaCl 2 , and the remainder was in the form of Friedel's salt. In washing experiments not only the mole percentage but also the amount of soluble chlorides including NaCl, KCl and CaCl 2 decreases quickly with the increase of liquid to solid (L/S) ratio or washing frequency. However, those of insoluble chlorides decrease slower. Moreover, Friedel's salt and its related compound (11CaO.7Al 2 O 3 .CaCl 2 ) were reliable standards for the insoluble chlorides in RFA, which are strongly related to CaCl 2 . Washing of RFA promoted the release of insoluble chlorides, most of which were in the form of CaCl 2 .
International Nuclear Information System (INIS)
Liu Min; Wang Lili; Zhu Lanying; Li Hui; Sun Dezhi; Di Youying; Li Linwei
2010-01-01
The mixing enthalpies of N-glycylglycine with xylitol and their respective enthalpies of dilution in aqueous sodium chloride and potassium chloride solutions have been determined by using flow-mix isothermal microcalorimetry at the temperature of 298.15 K. These experimental results have been used to determine the heterotactic enthalpic interaction coefficients (h xy , h xxy , and h xyy ) according to the McMillan-Mayer theory. It has been found that the heterotactic enthalpic pairwise interaction coefficients h xy between N-glycylglycine and xylitol in aqueous sodium chloride and potassium chloride solutions are negative and become less negative with an increase in the molality of sodium chloride or potassium chloride. The results are discussed in terms of solute-solute and solute-solvent interactions.
Energy Technology Data Exchange (ETDEWEB)
Liu Min, E-mail: panpanliumin@163.co [College of Chemistry and Chemical Engineering, Liao Cheng University, Liaocheng, Shandong 252059 (China); Wang Lili [College of Chemistry and Chemical Engineering, Liao Cheng University, Liaocheng, Shandong 252059 (China); Zhu Lanying [College of Life Science and Bioengineering, Liao Cheng University, Liaocheng, Shandong 252059 (China); Li Hui; Sun Dezhi; Di Youying; Li Linwei [College of Chemistry and Chemical Engineering, Liao Cheng University, Liaocheng, Shandong 252059 (China)
2010-07-15
The mixing enthalpies of N-glycylglycine with xylitol and their respective enthalpies of dilution in aqueous sodium chloride and potassium chloride solutions have been determined by using flow-mix isothermal microcalorimetry at the temperature of 298.15 K. These experimental results have been used to determine the heterotactic enthalpic interaction coefficients (h{sub xy}, h{sub xxy}, and h{sub xyy}) according to the McMillan-Mayer theory. It has been found that the heterotactic enthalpic pairwise interaction coefficients h{sub xy} between N-glycylglycine and xylitol in aqueous sodium chloride and potassium chloride solutions are negative and become less negative with an increase in the molality of sodium chloride or potassium chloride. The results are discussed in terms of solute-solute and solute-solvent interactions.
Modification of a two blood sample method used for measurement of GFR with 99mTc-DTPA.
Surma, Marian J; Płachcińska, Anna; Kuśmierek, Jacek
2018-01-01
Measurements of GFR may be performed with a slope/intercept method (S/I), using only two blood samples taken in strictly defined time points. The aim of the study was to modify this method in order to extend time intervals suitable for blood sampling. Modification was based on a variation of a Russel et al. model parameter, selection of time intervals suitable for blood sampling and assessment of uncertainty of calculated results. Archived values of GFR measurements of 169 patients with different renal function, from 5.5 to 179 mL/min, calculated with a multiple blood sample method were used. Concentrations of a radiopharmaceutical in consecutive minutes, from 60th to 190th after injection, were calculated theoretically, using archived parameters of biexponential functions describing a decrease in 99mTc-DTPA concentration in blood plasma with time. These values, together with injected activities, were treated as measurements and used for S/I clearance calculations. Next, values of S/I clearance were compared with the multiple blood sample method in order to calculate suitable values of exponent present in a Russel's model, for every combination of two blood sampling time points. A model was considered accurately fitted to measured values when SEE ≤ 3.6 mL/min. Assessments of uncertainty of obtained results were based on law of error superposition, taking into account mean square prediction error and also errors introduced by pipetting, time measurement and stochastic radioactive decay. The accepted criteria resulted in extension of time intervals suitable for blood sampling to: between 60 and 90 minutes after injection for the first sample and between 150 and 180 minutes for the second sample. Uncertainty of results was assessed as between 4 mL/min for GFR = 5-10 mL/min and 8 mL/min for GFR = 180 mL/min. Time intervals accepted for blood sampling fully satisfy nuclear medicine staff and ensure proper determination of GFR. Uncertainty of results is entirely
49 CFR 214.113 - Head protection.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Head protection. 214.113 Section 214.113 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... conform to the national consensus standards for industrial head protection (American National Standards...
Determination of uteroplacental blood flow by a radionuclide technique
International Nuclear Information System (INIS)
Rosati, P.; Exacuostos, C.; Bellati, U.; Maini, C.L.; Bonetti, M.G.; Galli, G.
1987-01-01
The placental blood flow was determined using a non-invasive radioisotopic approach, with the intravenous administration of 113m In (37 MBq). The method was employed in 20 normal pregnancies, in 24 patients with intrauterine growth retardation, in 8 patients with iso-Rh-incompatibility and in 9 patients with gestational diabetes. In the group with intrauterine growth retardation 2 pregnancies with extensive fetal malformations were included. In one case without evident histological placental alteration the index was 3.94 at 34 weeks of gestation and 5.62 at 36 weeks of gestation. In the second one with placental infarcts the index was 3.46 at 38 weeks of gestation. Normal pregnancies showed a flow index of 5.50 ± 1.57 units compared to the pathological pregnancies value of 2.74 ± 0.90 units. The method is very well suited to clinical evaluation of placental blood flow. (author)
A Microfluidic Long-Period Fiber Grating Sensor Platform for Chloride Ion Concentration Measurement
Directory of Open Access Journals (Sweden)
Jian-Neng Wang
2011-09-01
Full Text Available Optical fiber sensors based on waveguide technology are promising and attractive in chemical, biotechnological, agronomy, and civil engineering applications. A microfluidic system equipped with a long-period fiber grating (LPFG capable of measuring chloride ion concentrations of several sample materials is presented. The LPFG-based microfluidic platform was shown to be effective in sensing very small quantities of samples and its transmitted light signal could easily be used as a measurand. The investigated sample materials included reverse osmosis (RO water, tap water, dilute aqueous sample of sea sand soaked in RO water, aqueous sample of sea sand soaked in RO water, dilute seawater, and seawater. By employing additionally a chloride ion-selective electrode sensor for the calibration of chloride-ion concentration, a useful correlation (R2 = 0.975 was found between the separately-measured chloride concentration and the light intensity transmitted through the LPFG at a wavelength of 1,550 nm. Experimental results show that the sensitivity of the LPFG sensor by light intensity interrogation was determined to be 5.0 × 10−6 mW/mg/L for chloride ion concentrations below 2,400 mg/L. The results obtained from the analysis of data variations in time-series measurements for all sample materials show that standard deviations of output power were relatively small and found in the range of 7.413 × 10−5–2.769 × 10−3 mW. In addition, a fairly small coefficients of variations were also obtained, which were in the range of 0.03%–1.29% and decreased with the decrease of chloride ion concentrations of sample materials. Moreover, the analysis of stability performance of the LPFG sensor indicated that the random walk coefficient decreased with the increase of the chloride ion concentration, illustrating that measurement stability using the microfluidic platform was capable of measuring transmitted optical power with accuracy in the range of −0
American Society for Testing and Materials. Philadelphia
2003-01-01
1.1 These test methods cover procedures for the determination of the resistance of stainless steels and related alloys to pitting and crevice corrosion (see Terminology G 15) when exposed to oxidizing chloride environments. Six procedures are described and identified as Methods A, B, C, D, E, and F. 1.1.1 Method A—Ferric chloride pitting test. 1.1.2 Method B—Ferric chloride crevice test. 1.1.3 Method C—Critical pitting temperature test for nickel-base and chromium-bearing alloys. 1.1.4 Method D—Critical crevice temperature test for nickel-base and chromium-bearing alloys. 1.1.5 Method E—Critical pitting temperature test for stainless steels. 1.1.6 Method F—Critical crevice temperature test for stainless steels. 1.2 Method A is designed to determine the relative pitting resistance of stainless steels and nickel-base, chromium-bearing alloys, whereas Method B can be used for determining both the pitting and crevice corrosion resistance of these alloys. Methods C, D, E and F allow for a rankin...
Van Matre, Edward T; Ho, Kang C; Lyda, Clark; Fullmer, Beth A; Oldland, Alan R; Kiser, Tyree H
2017-09-01
Objective: The objective of this study was to evaluate the stability of epinephrine hydrochloride in 0.9% sodium chloride in polyvinyl chloride bags for up to 60 days. Methods: Dilutions of epinephrine hydrochloride to concentrations of 16 and 64 µg/mL were performed under aseptic conditions. The bags were then placed into ultraviolet light-blocking bags and stored at room temperature (23°C-25°C) or under refrigeration (3°C-5°C). Three samples of each preparation and storage environment were analyzed on days 0, 30, 45, and 60. Physical stability was performed by visual examination. The pH was assessed at baseline and upon final degradation evaluation. Sterility of the samples was not assessed. Chemical stability of epinephrine hydrochloride was evaluated using high-performance liquid chromatography. To determine the stability-indicating nature of the assay, degradation 12 months following preparation was evaluated. Samples were considered stable if there was less than 10% degradation of the initial concentration. Results: Epinephrine hydrochloride diluted to 16 and 64 µg/mL with 0.9% sodium chloride injection and stored in amber ultraviolet light-blocking bags was physically stable throughout the study. No precipitation was observed. At days 30 and 45, all bags had less than 10% degradation. At day 60, all refrigerated bags had less than 10% degradation. Overall, the mean concentration of all measurements demonstrated less than 10% degradation at 60 days at room temperature and under refrigeration. Conclusion: Epinephrine hydrochloride diluted to 16 and 64 µg/mL with 0.9% sodium chloride injection in polyvinyl chloride bags stored in amber ultraviolet light-blocking bags was stable up to 45 days at room temperature and up to 60 days under refrigeration.
Activity coefficients in (hydrogen chloride+holmium chloride) (aq) from T=(278.15 to 328.15) K
Energy Technology Data Exchange (ETDEWEB)
Roy, Rabindra N. [Hoffman Department of Chemistry, Drury University, Springfield, MO 65802 (United States)]. E-mail: rroy@drury.edu; Roy, Lakshmi N. [Hoffman Department of Chemistry, Drury University, Springfield, MO 65802 (United States); Tabor, Bennett J. [Hoffman Department of Chemistry, Drury University, Springfield, MO 65802 (United States); Richards, Sarah J. [Hoffman Department of Chemistry, Drury University, Springfield, MO 65802 (United States); Cummins, Mason P. [Hoffman Department of Chemistry, Drury University, Springfield, MO 65802 (United States); Himes, Curtis A. [Hoffman Department of Chemistry, Drury University, Springfield, MO 65802 (United States); Gibbs, Stephanie N. [Hoffman Department of Chemistry, Drury University, Springfield, MO 65802 (United States); Christiansen, Edward B. [Hoffman Department of Chemistry, Drury University, Springfield, MO 65802 (United States)
2005-07-15
Activity coefficients of HCl in (hydrogen chloride+holmium chloride) (aq) have been calculated from the observed e.m.f.s using the Nernst equation. The temperatures ranged from (278.15 to 328.15) K at 5 K intervals and at constant total ionic strengths of (0.01, 0.025, 0.05, 0.1, 0.25, 0.5, 1.0, and 1.5) mol.kg{sup -1}. Electromotive-force measurements were made on the cell without liquid junction of the type:Pt vertical bar H{sub 2}(g,p=101.325kPa) vertical bar HCl(m{sub A}),HoCl{sub 3}(m{sub B}) vertical bar AgCl(s), vertical bar Ag(s) The results of the activity coefficients of HCl for this mixed electrolyte mixture have been interpreted in terms of the simpler Harned's equations and the ion-interaction model of Pitzer. Results show that the quadratic term is sufficient for the full range of Y{sub B} (the ionic strength fraction of the salt) to 0.9 at all the ionic strengths studied. The Pitzer's mixing parameters S{sub {theta}}{sub H,Ho} and {psi}{sub H,Ho,Cl} (including higher order electrostatic effects) and {theta}{sub H,Ho} and {psi}{sub H,Ho,Cl} (excluding higher order electrostatic effects) have been determined. These values at T=298.15 K are: S{sub {theta}}{sub H},{sub Ho}=0.115, {psi}{sub H,Ho,Cl}=-.071; and {theta}{sub H,Ho}=-.663, {psi}{sub H,Ho,Cl}=0.165. The parameters obtained in this study reproduce the activity coefficients of HCl in the mixtures within 0.015 over the entire range of ionic strengths and within 0.009 for I>=0.05 mol.kg{sup -1} over the entire temperature range.
The determination of hydroxide and carbonate in concentrated sodium chloride solutions
Roolvink, W.B.; Bos, M.
1980-01-01
A computer method for the determination of carbonate and hydroxide in concentrated (2.89 M) sodium chloride solutions is described. The method is based on multiparametric curve-fitting and can also be applied to salts of dibasic acids with unknown equilibrium constants. The systematic error is not
Myocardial imaging with 9-[Te-123m]tellurapheptadecanoic acid
International Nuclear Information System (INIS)
Elmaleh, D.R.; Knapp, F.F.; Yasuda, T.; Coffey, J.L.; Kopiwoda, S.; Okada, R.; Strauss, W.H.
1981-01-01
The distribution of radioactivity in the myocardium of rats and dogs infarcted by ligation of the left anterior coronary artery has been determined after intravenous injection of 9-[Te-123m]telluraheptadecanoic acid (Te-123m HDA). In rats the normal myocardium concentrated radioactivity (3.7% +/- 0.28 injected dose/g) to nearly three times that in the zones of infarction (1.12% +/- 0.18 dose/g). The focal defects detected in the gamma-camera images of rats and dogs correspond well with areas of infarction identified in the excised hearts by staining with triphenyltetrazolium chloride. The distribution of radioactivity from Te-123m HDA in dog hearts sectioned at autopsy showed a linear correlation (r = 0.94) with blood flow as determined with scandium-46-labeled microspheres
33 CFR 136.113 - Other compensation.
2010-07-01
...) MARINE POLLUTION FINANCIAL RESPONSIBILITY AND COMPENSATION OIL SPILL LIABILITY TRUST FUND; CLAIMS PROCEDURES; DESIGNATION OF SOURCE; AND ADVERTISEMENT General Procedure § 136.113 Other compensation. A... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Other compensation. 136.113...
Boujbiha, Mohamed Ali; Ben Salah, Ghada; Ben Feleh, Abdelraouf; Saoudi, Mongi; Kamoun, Hassen; Bousslema, Ali; Ommezzine, Asma; Said, Khaled; Fakhfakh, Faiza; El Feki, Abdelfattah
2012-07-01
Erythrocytes are a convenient model to understand the subsequent oxidative deterioration of biological macromolecules in metal toxicities. The present study examined the variation of hematoxic and genotoxic parameters following subchronic exposure of mercuric chloride via drinking water and their possible association with oxidative stress. Male rats were exposed to 50 ppm (HG1) and 100 ppm (HG2) of mercuric chloride daily for 90 days. A significant dose-dependent decrease was observed in red blood cell count, hemoglobin, hematocrit, and mean cell hemoglobin concentration in treated groups (HG1 and HG2) compared with controls. A significant dose-dependent increase was observed in lipid peroxidation; therefore, a significant variation was found in the antioxidant enzyme activities, such as superoxide dismutase, catalase, and glutathione peroxidase. Interestingly, mercuric chloride treatment showed a significant dose-dependent increase in frequency of total chromosomal aberration and in percentage of aberrant bone marrow metaphase of treated groups (p mercury treatment may be the major cause for chromosomal aberration as free radicals lead to DNA damage. These data will be useful in screening the antioxidant activities of natural products, which may be specific to the bone marrow tissue.
Use of Hypertonic Sodium Chloride Solution at Surgery under Extracorporeal Circulation
Directory of Open Access Journals (Sweden)
V. V. Lomivorotov
2012-01-01
Full Text Available The paper analyzes the data available in the references on different aspects of using hypertonic sodium chloride solution during surgery under extracorporeal circulation in cardiosurgical care. The hypertonic solution is shown to lower positive fluid balance in the perioperative period, to increase cardiac output with simultaneously decreased vascular resistance, to improve lung oxygenating function, and to normalize tissue blood circulation and neurological status in patients exposed to artificial perfusion. There is evidence for its effect on the immune system and capillary endothelium. It is suggested that it is necessary to study the effect of the hypertonic solution on the incidence of complications and death rates during surgery under extracorporeal circulation and it is proposed to use the solution under long-term extracorporeal circulation. Key words: hypertonic saline, sodium chloride, extracorporeal circulation.
International Nuclear Information System (INIS)
Willans, S.M.; McCarthy, I.D.
1991-01-01
The distribution of tibial blood flow was measured by injecting approximately (600-1000) x 10(3) 15 mu microspheres, labelled with either tin-113 (113Sn) or cobalt-57 (57Co) into femoral arteries of five mature greyhounds. The diaphyseal cortex, stripped of periosteum and devoid of marrow, was sawn into 40 pieces (10 transverse sections x 4 anatomical quarters/section). Relative deposition densities of the 113Sn microspheres in 40 pieces of cortex were found. These values, together with their associated masses, proved, from a statistical point of view, that flow rate heterogeneity was substantial in the diaphysis. In particular, for the diaphyseal cortex, distribution of relative deposition densities (flow rates) in six bones was found to be positively-skewed with a relative dispersion ((SD/mean) x 100) of approximately 40%
7 CFR 1955.113 - Price (housing).
2010-01-01
... 7 Agriculture 14 2010-01-01 2009-01-01 true Price (housing). 1955.113 Section 1955.113 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE... REGULATIONS (CONTINUED) PROPERTY MANAGEMENT Disposal of Inventory Property Rural Housing (rh) Real Property...
Chlorides behavior in raw fly ash washing experiments.
Zhu, Fenfen; Takaoka, Masaki; Oshita, Kazuyuki; Kitajima, Yoshinori; Inada, Yasuhiro; Morisawa, Shinsuke; Tsuno, Hiroshi
2010-06-15
Chloride in fly ash from municipal solid waste incinerators (MSWIs) is one of the obstructive substances in recycling fly ash as building materials. As a result, we have to understand the behavior of chlorides in recycling process, such as washing. In this study, we used X-ray absorption near edge structure (XANES) and X-ray diffraction (XRD) to study the chloride behavior in washed residue of raw fly ash (RFA). We found that a combination of XRD and XANES, which is to use XRD to identify the situation of some compounds first and then process XANES data, was an effective way to explain the chlorides behavior in washing process. Approximately 15% of the chlorine in RFA was in the form of NaCl, 10% was in the form of KCl, 51% was CaCl(2), and the remainder was in the form of Friedel's salt. In washing experiments not only the mole percentage but also the amount of soluble chlorides including NaCl, KCl and CaCl(2) decreases quickly with the increase of liquid to solid (L/S) ratio or washing frequency. However, those of insoluble chlorides decrease slower. Moreover, Friedel's salt and its related compound (11CaO.7Al(2)O(3).CaCl(2)) were reliable standards for the insoluble chlorides in RFA, which are strongly related to CaCl(2). Washing of RFA promoted the release of insoluble chlorides, most of which were in the form of CaCl(2). Copyright 2010 Elsevier B.V. All rights reserved.
Vakylabad, Ali Behrad; Schaffie, Mahin; Naseri, Ali; Ranjbar, Mohammad; Manafi, Zahra
2016-07-01
In this investigation, copper was bioleached from a low-grade chalcopyrite ore using a chloride-containing lixiviant. In this regard, firstly, the composition of the bacterial culture media was designed to control the cost in commercial application. The bacterial culture used in this process was acclimated to the presence of chloride in the lixiviant. Practically speaking, the modified culture helped the bio-heap-leaching system operate in the chloridic media. Compared to the copper recovery from the low-grade chalcopyrite by bioleaching in the absence of chloride, bioleaching in the presence of chloride resulted in improved copper recovery. The composition of the lixiviant used in this study was a modification with respect to the basal salts in 9 K medium to optimize the leaching process. When leaching the ore in columns, 76.81 % Cu (based on solid residues of bioleaching operation) was recovered by staged leaching with lixiviant containing 34.22 mM NaCl. The quantitative findings were supported by SEM/EDS observations, X-ray elemental mapping, and mineralogical analysis of the ore before and after leaching. Finally, Adaptive neuro-fuzzy inference system (ANFIS) was used to simulate the operational parameters affecting the bioleaching operation in chloride-sulfate system.
Ax, M; Sanchez-Crespo, A; Lindahl, S G E; Mure, M; Petersson, J
2017-06-01
Previous studies in humans have shown that gravity has little influence on the distribution of lung blood flow while changing posture from supine to prone. This study aimed to evaluate the maximal influence of posture by comparison of regional lung blood flow in the upright and head-down posture in 8 healthy volunteers, using a tilt table. Regional lung blood flow was marked by intravenous injection of macroaggregates of human albumin labeled with 99m Tc or 113m In, in the upright and head-down posture, respectively, during tidal breathing. Both radiotracers remain fixed in the lung after administration. The distribution of radioactivity was mapped using quantitative single photon emission computed tomography (SPECT) corrected for attenuation and scatter. All images were obtained supine during tidal breathing. A shift from upright to the head-down posture caused a clear redistribution of blood flow from basal to apical regions. We conclude that posture plays a role for the distribution of lung blood flow in upright humans, and that the influence of posture, and thereby gravity, is much greater in the upright and head-down posture than in horizontal postures. However, the results of the study demonstrate that lung structure is the main determinant of regional blood flow and gravity is a secondary contributor to the distribution of lung blood flow in the upright and head-down positions. NEW & NOTEWORTHY Using a dual-isotope quantitative SPECT method, we demonstrated that although a shift in posture redistributes blood flow in the direction of gravity, the results are also consistent with lung structure being a greater determinant of regional blood flow than gravity. To our knowledge, this is the first study to use modern imaging methods to quantify the shift in regional lung blood flow in humans at a change between the upright and head-down postures. Copyright © 2017 the American Physiological Society.
Dynamic electrochemical measurement of chloride ions
Abbas, Yawar; de Graaf, Derk B.; Olthuis, Wouter; van den Berg, Albert
2016-01-01
This protocol describes the dynamic measurement of chloride ions using the transition time of a silver silver chloride (Ag/AgCl) electrode. Silver silver chloride electrode is used extensively for potentiometric measurement of chloride ions concentration in electrolyte. In this measurement,
Effects of broccoli extract on biodistribution and labeling blood components with 99mTc-GH
International Nuclear Information System (INIS)
Cekic, Betul; Muftuler, Fazilet Zumrut Biber; Kilcar, Ayfer Yurt; Ichedef, Cigdem; Unak, Perihan
2011-01-01
Purpose: people consume vegetables without the knowledge of the side effects of the biological and chemical contents and interactions between radiopharmaceuticals and herbal extract. To this end, current study is focused on the effects of broccoli extract on biodistribution of radiolabeled glucoheptonate ( 99m Tc-GH) and radiolabeling of blood components. Methods: GH was labeled with 99m Tc. Quality control studies were done utilizing TLC method. Biodistribution studies were performed on male rats which were treated via gavage with either broccoli extract or SF as control group for 15 days. Blood samples were withdrawn from rats' heart. Radiolabeling of blood constituents performed incubating with GH, SnCl 2 and 99m Tc. Results: radiochemical yield of 99m Tc-GH is 98.46±1.48 % (n=8). Biodistribution studies have shown that according to the control, the treated group with broccoli has approximately 10 times less uptake in kidney. The percentage of the radioactivity ratios of the blood components is found to be same in both groups. Conclusions: although there is no considerable effect on the radiolabeling of blood components, there is an outstanding change on the biodistribution studies especially on kidneys. The knowledge of this change on kidney uptake may contribute to reduce the risk of misdiagnosis and/or repetition of the examinations in Nuclear Medicine. (author)
SiC epitaxy growth using chloride-based CVD
International Nuclear Information System (INIS)
Henry, Anne; Leone, Stefano; Beyer, Franziska C.; Pedersen, Henrik; Kordina, Olof; Andersson, Sven; Janzén, Erik
2012-01-01
The growth of thick epitaxial SiC layers needed for high-voltage, high-power devices is investigated with the chloride-based chemical vapor deposition. High growth rates exceeding 100 μm/h can be obtained, however to obtain device quality epilayers adjustments of the process parameters should be carried out appropriately for the chemistry used. Two different chemistry approaches are compared: addition of hydrogen chloride to the standard precursors or using methyltrichlorosilane, a molecule that contains silicon, carbon and chlorine. Optical and electrical techniques are used to characterize the layers.
The ClC-K2 Chloride Channel Is Critical for Salt Handling in the Distal Nephron.
Hennings, J Christopher; Andrini, Olga; Picard, Nicolas; Paulais, Marc; Huebner, Antje K; Cayuqueo, Irma Karen Lopez; Bignon, Yohan; Keck, Mathilde; Cornière, Nicolas; Böhm, David; Jentsch, Thomas J; Chambrey, Régine; Teulon, Jacques; Hübner, Christian A; Eladari, Dominique
2017-01-01
Chloride transport by the renal tubule is critical for blood pressure (BP), acid-base, and potassium homeostasis. Chloride uptake from the urinary fluid is mediated by various apical transporters, whereas basolateral chloride exit is thought to be mediated by ClC-Ka/K1 and ClC-Kb/K2, two chloride channels from the ClC family, or by KCl cotransporters from the SLC12 gene family. Nevertheless, the localization and role of ClC-K channels is not fully resolved. Because inactivating mutations in ClC-Kb/K2 cause Bartter syndrome, a disease that mimics the effects of the loop diuretic furosemide, ClC-Kb/K2 is assumed to have a critical role in salt handling by the thick ascending limb. To dissect the role of this channel in detail, we generated a mouse model with a targeted disruption of the murine ortholog ClC-K2. Mutant mice developed a Bartter syndrome phenotype, characterized by renal salt loss, marked hypokalemia, and metabolic alkalosis. Patch-clamp analysis of tubules isolated from knockout (KO) mice suggested that ClC-K2 is the main basolateral chloride channel in the thick ascending limb and in the aldosterone-sensitive distal nephron. Accordingly, ClC-K2 KO mice did not exhibit the natriuretic response to furosemide and exhibited a severely blunted response to thiazide. We conclude that ClC-Kb/K2 is critical for salt absorption not only by the thick ascending limb, but also by the distal convoluted tubule. Copyright © 2016 by the American Society of Nephrology.
Method of processing chloride waste
International Nuclear Information System (INIS)
Tokiwai, Moriyasu; Tsunashima, Mikiyasu; Horie, Masaaki; Koyama, Masafumi; Sudo, Minoru; Kitagawa, Masatoshi; Ogasawara, Tadashi.
1991-01-01
In a method of applying molten salt electrolysis to chloride wastes discharged from a electrolytic refining step of a dry reprocessing step for spent fuels, and removed with transuranium elements of long half-decaying time, metals capable of alloying with alkali and alkaline earth metals under melting by electrolysis are used as a cathode material, and an electrolytic temperature is made higher than the melting point of salts in a molten salt electrolysis bath, to recover Li, Ca and Na as alloys with the cathode material in a first electrolysis step. Then, the electrolytic temperature is made higher than the melting point of the chloride salts remained in the bath after the electrolysis step described above by using the cathode material, to recover Ba, Rb, Sr and Cs of nuclear fission products also as alloys with the cathode material in a second electrolysis step. Accordingly, the amount of wastes formed can be reduced, and the wastes contain no heat generating nuclear fission elements. (T.M.)
Influence of probe motion on laser probe temperature in circulating blood.
Hehrlein, C; Splinter, R; Littmann, L; Tuntelder, J R; Tatsis, G P; Svenson, R H
1991-01-01
The purpose of this study was to evaluate the effect of probe motion on laser probe temperature in various blood flow conditions. Laser probe temperatures were measured in an in vitro blood circulation model consisting of 3.2 nm-diameter plastic tubes. A 2.0 mm-diameter metal probe attached to a 300 microns optical quartz fiber was coupled to an argon laser. Continuous wave 4 watts and 8 watts of laser power were delivered to the fiber tip corresponding to a 6.7 +/- 0.5 and 13.2 +/- 0.7 watts power setting at the laser generator. The laser probe was either moved with constant velocity or kept stationary. A thermocouple inserted in the lateral portion of the probe was used to record probe temperatures. Probe temperature changes were found with the variation of laser power, probe velocity, blood flow, and duration of laser exposure. Probe motion significantly reduced probe temperatures. After 10 seconds of 4 watts laser power the probe temperature in stagnant blood decreased from 303 +/- 18 degrees C to 113 +/- 17 degrees C (63%) by moving the probe with a velocity of 5 cm/sec. Blood flow rates of 170 ml/min further decreased the probe temperature from 113 +/- 17 degrees C to 50 +/- 8 degrees C (56%). At 8 watts of laser power a probe temperature reduction from 591 +/- 25 degrees C to 534 +/- 36 degrees C (10%) due to 5 cm/sec probe velocity was noted. Probe temperatures were reduced to 130 +/- 30 degrees C (78%) under the combined influence of 5 cm/sec probe velocity and 170 ml/min blood flow.(ABSTRACT TRUNCATED AT 250 WORDS)
Whole Blood mRNA Expression-Based Prognosis of Metastatic Renal Cell Carcinoma.
Giridhar, Karthik V; Sosa, Carlos P; Hillman, David W; Sanhueza, Cristobal; Dalpiaz, Candace L; Costello, Brian A; Quevedo, Fernando J; Pitot, Henry C; Dronca, Roxana S; Ertz, Donna; Cheville, John C; Donkena, Krishna Vanaja; Kohli, Manish
2017-11-03
The Memorial Sloan Kettering Cancer Center (MSKCC) prognostic score is based on clinical parameters. We analyzed whole blood mRNA expression in metastatic clear cell renal cell carcinoma (mCCRCC) patients and compared it to the MSKCC score for predicting overall survival. In a discovery set of 19 patients with mRCC, we performed whole transcriptome RNA sequencing and selected eighteen candidate genes for further evaluation based on associations with overall survival and statistical significance. In an independent validation of set of 47 patients with mCCRCC, transcript expression of the 18 candidate genes were quantified using a customized NanoString probeset. Cox regression multivariate analysis confirmed that two of the candidate genes were significantly associated with overall survival. Higher expression of BAG1 [hazard ratio (HR) of 0.14, p < 0.0001, 95% confidence interval (CI) 0.04-0.36] and NOP56 (HR 0.13, p < 0.0001, 95% CI 0.05-0.34) were associated with better prognosis. A prognostic model incorporating expression of BAG1 and NOP56 into the MSKCC score improved prognostication significantly over a model using the MSKCC prognostic score only ( p < 0.0001). Prognostic value of using whole blood mRNA gene profiling in mCCRCC is feasible and should be prospectively confirmed in larger studies.
Mass transport and chloride ion complexes in occluded cell
International Nuclear Information System (INIS)
Tsuru, T.; Hashimoto, K.; Nishikata, A.; Haruyama, S.
1989-01-01
Changes in the transport and the concentration of ions in a model occluded cell are traced during galvanostatic anodic polarization of a mild steel and a stainless steel. Apparent transport numbers of anions and cations, which were estimated from chemical analysis of solution, were different from those calculated from known mobility data. At the initial stage of the polarization, the transport number of chloride ion was almost unity, and then decreased gradually. For the mild steel, the concentration of total chloride ion accumulated in the occluded compartment increased with the anodic charge passed, and the amount of chloride ion complexed with cations also increased. The chloride complex was estimated as FeCl + . For SUS304 stainless steel, the total chloride ion increased, however, the free chloride ion, which responded to an Ag/AgCl electrode remained approximately 2 mol/dm 3 . Therefore, most of the chloride ions transferred into the occluded cell formed complex ions, such as CrCl n 3-n . The number of chloride ion coordinated to ferrous and chromic ions was estimated from the data fo mass transport for the case of the mild steel and the stainless steel. (author) 9 refs., 14 figs
Directory of Open Access Journals (Sweden)
Hongyan Wang
2018-01-01
Full Text Available Periodontal disease consists of chronic gingival inflammation characterized by both degradation of the periodontal connective tissue and alveolar bone loss. Drug therapy is used as an auxiliary treatment method in severe chronic periodontitis, aggressive periodontitis, and periodontitis-associated systemic disease. Nal-P-113, a modified antimicrobial peptide, specifically replaces the histidine residues of P-113 with the bulky amino acid β-naphthylalanine, and our previous studies have verified that this novel peptide is not toxic to the human body within a certain concentration range. The objective of the present study was to evaluate the effect of Nal-P-113 on periodontal pathogens and periodontal status in clinical studies. In a split-mouth clinical trial, the pocket depth and bleeding index values tended to decrease in the experimental group compared with those in the control group. SEM results verified that Nal-P-113 restrained the maturation of plaque. Based on real-time polymerase chain reaction, the levels of Fusobacterium nucleatum, Streptococcus gordonii, Treponema denticola, and Porphyromonas gingivalis in subgingival plaque were decreased when the subjects were given Nal-P-113. Bacterial growth curve analysis and a biofilm susceptibility assay verified that Nal-P-113 at a concentration of 20 μg/mL restrained the growth of S. gordonii, F. nucleatum, and P. gingivalis and biofilm formation. Therefore, Nal-P-113 effectively reduces periodontal pathogens and ameliorates periodontal status.
Zhang, Linna; Ding, Hongyan; Lin, Ling; Wang, Yimin; Guo, Xin
2018-01-01
Noncontact discriminating human blood is significantly crucial for import-export ports and inspection and quarantine departments. We had already demonstrated that visible diffuse reflectance spectroscopy combining PLS-DA method can successfully realize noncontact human blood discrimination. However, the circulated blood vessels may be produced with different materials. The use of various kinds of blood tubes may have a negative effect on the discrimination, based on ;M+N; theory (Li et al., 2016). In this research, we explored the impact of different material of blood vessels, such as glass tube and plastic tube, on the prediction ability of the discrimination model. Furthermore, we searched for the modification method to reduce the influence from the blood tubes. Our work indicated that generalized diffuse reflectance method can greatly improve the discrimination accuracy. This research can greatly facilitate the application of noncontact discrimination method based on visible and near-infrared diffuse reflectance spectroscopy.
Correia-Oliveira, Carlos Rafaell; Kiss, Maria Augusta Peduti Dal’Molin
2018-01-01
ABSTRACT The relationship between metabolic acidosis and athletic performance has been investigated over the years through manipulation of the blood and muscle pH. Among the pH manipulation manners, the ammonium chloride (NH4Cl) is the most widely used chemical component when is intentioned to induce a blood acidosis status prior to exercise. However, there is a lack of studies investigating the action of this substance on athletic performance as only two studies were performed in the last 15...
Effect of iron ions on corrosion of lithium in a thionyl chloride electrolytes
International Nuclear Information System (INIS)
Shirokov, A.V.; Churikov, A.V.
1999-01-01
The effect of the iron electrolyte addition on the growth rate of the passivating layer on lithium in the LiAlCl 4 1 M solution in thionyl chloride is experimentally studied. It is established, that kinetic curved in the first 10 hours of the Li-electrode contact with electrolyte are described by the equation, assuming mixed diffusion kinetic control over the corrosion process. It is shown that introduction of Fe 3+ into electrolyte causes increase in both ionic and electron conductivity constituents. Increase in the electron carrier concentration is the cause of lithium corrosion in the iron-containing thionyl chloride solutions [ru
Bone marrow scintigraphy using /sup 111/Indium chloride in patients with aplastic anemia
Energy Technology Data Exchange (ETDEWEB)
Mabuchi, Nobuhisa; Kumano, Machiko; Matsumoto, Fumiko; Arita, Shigehiro; Nakagawa, Kenichi; Fujii, Koichi; Yoshioka, Hiroyasu; Hamada, Tatsumi; Ishida, Osamu
1987-12-01
Bone marrow scintigraphy using /sup 111/Indium chloride (/sup 111/In-chloride) was performed in 18 patients with aplastic anemia. The scintigrams were taken 48 hours after an intravenous injection of /sup 111/In-chloride 3 mCi. The distribution patterns on scintigram were classified into 5 types: Type I (4 cases) showed no accumulation, Type II (6 cases) showed low accumulation in usual bone marrow sites. Type III (7 cases) showed island-like distribution in bone marrow sites. Type IV, although no case was included in the 18 patients, shows uneven distribution between pelvis and sternum or vertebrae. Type V (one case) showed almost normal accumulation in usual bone marrow sites. Bone marrow uptake of /sup 111/In-chloride correlated well with the cellularity of bone marrow. There was a tendency for the cases of markedly increased saturated iron-binding capacity to show increased renal activity. In type III, both the percentage of cases who had been treated and the count of reticulocytes were higher than those in the other types, which suggested that island-like distribution on scintigram showed the regeneration responded to the therapy, and related to the erythropoietic function.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Testing aids. 113.2 Section 113.2... Testing aids. To better ensure consistent and reproducible test results when Standard Requirement tests... Agriculture, may provide testing aids, when available, to licensees, permittees, and applicants for licenses...
27 CFR 21.113 - Isopropyl alcohol.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Isopropyl alcohol. 21.113 Section 21.113 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS FORMULAS FOR DENATURED ALCOHOL AND RUM Specifications for Denaturants § 21...
9 CFR 113.451 - Tetanus Antitoxin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Tetanus Antitoxin. 113.451 Section 113.451 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... which conforms to the National Institute of Standards and Technology requirements shall be used. The...
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Scar rule. 11.3 Section 11.3 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL... inflammation, and, other bilateral evidence of abuse indicative of soring including, but not limited to...
Preparation of 114mIn low energy conversion electron sources
International Nuclear Information System (INIS)
Wrede, C.; Filippone, B.W.; Garcia, A.; Harper, G.C.; Lassell, S.; Liu, J.; Mendenhall, M.P.; Palmer, A.S.C.; Pattie, R.W.; Will, D.I.; Young, A.R.
2011-01-01
Highlights: → Controlled ion implantation of In-113 into thin Al substrate. → Production of In-114m (half life = 50 days) by neutron irradiation. → Use of In-114m as a source of electron lines and continuum for calibrations. → Source reactivation by short neutron irradiation. -- Abstract: The preparation of 114m In sources of conversion electrons in the energy range 162-190 keV and β continuum with a 1989 keV endpoint via ion implantation of 113 In into Al substrates and subsequent irradiation by thermal and epi-thermal neutrons in a nuclear reactor is described.
International Nuclear Information System (INIS)
Sukhova, N.S.; Skatina, L.I.
1993-01-01
The chloride content of circulating water and wastewater in industrial plants is one of the important indexes of contamination. The increasingly stringent sanitary and ecological requirements that have been imposed on wastewater are making it necessary to monitor the chloride content on a regular basis. It is difficult to use the mercurometric method of chloride determination that has been recommended for use in petroleum refineries in analyzing turbid of dark-colored waters with high contents of organic matter. Also, when the mercurometric method is used, accurate control of pH must be maintained in order to achieve good reproducibility of results. The authors are proposing a rapid method for monitoring the content of chloride ions in circulating water systems by potentiometric titration of a sample in a medium of glacial acetic acid by a 0.01 M solution of silver nitrate with the silver indicator electrode and a silver chloride auxiliary electrode EVL-1MZ, filled with a saturated solution of potassium nitrate. The potential is measured 30 sec after it has been established, in a type pH-121 potentiometer. The titration is performed from a microburette with a scale division of 0.02 cm 3 , with constant stirring of the test solution by means of a magnetic stirrer
... page: //medlineplus.gov/ency/article/002474.htm Mercuric chloride poisoning To use the sharing features on this page, please enable JavaScript. Mercuric chloride is a very poisonous form of mercury. It ...
Demonstration of hematobilia using technetium-99m labeled red blood cells
International Nuclear Information System (INIS)
Lee, S.M.; Lee, R.G.; Clouse, M.E.; Hill, T.C.
1986-01-01
A 75-year-old woman, who presented with obstructive jaundice, was shown by percutaneous transhepatic cholangiography to have a markedly dilated biliary system and stones within the common bile duct. The stones were removed percutaneously using the transduodenal approach, and an internal drainage catheter was placed. Following the procedure, the patient experienced gastrointestinal bleeding manifested by melanotic stools. Blood-tinged bile was withdrawn from the biliary drainage catheter, leading to the suspicion that the bleeding might be originating from the biliary tract. A Tc-99m red blood cell (Tc-99m RBC) scan was performed to try to designate the biliary tract as the site of bleeding, and to determine if there were any other bleeding sites present. The study demonstrated bleeding from the biliary tract, which was confirmed by angiography and endoscopy. The technique for the detection of gastrointestinal bleeding using Tc-99m RBCs is well described. This case suggests that when doing studies to localize occult bleeding, the liver should be included in the field-of-view to exclude bleeding from the liver
International Nuclear Information System (INIS)
Morrison, S.J.; Spangler, R.R.; Morris, S.A.
1996-01-01
A chemical barrier is a permeable zone of reactive materials emplaced in the subsurface to remove ground-water contaminants while allowing clean ground water to pass through. Because dissolved ferric chloride hydrolyzes to amorphous ferric oxyhydroxide when it contacts calcite (CaCO 3 ), it may be viable to emplace a zone of amorphous ferric oxyhydroxide (an absorbent for U, Mo, and other inorganic contaminants) into calcite-bearing geologic units by injecting ferric chloride through wells. For a chemical barrier to be successful, it must remain permeable and must be immobile. This investigation monitored chemical compositions, hydraulic conductivity, and iron mobility in laboratory columns and in a two-dimensional tank to determine the viability of injecting ferric chloride to form an amorphous ferric oxyhydroxide chemical barrier. The authors introduced a ferric chloride solution (1,345 mg/1[0.024 m] Fe) to calcite-bearing alluvial gravel to form a chemical barrier of amorphous ferric oxyhydroxide, followed by solutions contaminated with U and Mo. The simulated chemical barriers decreased U and Mo concentrations to less than 0.05 mg/l (2.1 x 10 -7 m) and 0.01 (1.0 x 10 -7 m), respectively; however, the breakthrough front is spread out with concentrations increasing to more than regulatory guideline values sooner than predicted. The hydraulic conductivity of calcite-bearing alluvial gravel decreased substantially during ferric chloride introduction because of the formation of carbon dioxide but increased to within factors of 1 to 5 of the original value as synthetic ground water flowed through the system. Amorphous ferric oxyhydroxide that formed in these experiments remained immobile at flow rates exceeding those typical of ground water. These laboratory results, in conjunction with site-specific characterization data, can be used to design chemical barriers emplaced by injection of ferric chloride
Surface Chloride Levels in Colorado Structural Concrete
2018-01-01
This project focused on the chloride-induced corrosion of reinforcing steel in structural concrete. The primary goal of this project is to analyze the surface chloride concentration level of the concrete bridge decks throughout Colorado. The study in...
37 CFR 11.3 - Suspension of rules.
2010-07-01
... Section 11.3 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE REPRESENTATION OF OTHERS BEFORE THE UNITED STATES PATENT AND TRADEMARK OFFICE General Provisions General Information § 11.3 Suspension of rules. (a) In an extraordinary situation, when justice requires...
International Nuclear Information System (INIS)
Imai, Kiyoko; Watari, Kazuo; Ohno, Shigeru; Ohmiya, Toshinobu; Kuroda, Emi; Izawa, Masami.
1986-01-01
Adsorption behavior of radiogallium ( 67 Ga, 68 Ga) on non-ionic MR resin (XAD-7) from hydrochloric acid, lithium chloride and other metal chloride solutions, and purification of 68 Ga by this resin were studied. Radiogallium was adsorbed on XAD-7 rapidly and quantitatively from the solution of higher chloride concentration than 6M. The adsorption behavior is similar to that obtained with 59 Fe and 195 Au previously. Based on adsorption data, elimination of trace amount of 68 Ge commonly contained in 68 Ga milked from a 68 Ge/ 68 Ga generator was tried. When 68 Ga-6M hydrochloric acid solution containing 68 Ge was passed through a XAD-7 column, all the activity was transferred on the column. After eliminating 68 Ge fraction with 3M hydrochloric acid, 68 Ga was obtained in high purity by eluting with 0.1M hydrochloric acid. (author)
Gschwind, Fabienne; Steinle, Dominik; Sandbeck, Daniel; Schmidt, Celine; von Hauff, Elizabeth
2016-01-01
Three types of chloride-conducting membranes based on polyvinyl chloride, commercial gelatin, and polyvinyldifluoride-hexafluoropolymer are introduced in this report. The polymers are mixed with chloride-containing salts, such as tetrabutylammonium chloride, and cast to form membranes. We studied
International Nuclear Information System (INIS)
Lipp, C.; Schleid, T.
2008-01-01
The B-type lanthanoid(III) chloride oxoselenates(IV) MCl[SeO 3 ] (M = Sm - Lu) crystallize in the orthorhombic space group Pnma (no. 62) with Z = 4 in the structure type of HoCl[TeO 3 ]. Their lattice constants are decreasing following the lanthanoid contraction from a = 730.01(7), b = 707.90(7), c 895.64(9) pm for SmCl[SeO 3 ] to a = 714.63(7), b = 681.76(7), c = 864.05(9) pm for LuCl[SeO 3 ]. In contrast to NdCl[SeO 3 ], the only representative of the A-type structure, where the coordination numbers of the Nd 3+ cations are 7+2 and 8, the B-type structure is dominated by pentagonal bipyramids [MO 5 Cl 2 ] 9- (CN(M 3+ ) = 7), which are connected via trans-oriented O..O edges to ∞ 1 {[MO 4/2 e O 1/1 t Cl 2/1 t ] 5- } chains (e = edge-sharing, t = terminal) running parallel to the [010] direction. Their inclination relative to each other allows for an alternating interconnection of these chains via Cl - and ψ 1 -tetrahedral [SeO 3 ] 2- anions to form a three-dimensional structure. The distances within the [SeO 3 ] 2- groups are in the normal range (d(Se-O) = 165 - 172 pm), while those of the O 2- and Cl - anions to the central M 3+ cation diminish in dependence of the increasing atomic number (d(M-O) = 226 - 244 pm / 216 - 232 pm, d(M-Cl) 277 - 278 pm / 266 - 270 pm, M = Sm / Lu). For the synthesis of the chloride oxoselenates(IV) MCl[SeO 3 ] the respective lanthanoid sesquioxide (M 2 O 3 ) and selenium dioxide (SeO 2 ) were reacted with either an eutectic mixture of RbCl and LiCl or with the corresponding lanthanoid trichloride (MCl 3 ) in evacuated silica ampoules for either five weeks at 500 C or one week at 850 C. (orig.)
Hydrolysis of cupric chloride in aqueous ammoniacal ammonium chloride solutions
Directory of Open Access Journals (Sweden)
Limpo, J. L.
1995-06-01
Full Text Available Cupric solubility in the CuCl2-NH4Cl-NH3-H2O system for chloride concentrations lower than 4 molal in the temperature range 25-60 °C was studied. The experimental results show that for chloride concentration between 3.0 and 1.0 molal the cupric solubility is determined by the solubility of the cupric hydroxychloride Cu(OH1.5Cl0.5. For a chloride concentration value of 4.0 molal, there are two cupric compounds, the hydroxychloride Cu(OH1.5Cl0.5 or the diammine chloride Cu(NH32Cl2, on which the solubility of Cu(II depends, according to the temperature and the value of the ratio [NH3]Total/[Cu]Total.
Se estudia la solubilidad del Cu(II en el sistema CuCl2-NH4Cl-NH3-H2O para concentraciones de cloruro inferiores a 4 molal en el intervalo de temperaturas 25-60 °C. Los resultados experimentales muestran que, para concentraciones de cloruros comprendidas entre 3,0 y 1,0 molal, la solubilidad cúprica viene determinada por la solubilidad del hidroxicloruro cúprico, Cu(OH1.5Cl0.5. Para concentraciones de cloruro 4,0 molal, existen dos compuestos cúpricos, el hidroxicloruro, Cu(OH1.5Cl0.5 o el cloruro de diamina, Cu(NH32Cl2, de los que, de acuerdo con la temperatura y con el valor de la relación [NH3]Total/[Cu]Total depende la solubilidad del Cu(II.
Influence of bicarbonate on the sensitivity of renin release to sodium chloride
DEFF Research Database (Denmark)
Skøtt, O; Jensen, B L
1989-01-01
glomeruli treated with bicarbonate/chloride exchange inhibitor (DNDS), NaCl/KCl cotransport inhibitor (bumetanide), or Na+/H+ antiport inhibitor (amiloride) in the presence or absence of bicarbonate. In addition, the sensitivity to increases in osmolality by addition of sucrose was tested in the presence...... or absence of bicarbonate. Renin release from time controls superfused with a bicarbonate-free Ringer was identical to release from glomeruli superfused with a bicarbonate Ringer. DNDS (0.11 or 1.1 mM) had no effect on renin release in a bicarbonate Ringer. 30 mM sucrose inhibited renin release independently...... of bicarbonate. 15 mM NaCl stimulated renin release when bicarbonate was absent, while it caused an inhibition in the presence of bicarbonate. When bicarbonate/chloride exchange was inhibited, addition of NaCl stimulated renin release even when bicarbonate was present. The effect of NaCl on renin release...
The evaluation of organic inhibitors for the protection of grade 5 titanium in chloride media
International Nuclear Information System (INIS)
Popa, L.; Tunaru, M.; Velciu, L.
2013-01-01
The corrosion failures of titanium and titanium alloys are inevitably associated with the non-observance of environmental limits prescribed in corrosion handbooks, such as its use in solutions chloride. Titanium alloys are often used in the thermal transfer technology especially in the heat exchangers cooled with sea cooled water. However, it is not indicated its use in strong oxidant and any concentrated chloride environments. For the evaluation of grade 5 titanium alloy samples behaviour in solutions containing chloride ions in presence, respectively, absence of some organic inhibitors were performed by potentiodynamic polarization method. On the basis of our experimental results we consider that the most adequate inhibitor for the system Ti- 5 alloys/0 .083 M NaCl solution is the resorcinol. (authors)
9 CFR 113.317 - Parvovirus Vaccine (Canine).
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Parvovirus Vaccine (Canine). 113.317... Virus Vaccines § 113.317 Parvovirus Vaccine (Canine). Parvovirus Vaccine recommended for use in dogs... from each dog shall be individually tested for neutralizing antibody against canine parvovirus to...
Studies on the preparation of sup(99m)Tc labelled medical tracer compounds: pt. 4
International Nuclear Information System (INIS)
Kim, J.R.; Park, K.B.; Shim, H.S.
1981-01-01
A crude extract from a Korean native plant, Banha (Pinellia ternata), has been known to agglutinate the erythrocytes of rabbit, mouse and especially erythrocytes of leukemic patients, Sarcoma-180 cell and Ehrlich ascite cell. The Banha lectin was labelled either with 125 with 125 I by means of chloramine-T method or with sup(99m)Tc by using aqueous sodium pertechnetate (- sup(99m)Tc) solution and stannous chloride as a reducing agent. Their labelling yield was 60% and 98%, respectively. These labelled compounds were administered to mice by intraperitoneal injections and their radioactivity distributions were measured after 3 hours. The uptake of 125 I labelled compound to tissue in mice appeared in the order of kidney, pancreas, spleen, liver, blood, and stomach, but in the case of sup(99m)Tc, it appeared in the order of kidney, pancreas, stomach, liver, spleen and blood
International Nuclear Information System (INIS)
Matsuda, Hiroshi; Nakano, Seigo; Tanaka, Masaaki.
1996-01-01
A technique for serial noninvasive cerebral blood flow measurements at pre- and post-acetazolamide (Diamox) test was newly developed using 99m Tc-ECD without blood sampling. Baseline mean cerebral blood flow (mCBF) was measured from graphical analysis of time activity curves for brain and aortic arch obtained from radionuclide angiography by injection of 370-555 MBq 99m Tc-ECD. The first SPECT study was performed immediately after intravenous administration of 1 g of Diamox, then baseline regional cerebral blood flow (rCBF) was calculated using Lassen's correction algorithm. Immediately after the stop of the first SPECT study, additional 555-740 MBq of 99m Tc-ECD was administered, thereafter the second SPECT study was started. Post-Diamox SPECT images were obtained by subtraction of the first baseline images from the second images. Using Lassen's algorithm, post-Diamox mCBF was estimated from the baseline mCBF, the baseline mean SPECT counts, and post-Diamox mean SPECT counts corrected for administered dose and imaging time. Post-Diamox rCBF was obtained from the post-Diamox mCBF and the post-Diamox mean SPECT counts using Lassen's algorithm. Coefficient variation was shown 2.7% and 3.5%: mCBF and rCBF, respectively in test-retest results in six patients without Diamox administration. Nine demented patients without vascular disorders showed significant mCBF increase of 35.7% on the average by post-Diamox. In conclusion, this simplified method is practically useful for measuring CBF at pre- and post-Diamox test within short period of time without any blood sample. (author)
Electrolytic preparation of sup(99m)Tc human serum albumin using tin electrodes
International Nuclear Information System (INIS)
Narasimhan, D.V.S.; Mani, R.S.
1975-01-01
A method for labelling human serum albumin [HSA] with sup(99m)Tc using electrolytically generated Sn/II/ ions has been developed. The procedure uses Sn electrodes for electrolysis and gives high labelling yields. The amount of Sn released into the final product was found to be much less than the reported toxic levels. A ready-to-use kit for obtaining sterile sup(99m)Tc HSA is described. Tin metal wires sealed in aluminium were irradiated in a CIRUS reactor at a neutron flux of 7.5x10 12 n cm -2 sec -1 for one month. The 113 Sn produced in the wire was used for tracer studies with the electrolitically labelled HSA. sup(99m)Tc in the form sodium pertechnetate in 0.9% NaCl was obtained by methyl ethyl ketone extraction from alkaline solutions of neutron irradiated 99 Mo [specific activity 50-200 mCi/g] in the solvent extraction generator developed at Isotope Division, BARC. Radiochemical purity analysis of sup(99m)Tc labelled HSA prepared by the above procedure was carried out by ascending paper chromatography on Whatman No.1 paper, and 85% methanol and 0.9% sodium chloride as solvents. (F.Gy.)
Hydrolysis of ferric chloride in solution
International Nuclear Information System (INIS)
Lussiez, G.; Beckstead, L.
1996-11-01
The Detox trademark process uses concentrated ferric chloride and small amounts of catalysts to oxidize organic compounds. It is under consideration for oxidizing transuranic organic wastes. Although the solution is reused extensively, at some point it will reach the acceptable limit of radioactivity or maximum solubility of the radioisotopes. This solution could be cemented, but the volume would be increased substantially because of the poor compatibility of chlorides and cement. A process has been developed that recovers the chloride ions as HCl and either minimizes the volume of radioactive waste or permits recycling of the radioactive chlorides. The process involves a two-step hydrolysis at atmospheric pressure, or preferably under a slight vacuum, and relatively low temperature, about 200 degrees C. During the first step of the process, hydrolysis occurs according to the reaction below: FeCl 3 liquid + H 2 O → FeOCl solid + 2 HCl gas During the second step, the hot, solid, iron oxychloride is sprayed with water or placed in contact with steam, and hydrolysis proceeds to the iron oxide according to the following reaction: 2 FeOCl solid + H 2 O → Fe 2 O 3 solid + 2 HCl gas . The iron oxide, which contains radioisotopes, can then be disposed of by cementation or encapsulation. Alternately, these chlorides can be washed off of the solids and can then either be recycled or disposed of in some other way
Estimating Anthropogenic Emissions of Hydrogen Chloride and Fine Particulate Chloride in China
Fu, X.; Wang, T.; Wang, S.; Zhang, L.
2017-12-01
Nitryl chloride (ClNO2) can significantly impact the atmospheric photochemistry via photolysis and subsequent reactions of chlorine radical with other gases. The formation of ClNO2 in the atmosphere is sensitive to the emissions of chlorine-containing particulates from oceanic and anthropogenic sources. For China, the only available anthropogenic chlorine emission inventory was compiled for the year 1990 with a coarse resolution of 1 degree. In this study, we developed an up-to-date anthropogenic inventory of hydrogen chloride (HCl) and fine particulate chloride (Cl-) emissions in China for the year 2014, including coal burning, industrial processes, biomass burning and waste burning. Bottom-up and top-down methodologies were combined. Detailed local data (e.g. Cl content in coal, control technologies, etc.) were collected and applied. In order to improve the spatial resolution of emissions, detailed point source information were collected for coal-fired power plants, cement factories, iron & steel factories and waste incineration factories. Uncertainties of this emission inventory and their major causes were analyzed using the Monte Carlo method. This work enables better quantification of the ClNO2 production and impact over China.
Guava extract (Psidium guajava) alters the labelling of blood constituents with technetium-99m*
Abreu, P.R.C.; Almeida, M.C.; Bernardo, R.M.; Bernardo, L.C.; Brito, L.C.; Garcia, E.A.C.; Fonseca, A.S.; Bernardo-Filho, M.
2006-01-01
Psidium guajava (guava) leaf is a phytotherapic used in folk medicine to treat gastrointestinal and respiratory disturbances and is used as anti-inflammatory medicine. In nuclear medicine, blood constituents (BC) are labelled with technetium-99m (99mTc) and used to image procedures. However, data have demonstrated that synthetic or natural drugs could modify the labelling of BC with 99mTc. The aim of this work was to evaluate the effects of aqueous extract of guava leaves on the labelling of BC with 99mTc. Blood samples of Wistar rats were incubated with different concentrations of guava extract and labelled with 99mTc after the percentage of incorporated radioactivity (%ATI) in BC was determined. The results suggest that aqueous guava extract could present antioxidant action and/or alters the membrane structures involved in ion transport into cells, thus decreasing the radiolabelling of BC with 99mTc. The data showed significant (Pguava extract. PMID:16691636
Chloride ingress in cement paste and mortar
DEFF Research Database (Denmark)
Jensen, Ole Mejlhede; Hansen, Per Freiesleben; Coats, Alison M.
1999-01-01
In this paper chloride ingress in cement paste and mortar is followed by electron probe microanalysis. The influence of several paste and exposure parameters on chloride ingress are examined (e.g., water-cement ratio, silica fume addition, exposure time, and temperature), The measurements...
49 CFR 230.113 - Wheels and tire defects.
2010-10-01
... tires may not have a seam running lengthwise that is within 33/4 inches of the flange. (g) Worn flanges... 49 Transportation 4 2010-10-01 2010-10-01 false Wheels and tire defects. 230.113 Section 230.113... Tenders Wheels and Tires § 230.113 Wheels and tire defects. Steam locomotive and tender wheels or tires...
9 CFR 113.67 - Erysipelothrix Rhusiopathiae Vaccine.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Erysipelothrix Rhusiopathiae Vaccine. 113.67 Section 113.67 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE... Health Inspection Service. (4) A satisfactory challenge shall be evidenced in the controls by a high body...
CRC-113 gene expression signature for predicting prognosis in patients with colorectal cancer.
Nguyen, Minh Nam; Choi, Tae Gyu; Nguyen, Dinh Truong; Kim, Jin-Hwan; Jo, Yong Hwa; Shahid, Muhammad; Akter, Salima; Aryal, Saurav Nath; Yoo, Ji Youn; Ahn, Yong-Joo; Cho, Kyoung Min; Lee, Ju-Seog; Choe, Wonchae; Kang, Insug; Ha, Joohun; Kim, Sung Soo
2015-10-13
Colorectal cancer (CRC) is the third leading cause of global cancer mortality. Recent studies have proposed several gene signatures to predict CRC prognosis, but none of those have proven reliable for predicting prognosis in clinical practice yet due to poor reproducibility and molecular heterogeneity. Here, we have established a prognostic signature of 113 probe sets (CRC-113) that include potential biomarkers and reflect the biological and clinical characteristics. Robustness and accuracy were significantly validated in external data sets from 19 centers in five countries. In multivariate analysis, CRC-113 gene signature showed a stronger prognostic value for survival and disease recurrence in CRC patients than current clinicopathological risk factors and molecular alterations. We also demonstrated that the CRC-113 gene signature reflected both genetic and epigenetic molecular heterogeneity in CRC patients. Furthermore, incorporation of the CRC-113 gene signature into a clinical context and molecular markers further refined the selection of the CRC patients who might benefit from postoperative chemotherapy. Conclusively, CRC-113 gene signature provides new possibilities for improving prognostic models and personalized therapeutic strategies.
Alkali metal and ammonium chlorides in water and heavy water (binary systems)
Cohen-Adad, R
1991-01-01
This volume surveys the data available in the literature for solid-fluid solubility equilibria plus selected solid-liquid-vapour equilibria, for binary systems containing alkali and ammonium chlorides in water or heavy water. Solubilities covered are lithium chloride, sodium chloride, potassium chloride, rubidium chloride, caesium chloride and ammonium chloride in water and heavy water.
Removal of chloride from MSWI fly ash.
Chen, Wei-Sheng; Chang, Fang-Chih; Shen, Yun-Hwei; Tsai, Min-Shing; Ko, Chun-Han
2012-10-30
The high levels of alkali chloride and soluble metal salts present in MSWI fly ash is worth noting for their impact on the environment. In addition, the recycling or reuse of fly ash has become an issue because of limited landfill space. The chloride content in fly ash limits its application as basis for construction materials. Water-soluble chlorides such as potassium chloride (KCl), sodium chloride (NaCl), and calcium chloride hydrate (CaCl(2) · 2H(2)O) in fly ash are easily washed away. However, calcium chloride hydroxide (Ca(OH)Cl) might not be easy to leach away at room temperature. The roasting and washing-flushing processes were applied to remove chloride content in this study. Additionally, air and CO(2) were introduced into the washing process to neutralize the hazardous nature of chlorides. In comparison with the water flushing process, the roasting process is more efficient in reducing the process of solid-liquid separation and drying for the reuse of Cl-removed fly ash particles. In several roasting experiments, the removal of chloride content from fly ash at 1050°C for 3h showed the best results (83% chloride removal efficiency). At a solid to liquid ratio of 1:10 the water-flushing process can almost totally remove water-soluble chloride (97% chloride removal efficiency). Analyses of mineralogical change also prove the efficiency of the fly ash roasting and washing mechanisms for chloride removal. Copyright © 2012 Elsevier B.V. All rights reserved.
Increased cerebral blood flow in MELAS shown by Tc-99m HMPAO brain SPECT
International Nuclear Information System (INIS)
Peng, N.J.; Tsay, D.G.; Liu, R.S.; Li, J.Y.; Kong, K.W.; Kwok, C.G.; Strauss, H.W.
2000-01-01
We report cerebral SPECT studies on two siblings with the syndrome of mitochondrial myopathy, encephalopathy, lactic acidosis and stroke-like episodes (MELAS). Tc-99m HMPAO brain SPECT was performed 8, 19 and 30 days after a stroke-like episode in one case and 10 days after a stroke-like episode, 6 h after a partial seizure and as a follow-up study in the other. Increased blood flow was seen in both these patients with stroke-like episodes due to MELAS. The cause of the increased blood flow is uncertain, but it may be related to the decreased pH created by local increase in lactic acid. (orig.)
21 CFR 184.1622 - Potassium chloride.
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Potassium chloride. 184.1622 Section 184.1622 Food... Specific Substances Affirmed as GRAS § 184.1622 Potassium chloride. (a) Potassium chloride (KCl, CAS Reg... levels not to exceed current good manufacturing practice. Potassium chloride may be used in infant...
Whole Blood mRNA Expression-Based Prognosis of Metastatic Renal Cell Carcinoma
Directory of Open Access Journals (Sweden)
Karthik V. Giridhar
2017-11-01
Full Text Available The Memorial Sloan Kettering Cancer Center (MSKCC prognostic score is based on clinical parameters. We analyzed whole blood mRNA expression in metastatic clear cell renal cell carcinoma (mCCRCC patients and compared it to the MSKCC score for predicting overall survival. In a discovery set of 19 patients with mRCC, we performed whole transcriptome RNA sequencing and selected eighteen candidate genes for further evaluation based on associations with overall survival and statistical significance. In an independent validation of set of 47 patients with mCCRCC, transcript expression of the 18 candidate genes were quantified using a customized NanoString probeset. Cox regression multivariate analysis confirmed that two of the candidate genes were significantly associated with overall survival. Higher expression of BAG1 [hazard ratio (HR of 0.14, p < 0.0001, 95% confidence interval (CI 0.04–0.36] and NOP56 (HR 0.13, p < 0.0001, 95% CI 0.05–0.34 were associated with better prognosis. A prognostic model incorporating expression of BAG1 and NOP56 into the MSKCC score improved prognostication significantly over a model using the MSKCC prognostic score only (p < 0.0001. Prognostic value of using whole blood mRNA gene profiling in mCCRCC is feasible and should be prospectively confirmed in larger studies.
A new 99mTc-red blood cell labeling procedure for cardiac blood pool imaging: Clinical results
International Nuclear Information System (INIS)
Kelbaek, H.; Buelow, K.; Aldershvile, J.; Moegelyang, J.; Nielsen, S.L.; Copenhagen Univ.
1989-01-01
The first clinical results of a new 99m Tc-red blood cell labeling procedure avoiding cell centrifugation are presented. One ml heparinized blood samples were incubated with small amounts of a stannous kit. By titration studies, ideal quantities of sodium hypochlorite for oxidation of extracellular tin and of EDTA as stabilizer of the label were found. The Cl - concentration and pH of the labeled blood were acceptable, and EDTA increased labeling yield and stability determined in vitro by a few percent. The new procedure gave a slightly higher labeling yield than a current technique using centrifugation of cells. Labeling efficiency expressed as cell bound/total activity was 96.6%±1.3% in healthy subjects and 95.5%±2.2% in cardiac patients and remained high for 2 h after reinjection. The biological halflife of labeled cells following the new procedure was 11-12 h rendering it suitable for serial determinations of radionuclide cardiography. (orig.)
International Nuclear Information System (INIS)
Bensenouci, F.; Michelot, J.L.; Matray, J.M.; Savoye, S.
2010-01-01
Document available in extended abstract form only. A method to obtain information about fluid flow and solute transport in porous media with low hydraulic conductivity and low water content is based on the study of the natural tracer distribution in pore water. This approach was previously applied to the Callovo-Oxfordian argillites, studied by Andra at the Bure URL (East of France), using several natural tracer profiles ( 4 He, 2 H, 18 O, Cl - , 37 Cl). These profiles were interpreted as the result of a diffusive exchange between pore water in the aquitard and groundwater in the surrounding aquifers. However, at the Bure URL, and in contrast to other investigated argillaceous formations, the concentrations of tracers in lower aquifer groundwater may be higher than those in argillite pore water and increase with depth. The continuity of the profiles and the origin of pore water salinity remained questionable. This study aims at presenting and interpreting chloride and stable isotope profiles in pore water through more than 800 m of sediments, from the lower Oxfordian to the lower Hettangian. Drill-core samples were collected from the 2000 m-deep borehole (EST 433) drilled by Andra in the so-called 'Transposition Zone', located north to the Bure URL. In the framework of the TAPPS 2000 programme, twenty-five core samples were collected from the Oxfordian to the lower Hettangian during the drilling campaign, and in-situ conditioned. The chloride concentrations in pore water were firstly estimated by aqueous leaching, using a geochemical porosity two times smaller than the porosity measured by heating at 150 deg. C. After this estimation of pore water salinities, the radial diffusion and vapour exchange methods were applied to determine the stable isotope and anion concentrations in pore water. The deuterium contents of pore water derived from the vapour exchange experiments describe a classical bell-shape profile in the Callovo-Oxfordian argillites with an
Energy Technology Data Exchange (ETDEWEB)
Zheng, Jinjian, E-mail: jinjian.zheng@merck.com; Tan, Feng; Hartman, Robert
2015-09-03
Thionyl chloride is often used to convert alcohols into more reactive alkyl chloride, which can be easily converted to many compounds that are not possible from alcohols directly. One important reaction of alkyl chloride is nucleophilic substitution, which is typically conducted under basic conditions. Sulfur dioxide, the by-product from alcohol-thionyl chloride reactions, often reacts with alkyl chloride to form a sulfonyl acid impurity, resulting in yield loss. Therefore, the alkyl chloride is typically isolated to remove the by-products including sulfur dioxide. However, in our laboratory, the alkyl chloride formed from alcohol and thionyl chloride was found to be a potential mutagenic impurity, and isolation of this compound would require extensive safety measures. As a result, a flow-through process was developed, and the sulfur dioxide was purged using a combination of vacuum degassing and nitrogen gas sweeping. An analytical method that can quickly and accurately quantitate residual levels of sulfur dioxide in the reaction mixture is desired for in-process monitoring. We report here a simple ultraviolet (UV) spectrophotometry method for this measurement. This method takes advantage of the dramatic change in the UV absorbance of sulfur dioxide with respect to pH, which allows for accurate quantitation of sulfur dioxide in the presence of the strong UV-absorbing matrix. Each sample solution was prepared using 2 different diluents: 1) 50 mM ammonium acetate in methanol +1% v/v hydrochloric acid, pH 1.3, and 2) 50 mM ammonium acetate in methanol +1% glacial acetic acid, pH 4.0. The buffer solutions were carefully selected so that the UV absorbance of the sample matrix (excluding sulfur dioxide) at 276 nm remains constant. In the pH 1.3 buffer system, sulfur dioxide shows strong UV absorbance at 276 nm. Therefore, the UV absorbance of sample solution is the sum of sulfur dioxide and sample matrix. While in the pH 4.0 buffer system, sulfur dioxide has
Frysz, Christine A.; Shui, Xiaoping; Chung, D. D. L.
Submicron carbon filaments (ADNH, Applied Sciences Inc.) used in place of carbon black as porous reduction electrodes (i.e., current collectors) in plate and jellyroll configurations in carbon limited lithium batteries with the BCX (bromine chloride in thionyl chloride) catholyte gave a specific capacity (at 2 V cut-off) of up to 8700 mAh/g of carbon, compared with a value of up to 2900 mAh/g of carbon for carbon black. The high specific capacity for the filament electrode is partly due to the filaments' processability into sheets as thin as 0.2 mm with good porosity, acceptable mechanical properties and without binder, and partly due to the high catholyte absorptivity and high rate of catholyte absorption of the filament electrode. Use of solvent-cleansed filaments in place of as-received filaments in making electrodes increased the packing density, thus decreasing capacity per g of carbon. The BCX catholyte acted as a cleanser anyway, due to the thionyl chloride in it. The specific capacity per cm 3 of carbon and that per unit density of carbon were also increased by using carbon filaments in place of carbon black, provided that the filament electrode was not pressed after forming by slurry filtration. Though no binder was needed for the filament plate electrode, it was needed for the filament jellyroll electrode. The Teflon™ binder increased the tensile strength and modulus, but decreased the catholyte absorption and rate of absorption. The filament electrode exhibited 405 less volume electrical resistivity than the carbon black electrode, both without a binder.
Energy Technology Data Exchange (ETDEWEB)
Frysz, C.A. [Technology Div., Wilson Greatbatch Ltd., Clarence, NY (United States); Shui Xiaoping [Composite Materials Research Lab., State Univ. of New York, Buffalo, NY (United States); Chung, D.D.L. [Composite Materials Research Lab., State Univ. of New York, Buffalo, NY (United States)
1996-01-01
Submicron carbon filaments (ADNH, Applied Sciences Inc.) used in place of carbon black as porous reduction electrodes (i.e., current collectors) in plate and jellyroll configurations in carbon limited lithium batteries with the BCX (bromine chloride in thionyl chloride) catholyte gave a specific capacity (at 2 V cut-off) of up to 8700 mAh/g of carbon, compared with a value of up to 2900 mAh/g of carbon for carbon black. The high specific capacity for the filament electrode is partly due to the filaments` processability into sheets as thin as 0.2 mm with good porosity, acceptable mechanical properties and without binder, and partly due to the high catholyte absorptivity and high rate of catholyte absorption of the filament electrode. Use of solvent-cleansed filaments in place of as-received filaments in making electrodes increased the packing density, thus decreasing capacity per g of carbon. The BCX catholyte acted as a cleanser anyway, due to the thionyl chloride in it. The specific capacity per cm{sup 3} of carbon and that per unit density of carbon were also increased by using carbon filaments in place of carbon black, provided that the filament electrode was not pressed after forming by slurry filtration. Though no binder was needed for the filament plate electrode, it was needed for the filament jellyroll electrode. The Teflon{sup TM} binder increased the tensile strength and modulus, but decreased the catholyte absorption and rate of absorption. The filament electrode exhibited 40% less volume electrical resistivity than the carbon black electrode, both without a binder. (orig.)
International Nuclear Information System (INIS)
Thakur, M.L.
1987-01-01
Seventeen monoclonal antibodies (MAbs), 7 specific for human platelets and 10 specific for human polumorphonuclear leukocytes (PMNs) have been evaluated. One MAb has been identified as the antibody most suitable for canine platelets and another has been evaluted as the best among the group, for human neutrophil studies. Indium-111, Tc-99m, and I-125 have been used as the tracers. Six bifunctional chelating agents (BFCAs) were evaluated in order to determine the most efficient agent for maximal cell labeling efficiency. Among these, the DTPA has given us the best results. (4) To botain maximum In-111 chelation and minimum loss of the MAb affinity, the optimal BFCA to MAb ratios for both IgG and IgM type of MAbs were determined. Four different substances, stannous chloride, ascorbic acid, sodium dithionite and sodium borohydride, were evaluated as reducing agents for Tc-99m reduction and its optimal binding to MAbs. Dithionite at the concentration of 200 ug/ml DTPA-MAb solution provides greater than 50% Tc-99m labeling efficiency and maintains its immunospecificity equal to that of In-111-DTPA-MAb. The ability of radiolabeled MAb to interact with blood cells selectively in whole blood and with isolated blood cells was assessed and compared
On barium oxide solubility in barium-containing chloride melts
International Nuclear Information System (INIS)
Nikolaeva, Elena V.; Zakiryanova, Irina D.; Bovet, Andrey L.; Korzun, Iraida V.
2016-01-01
Oxide solubility in chloride melts depends on temperature and composition of molten solvent. The solubility of barium oxide in the solvents with barium chloride content is essentially higher than that in molten alkali chlorides. Spectral data demonstrate the existence of oxychloride ionic groupings in such melts. This work presents the results of the BaO solubility in two molten BaCl 2 -NaCl systems with different barium chloride content. The received data together with earlier published results revealed the main regularities of BaO solubility in molten BaO-BaCl 2 -MCl systems.
47 CFR 25.113 - Station licenses and launch authority.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Station licenses and launch authority. 25.113 Section 25.113 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Applications and Licenses General Application Filing Requirements § 25.113 Station...
21 CFR 184.1297 - Ferric chloride.
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Ferric chloride. 184.1297 Section 184.1297 Food and... Substances Affirmed as GRAS § 184.1297 Ferric chloride. (a) Ferric chloride (iron (III) chloride, FeC13, CAS Reg. No. 7705-08-0) may be prepared from iron and chlorine or from ferric oxide and hydrogen chloride...
21 CFR 184.1138 - Ammonium chloride.
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Ammonium chloride. 184.1138 Section 184.1138 Food... Specific Substances Affirmed as GRAS § 184.1138 Ammonium chloride. (a) Ammonium chloride (NH4Cl, CAS Reg. No. 12125-02-9) is produced by the reaction of sodium chloride and an ammonium salt in solution. The...
International Nuclear Information System (INIS)
Sharma, H.L.; Jackson, N.C.; Jackson, H.; Smith, A.M.; Shukla, S.K.
1998-01-01
Spleen targeted In-114m, using labelled autologous lymphocytes, has produced a significant antitumour effect in patients with chronic lymphocytic leukaemia and Non-Hodgkins lymphoma (Sharma et al, Anti-Cancer Research 17, 1815-1822,1997). Heat treated red blood cells could be used as alternative vectors for splenic targeting of In-114m, making the technique easier, more universally applicable and furthermore, may reduce the myelosuppression seen with labelled lymphocytes. Red blood cells from HO3T rats were labelled with In-114m-oxine, incubated at 49.5 deg. C for 15 minutes and their distribution investigated in the spleen, liver and blood or recipient animals. The splenic uptake in the spleen at 24h was 64.08%, remained unchanged at 7 days, cleared slowly after that, clearly demonstrating the specificity of HTRBC to target In-114m to the spleen. The depletion of peripheral blood lymphocytes was measured in two groups of HO3T rats following the administration of 1.6 and 3.2 MBq of In-114m-HTRBC respectively. Compared to the controls, ∼ 70% of lymphocytes were depleted in the treated animals within one week and remained unchanged for 6 weeks. Using a rat T-cell lymphocytic leukaemia model, with resemblance to the clinical disease, an anti-leukaemic effect of his method of treatment, was monitored. An average life span of the treated group (1.85 MBq of In-114m-HTRBC) was 17.1 days, compared to the 13.5 days for the untreated group. These results are similar to the ones reported by targeting In-114m with labelled lymphocytes. In summary, the project has shown that In-114m-HTRBC can be used to deposit the radioactivity, selectively in the spleen, which in turn, depletes the peripheral blood lymphocytes and produces an anti-leukaemic effect in terms of enhanced life span. The bone marrow toxicity from In-114m therapy is under investigation and a pharmacokinetic study in selected cancer patients is planned following which, a clinical trial will be considered. (author)
Ai, Zhiyong; Sun, Wei; Jiang, Jinyang; Song, Dan; Ma, Han; Zhang, Jianchun; Wang, Danqian
2016-09-01
The electrochemical behaviour for passivation of new alloy corrosion-resistant steel Cr10Mo1 immersed in alkaline solutions with different pH values (13.3, 12.0, 10.5, and 9.0) and chloride contents (0.2 M and 1.0 M), was investigated by various electrochemical techniques: linear polarization resistance, electrochemical impedance spectroscopy and capacitance measurements. The chemical composition and structure of passive films were determined by XPS. The morphological features and surface composition of the immersed steel were evaluated by SEM together with EDS chemical analysis. The results evidence that pH plays an important role in the passivation of the corrosion-resistant steel and the effect is highly dependent upon the chloride contents. In solutions with low chloride (0.2 M), the corrosion-resistant steel has notably enhanced passivity with pH falling from 13.3 to 9.0, but does conversely when in presence of high chloride (1.0 M). The passive film on the corrosion-resistant steel presents a bilayer structure: an outer layer enriched in Fe oxides and hydroxides, and an inner layer, rich in Cr species. The film composition varies with pH values and chloride contents. As the pH drops, more Cr oxides are enriched in the film while Fe oxides gradually decompose. Increasing chloride promotes Cr oxides and Fe oxides to transform into their hydroxides with little protection, and this is more significant at lower pH (10.5 and 9.0). These changes annotate passivation characteristics of the corrosion-resistant steel in the solutions of different electrolyte.
Effects of broccoli extract on biodistribution and labeling blood components with {sup 99m}Tc-GH
Energy Technology Data Exchange (ETDEWEB)
Cekic, Betul; Muftuler, Fazilet Zumrut Biber; Kilcar, Ayfer Yurt; Ichedef, Cigdem; Unak, Perihan [Ege University, Izmir (Turkey). Inst. of Nuclear Sciences. Dept. of Nuclear Applications
2011-09-15
Purpose: people consume vegetables without the knowledge of the side effects of the biological and chemical contents and interactions between radiopharmaceuticals and herbal extract. To this end, current study is focused on the effects of broccoli extract on biodistribution of radiolabeled glucoheptonate ({sup 99m}Tc-GH) and radiolabeling of blood components. Methods: GH was labeled with {sup 99m}Tc. Quality control studies were done utilizing TLC method. Biodistribution studies were performed on male rats which were treated via gavage with either broccoli extract or SF as control group for 15 days. Blood samples were withdrawn from rats' heart. Radiolabeling of blood constituents performed incubating with GH, SnCl{sub 2} and {sup 99m} Tc. Results: radiochemical yield of {sup 99m}Tc-GH is 98.46{+-}1.48 % (n=8). Biodistribution studies have shown that according to the control, the treated group with broccoli has approximately 10 times less uptake in kidney. The percentage of the radioactivity ratios of the blood components is found to be same in both groups. Conclusions: although there is no considerable effect on the radiolabeling of blood components, there is an outstanding change on the biodistribution studies especially on kidneys. The knowledge of this change on kidney uptake may contribute to reduce the risk of misdiagnosis and/or repetition of the examinations in Nuclear Medicine. (author)
9 CFR 113.208 - Avian Encephalomyelitis Vaccine, Killed Virus.
2010-01-01
..., Killed Virus. 113.208 Section 113.208 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.208 Avian Encephalomyelitis Vaccine, Killed Virus. Avian...
9 CFR 113.210 - Feline Calicivirus Vaccine, Killed Virus.
2010-01-01
... Virus. 113.210 Section 113.210 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.210 Feline Calicivirus Vaccine, Killed Virus. Feline Calicivirus...
9 CFR 113.211 - Feline Rhinotracheitis Vaccine, Killed Virus.
2010-01-01
... Virus. 113.211 Section 113.211 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.211 Feline Rhinotracheitis Vaccine, Killed Virus. Feline...
9 CFR 113.216 - Bovine Rhinotracheitis Vaccine, Killed Virus.
2010-01-01
... Virus. 113.216 Section 113.216 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.216 Bovine Rhinotracheitis Vaccine, Killed Virus. Infectious Bovine...
9 CFR 113.203 - Feline Panleukopenia Vaccine, Killed Virus.
2010-01-01
... Virus. 113.203 Section 113.203 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.203 Feline Panleukopenia Vaccine, Killed Virus. Feline Panleukopenia...
Polder, R.B.; Hondel, A.W.M. van den
2002-01-01
Chloride extraction of concrete is a short-term electrochemical treatment against corrosion of reinforcing steel. The aim is to remove chloride ions from the concrete cover in order to reinstate passive behaviour. Physically sound concrete is left in place. To make this method more predictable and
Preparation of {sup 114m}In low energy conversion electron sources
Energy Technology Data Exchange (ETDEWEB)
Wrede, C., E-mail: wrede@uw.ed [Center for Experimental Nuclear Physics and Astrophysics, and Department of Physics, University of Washington, Seattle, WA 98195 (United States); Filippone, B.W. [Kellogg Radiation Laboratory, California Institute of Technology, Pasadena, California 91125 (United States); Garcia, A.; Harper, G.C. [Center for Experimental Nuclear Physics and Astrophysics, and Department of Physics, University of Washington, Seattle, WA 98195 (United States); Lassell, S. [Department of Nuclear Engineering, North Carolina State University, Raleigh, North Carolina 27695 (United States); Liu, J. [Kellogg Radiation Laboratory, California Institute of Technology, Pasadena, California 91125 (United States); Department of Physics, Shanghai Jiao Tong University, Shanghai 200240 (China); Mendenhall, M.P. [Kellogg Radiation Laboratory, California Institute of Technology, Pasadena, California 91125 (United States); Palmer, A.S.C. [Center for Experimental Nuclear Physics and Astrophysics, and Department of Physics, University of Washington, Seattle, WA 98195 (United States); Pattie, R.W. [Department of Physics, North Carolina State University, Raleigh, North Carolina 27695 (United States); Will, D.I. [Center for Experimental Nuclear Physics and Astrophysics, and Department of Physics, University of Washington, Seattle, WA 98195 (United States); Young, A.R. [Department of Physics, North Carolina State University, Raleigh, North Carolina 27695 (United States)
2011-05-15
Highlights: {yields} Controlled ion implantation of In-113 into thin Al substrate. {yields} Production of In-114m (half life = 50 days) by neutron irradiation. {yields} Use of In-114m as a source of electron lines and continuum for calibrations. {yields} Source reactivation by short neutron irradiation. -- Abstract: The preparation of {sup 114m}In sources of conversion electrons in the energy range 162-190 keV and {beta} continuum with a 1989 keV endpoint via ion implantation of {sup 113}In into Al substrates and subsequent irradiation by thermal and epi-thermal neutrons in a nuclear reactor is described.
ESO 113-IG45 galaxy and/or quasar?
West, R M; Danks, A C
1978-01-01
Spectroscopy, UBV photometry and photography have been obtained of the extraordinary 13th magnitude object ESO 113-IG45 identified as a Seyfert galaxy by Fairall (1977); R.A.=01/sup h/ 21/sup m/.9; Decl .=-59 degrees 04' (1950). V/sub 0/=13630+or-50 km s/sup -1/; M/sub V /=-24/sup m/.0; largest diameter 75 kpc or more (with H/sub 0/=55 km s /sup -1/ Mpc/sup -1/). The nucleus is stellar-like and several times more luminous than the surrounding envelope which has a well-developed lane-structure. It is the intrinsically most luminous Seyfert nuclear yet known, and may be described as a 'quasar in the center of a (spiral) galaxy'. It is probably associated with the X-ray source 2A0120-591. (14 refs).
International Nuclear Information System (INIS)
Gad, M.M.A.; El-Sayed, A.A.
2008-01-01
Electrochemical techniques have been applied to study the crevice corrosion behavior of 316 L stainless steel in both 0.5 and 2 M NaCl solution with and without thiosulfate additions. In this investigation, the crevice corrosion of the tested material was studied in both bulk solution environment (0.5 M NaCl) as well as in chloride solutions simulating those formed inside crevices of stainless steels. A metal to nonmetal assembly, in which disc type specimens were faced to a PTFE crevice former, is used for bulk solution tests. Crevice- free specimens of cylindrical shape were used for the determination of the composition of solutions formed inside crevices (known as CCS). Potentiodynamic runs in extremely low ph solution (2 M NaCl solution with and without 0.01 M Na 2 SO 3 addition) were conducted to determine the ph at which the passive film breaks down (d ph). The d ph value was found to be a function of both chloride and thiosulfate ions. Cyclic potentiodynamic technique was used in evaluating the electrochemical corrosion performance of the tested alloy in bulk 0.5 M NaCl solution with and without 0.01 M Na 2 SO 3 addition. Results indicated that the presence of thiosulfate, combined with chloride ions led to a notable decrease in the corrosion resistance of the tested material. The deleterious effect of thiosulfates was discussed in terms of passivity breakdown and formation of reduced sulfur species within active crevices leading to the formation of H 2 S, which enhances the anodic dissolution of iron
Directory of Open Access Journals (Sweden)
Anatoli Y Kabakov
Full Text Available Glutamate is the major excitatory neurotransmitter, but prolonged exposure even at micromolar concentrations causes neuronal death. Extracellular glutamate is maintained at nanomolar level by glutamate transporters, which, however, may reverse transport and release glutamate. If and when the reverse occurs depends on glutamate transport stoichiometry (GTS. Previously we found that in the presence of chloride, the coupled GLT-1 glutamate transporter current and its relationship to radiolabeled glutamate flux significantly decreased when extracellular glutamate concentration increased above 0.2 mM, which implies a change in GTS. Such high concentrations are feasible near GLT-1 expressed close to synaptic release site during excitatory neurotransmission. The aim of this study was to determine GLT-1 GTS at both low (19-75 μM and high (300-1200 μM glutamate concentration ranges. GTS experiments were conducted in the absence of chloride to avoid contributions by the GLT-1 uncoupled chloride conductance. Mathematical analysis of the transporter thermodynamic equilibrium allowed us to derive equations revealing the number of a particular type of ion transported per elementary charge based on the measurements of the transporter reversal potential. We found that GLT-1a expressed in COS-7 cells co-transports 1.5 Na+, 0.5 Glu-, 0.5 H+ and counter-transports 0.6 K+ per elementary charge in both glutamate concentration ranges, and at both 37°C and 26°C temperatures. The thermodynamic parameter Q10 = 2.4 for GLT-1 turnover rate of 19 s-1 (37°C, -50 mV remained constant in the 10 μM-10 mM glutamate concentration range. Importantly, the previously reported decrease in the current/flux ratio at high glutamate concentration was not seen in the absence of chloride in both COS-7 cells and cultured rat neurons. Therefore, only in the absence of chloride, GLT-1 GTS remains constant at all glutamate concentrations. Possible explanations for why apparent GTS might
Evaluation of RI images of hepatic blood flow using Tc-99m PMT
Energy Technology Data Exchange (ETDEWEB)
Fujiwara, Hiromichi; Iwasaki, Naoya; Ichikawa, Kesato
1988-03-01
To evaluate the clinical significance of RI images of hepatic blood flow using Tc-99m-PMT, analysis of the RI images and estimation of hepatic blood flow were carried out in patients with various liver diseases (37 cases). After intravenous injection of Tc-99m-PMT, hepatic accumulation curve of ROI positioned at whole liver area and time activity curve of ROI positioned at celiac artery were obtained through scintillation camera images with the computer-analysed system. Hepatic blood flow coefficient (K) was calculated from the hepatic accumulation curve. Based on the differential curve calculated from the time activity curve, chronological images of arterial, portal, parenchymal and saturated parenchymal phases were obtained. Results ; 1) K was 0.50 + 0.04, 0.35 + 0.02 and 0.26 + 0.04/min in normal type, CH type and LC type respectively. These coefficients well correlated with clinical severity of hepatic diseases. 2) Perfusional phase images of the liver became poorer in accordance with progression of liver disease, while images of spleen, portal venous system and collateral channels were more clearly obtained in liver cirrhosis. This method was shown to have a potential to understanding of severity of liver disease and hepatic blood flow dynamics.
Effect of miglitol (BAY m-1099) on fasting blood glucose in type 2 diabetes mellitus
Sels, J P; Kingma, P J; Wolffenbuttel, B H; Menheere, P P; Branolte, J H; Nieuwenhuijzen Kruseman, A C
BACKGROUND: In type 2 diabetes mellitus, fasting blood glucose values are increased due to increased glycogenolysis and gluconeogenesis. As miglitol (BAY m-1099), an absorbable alpha-glucosidase inhibitor, can inhibit glycogenolysis, we investigated whether 200 mg miglitol ingested at bedtime could
14 CFR 13.113 - Noncompliance with the investigative process.
2010-01-01
... process. 13.113 Section 13.113 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF... an Order of Investigation § 13.113 Noncompliance with the investigative process. If any person fails... Officer or the designee of the Presiding Officer, judicial enforcement may be initiated against that...
9 CFR 113.205 - Newcastle Disease Vaccine, Killed Virus.
2010-01-01
... Virus. 113.205 Section 113.205 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.205 Newcastle Disease Vaccine, Killed Virus. Newcastle Disease Vaccine...
Directory of Open Access Journals (Sweden)
Stanisław J. Knypl
2014-01-01
Full Text Available N-Dodecyloxymethylene-N-methylpiperidinium chloride (DMMP and N-dodecyloxyme-thylene-N-methylmorpholinium chloride (DMMM retarded germination of seeds of 9 cultivated plant species when applied at a concentration of 10-3 M, and inhibited germination at a concentration of 10-2 M. The exceptions were represented by Lepidium sativum L. and Linum usitatissimum L. seeds which germinated well even in 10-2 M solutions of either DMMP or DMMM.
9 CFR 113.104 - Leptospira Grippotyphosa Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Grippotyphosa Bacterin. 113... REQUIREMENTS Inactivated Bacterial Products § 113.104 Leptospira Grippotyphosa Bacterin. Leptospira Grippotyphosa Bacterin shall be produced from a culture of Leptospira grippotyphosa which has been inactivated...
International Nuclear Information System (INIS)
Thorne, D.A.; Datz, F.L.; Remley, K.; Christian, P.E.
1987-01-01
Proponents of [/sup 99m/Tc]sulfur colloid for GI bleeding studies argue that, although labeled red blood cells are useful for intermittent bleeding, they are not capable of detecting low bleeding rates. Studies of dogs with experimental GI bleeding have indicated bleeding rates of 0.05 ml/min can be detected with [/sup 99m/Tc]sulfur colloid. Since similar data in the dog model were unavailable for /sup 99m/Tc-labeled red blood cells, we undertook this study. To simulate lower GI bleeding, catheters were inserted into the bowel lumen. Each dog's blood was labeled with /sup 99m/Tc using an in vitro technique. Venous blood was then withdrawn and re-infused into the lumen of the bowel using a Harvard pump. Fourteen dogs were studied, ten receiving a bleeding rate from 4.6-0.02 ml/min in the descending colon and four with proximal jejunal bleeds of 0.20-0.02 ml/min. Bleeding rates of 4.6-0.2 ml/min were detected within 10 min in the colon and bleeding rates as low as 0.04 ml/min were seen by 55 min. Slower bleeding rates were not detected. Similar findings were noted for proximal jejunal bleeds. Based on the time of appearance, a minimum volume of approximately 2-3 ml labeled blood was necessary to detect bleeding. We conclude that /sup 99m/Tc-labeled RBCs are sensitive for low bleeding rates in the dog model. The rates are comparable to those described for [/sup 99m/Tc]sulfur colloid in this experimental setting. The time of appearance of activity is related to the bleeding rate
Energy Technology Data Exchange (ETDEWEB)
Houston, A.H.; McCarty, L.S.
1978-04-01
Gill, kidney and blood levels of acetazolamide-sensitive esterase (carbonic anhydrase) activity were estimated at acclimation temperature and at a common temperature (25/sup 0/C) in rainbow trout acclimated to 2, 10, and 18/sup 0/C. Plasma levels of sodium, potassium and chloride were also examined for possible acclimatory variations. Plasma sodium and chloride levels, and the sodium:chloride ratio were unaffected by thermal acclimation; potassium concentrations were significantly elevated at 18/sup 0/C. Significant, but modest changes in renal and branchial carbonic anhydrase activity were observed under physiologically realistic incubation temperature conditions. Blood carbonic anhydrase activity was sharply elevated at higher acclimation temperatures. The data are discussed in relation to the hypothesis that carbonic anhydrase in this relatively stenothermal freshwater salmonid, through its intimate association with the coupled HCO/sub 3//sup -//Cl/sup -/ and H/sup +/ + NH/sub 4//sup +//Na/sup +/ exchange systems may provide for relatively thermostable basal rates of sodium and chloride uptake from the medium and recovery from urine. The renal, and more notably the branchial (Na/sup +//K/sup +/)-simulated ATPase systems, and erythrocytic carbonic anhydrase may then serve primarily as high-temperature amplifiers of sodium and chloride recruitment respectively.
Propolis Protection from Toxicity Caused by Aluminium Chloride in Male Rats
International Nuclear Information System (INIS)
Mangood, S.A.; Kamal, A.M.; Haggag, A.M.
2012-01-01
Propolis is a resinous natural hive product derived from plant exudate collected by honey bees and has been extensively used in folk medicine. The present study was undertaken to determine the effectiveness of propolis in alleviating the toxicity of aluminium chloride (AlCl 3 )on some hematological and biochemical parameters of male albino rats. Twenty four male albino rats were arranged into 4 equal groups; control group, aluminium group (34 mg AlCl 3 /kg/day), propolis group (100μg propolis/rat)and aluminium plus propolis group. Rats were orally administered their respective doses daily for 30 days. AlCl 3 caused significant decrease in hemoglobin (Hb), red blood cell count (RBC), hematocrit (Ht), total and differential leucocyte count (TLC) when compared to control. On the other hand, aluminium administration caused a significant increase in urea, uric acid, creatinin, bilirubin, the content of phosphorous, alanine aminotransferase (ALT) and asparate aminotransferase (AST) and significant decrease in total protein, albumin, globulin and calcium when compared to control. The administration of propolis alleviated the toxic effect of AlCl 3 in experimental rats. It could be concluded thal propolis my afford protection from toxicity caused by aluminium chloride in male albino rats
The role of skeletal blood flow in determining the uptake of sup(99m)Tc-methylene diphosphonate
International Nuclear Information System (INIS)
McCarthy, I.D.; Hughes, S.P.F.
1983-01-01
The increased uptake of bone-seeking radionuclides following a fracture has been stated to be due to an increase in bone blood flow, resulting in an increase in capillary surface area available for exchange. This paper examines the relationship between the maximum instantaneous extraction of sup(99m)Tc-MDP and blood flow in normal canine tibia. The findings, consistent with the model of capillary action proposed for muscle by Renkin and Crone, are applicable to bone. There is no evidence that in normal bone the surface area available for exchange responds to an increase in bone blood flow. (orig.)
International Nuclear Information System (INIS)
Iijima, Toshio; Kato, Kazuhiro; Kuno, Toyohiko; Okuwaki, Akitsugu; Umetsu, Yoshiaki; Okabe, Taijiro
1993-01-01
Bastnaesite was treated in molten NaOH at 623-777 K for 10-60 min under atmosphere. Cerium-(III) in the ore was easily oxidized 95% or more within 30 min to give an oxidation product composed of solid solutions of CeO 2 -rich and CeO 2 -lean phases and Ce-free rare earth oxide phase. Simultaneously fluoride ion was removed 97% or more. Cerium concentrate was prepared from the oxidation product by leaching with 0.1-3 M HCl solution. The yield of cerium concentrate and the CeO 2 content reached 55-57% and 70-72%, respectively. Mixed rare earth chloride is composed of about 90% rare earth chloride and 10% alkaline earth chloride, and the contents of CeCl 3 , LaCl 3 , NdCl 3 , and PrCl 3 are 11.5, 58.5, 14.4, and 5.4%, respectively. The particle size of resulting cerium concentrate was fairly uniform and about 0.1 μm
7 CFR 1463.113 - Issuance of payments in event of death.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Issuance of payments in event of death. 1463.113 Section 1463.113 Agriculture Regulations of the Department of Agriculture (Continued) COMMODITY CREDIT CORPORATION, DEPARTMENT OF AGRICULTURE LOANS, PURCHASES, AND OTHER OPERATIONS 2005-2014 TOBACCO TRANSITION PROGRAM Tobacco Transition Payment Program ...
9 CFR 113.122 - Salmonella Choleraesuis Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Salmonella Choleraesuis Bacterin. 113... REQUIREMENTS Inactivated Bacterial Products § 113.122 Salmonella Choleraesuis Bacterin. Salmonella Choleraesuis Bacterin shall be prepared from a culture of Salmonella choleraesuis which has been inactivated and is...
9 CFR 113.120 - Salmonella Typhimurium Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Salmonella Typhimurium Bacterin. 113... REQUIREMENTS Inactivated Bacterial Products § 113.120 Salmonella Typhimurium Bacterin. Salmonella Typhimurium Bacterin shall be prepared from a culture of Salmonella typhimurium which has been inactivated and is...