
Sample records for ii annotated bibliography

  1. Annotated bibliography


    Under a cooperative agreement with the U.S. Department of Energy's Office of Science and Technology, Waste Policy Institute (WPI) is conducting a five-year research project to develop a research-based approach for integrating communication products in stakeholder involvement related to innovative technology. As part of the research, WPI developed this annotated bibliography which contains almost 100 citations of articles/books/resources involving topics related to communication and public involvement aspects of deploying innovative cleanup technology. To compile the bibliography, WPI performed on-line literature searches (e.g., Dialog, International Association of Business Communicators Public Relations Society of America, Chemical Manufacturers Association, etc.), consulted past years proceedings of major environmental waste cleanup conferences (e.g., Waste Management), networked with professional colleagues and DOE sites to gather reports or case studies, and received input during the August 1996 Research Design Team meeting held to discuss the project's research methodology. Articles were selected for annotation based upon their perceived usefulness to the broad range of public involvement and communication practitioners

  2. GSV Annotated Bibliography

    Roberts, Randy S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Pope, Paul A. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Jiang, Ming [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Trucano, Timothy G. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Aragon, Cecilia R. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Ni, Kevin [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Wei, Thomas [Argonne National Lab. (ANL), Argonne, IL (United States); Chilton, Lawrence K. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Bakel, Alan [Argonne National Lab. (ANL), Argonne, IL (United States)


    The following annotated bibliography was developed as part of the Geospatial Algorithm Veri cation and Validation (GSV) project for the Simulation, Algorithms and Modeling program of NA-22. Veri cation and Validation of geospatial image analysis algorithms covers a wide range of technologies. Papers in the bibliography are thus organized into the following ve topic areas: Image processing and analysis, usability and validation of geospatial image analysis algorithms, image distance measures, scene modeling and image rendering, and transportation simulation models.

  3. GSV Annotated Bibliography

    Roberts, Randy S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Pope, Paul A. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Jiang, Ming [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Trucano, Timothy G. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Aragon, Cecilia R. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Ni, Kevin [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Wei, Thomas [Argonne National Lab. (ANL), Argonne, IL (United States); Chilton, Lawrence K. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Bakel, Alan [Argonne National Lab. (ANL), Argonne, IL (United States)


    The following annotated bibliography was developed as part of the geospatial algorithm verification and validation (GSV) project for the Simulation, Algorithms and Modeling program of NA-22. Verification and Validation of geospatial image analysis algorithms covers a wide range of technologies. Papers in the bibliography are thus organized into the following five topic areas: Image processing and analysis, usability and validation of geospatial image analysis algorithms, image distance measures, scene modeling and image rendering, and transportation simulation models. Many other papers were studied during the course of the investigation including. The annotations for these articles can be found in the paper "On the verification and validation of geospatial image analysis algorithms".

  4. Impingement: an annotated bibliography

    Uziel, M.S.; Hannon, E.H.


    This bibliography of 655 annotated references on impingement of aquatic organisms at intake structures of thermal-power-plant cooling systems was compiled from the published and unpublished literature. The bibliography includes references from 1928 to 1978 on impingement monitoring programs; impingement impact assessment; applicable law; location and design of intake structures, screens, louvers, and other barriers; fish behavior and swim speed as related to impingement susceptibility; and the effects of light, sound, bubbles, currents, and temperature on fish behavior. References are arranged alphabetically by author or corporate author. Indexes are provided for author, keywords, subject category, geographic location, taxon, and title

  5. Persuasion: A Selected, Annotated Bibliography.

    McDermott, Steven T.

    Designed to reflect the diversity of approaches to persuasion, this annotated bibliography cites materials selected for their contribution to that diversity as well as for being relatively current and/or especially significant representatives of particular approaches. The bibliography starts with a list of 17 general textbooks on approaches to…

  6. Annotated Bibliography: Denmark

    Rytter, Jens Elo; Gøtze, Michael


    The bibliography includes the most important DaNISH BOOKS OF GENERAL INTEREST IN THE FIELD OF PUBLIC LAW IN THE PERIOD FROM 2006 - 2007.......The bibliography includes the most important DaNISH BOOKS OF GENERAL INTEREST IN THE FIELD OF PUBLIC LAW IN THE PERIOD FROM 2006 - 2007....

  7. Public Relations: Selected, Annotated Bibliography.

    Demo, Penny

    Designed for students and practitioners of public relations (PR), this annotated bibliography focuses on recent journal articles and ERIC documents. The 34 citations include the following: (1) surveys of public relations professionals on career-related education; (2) literature reviews of research on measurement and evaluation of PR and…

  8. Systems Theory and Communication. Annotated Bibliography.

    Covington, William G., Jr.

    This annotated bibliography presents annotations of 31 books and journal articles dealing with systems theory and its relation to organizational communication, marketing, information theory, and cybernetics. Materials were published between 1963 and 1992 and are listed alphabetically by author. (RS)

  9. Potential use of geothermal resources in the Snake River Basin: an environmental overview. Volume II. Annotated bibliography

    Spencer, S.G.; Russell, B.F.; Sullivan, J.F. (eds.)


    This volume is a partially annotated bibliography of reference materials pertaining to the seven KGRA's. The bibliography is divided into sections by program element as follows: terrestrial ecology, aquatic ecology, heritage resources, socioeconomics and demography, geology, geothermal, soils, hydrology and water quality, seismicity, and subsidence. Cross-referencing is available for those references which are applicable to specific KGRA's. (MHR)

  10. Ion implantation: an annotated bibliography

    Ting, R.N.; Subramanyam, K.


    Ion implantation is a technique for introducing controlled amounts of dopants into target substrates, and has been successfully used for the manufacture of silicon semiconductor devices. Ion implantation is superior to other methods of doping such as thermal diffusion and epitaxy, in view of its advantages such as high degree of control, flexibility, and amenability to automation. This annotated bibliography of 416 references consists of journal articles, books, and conference papers in English and foreign languages published during 1973-74, on all aspects of ion implantation including range distribution and concentration profile, channeling, radiation damage and annealing, compound semiconductors, structural and electrical characterization, applications, equipment and ion sources. Earlier bibliographies on ion implantation, and national and international conferences in which papers on ion implantation were presented have also been listed separately

  11. Pulsed power bibliography. Volume 2: Annotated bibliography

    Bemesderfer, J.; Druce, R. L.; Frantz, B.; Guenther, A. H.; Kristiansen, M.; Oloughlin, J. P.; Pendleton, W. K.


    Pulsed power and high-voltage technologies are playing an ever increasing role in weapons' effects simulation, fusion power research, power distribution, materials processing and medical research. It is a rapidly expanding field of applied physics as evidenced by the growth in published literature. Three years ago, the Air Force Weapons Laboratory (AFWL) initiated a project to compile a computerized data base of pulsed power research papers. The data base is stored on our IBM System 2000. This AFWL Technical Report is the first release of the bibliography to date. It contains about 2,500 full bibliographic citations, original sources, availability, key words and abstracts. There are three indices: Subject, Personal Author, and Corporate. There are 30 main subject headings, from Breakdown Studies to Switching. Volume II contains the citations. In addition to these entries, the data base contains about 7,500 additional titles. As these titles are added to the full bibliography, they will be published.

  12. A Selected Annotated Bibliography on Work Time Options.

    Ivantcho, Barbara

    This annotated bibliography is divided into three sections. Section I contains annotations of general publications on work time options. Section II presents resources on flexitime and the compressed work week. In Section III are found resources related to these reduced work time options: permanent part-time employment, job sharing, voluntary…

  13. An Informally Annotated Bibliography of Sociolinguistics.

    Tannen, Deborah

    This annotated bibliography of sociolinguistics is divided into the following sections: speech events, ethnography of speaking and anthropological approaches to analysis of conversation; discourse analysis (including analysis of conversation and narrative), ethnomethodology and nonverbal communication; sociolinguistics; pragmatics (including…

  14. The Community Junior College: An Annotated Bibliography.

    Rarig, Emory W., Jr., Ed.

    This annotated bibliography on the junior college is arranged by topic: research tools, history, functions and purposes, organization and administration, students, programs, personnel, facilities, and research. It covers publications through the fall of 1965 and has an author index. (HH)




  16. Review of actinide-sediment reactions with an annotated bibliography

    Ames, L.L.; Rai, D.; Serne, R.J.


    The annotated bibliography is divided into sections on chemistry and geochemistry, migration and accumulation, cultural distributions, natural distributions, and bibliographies and annual reviews. (LK)

  17. Legal Information Sources: An Annotated Bibliography.

    Conner, Ronald C.

    This 25-page annotated bibliography describes the legal reference materials in the special collection of a medium-sized public library. Sources are listed in 12 categories: cases, dictionaries, directories, encyclopedias, forms, references for the lay person, general, indexes, laws and legislation, legal research aids, periodicals, and specialized…

  18. Argumentation Theory. [A Selected Annotated Bibliography].

    Benoit, William L.

    Materials dealing with aspects of argumentation theory are cited in this annotated bibliography. The 50 citations are organized by topic as follows: (1) argumentation; (2) the nature of argument; (3) traditional perspectives on argument; (4) argument diagrams; (5) Chaim Perelman's theory of rhetoric; (6) the evaluation of argument; (7) argument…

  19. Annotated Bibliography of EDGE2D Use

    J.D. Strachan and G. Corrigan


    This annotated bibliography is intended to help EDGE2D users, and particularly new users, find existing published literature that has used EDGE2D. Our idea is that a person can find existing studies which may relate to his intended use, as well as gain ideas about other possible applications by scanning the attached tables.

  20. Nutrition & Adolescent Pregnancy: A Selected Annotated Bibliography.

    National Agricultural Library (USDA), Washington, DC.

    This annotated bibliography on nutrition and adolescent pregnancy is intended to be a source of technical assistance for nurses, nutritionists, physicians, educators, social workers, and other personnel concerned with improving the health of teenage mothers and their babies. It is divided into two major sections. The first section lists selected…

  1. Great Basin Experimental Range: Annotated bibliography

    E. Durant McArthur; Bryce A. Richardson; Stanley G. Kitchen


    This annotated bibliography documents the research that has been conducted on the Great Basin Experimental Range (GBER, also known as the Utah Experiment Station, Great Basin Station, the Great Basin Branch Experiment Station, Great Basin Experimental Center, and other similar name variants) over the 102 years of its existence. Entries were drawn from the original...

  2. Annotated Bibliography of EDGE2D Use

    Strachan, J.D.; Corrigan, G.


    This annotated bibliography is intended to help EDGE2D users, and particularly new users, find existing published literature that has used EDGE2D. Our idea is that a person can find existing studies which may relate to his intended use, as well as gain ideas about other possible applications by scanning the attached tables

  3. Acid precipitation; an annotated bibliography

    Wiltshire, Denise A.; Evans, Margaret L.


    This collection of 1660 bibliographies references on the causes and environmental effects of acidic atmospheric deposition was compiled from computerized literature searches of earth-science and chemistry data bases. Categories of information are (1) atmospheric chemistry (gases and aerosols), (2) precipitation chemistry, (3) transport and deposition (wet and dry), (4) aquatic environments (biological and hydrological), (5) terrestrial environments, (6) effects on materials and structures, (7) air and precipitation monitoring and data collection, and (8) modeling studies. References date from the late 1800 's through December 1981. The bibliography includes short summaries of most documents. Omitted are unpublished manuscripts, publications in press, master 's theses and doctoral dissertations, newspaper articles, and book reviews. Coauthors and subject indexes are included. (USGS)

  4. Annotated geothermal bibliography of Utah

    Budding, K.E.; Bugden, M.H. (comps.)


    The bibliography includes all the Utah geothermal references through 1984. Some 1985 citations are listed. Geological, geophysical, and tectonic maps and reports are included if they cover a high-temperature thermal area. The references are indexed geographically either under (1) United States (national studies), (2) regional - western United States or physiographic province, (3) Utah - statewide and regional, or (4) county. Reports concerning a particular hot spring or thermal area are listed under both the thermal area and the county names.

  5. Consumer energy research: an annotated bibliography

    Anderson, C.D.; McDougall, G.H.G.


    This document is an updated and expanded version of an earlier annotated bibliography by Dr. C. Dennis Anderson and Carman Cullen (A Review and Annotation of Energy Research on Consumers, March 1978). It is the final draft of the major report that will be published in English and French and made publicly available through the Consumer Research and Evaluation Branch of Consumer and Corporate Affairs, Canada. Two agencies granting permission to include some of their energy abstracts are the Rand Corporation and the DOE Technical Information Center. The bibliography consists mainly of empirical studies, including surveys and experiments. It also includes a number of descriptive and econometric studies that utilize secondary data. Many of the studies provide summaries of research is specific areas, and point out directions for future research efforts. 14 tables.

  6. Entrainment: an annotated bibliography. Interim report

    Carrier, R.F.; Hannon, E.H.


    The 604 annotated references in this bibliography on the effects of pumped entrainment of aquatic organisms through the cooling systems of thermal power plants were compiled from published and unpublished literature and cover the years 1947 through 1977. References to published literature were obtained by searching large-scale commercial data bases, ORNL in-house-generated data bases, relevant journals, and periodical bibliographies. The unpublished literature is a compilation of Sections 316(a) and 316(b) demonstrations, environmental impact statements, and environmental reports prepared by the utilities in compliance with Federal Water Pollution Control Administration regulations. The bibliography includes references on monitoring studies at power plant sites, laboratory studies of physical and biological effects on entrained organisms, engineering strategies for the mitigation of entrainment effects, and selected theoretical studies concerned with the methodology for determining entrainment effects

  7. Special Issue: Annotated Bibliography for Volumes XIX-XXXII.

    Pullin, Richard A.


    This annotated bibliography lists 310 articles from the "Journal of Cooperative Education" from Volumes XIX-XXXII, 1983-1997. Annotations are presented in the order they appear in the journal; author and subject indexes are provided. (JOW)

  8. Annotated bibliography of Software Engineering Laboratory literature

    Morusiewicz, Linda; Valett, Jon D.


    An annotated bibliography of technical papers, documents, and memorandums produced by or related to the Software Engineering Laboratory is given. More than 100 publications are summarized. These publications cover many areas of software engineering and range from research reports to software documentation. All materials have been grouped into eight general subject areas for easy reference: The Software Engineering Laboratory; The Software Engineering Laboratory: Software Development Documents; Software Tools; Software Models; Software Measurement; Technology Evaluations; Ada Technology; and Data Collection. Subject and author indexes further classify these documents by specific topic and individual author.

  9. Annotated bibliography of software engineering laboratory literature

    Kistler, David; Bristow, John; Smith, Don


    This document is an annotated bibliography of technical papers, documents, and memorandums produced by or related to the Software Engineering Laboratory. Nearly 200 publications are summarized. These publications cover many areas of software engineering and range from research reports to software documentation. This document has been updated and reorganized substantially since the original version (SEL-82-006, November 1982). All materials have been grouped into eight general subject areas for easy reference: (1) The Software Engineering Laboratory; (2) The Software Engineering Laboratory: Software Development Documents; (3) Software Tools; (4) Software Models; (5) Software Measurement; (6) Technology Evaluations; (7) Ada Technology; and (8) Data Collection. This document contains an index of these publications classified by individual author.

  10. Promoting positive parenting: an annotated bibliography.

    Ahmann, Elizabeth


    Positive parenting is built on respect for children and helps develop self-esteem, inner discipline, self-confidence, responsibility, and resourcefulness. Positive parenting is also good for parents: parents feel good about parenting well. It builds a sense of dignity. Positive parenting can be learned. Understanding normal development is a first step, so that parents can distinguish common behaviors in a stage of development from "problems." Central to positive parenting is developing thoughtful approaches to child guidance that can be used in place of anger, manipulation, punishment, and rewards. Support for developing creative and loving approaches to meet special parenting challenges, such as temperament, disabilities, separation and loss, and adoption, is sometimes necessary as well. This annotated bibliography offers resources to professionals helping parents and to parents wishing to develop positive parenting skills.

  11. Pulsed power bibliography. Volume 2. Annotated bibliography. Final report

    Bemesderfer, J.; Druce, R.L.; Frantz, B.; Guenther, A.H.; Kristiansen, M.


    Pulsed power and high-voltage technologies are playing an ever increasing role in weapons' effects simulation, fusion power research, power distribution, materials processing and medical research. It is a rapidly expanding field of applied physics as evidenced by the growth in published literature. Three years ago, the Air Force Weapons Laboratory (AFWL) initiated a project to compile a computerized data base of pulsed power research papers. The data base is stored on our IBM System 2000. This AFWL Technical Report is the first release of the bibliography to date. It contains about 2,500 full bibliographic citations, original sources, availability, key words and abstracts. There are three indices: Subject, Personal Author, and Corporate. There are 30 main subject headings, from Breakdown Studies to Switching. Volume II contains the citations. In addition to these entries, the data base contains about 7,500 additional titles. As these titles are added to the full bibliography, they will be published.

  12. Fluid inclusions in salt: an annotated bibliography

    Isherwood, D.J.


    An annotated bibliography is presented which was compiled while searching the literature for information on fluid inclusions in salt for the Nuclear Regulatory Commission's study on the deep-geologic disposal of nuclear waste. The migration of fluid inclusions in a thermal gradient is a potential hazard to the safe disposal of nuclear waste in a salt repository. At the present time, a prediction as to whether this hazard precludes the use of salt for waste disposal can not be made. Limited data from the Salt-Vault in situ heater experiments in the early 1960's (Bradshaw and McClain, 1971) leave little doubt that fluid inclusions can migrate towards a heat source. In addition to the bibliography, there is a brief summary of the physical and chemical characteristics that together with the temperature of the waste will determine the chemical composition of the brine in contact with the waste canister, the rate of fluid migration, and the brine-canister-waste interactions

  13. Annotated bibliography of South African indigenous evergreen forest ecology

    Geldenhuys, CJ


    Full Text Available Annotated references to 519 publications are presented, together with keyword listings and keyword, regional, place name and taxonomic indices. This bibliography forms part of the first phase of the activities of the Forest Biome Task Group....

  14. Geothermal wetlands: an annotated bibliography of pertinent literature

    Stanley, N.E.; Thurow, T.L.; Russell, B.F.; Sullivan, J.F.


    This annotated bibliography covers the following topics: algae, wetland ecosystems; institutional aspects; macrophytes - general, production rates, and mineral absorption; trace metal absorption; wetland soils; water quality; and other aspects of marsh ecosystems. (MHR)

  15. Rural Development Literature 1976-1977: An Updated Annotated Bibliography.

    Buzzard, Shirley, Comp.

    More than 100 books and articles on rural development published during 1976-77 are annotated in this selective bibliography. Concentrating on social science literature, the bibliography is interdisciplinary in nature, spanning agricultural economics, anthropology, community development, community health, and rural sociology. Types of works…

  16. Annotated bibliography of highly ionized atoms of importance to plasmas

    Schmieder, R.W.


    A bibliography is presented of the literature on highly ionized atoms which have relevance to plasmas. The bibliography is annotated with keywords, and indexed by subjects and authors. It should be of greatest use to researchers working on the problems of impurity cooling and diagnostics of CTR plasmas. (U.S.)

  17. Resources for Achieving Sex Equity: An Annotated Bibliography.

    Miller, Susan W., Comp.

    This annotated bibliography provides a list of resources dealing with sex equity in vocational education. The bibliography first provides operational definitions of "sexism,""sex fair,""sex affirmative,""sex bias," and "affirmative action." It then lists resources under the following topics and/or bibliographic forms: (1) sex role definition, (2)…

  18. Persuasion: Attitude/Behavior Change. A Selected, Annotated Bibliography.

    Benoit, William L.

    Designed for teachers, students and researchers of the psychological dimensions of attitude and behavior change, this annotated bibliography lists books, bibliographies and articles on the subject ranging from general introductions and surveys through specific research studies, and from theoretical position essays to literature reviews. The 42…

  19. Frame on frames: an annotated bibliography

    Wright, T.; Tsao, H.J.


    The success or failure of any sample survey of a finite population is largely dependent upon the condition and adequacy of the list or frame from which the probability sample is selected. Much of the published survey sampling related work has focused on the measurement of sampling errors and, more recently, on nonsampling errors to a lesser extent. Recent studies on data quality for various types of data collection systems have revealed that the extent of the nonsampling errors far exceeds that of the sampling errors in many cases. While much of this nonsampling error, which is difficult to measure, can be attributed to poor frames, relatively little effort or theoretical work has focused on this contribution to total error. The objective of this paper is to present an annotated bibliography on frames with the hope that it will bring together, for experimenters, a number of suggestions for action when sampling from imperfect frames and that more attention will be given to this area of survey methods research

  20. Annotated bibliography of LAMPF research and development

    Jameson, R.A.; Roybal, E.U.


    A bibliography on published and in-house technical material written on LAMPF activities since its inception is presented. Subject and author concordances provide cross-reference to detailed citations, which include an abstract and notes on the material. The bibliography resides in a computer database that can be searched for key words and phrases.

  1. Annotated bibliography of LAMPF research and development

    Jameson, R.A.; Roybal, E.U.


    A bibliography on published and in-house technical material written on LAMPF activities since its inception is presented. Subject and author concordances provide cross-reference to detailed citations, which include an abstract and notes on the material. The bibliography resides in a computer database that can be searched for key words and phrases

  2. Music journals in South Africa 1854-2010: an annotated bibliography

    Music journals in South Africa 1854-2010: an annotated bibliography. ... The article focuses on presenting an annotated bibliography of music journalism in South Africa from as early as 1854 until 2010. Most of ... Key words: annotated bibliography, electronic journals, music journals, periodicals, South African music history ...

  3. Annotated Bibliography; Freedom of Information Center Reports and Summary Papers.

    Freedom of Information Center, Columbia, MO.

    This bibliography lists and annotates almost 400 information reports, opinion papers, and summary papers dealing with freedom of information. Topics covered include the nature of press freedom and increased press efforts toward more open access to information; the press situation in many foreign countries, including France, Sweden, Communist…

  4. Annotated bibliography of remote sensing methods for monitoring desertification

    Walker, A.S.; Robinove, Charles J.


    Remote sensing techniques are valuable for locating, assessing, and monitoring desertification. Remotely sensed data provide a permanent record of the condition of the land in a format that allows changes in land features and condition to be measured. The annotated bibliography of 118 items discusses remote sensing methods that may be applied to desertification studies.

  5. Douglas-fir tussock moth: an annotated bibliography.

    Robert W. Campbell; Lorna C. Youngs


    This annotated bibliography includes references to 338 papers. Each deals in some way with either the Douglas-fir tussock moth, Orgyia pseudotsugata (McDunnough), or a related species. Specifically, 210 publications and 82 unpublished documents make some reference, at least, to the Douglas-fir tussock moth; 55 are concerned with other species in...




  7. Workshops for the Handicapped; An Annotated Bibliography - No. 6.

    Perkins, Dorothy C., Comp.; And Others

    An annotated bibliography of workshops for the handicapped covers the literature on work programs for the period July, 1968 through June, 1969. One hundred and fifty four publications were reviewed; the number of articles on administration, management, and planning of facilities and programs has increased since the last edition. (Author/RJ)

  8. Adolescent Literacy Resources: An Annotated Bibliography. Second Edition 2009

    Center on Instruction, 2009


    This annotated bibliography updated from a 2007 edition, is intended as a resource for technical assistance providers as they work with states on adolescent literacy. This revision includes current research and documents of practical use in guiding improvements in grades 4-12 reading instruction in the content areas and in interventions for…

  9. Ethical Issues in Health Services: A Report and Annotated Bibliography.

    Carmody, James

    This publication identifies, discusses, and lists areas for further research for five ethical issues related to health services: 1) the right to health care; 2) death and euthanasia; 3) human experimentation; 4) genetic engineering; and, 5) abortion. Following a discussion of each issue is a selected annotated bibliography covering the years 1967…

  10. Legal and Political Aspects of Satellite Telecommunication: An Annotated Bibliography.

    Shervis, Katherine, Comp.

    The potential of satellites for telecommunication is enormous; however, it is possible that political and legal barriers rather than technological considerations will ultimately shape the utilization of satellite systems. This annotated bibliography is designed for use by lawyers, political scientists, technicians, engineers, and scholars who need…

  11. Classic Religious Books for Children: An Annotated Bibliography.

    Campbell, Carol, Comp.

    This annotated bibliography of religious books for children contains approximately 450 books, one-fifth of which are Judaic. The books' current availability has been verified using Web sites such as those of individual publishers, the Library of Congress,, or Barnes& New subject headings have been added, such as Kwanza,…

  12. An Annotated Bibliography of the Gestalt Methods, Techniques, and Therapy

    Prewitt-Diaz, Joseph O.

    The purpose of this annotated bibliography is to provide the reader with a guide to relevant research in the area of Gestalt therapy, techniques, and methods. The majority of the references are journal articles written within the last 5 years or documents easily obtained through interlibrary loans from local libraries. These references were…

  13. Pertinent Discussions Toward Modeling the Social Edition: Annotated Bibliographies

    Siemens, R.; Timney, M.; Leitch, C.; Koolen, C.; Garnett, A.


    The two annotated bibliographies present in this publication document and feature pertinent discussions toward the activity of modeling the social edition, first exploring reading devices, tools and social media issues and, second, social networking tools for professional readers in the Humanities.

  14. Annotated Bibliography of Materials for Elementary Foreign Language Programs.

    Dobb, Fred

    An annotated bibliography contains about 70 citations of instructional materials and materials concerning curriculum development for elementary school foreign language programs. Citations are included for Arabic, classical languages, French, German, Hebrew, Italian, Japanese, and Spanish. Items on exploratory language courses and general works on…

  15. Annotated Bibliography of Law-Related Pollution Prevention Sources.

    Lynch, Holly; Murphy, Elaine

    This annotated bibliography of law-related pollution prevention sources was prepared by the National Pollution Prevention Center for Higher Education. Some topics of the items include waste reduction, hazardous wastes, risk reduction, environmental policy, pollution prevention, environmental protection, environmental leadership, environmental…

  16. Annotated bibliography of human factors applications literature

    McCafferty, D.B.


    This bibliography was prepared as part of the Human Factors Technology Project, FY 1984, sponsored by the Office of Nuclear Safety, US Department of Energy. The project was conducted by Lawrence Livermore National Laboratory, with Essex Corporation as a subcontractor. The material presented here is a revision and expansion of the bibliographic material developed in FY 1982 as part of a previous Human Factors Technology Project. The previous bibliography was published September 30, 1982, as Attachment 1 to the FY 1982 Project Status Report.

  17. Annotated bibliography of human factors applications literature

    McCafferty, D.B.


    This bibliography was prepared as part of the Human Factors Technology Project, FY 1984, sponsored by the Office of Nuclear Safety, US Department of Energy. The project was conducted by Lawrence Livermore National Laboratory, with Essex Corporation as a subcontractor. The material presented here is a revision and expansion of the bibliographic material developed in FY 1982 as part of a previous Human Factors Technology Project. The previous bibliography was published September 30, 1982, as Attachment 1 to the FY 1982 Project Status Report

  18. Poverty in America: An Annotated Bibliography. Magill Bibliographies.

    Pressman, Steven

    This bibliography is a comprehensive treatment of poverty in the United States. It summarizes the major economic, literary, sociological, historical, and other social-science literature written over the past century on this topic. In addition to general descriptions of the measurement, causes, and consequences of poverty, individual chapters…

  19. Annotated Tsunami bibliography: 1962-1976

    Pararas-Carayannis, G.; Dong, B.; Farmer, R.


    This compilation contains annotated citations to nearly 3000 tsunami-related publications from 1962 to 1976 in English and several other languages. The foreign-language citations have English titles and abstracts

  20. Sugar pine management—an annotated bibliography

    James L. Averell; John C. Crowell; Clarence R. Quick; Gilbert H. Schubert


    The purposes of this bibliography are to enumerate and describe publications that have a bearing on the growing of sugar pine for timber production. It is intended primarily for the information of forest managers, and it includes mainly those articles which appeared to pertain rather directly to management. Although a careful search was made for titles, no claim is...

  1. At Issue: Academic Integrity, an Annotated Bibliography

    Pricer, Wayne F.


    Academic integrity is central to the heart of any academic institution, yet the topic is a complex one. This bibliography addresses the subjects of copyright and plagiarism. Resources for exploring common campus copyright and fair use issues seek to answer common, frequently misunderstood questions such as what exactly does "copyright" mean? What…

  2. The Evaluation of Teachers. ERS Annotated Bibliography.

    Baral, Laurie R., Comp.

    To provide a useful reference to published and unpublished documents relating to teacher evaluation, a search was made of the Education Index, Research in Education (RIE), and Current Index to Journals in Education (CIJE), which resulted in this 125-item bibliography. The source for each entry is indicated, along with pricing and ordering…

  3. An Annotated Bibliography for Environmental Educators.

    Stitt, Thomas R.

    This bibliography is organized according to occupations: biology and agriculture, business, marketing, management, health, industrial, and public service. In addition, entries are further classified as air, water, public water supply, land pollution, noise, atomic radiation, and general. Over 130 books, publications, and articles are cited, with…

  4. An Annotated Bibliography of Concept Mapping

    Garcia, GNA


    A rich narrative-style bibliography of concept mapping (reviewing six articles published between 1992-2005). Articles reviewed include: (1) Cognitive mapping: A qualitative research method for social work (C. Bitoni); (2) Collaborative concept mapping: Provoking and supporting meaningful discourse (C. Boxtel, J. Linden, E. Roelofs, and G. Erkens);…

  5. An Annotated Bibliography of Accelerated Learning

    Garcia, GNA


    A rich narrative-style bibliography of accelerated learning (reviewing six articles published between 1995-2003). Articles reviewed include: (1) Accelerative learning and the Emerging Science of Wholeness (D. D. Beale); (2) Effective Teaching in Accelerated Learning Programs (D. Boyd); (3) A Critical Theory Perspective on Accelerated Learning (S.…

  6. Consumer energy research: an annotated bibliography. Vol. 3

    Anderson, D.C.; McDougall, G.H.G.


    This annotated bibliography attempts to provide a comprehensive package of existing information in consumer related energy research. A concentrated effort was made to collect unpublished material as well as material from journals and other sources, including governments, utilities research institutes and private firms. A deliberate effort was made to include agencies outside North America. For the most part the bibliography is limited to annotations of empiracal studies. However, it includes a number of descriptive reports which appear to make a significant contribution to understanding consumers and energy use. The format of the annotations displays the author, date of publication, title and source of the study. Annotations of empirical studies are divided into four parts: objectives, methods, variables and findings/implications. Care was taken to provide a reasonable amount of detail in the annotations to enable the reader to understand the methodology, the results and the degree to which the implications fo the study can be generalized to other situations. Studies are arranged alphabetically by author. The content of the studies reviewed is classified in a series of tables which are intended to provide a summary of sources, types and foci of the various studies. These tables are intended to aid researchers interested in specific topics to locate those studies most relevant to their work. The studies are categorized using a number of different classification criteria, for example, methodology used, type of energy form, type of policy initiative, and type of consumer activity. A general overview of the studies is also presented. 17 tabs.

  7. Annotated Bibliography for the DEWPOINT project

    Oehmen, Christopher S.


    This bibliography covers aspects of the Detection and Early Warning of Proliferation from Online INdicators of Threat (DEWPOINT) project including 1) data management and querying, 2) baseline and advanced methods for classifying free text, and 3) algorithms to achieve the ultimate goal of inferring intent from free text sources. Metrics for assessing the quality and correctness of classification are addressed in the second group. Data management and querying include methods for efficiently storing, indexing, searching, and organizing the data we expect to operate on within the DEWPOINT project.

  8. Annotated Bibliography for Drying Nuclear Fuel

    Rebecca E. Smith


    Internationally, the nuclear industry is represented by both commercial utilities and research institutions. Over the past two decades many of these entities have had to relocate inventories of spent nuclear fuel from underwater storage to dry storage. These efforts were primarily prompted by two factors: insufficient storage capacity (potentially precipitated by an open-ended nuclear fuel cycle) or deteriorating quality of existing underwater facilities. The intent of developing this bibliography is to assess what issues associated with fuel drying have been identified, to consider where concerns have been satisfactorily addressed, and to recommend where additional research would offer the most value to the commercial industry and the U. S. Department of Energy.

  9. Deburring: an annotated bibliography. Volume V

    Gillespie, L.K.


    An annotated summary of 204 articles and publications on burrs, burr prevention and deburring is presented. Thirty-seven deburring processes are listed. Entries cited include English, Russian, French, Japanese and German language articles. Entries are indexed by deburring processes, author, and language. Indexes also indicate which references discuss equipment and tooling, how to use a process, economics, burr properties, and how to design to minimize burr problems. Research studies are identified as are the materials deburred


    V. M. Kotlyakov


    Full Text Available This bibliography includes 294 books and articles published mostly in 2010. Annotated books and articles relate to ten thematic sections of glaciology:1. General problems of glaciology2. Physics and chemistry of ice3. Ice in atmosphere4. Snow cover5. Snow avalanches and glacial mudflows6. Sea ice7. River and lake ice8. Icings and ground ice9. Glaciers and ice sheets10. Paleoglaciology

  11. Recruiting and Retaining Army Nurses: An Annotated Bibliography

    Roberts, Benjamin J.; Kocher, Kathryn M.


    This listing of annotated references includes studies dealing with the labor market behavior of registered nurses. References describing both the military and the civilian working environments for RNs are contained in the bibliography. Because the Army must recruit and retain nurses in the context of the national labor market for nurses, a broad perspective was maintained in selecting publication. Studies dealing with the factors influential in attracting and retaining Army Active Duty and Re...

  12. Grass buffers for playas in agricultural landscapes: An annotated bibliography

    Melcher, Cynthia P.; Skagen, Susan K.


    This bibliography and associated literature synthesis (Melcher and Skagen, 2005) was developed for the Playa Lakes Joint Venture (PLJV). The PLJV sought compilation and annotation of the literature on grass buffers for protecting playas from runoff containing sediments, nutrients, pesticides, and other contaminants. In addition, PLJV sought information regarding the extent to which buffers may attenuate the precipitation runoff needed to fill playas, and avian use of buffers. We emphasize grass buffers, but we also provide information on other buffer types.

  13. Cultural Influences on Intertemporal Reasoning: An Annotated Bibliography


    relative. Loans have moral connotations. Both parties are “loved by Allah” (p. 117). But to ask for a loan implies that one is not Pukhtun. Debts to Pukhtuns must be repaid. When debts are owed to outsiders, there is no moral obligation to repay. Among themselves, Pukhtun...what truth is.” (p. 25) Annotated Bibliography 29 NOTE: In other sections of the book, Shuon discusses the relativism of Christianity in

  14. Systemic Planning: An Annotated Bibliography and Literature Guide. Exchange Bibliography No. 91.

    Catanese, Anthony James

    Systemic planning is an operational approach to using scientific rigor and qualitative judgment in a complementary manner. It integrates rigorous techniques and methods from systems analysis, cybernetics, decision theory, and work programing. The annotated reference sources in this bibliography include those works that have been most influential…

  15. Environmental Support to Amphibious Craft, Patrol Boats, and Coastal Ships: An Annotated Bibliography

    Bachmann, Charles M; Fusina, Robert A; Nichols, C. R; McDermid, Jack


    This annotated bibliography is a selection of citations to books, articles, documents, and data bases highlighting environmental conditions that impact the safety and performance of amphibious craft...

  16. Annotated bibliography of economic literature on wetlands

    Douglas, Aaron J.


    This bibliography is intended for the use of wetlands scientists, policy analysts, and natural resource professionals who have little acquaintance with natural resource economics, and natural resource professionals who have some background in economic analysis and wish to sharpen their appreciation of the specialized methods used to value the nonmarket uses of wetland resources. It is not intended to serve as a first primer of natural resource economics. The purpose of including this discussion is to introduce the reader to the fact that specialized language and analytic techniques are used in this field, and that summary discussion of these techniques are not available in introductory or intermediate level economics textbooks. A key difficulty in economic analysis lies in the need that economists have to express common-sense terms such as "demand" or "supply" in a precise way; this facilitates the interpretation of data and is a powerful aid in making internally consistent, policy analysis. Natural resource economists would like to find a consistent, intuitively plausible measure of the social benefits conferred by some good or service. The most common fallacy noneconomists make in this field is to use expenditures as a measure of well-being or benefits. This measure is defective; expenditures may rise, while benefits fall. The following simple example should clarify the issue. Suppose that a certain population center, in the 1940's, is located 5 miles from a riverine recreation site. Suppose that a factory opens up 15 miles away from the site during the 1950's, and closes at the end of the 1960's; and that during this 20-year period, the bulk of this region's populace resides 15 miles from the site, close to the factory. In the 1970's, the populace of the region returns to the old population center, 5 miles from the recreation site. The benefits conferred by the site diminished during the 1950's and 1960's, even though travel (and even total) expenditures

  17. Low-level radioactive waste technology: a selected, annotated bibliography

    Fore, C.S.; Carrier, R.F.; Brewster, R.H.; Hyder, L.K.; Barnes, K.A.


    This annotated bibliography of 416 references represents the third in a series to be published by the Hazardous Materials Information Center containing scientific, technical, economic, and regulatory information relevant to low-level radioactive waste technology. The bibliography focuses on disposal site, environmental transport, and waste treatment studies as well as general reviews on the subject. The publication covers both domestic and foreign literature for the period 1951 to 1981. Major chapters selected are Chemical and Physical Aspects; Container Design and Performance; Disposal Site; Environmental Transport; General Studies and Reviews; Geology, Hydrology, and Site Resources; Regulatory and Economic Aspects; Social Aspects; Transportation Technology; Waste Production; and Waste Treatment. Entries in each of the chapters are further classified as a field study, laboratory study, theoretical study, or general overview involving one or more of these research areas

  18. Impingement and entrainment: an updated annotated bibliography. Final report

    Yost, F.E.; Uziel, M.S.


    Presented as an annotated bibliography are 1343 references dealing with entrainment and impingement effects on aquatic organisms passing through the cooling systems of thermal power plants. The references were obtained from open literature and from environmental reports and impact statements prepared by or for the electric utility industry. Two earlier bibliographies contain literature from 1950 through 1976. This update contains additional literature acquired since 1976. Topics covered are site-specific field studies at facilities located on lakes, reservoirs, rivers, or estuaries. The studies include special engineering studies, laboratory studies, studies of biological effects, reviews and methodologies, and studies of the mitigation of effects. References are arranged alphabetically by author, and indexes are provided to personal and corporate authors, and to facility, waterbody, and taxonomic names

  19. An Annotated Bibliography on Silicon Nitride for Structural Applications


    annotated in this bibliography with each entry under the name of the specific author. 16. Canteloup, J., and Mocellin , A., "Synthesis of...thinning. Oxidation of the SJ3N4 grains started at the grain boundaries. 81. Torre, J. P., and Mocellin , A., "On the Existence of Si-AI-O-N Solid...Torre, J. P., and Mocellin , A., "Some Effects of Al and O2 on the Nitridation of Silicon Compacts", J. Mater. Sei., 11., 1725-1733(1976). Highest final

  20. Eastern gas shales bibliography selected annotations: gas, oil, uranium, etc. Citations in bituminous shales worldwide

    Hall, V.S. (comp.)


    This bibliography contains 2702 citations, most of which are annotated. They are arranged by author in numerical order with a geographical index following the listing. The work is international in scope and covers the early geological literature, continuing through 1979 with a few 1980 citations in Addendum II. Addendum I contains a listing of the reports, well logs and symposiums of the Unconventional Gas Recovery Program (UGR) through August 1979. There is an author-subject index for these publications following the listing. The second part of Addendum I is a listing of the UGR maps which also has a subject-author index following the map listing. Addendum II includes several important new titles on the Devonian shale as well as a few older citations which were not found until after the bibliography had been numbered and essentially completed. A geographic index for these citations follows this listing.

  1. Low-level radioactive waste technology: a selected, annotated bibliography

    Fore, C.S.; Vaughan, N.D.; Hyder, L.K.


    This annotated bibliography of 447 references contains scientific, technical, economic, and regulatory information relevant to low-level radioactive waste technology. The bibliography focuses on environmental transport, disposal site, and waste treatment studies. The publication covers both domestic and foreign literature for the period 1952 to 1979. Major chapters selected are Chemical and Physical Aspects; Container Design and Performance; Disposal Site; Environmental Transport; General Studies and Reviews; Geology, Hydrology and Site Resources; Regulatory and Economic Aspects; Transportation Technology; Waste Production; and Waste Treatment. Specialized data fields have been incorporated into the data file to improve the ease and accuracy of locating pertinent references. Specific radionuclides for which data are presented are listed in the Measured Radionuclides field, and specific parameters which affect the migration of these radionuclides are presented in the Measured Parameters field. In addition, each document referenced in this bibliography has been assigned a relevance number to facilitate sorting the documents according to their pertinence to low-level radioactive waste technology. The documents are rated 1, 2, 3, or 4, with 1 indicating direct applicability to low-level radioactive waste technology and 4 indicating that a considerable amount of interpretation is required for the information presented to be applied. The references within each chapter are arranged alphabetically by leading author, corporate affiliation, or title of the document. Indexes are provide for (1) author(s), (2) keywords, (3) subject category, (4) title, (5) geographic location, (6) measured parameters, (7) measured radionuclides, and (8) publication description

  2. Low-level radioactive waste technology: a selected, annotated bibliography

    Fore, C.S.; Vaughan, N.D.; Hyder, L.K.


    This annotated bibliography of 447 references contains scientific, technical, economic, and regulatory information relevant to low-level radioactive waste technology. The bibliography focuses on environmental transport, disposal site, and waste treatment studies. The publication covers both domestic and foreign literature for the period 1952 to 1979. Major chapters selected are Chemical and Physical Aspects; Container Design and Performance; Disposal Site; Environmental Transport; General Studies and Reviews; Geology, Hydrology and Site Resources; Regulatory and Economic Aspects; Transportation Technology; Waste Production; and Waste Treatment. Specialized data fields have been incorporated into the data file to improve the ease and accuracy of locating pertinent references. Specific radionuclides for which data are presented are listed in the Measured Radionuclides field, and specific parameters which affect the migration of these radionuclides are presented in the Measured Parameters field. In addition, each document referenced in this bibliography has been assigned a relevance number to facilitate sorting the documents according to their pertinence to low-level radioactive waste technology. The documents are rated 1, 2, 3, or 4, with 1 indicating direct applicability to low-level radioactive waste technology and 4 indicating that a considerable amount of interpretation is required for the information presented to be applied. The references within each chapter are arranged alphabetically by leading author, corporate affiliation, or title of the document. Indexes are provide for (1) author(s), (2) keywords, (3) subject category, (4) title, (5) geographic location, (6) measured parameters, (7) measured radionuclides, and (8) publication description.

  3. Annotated bibliography of uranium in Australia, 1970-1987

    O'Faircheallaigh, C.; Webb, A.; Wade-Marshall, D.


    The bibliography contains 845 separate numbered items which deal with uranium mining in Australia during the period 1970-1987, which it was feasible to annotate, which are publicly available, and which are not of a highly technical nature. The bibliography is not restricted to material originating in Australia. The items are organised into nine major subject areas on the basis of their principal subject matter, with cross references being added in cases where more than one subject area is dealt with. The nine sections deal with the development and structure of the Australian uranium industry; the uranium debate; uranium policies; uranium and Aborigines; economic issues; domestic processing and utilisation of Australian uranium; environmental issues; nuclear proliferation and safeguards; and the major individual uranium projects. The bibliography is preceded by a chapter on its scope, organisation and sources and by an overview providing background information on the nuclear fuel cycle, uranium in Australia and Australian uranium policy and is followed by an author index

  4. Algae from the arid southwestern United States: an annotated bibliography

    Thomas, W.H.; Gaines, S.R.


    Desert algae are attractive biomass producers for capturing solar energy through photosynthesis of organic matter. They are probably capable of higher yields and efficiencies of light utilization than higher plants, and are already adapted to extremes of sunlight intensity, salinity and temperature such as are found in the desert. This report consists of an annotated bibliography of the literature on algae from the arid southwestern United States. It was prepared in anticipation of efforts to isolate desert algae and study their yields in the laboratory. These steps are necessary prior to setting up outdoor algal culture ponds. Desert areas are attractive for such applications because land, sunlight, and, to some extent, water resources are abundant there. References are sorted by state.

  5. Chest x-ray screening practices: an annotated bibliography

    Torchia, M.; DuChez, J.


    This annotated bibliography is a review of the scientific literature on the selection of asymptomatic patients for chest x-ray screening examinations. Selected articles cover a period of time from 1969 through 1979. The articles are organized under 10 main topics which correspond to various categories of chest x-ray screening examinations performed in the United States today. Within each main topic, the articles are presented in chronological order. To aid the reader in identifying specific citations, an author index and a list of citations by journal have been included for user reference. The standard format for each citation includes the title of each article, the author(s), journal, volume, page, date, and abstract

  6. Annotated bibliography of coal in the Caribbean region. [Lignite

    Orndorff, R.C.


    The purpose of preparing this annotated bibliography was to compile information on coal localities for the Caribbean region used for preparation of a coal map of the region. Also, it serves as a brief reference list of publications for future coal studies in the Caribbean region. It is in no way an exhaustive study or complete listing of coal literature for the Caribbean. All the material was gathered from published literature with the exception of information from Cuba which was supplied from a study by Gordon Wood of the US Geological Survey, Branch of Coal Resources. Following the classification system of the US Geological Survey (Wood and others, 1983), the term coal resources has been used in this report for reference to general estimates of coal quantities even though authors of the material being annotated may have used the term coal reserves in a similar denotation. The literature ranges from 1857 to 1981. The countries listed include Colombia, Mexico, Venezuela, Cuba, the Dominican Republic, Haiti, Jamaica, Puerto Rico, and the countries of Central America.

  7. Annotated Bibliography of Bird Hazards to Aircraft: Bird Strike Committee Citations 1967-1997

    Short, Jeffrey


    .... This annotated bibliography of bird hazards to aircraft, termed ABBHA, is a compilation of citations with abstracts on a wide range of related topics such as bird strike tolerance engineering, bird...

  8. An Annotated Bibliography of Research on Reading and Adults Learning English as a Second Language.

    Burt, Miriam, Comp.; Florez, MaryAnn, Comp.; Terrill, Lynda, Comp.; Van Duzer, Carol, Comp.

    This annotated bibliography contains 27 references regarding research on reading and adults learning English as a Second Language (ESL). None of the resources are more than 10 years old. (Adjunct ERIC Clearinghouse for ESL Literacy Education) (KFT)

  9. Annotated Bibliography of Dr Salmani Nodoushan's Research on Education and Language Teaching

    Etemadfar Kashani, Abbas Ali


    This is an annotated bibliography of the research conducted on education and language teaching and assessment by Dr. Mohammad Ali Salmani Nodoushan in the past 25 years. This bibliography is a precise picture of the current state of education and language teaching and assessment in Iran. Dr. Salmani Nodoushan is the most distinguished Iranian…

  10. Annotated Bibliography on Koreans in America. Working Papers on Asian American Studies.

    Kim, Christopher; Takabashi, Michiko, Ed.

    This annotated bibliography lists bibliographies, directories, articles, unpublished papers, manuals, citations, conference reports, and other documents dealing with Koreans in America. Topics considered include general history, immigration history, deportation cases, Korean students, State and Federal legislation affecting Koreans in America,…

  11. Research on College Board Programs and Services: Annotated Bibliography 2012. Research in Review 2012-2

    Barry, Carol; Bausmith, Jennifer; Cooney, Siobhan; Laitusis, Vytas; Matos-Elefonte, Haifa; McKillip, Mary; Niu, Sunny; Rawls, Anita


    This annotated bibliography contains summaries of research studies examining a number of College Board assessments and programs. To be included in the bibliography, each study needed to meet a number of criteria. First, articles must have been published (as a College Board research report, in an external journal, or as an ETS research report).…

  12. Sex Discrimination in Higher Education and the Professions: An Annotated Bibliography.

    Donovan, Mary

    An annotated bibliography on sex discrimination in higher education and the professions is presented. Sex discrimination remains a major workplace problem and is found in virtually all levels of employment. The bibliography consists of 124 citations which appeared from 1984-1988. It excludes court cases and the "popular press," and although not…

  13. Promotores de salud and community health workers: an annotated bibliography.

    WestRasmus, Emma K; Pineda-Reyes, Fernando; Tamez, Montelle; Westfall, John M


    For underserved and disenfranchised communities in the United States, affordable, effective health care can be nearly inaccessible, which often leads to the exclusion of these communities from relevant medical information and care. Barriers to care are especially salient in minority communities, where language, traditions and customs, socioeconomics, and access to education can serve as additional roadblocks to accessing health care information and services. These factors have contributed to a national health disparity crisis that unnecessarily places some communities in a vulnerable position without adequate prevention and treatment opportunities. One solution to the exclusion some communities face in the health care system may be the promotores de salud (PdS)/community health worker (CHW), an approach to culturally competent health care delivery whose popularity in the mainstream health care system has been steadily growing in recent decades. Known by a wide variety of names and broad in the spectrum of health issues they address, the PdS/CHW serves as cultural brokers between their own community and the formal health care system and can play a crucial role in promoting health and wellness within their community. This annotated bibliography was created to educate the reader about the history, definition, key features, utility, outcomes, and broad potential of the CHW approach in a variety of populations. Intended to serve as a reference point to a vast body of information on the CHW/PdS approach, this document is a resource for those wishing to effect change in the disparities within the health care system, and to improve the access to, quality, and cost of health care for underserved patients and their communities. Promotores de Salud is a Spanish term that translates to Health Promoter. A female health worker may be referred to as a Promotora, a male as a Promotor, and the plural of both is Promotores. For the purposes of this bibliography, the terms community

  14. Annotated Bibliography of Textbooks and Reference Materials in Marine Sciences. Provisional Edition. Intergovernmental Oceanographic Commission, Technical Series.

    United Nations Educational, Scientific, and Cultural Organization, Paris (France). Intergovernmental Oceanographic Commission.

    Presented is an annotated bibliography based on selected materials from a preliminary survey of existing bibliographies, publishers' listings, and other sources. It is intended to serve educators and researchers, especially those in countries where marine sciences are just developing. One hundred annotated and 450 non-annotated entries are…

  15. Simulator fidelity and training effectiveness: a comprehensive bibliography with selected annotations

    Rankin, W.L.; Bolton, P.A.; Shikiar, R.; Saari, L.M.


    This document contains a comprehensive bibliography on the topic of simulator fidelity and training effectiveness, prepared during the preliminary phases of work on an NRC-sponsored project on the Role of Nuclear Power Plant Simulators in Operator Licensing and Training. Section A of the document is an annotated bibliography consisting of articles and reports with relevance to the psychological aspects of simulator fidelity and the effectiveness of training simulators in a variety of settings, including military. The annotated items are drawn from a more comprehensive bibliography, presented in Section B, listing documents treating the role of simulators in operator training both in the nuclear industry and elsewhere

  16. An Annotated and Cross-Referenced Bibliography on Computer Security and Access Control in Computer Systems.

    Bergart, Jeffrey G.; And Others

    This paper represents a careful study of published works on computer security and access control in computer systems. The study includes a selective annotated bibliography of some eighty-five important published results in the field and, based on these papers, analyzes the state of the art. In annotating these works, the authors try to be…

  17. Bibliographies.

    Halsted, Ann L., Comp.


    Two annotated bibliographies of books are compiled, one devoted to Roosevelt and the New Deal, the other concerned with Hitler, the Weimar Republic, and the rise of Nazism. Annotations indicate scope of the work and occasionally point out bias or point of view. (CS)

  18. Individualization and Modularization of Vocational Education Instructional Materials. An Annotated Bibliography of Publications and Projects. Bibliography Series No. 32.

    Magisos, Joel H., Comp.; Stakelon, Anne E., Comp.

    This annotated bibliography is designed to assist applicants for research grants under part C (section 131a) of the amendments to the Vocational Education Act of 1963 by providing access to documents, journal articles, and current projects related to the individualization and modularization of vocational education instructional materials. The…

  19. Selected annotated bibliographies for adaptive filtering of digital image data

    Mayers, Margaret; Wood, Lynnette


    Digital spatial filtering is an important tool both for enhancing the information content of satellite image data and for implementing cosmetic effects which make the imagery more interpretable and appealing to the eye. Spatial filtering is a context-dependent operation that alters the gray level of a pixel by computing a weighted average formed from the gray level values of other pixels in the immediate vicinity.Traditional spatial filtering involves passing a particular filter or set of filters over an entire image. This assumes that the filter parameter values are appropriate for the entire image, which in turn is based on the assumption that the statistics of the image are constant over the image. However, the statistics of an image may vary widely over the image, requiring an adaptive or "smart" filter whose parameters change as a function of the local statistical properties of the image. Then a pixel would be averaged only with more typical members of the same population. This annotated bibliography cites some of the work done in the area of adaptive filtering. The methods usually fall into two categories, (a) those that segment the image into subregions, each assumed to have stationary statistics, and use a different filter on each subregion, and (b) those that use a two-dimensional "sliding window" to continuously estimate the filter either the spatial or frequency domain, or may utilize both domains. They may be used to deal with images degraded by space variant noise, to suppress undesirable local radiometric statistics while enforcing desirable (user-defined) statistics, to treat problems where space-variant point spread functions are involved, to segment images into regions of constant value for classification, or to "tune" images in order to remove (nonstationary) variations in illumination, noise, contrast, shadows, or haze.Since adpative filtering, like nonadaptive filtering, is used in image processing to accomplish various goals, this bibliography

  20. Stakeholder involvement techniques. A short guide and annotated bibliography


    The Forum on Stakeholder Confidence (FSC) was created under a mandate from the Radioactive Waste Management Committee (RWMC) of the OECD Nuclear Energy Agency (NEA) to facilitate the sharing of international experience in addressing the societal dimension of radioactive waste management. It explores means of ensuring an effective dialogue amongst all stakeholders, and considers ways to strengthen confidence in decision-making processes. FSC documents may be obtained online at OECD countries are increasingly implementing forms of participatory democracy that will require new or enhanced forms of dialogue amongst a broader range of concerned parties. The 4. regular FSC meeting held in Paris in May 2003 included a topical session on Stakeholder involvement tools: Criteria for choice and evaluation. The internal Minutes of the 4. meeting noted, in response to the discussions initiated by this topical session: 'Given that FSC members have one specific issue - radioactive waste management (RWM) - to deal with, a continuing relationship and dialogue among stakeholders seems important. What is desired is a well-informed citizen, because this is - in the end - an issue of democracy. Perhaps we have suffered in our field from a lack of recognition that RWM, like others, is an issue of democracy as well as a technical one'. At the close of the topical session, it was agreed that the FSC would prepare a short guide on stakeholder involvement techniques. The present guide approaches the topic from the point of view of radioactive waste management. However, because dialogue and deliberation techniques can be used in many fields, it will be of interest to a wide readership. It includes an annotated bibliography pointing to easily accessible handbooks and other resources. (author)

  1. How to Write: A Barely Annotated Bibliography. Research Report.

    Miller, Lance A.

    The references in this bibliography tend toward practical or "how to" strategies for writing. The 718 references are listed alphabetically in the bibliography section, with each citation followed by a code denoting its topical categories: (1) general "how to write," (2) "how to write" business letters, (3) stylistics,…

  2. Annotated bibliography on high-intensity linear accelerators

    Jameson, R.A.; Roybal, E.U.


    A technical bibliography covering subjects important to the design of high-intensity beam transport systems and linear accelerators is presented. Space charge and emittance growth are stressed. Subject and author concordances provide cross-reference to detailed citations, which include an abstract and notes on the material. The bibliography resides in a computer database that can be searched for key words and phrases

  3. Annotated bibliography on high-intensity linear accelerators. [240 citations

    Jameson, R.A.; Roybal, E.U.


    A technical bibliography covering subjects important to the design of high-intensity beam transport systems and linear accelerators is presented. Space charge and emittance growth are stressed. Subject and author concordances provide cross-reference to detailed citations, which include an abstract and notes on the material. The bibliography resides in a computer database that can be searched for key words and phrases.

  4. Bats and wind energy: a literature synthesis and annotated bibliography

    Ellison, Laura E.


    Turbines have been used to harness energy from wind for hundreds of years. However, with growing concerns about climate change, wind energy has only recently entered the mainstream of global electricity production. Since early on in the development of wind-energy production, concerns have arisen about the potential impacts of turbines to wildlife; these concerns have especially focused on the mortality of birds. Despite recent improvements to turbines that have resulted in reduced mortality of birds, there is clear evidence that bat mortality at wind turbines is of far greater conservation concern. Bats of certain species are dying by the thousands at turbines across North America, and the species consistently affected tend to be those that rely on trees as roosts and most migrate long distances. Turbine-related bat mortalities are now affecting nearly a quarter of all bat species occurring in the United States and Canada. Most documented bat mortality at wind-energy facilities has occurred in late summer and early fall and has involved tree bats, with hoary bats (Lasiurus cinereus) being the most prevalent among fatalities. This literature synthesis and annotated bibliography focuses on refereed journal publications and theses about bats and wind-energy development in North America (United States and Canada). Thirty-six publications and eight theses were found, and their key findings were summarized. These publications date from 1996 through 2011, with the bulk of publications appearing from 2007 to present, reflecting the relatively recent conservation concerns about bats and wind energy. The idea for this Open-File Report formed while organizing a joint U.S. Fish and Wildlife Service/U.S. Geological Survey "Bats and Wind Energy Workshop," on January 25-26, 2012. The purposes of the workshop were to develop a list of research priorities to support decision making concerning bats with respect to siting and operations of wind-energy facilities across the United

  5. A selective annotated bibliography for clinical audiology (1989-2009): books.

    Ferrer-Vinent, Susan T; Ferrer-Vinent, Ignacio J


    This is the 2nd in a series of 3 planned companion articles that present a selected, annotated, and indexed bibliography of clinical audiology publications from 1989 through 2009. Research and preparation of the bibliography were based on published guidelines, professional audiology experience, and professional librarian experience. The first article in the series covered reference works. This article focuses on other books. The planned third companion article will present periodicals and online resources. Audiologists and librarians can use this bibliography to help them identify relevant clinical audiology literature.

  6. Thermal effects on aquatic organisms: an annotated bibliography of the 1977 literature

    Talmage, S.S.


    This bibliography, containing 537 references from the 1977 literature, is the seventh in a series of annotated bibliographies on the effects of heat on aquatic organisms. The effects of thermal discharges at power plant sites are emphasized. Laboratory and field studies on temperature tolerance and the effects of temperature changes on reproduction, development, growth, distribution, physiology, and sensitivity to other stresses are included. References in the bibliography are divided into three subject categories: marine systems, freshwater systems, and estuaries. The references are arranged alphabetically by first author. Indexes are provided for author, keywords, subject category, geographic location of the study, taxon, and title

  7. Fire in South African ecosystems: an annotated bibliography.

    Schrige, GU


    Full Text Available References to 258 publications are presented together with summaries, keyword listings and a keyword index. This bibliography forms part of the South African contribution to the SCOPE project "The ecological effects of fire", 1977-1980....

  8. Systematic reviews of herbal medicines--an annotated bibliography

    Linde, K.; ter Riet, G.; Hondras, M.; Vickers, A.; Saller, R.; Melchart, D.


    OBJECTIVE: To provide a comprehensive collection and a summary of systematic reviews of clinical trials on herbal medicines. METHODS: Potentially relevant reviews were searched through the register of the Cochrane Complementary Medicine Field, the Cochrane Library, Medline, and bibliographies of

  9. Product Modelling for Building Design: Annotated Bibliography (2nd Edition)

    Galle, Per


    This bibliography concerns research publications from 1976 to 1994-5, on product modelling in computer aided architectural design and computer aided engineering design of buildings and their surroundings. For each item of literature, full bibliographic information is given whenever available...... of literature is offered on machine interpretation of drawings, which may be relevant in the context of information exchange among different product models. Although the bibliography is fairly comprehensive as far as it goes, no completeness of coverage is claimed....

  10. Annotated bibliography of selected reports relating to the isolation of nuclear waste in crystalline rock


    BMI/OCRD-29 is an annotated bibliography of published reports that have been produced for the US Department of Energy Crystalline Repository Project Office or the Swedish-American Cooperative Program on Radioactive Waste Storage in Mined Caverns. This document consists of a main report listing of citations and abstracts and a topical index

  11. Women, Islam, and Pakistan: A Selected Annotated Bibliography. Fulbright-Hays Summer Seminar Abroad Project.

    Phillips, Brenda

    This bibliography features selected books, book chapters, research projects, and journal articles, published between 1953 and 1994, about the social, legal, economic, educational political, and professional position of Muslim Pakistani women. Sixteen of the references are annotated. An additional 41 bibliographic references to other materials, not…

  12. Teaching Diversity and Aging through Active Learning Strategies: An Annotated Bibliography.

    Fried, Stephen B.; Mehrotra, Chandra M.

    Covering 10 topical areas, this annotated bibliography offers a guide to journal articles, book chapters, monographs, and books useful for teaching diversity and aging through active learning. Active learning experiences may help expand students' awareness of elements of their own diversity, broaden their world view, and enhance their culturally…

  13. Enhanced oil recovery using improved aqueous fluid-injection methods: an annotated bibliography. [328 citations

    Meister, M.J.; Kettenbrink, G.K.; Collins, A.G.


    This annotated bibliography contains abstracts, prepared by the authors, of articles published between 1968 and early 1976 on tests of improved aqueous fluid injection methods (i.e., polymer and surfactant floods). The abstracts have been written and organized to facilitate studies of the oil recovery potential of polymer and surfactant floods under known reservoir conditions. 328 citations.

  14. Annotated Bibliography of Alcohol, Other Drug, and Violence Prevention Resources, 2006-2008

    Segars, Lance, Ed.; Akinola, Olayinka, Ed.


    The U.S. Department of Education's Higher Education Center for Alcohol and Other Drug Abuse and Violence Prevention has developed this annotated bibliography to provide those interested in prevention at colleges and universities--and in surrounding communities--with a ready reference of current, important, and available information resources.…

  15. Education--An Annotated Bibliography of Current Issues, July-September, 1989.

    Wardell, David

    This annotated bibliography of newspaper and magazine articles on a wide variety of topics in education includes entries from the following publications: "Asahi Evening News,""Asian Wall Street Journal,""Daily Yomiuri,""International Herald Tribune,""Japan Times,""Mainichi Daily…

  16. College and University Rankings: Part 2--An Annotated Bibliography of Analysis, Criticism, and Evaluation.

    Hattendorf, Lynn C.


    This annotated bibliography of recent articles and books on academic rankings updates an article in the Spring 1986 "RQ." Items are listed by subject and ranking in general; individual guides; subject areas including accounting, advertising, biogeography, business, communications, data communications, economics, music, publishing,…

  17. An Annotated Selective Bibliography on Human Performance in Fault Diagnosis Tasks. Technical Report 435. Final Report.

    Johnson, William B.; And Others

    This annotated bibliography developed in connection with an ongoing investigation of the use of computer simulations for fault diagnosis training cites 61 published works taken predominantly from the disciplines of engineering, psychology, and education. A review of the existing literature included computer searches of the past ten years of…

  18. Health Education Intervention. An Annotated Bibliography. Nutrition Education Series Issue 13.

    United Nations Educational, Scientific, and Cultural Organization, Paris (France).

    This annotated bibliography contains 73 citations describing health education programs around the world. Countries represented include: Bangladesh, Egypt, Gambia, Gilbert Islands, Guatemala, Haiti, Honduras, Jamaica, Kenya, Indonesia, Nicaragua, Peru, Philippines, Swaziland, Thailand, Tunisia, Australia, Colombia, India, United Kingdom, Canada,…

  19. Thermal effects on aquatic organisms: annotated bibliography of the 1974 literature

    Coutant, C.C.; Talmage, S.S.; Carrier, R.F.; Collier, B.N.


    The annotated bibliography covers the 1974 literature concerning thermal effects on aquatic organisms. Emphasis is placed on the effects of the release of thermal effluents on aquatic ecosystems. Indexes are provided for: author, keywords, subject category, geographic location, taxon, and title (alphabetical listing of keyword-in-context of the nontrivial words in the title). (CH)

  20. By the Book: An Annotated Bibliography of Music-Based Picture Books.

    Sotherden, Emily


    Provides an annotated bibliography of music related picture books that can be used in the music classroom. Discusses the benefits of using picture books for all ages. Includes books in ten categories, such as instruments, ensembles, and styles of music. (CMK)

  1. Working Papers on Asian American Studies: Annotated Bibliography on Koreans in America.

    Kim, Christopher

    This classified annotated bibliography on Koreans in America includes references on the following topics: (1) Korean American directories, (2) immigration history, (3) deportation cases, (4) Korean students in the U.S., (5) Korean Americans in the Asian American Movement, (6) state and federal legislation affecting Koreans in America, (7) Korean…

  2. Assessment and management of animal damage in Pacific Northwest forests: an annotated bibliography.

    D.M. Loucks; H.C. Black; M.L. Roush; S.R. Radosevich


    This annotated bibliography of published literature provides a comprehensive source of information on animal damage assessment and management for forest land managers and others in the Pacific Northwest. Citations and abstracts from more than 900 papers are indexed by subject and author. The publication complements and supplements A Silvicultural Approach to...

  3. Forestry-based biomass economic and financial information and tools: An annotated bibliography

    Dan Loeffler; Jason Brandt; Todd Morgan; Greg Jones


    This annotated bibliography is a synthesis of information products available to land managers in the western United States regarding economic and financial aspects of forestry-based woody biomass removal, a component of fire hazard and/or fuel reduction treatments. This publication contains over 200 forestry-based biomass papers, financial models, sources of biomass...

  4. Teacher-to-Teacher: An Annotated Bibliography on DNA and Genetic Engineering.

    Mertens, Thomas R., Comp.


    Presented is an annotated bibliography of 24 books on DNA and genetic engineering. Areas considered in these books include: basic biological concepts to help understand advances in genetic engineering; applications of genetic engineering; social, legal, and moral issues of genetic engineering; and historical aspects leading to advances in…

  5. Questionnaires for research: an annotated bibliography on design, construction, and use.

    Dale R. Potter; Kathryn M. Sharpe; John C. Hendee; Roger N. Clark


    Questionnaires as social science tools are used increasingly to study people aspects of outdoor recreation and other natural resource fields. An annotated bibliography including subjective evaluations of each article and a keyword list is presented for 193 references to aid researchers and managers in the design, construction, and use of mail questionnaires.

  6. Radicalization: An Overview and Annotated Bibliography of Open-Source Literature


    particularly with liberal, democratic, and humanistic Muslims Phares points to Jihadism as the main root cause of terrorism and suggests that defending...An Overview and Annotated Bibliography of Open-Source Literature 155 of ambiguity), epistemic and existential needs theory (need for closure...This book presents Terror Management Theory, which addresses behavioral and psychological responses to terrorist events. An existential

  7. Policies and Background Literature for Self-Education on Research Data Management: An Annotated Bibliography

    Goben, Abigail; Raszewski, Rebecca


    Librarians navigating research data management self-education have an increasing body of literature to choose from, which may become overwhelming. This annotated bibliography reviews: (1) U.S. federal policies; (2) articles; and (3) books to assist librarians who are self-educating on research data management or are seeking background reading…

  8. The UNO Aviation Monograph Series: Aviation Security: An Annotated Bibliography of Responses to the Gore Commission

    Carrico, John S.; Schaaf, Michaela M.


    This monograph is a companion to UNOAI Monograph 96-2, "The Image of Airport Security: An Annotated Bibliography," compiled in June 1996. The White House Commission on Aviation Safety and Security, headed by Vice President Al Gore, was formed as a result of the TWA Flight 800 crash in August 1996. The Commission's final report included 31 recommendations addressed toward aviation security. The recommendations were cause for security issues to be revisited in the media and by the aviation industry. These developments necessitated the need for an updated bibliography to review the resulting literature. Many of the articles were written in response to the recommendations made by the Gore Commission. "Aviation Security: An Annotated Bibliography of Responses to the Gore Commission" is the result of this need.

  9. Partially annotated bibliography for computer protection and related topics

    Huskamp, J.C.


    References for the commonly cited technical papers in the area of computer protection are given. Great care is taken to exclude papers with no technical content or merit. For the purposes of this bibliography, computer protection is broadly defined to encompass all facets of the protection problem. The papers cover, but are not limited to, the topics of protection features in operating systems (e.g., MULTICS and HYDRA), hardware implementations of protection facilities (e.g., Honeywell 6180, System 250, BCC 5000, B6500), data base protection controls, confinement and protection models. Since computer protection is related to many other areas in computer science and electrical engineering, a bibliography of related areas is included after the protection bibliography. These sections also include articles of general interest in the named areas which are not necessarily related to protection.

  10. Fish passage at road crossings: an annotated bibliography.

    Lynette Anderson; Mason. Bryant


    A report of special interest to fishery biologists, resource managers, hydrologists, and road engineers, this bibliography lists publications pertinent to road crossings of salmon and trout streams. Topics include bridge and culvert installation, design criteria, mechanics, hydraulics, and economics, as well as their biological effects.

  11. Annotated bibliography for the humpback chub (Gila cypha) with emphasis on the Grand Canyon population.

    Goulet, C. T.; LaGory, K. E.; Environmental Science Division


    Glen Canyon Dam is a hydroelectric facility located on the Colorado River in Arizona that is operated by the U.S. Bureau of Reclamation (Reclamation) for multiple purposes including water storage, flood control, power generation, recreation, and enhancement of fish and wildlife. Glen Canyon Dam operations have been managed for the last several years to improve conditions for the humpback chub (Gila cypha) and other ecosystem components. An extensive amount of literature has been produced on the humpback chub. We developed this annotated bibliography to assist managers and researchers in the Grand Canyon as they perform assessments, refine management strategies, and develop new studies to examine the factors affecting humpback chub. The U.S. Geological Survey recently created a multispecies bibliography (including references on the humpback chub) entitled Bibliography of Native Colorado River Big Fishes (available at That bibliography, while quite extensive and broader in scope than ours, is not annotated, and, therefore, does not provide any of the information in the original literature. In developing this annotated bibliography, we have attempted to assemble abstracts from relevant published literature. We present here abstracts taken unmodified from individual reports and articles except where noted. The bibliography spans references from 1976 to 2009 and is organized in five broad topical areas, including: (1) biology, (2) ecology, (3) impacts of dam operations, (4) other impacts, and (5) conservation and management, and includes twenty subcategories. Within each subcategory, we present abstracts alphabetically by author and chronologically by year. We present relevant articles not specific to either the humpback chub or Glen Canyon Dam, but cited in other included reports, under the Supporting Articles subcategory. We provide all citations in alphabetical order in Section 7.

  12. Environmental aspects of the transuranics: a selected, annotated bibliography

    Fore, C.S.; Martin, F.M.; Faust, R.A.


    This bibliography of 500 references is compiled from the Data Base on the Environmental Aspects of the Transuranics built to provide information support to the Nevada Applied Ecology Group (NAEG) of ERDA's Nevada Operations Office. The general scope is environmental aspects of uranium and the transuranic elements, with emphasis on plutonium. Laboratory and field studies dealing with the effects of plutonium-239 on animals are highlighted in this bibliography. Supporting information on ecology of the Nevada Test Site and reviews on the effects of other radionuclides upon man and his environment has been included at the request of the NAEG. The references are arranged by subject category with first authors appearing alphabetically in each category. Indexes are given for author, geographic location, keywords, taxons, permuted title and publication description

  13. Environmental aspects of the transuranics. A selected, annotated bibliography

    Martin, F.M.; Faust, R.A.; Sanders, C.T.


    This bibliography of 470 references is from the computer file built to provide information support to the Nevada Applied Ecology Group (NAEG) of ERDA's Nevada Operations Office. The general scope is environmental aspects of uranium and the transuranic elements, with emphasis on plutonium. Biological aspects of the transuranics is highlighted in this bibliography. In addition, supporting materials involving basic ecology studies, ecology of the Nevada Test Site, and reviews on other radionuclides are entered at the request of the NAEG. Significant numeric data is shown in tabular display or is noted for reference to the original document. The references are arranged by subject category with first authors arranged alphabetically within the category. Indexes are given for author, keywords, geographic location, permuted title, taxons, and publication description. (U.S.)

  14. Environmental aspects of the transuranics: a selected, annotated bibliography

    Fore, C.S.; Martin, F.M.; Faust, R.A. (comp.)


    This bibliography of 500 references is compiled from the Data Base on the Environmental Aspects of the Transuranics built to provide information support to the Nevada Applied Ecology Group (NAEG) of ERDA`s Nevada Operations Office. The general scope is environmental aspects of uranium and the transuranic elements, with emphasis on plutonium. Laboratory and field studies dealing with the effects of plutonium-239 on animals are highlighted in this bibliography. Supporting information on ecology of the Nevada Test Site and reviews on the effects of other radionuclides upon man and his environment has been included at the request of the NAEG. The references are arranged by subject category with first authors appearing alphabetically in each category. Indexes are given for author, geographic location, keywords, taxons, permuted title and publication description.

  15. Environmental aspects of the transuranics: a selected, annotated bibliography

    Ensminger, J.T.; Martin, F.M.; Fore, C.S.


    This eighth published bibliography of 427 references is compiled from the Nevada Applied Ecology Information Center's Data Base on the Environmental Aspects of the Transuranics. The data base was built to provide information support to the Nevada Applied Ecology Group (NAEG) of ERDA's Nevada Operations Office. The general scope covers environmental aspects of uranium and the transuranic elements, with emphasis on plutonium. This bibliography highlights literature on plutonium 238 and 239 and americium in the critical organs of man and animals. Supporting information on ecology of the Nevada Test Site and reviews and summarizing literature on other radionuclides have been included at the request of the NAEG. The references are arranged by subject category with leading authors appearing alphabetically in each category. Indexes are provided for author(s), geographic location, keyword(s), taxon, title, and publication description

  16. Spacecraft Fire Safety 1956 to 1999: An Annotated Bibliography

    Friedman, Robert; Ruff, Gary A.


    Knowledge of fire safety in spacecraft has resulted from over 50 years of investigation and experience in space flight. Current practices and procedures for the operation of the Space Transportation System (STS) shuttle and the International Space Station (ISS) have been developed from this expertise, much of which has been documented in various reports. Extending manned space exploration from low Earth orbit to lunar or Martian habitats and beyond will require continued research in microgravity combustion and fire protection in low gravity. This descriptive bibliography has been produced to document and summarize significant work in the area of spacecraft fire safety that was published between 1956 and July 1999. Although some important work published in the late 1990s may be missing, these citations as well as work since 2000 can generally be found in Web-based resources that are easily accessed and searched. In addition to the citation, each reference includes a short description of the contents and conclusions of the article. The bibliography contains over 800 citations that are cross-referenced both by topic and the authors and editors. There is a DVD that accompanies this bibliography (available by request from the Center for Aerospace Information) containing the full-text articles of selected citations as well as an electronic version of this report that has these citations as active links to their corresponding full-text article.

  17. DOE Hydropower Program biennial report 1990--1991 (with updated annotated bibliography)

    Chappell, J.R.; Rinehart, B.N.; Sommers, G.L. (Idaho National Engineering Lab., Idaho Falls, ID (United States)); Sale, M.J. (Oak Ridge National Lab., TN (United States))


    This report summarizes the activities of the US Department of Energy's (DOE) Hydropower Program for fiscal years 1990 and 1991, and provides an annotated bibliography of research, engineering, operations, regulations, and costs of projects pertinent to hydropower development. The Hydropower Program is organized as follows: background (including Technology Development and Engineering Research and Development); Resource Assessment; National Energy Strategy; Technology Transfer; Environmental Research; and, the bibliography discusses reports written by both private and non-Federal Government sectors. Most reports are available from the National Technical Information Service. 5 figs., 2 tabs.

  18. A selective annotated bibliography for clinical audiology (1988-2008): reference works.

    Ferrer-Vinent, Susan T; Ferrer-Vinent, Ignacio J


    This is the 1st in a series of 3 planned companion articles that present a selected, annotated, and indexed bibliography of clinical audiology publications from 1988 to 2008. Research and preparation of the bibliography were based on published guidelines, professional audiology experience, and professional librarian experience. This article presents reference works (dictionaries, encyclopedias, handbooks, and manuals). The future planned articles will cover other monographs, periodicals, and online resources. Audiologists and librarians can use these lists as a guide when seeking clinical audiology literature.

  19. Shakespeare Is Alive and Well in Cyberspace: An Annotated Bibliography.

    Hett, Dorothy Marie


    Suggests that in addition to using books and movies to enhance students' understanding of Shakespeare, teachers can add the World Wide Web to their repertoire to help students connect to Shakespeare. Presents annotations of 12 websites to use for teaching Shakespeare. (SG)

  20. An Annotated Bibliography of Isotonic Weight-Training Methods.

    Wysong, John V.

    This literature study was conducted to compare and evaluate various types and techniques of weight lifting so that a weight lifting program could be selected or devised for a secondary school. Annotations of 32 research reports, journal articles, and monographs on isotonic strength training are presented. The literature in the first part of the…

  1. A Review and Annotated Bibliography of the Literature Pertaining to Team and Small Group Performance (1989 to 1999)

    LaJoie, Andrew


    .... Training and military doctrine has been evolving to reflect this emphasis on teamwork. The purpose of this annotated bibliography is to review literature published over the last ten years concerning team and small group performance...

  2. Consumer energy research: an annotated bibliography. Vol. 1. [Some text in French

    Anderson, D.C.; McDougall, G.H.G.


    This annotated bibliography attempts to provide a comprehensive package of existing information in consumer related energy research. A concentrated effort was made to collect unpublished material as well as material from journals and other sources, including governments, utilities, research institutes and private firms. A deliberate effort was made to include agencies outside North America. For the most part the bibliography is limited to annotations of empirical studies. However, it includes a number of descriptive reports which appear to make a significant contribution to understanding consumers and energy use. The format of the annotations diplays the author, date of publication, title and source of the study. Annotations of empirical studies are divided into four parts: objectives, methods, variables and findings/implications. Care was taken to provide a reasonable amount of detail in the annotations to enable the reader to understand the methodology, the results and the degree to which the implications of the study can be generalized to other situations. Studies are arranged alphabetically by author. The content of the studies reviewed is classified in a series of tables which are intended to provide a summary of sources, types and foci of the various studies. These tables are intended to aid researchers interested in specific topics to locate those studies most relevant to their work. The studies are categorized using a number of different classification criteria, for example, methodology used, type of energy form, type of policy initiative, and type of consumer activity. A general overview of the studies is also presented. 20 tabs.

  3. An Annotated Bibliography of Education for Medical Librarianship, 1940-1968

    Shirley, Sherrilynne


    An attempt has been made in this bibliography to represent the various viewpoints concerning education for medical librarianship equally. The topics covered include: general background reading and readings for those interested in establishing courses in medical librarianship. The former includes annotations on the history and international aspects of the subject. The latter consists of annotations of articles on early courses and present courses in medical librarianship. A final area discussed is the Medical Library Association's Code for the Training and Certification of Medical Librarians. PMID:4898629

  4. Annotated Bibliography. Conference Materials: Strategy Conference on Education and the Economy (Washington, D.C., September 22-24, 1981).

    Center for Law and Education, Boston, MA.

    The 22 items included in a packet distributed to participants at a 1981 conference on education and the economy are listed in this annotated bibliography, with sources for the items identified. The materials include articles, chapters from books, and monographs, as well as a resource guide and bibliography concerning rural economic and community…

  5. School Sexuality Education: Opposition and Answers. Materials from the Katharine Dexter McCormick Library: A Selective, Annotated Bibliography.

    Modig, Zeau D., Ed.

    This annotated bibliography was compiled as a guide for educators, administrators, counselors, parents, and everyone concerned about the opponents of sexuality education in schools, their arguments, and their tactics. Entries were chosen to represent a variety of materials in terms of both format and content. This bibliography is divided into…

  6. Geomicrobiology and its relevance to nuclear waste disposal - a further annotated bibliography

    West, J.M.; Arme, S.C.


    Scientific investigations into the disposal of high/intermediate level radioactive waste into deep geological formations includes work in the field of geomicrobiology. It has been shown that microbes exist in deep and shallow geological formations and that they could alter the geochemical environment of a waste repository and influence radionuclide migration. A preliminary literature survey indicated a lack of annotated material and an initial report (West, McKinley and Christofi, 1982) provided the first bibliography. This report is an updated annotated bibliography of relevant geomicrobiological research published since 1982 and should be used in conjunction with the previous report. Those without specific biological experience may find the glossary of common terms in the initial report of use. A major area of work which has not been referenced widely here is near surface disposal of both radioactive and conventional industrial waste. This vast topic can be accessed via some of the general reviews in this report. (author)

  7. Thermal effects on aquatic organisms: an annotated bibliography of the 1977 literature

    Talmage, S.S. (comp.)


    This bibliography, containing 537 references from the 1977 literature, is the seventh in a series of annotated bibliographies on the effects of heat on aquatic organisms. The effects of thermal discharges at power plant sites are emphasized. Laboratory and field studies on temperature tolerance and the effects of temperature changes on reproduction, development, growth, distribution, physiology, and sensitivity to other stresses are included. References in the bibliography are divided into three subject categories: marine systems, freshwater systems, and estuaries. The references are arranged alphabetically by first author. Indexes are provided for author, keywords, subject category, geographic location of the study, taxon, and title (alphabetical listing of keywords-in-context of nontrivial words in the title).

  8. Monitoring of radioactivity in the UK environment: an annotated bibliography of current programmes

    Cotter, A.J.R.; Hunt, G.J.


    In the UK, many organisations carry out regular radioactivity monitoring programmes, and summaries of these programmes have been published in 1983 and 1988. The number of organisations carrying out radioactivity monitoring has increased rapidly in recent years, particularly in the local authority sector. The present report updates the previous summarises in the form of an annotated bibliography, giving synopses of all regular UK programmes whose results are published in report form. (author)

  9. Basic environmental bookshelf: An annotated bibliography. Current issue paper No. 116

    Yeager, L.


    This bibliography is intended to provide objective basic information on science and the environment, and includes books and journal articles that should be understandable to the nonspecialist. The bibliographic entries are arranged alphabetically by author within broad categories such as acid precipitation, air quality, climate change, ecology and ecosystems, energy, environmental assessment, hazardous wastes, law, natural history, ozone depletion, parks and urban issues, public policy, toxic chemicals, and water resources. Most entries have brief annotations.

  10. Annotated bibliography of the physical data of Rainier Mesa and Yucca Mountain

    Russell, C.E.


    Yucca Mountain, located on and adjacent to the Nevada Test Site (NTS) has been designated as the only site to undergo characterization to determine if it meets the criteria to become the Nation's first high-level nuclear waste repository. During this process, care must be taken to not compromise the site's integrity through excessive testing. In order to supplement the limited data to be gathered at Yucca Mountain, analog areas are to be considered. This annotated bibliography was compiled by the Desert Research Institute to help investigate ways in which Rainier Mesa could either be used as a supplemental repository test site or where existing Rainier Mesa data can be used either to support or refute test results from Yucca Mountain. Rainier Mesa, the location of numerous underground nuclear tests on the NTS, possesses some geologic characteristics similar to those of Yucca Mountain, which makes it a likely candidate for comparison. Almost 500 references regarding geology, hydrology, meteorology, biology, and archaeology were annotated and entered alpha-numerically into the bibliography. These references were categorized into 50 topics which are defined in Section 2 and presented in Section 3. Each reference is categorized as to whether it contains Yucca Mountain data, Rainier Mesa data, or both, and a final category consists of those reports that contain Rainier Mesa data that have already been applied to Yucca Mountain research. The annotated bibliography is presented in Section 4

  11. Annotated Bibliography on School Finance: Policy and Political Issues; Federal Government; State Issues; Non-Public Schools; Accountability.

    Gipson, Joella

    Limited to periodical literature, this annotated bibliography on school finance contains 81 references grouped in 5 categories: (1) policy and politica issues, (2) federal government, (3) state issues, (4) aid to nonpublic schools, and (5) accountability. Following the bibliographic citations, annotations range from 4 to 15 lines and conclude by…

  12. Annotated bibliography of structural equation modelling: technical work.

    Austin, J T; Wolfle, L M


    Researchers must be familiar with a variety of source literature to facilitate the informed use of structural equation modelling. Knowledge can be acquired through the study of an expanding literature found in a diverse set of publishing forums. We propose that structural equation modelling publications can be roughly classified into two groups: (a) technical and (b) substantive applications. Technical materials focus on the procedures rather than substantive conclusions derived from applications. The focus of this article is the former category; included are foundational/major contributions, minor contributions, critical and evaluative reviews, integrations, simulations and computer applications, precursor and historical material, and pedagogical textbooks. After a brief introduction, we annotate 294 articles in the technical category dating back to Sewall Wright (1921).

  13. India: an annotated bibliography on rural regional development


    References contained in this bibliography focus on rural regional development in India during the past fifteen years. They include works on administration, administrative law, agriculture, business, community development, decision making, demography, development indicators, development planning, economic development, economic policy, education, employment and labor utilization, energy, family planning, finance and taxation, geography, health, housing, human settlements, income distribution, industry, institutional development, intergovernmental relations, land reform, location and space economy, migration, models, national planning, plan implementation, planning and programming techniques, politics and government, popular participation, population policy, poverty, project and program evaluation, public works, reference works, regional analysis, regional development, regional planning, rural development, science and technology, social communication, social development, social integration and welfare, social policy, socioeconomic diagnosis, subregional planning, systems approach, tourism and recreation, training techniques, and utilities. The information sources are primarilly Indian, but a few significant documents of foreign imprints have also been included. All documents referred to are in English and include reference works, government publications, scholarly works (monographs), conference proceedings, and periodical articles.

  14. Entrepreneurship Education for Agriculture. Phase "O" Planning Project Report. Performance Report. Volume II: Bibliography and Storyboard Scripts.

    Lee and Associates, Starkville, MS.

    Volume 2 of this report is supplementary and contains three bibliographies: (1) Annotated Bibliography on Minority Entrepreneurship in Agriculture; (2) Annotated Bibliography on Entrepreneurship Education in Agriculture; (3) Bibliography on Entrepreneurship. The next section presents three storyboard scripts for instructional videotapes on…

  15. Low-level radioactive waste technology: a selected, annotated bibliography. [416 references

    Fore, C.S.; Carrier, R.F.; Brewster, R.H.; Hyder, L.K.; Barnes, K.A.


    This annotated bibliography of 416 references represents the third in a series to be published by the Hazardous Materials Information Center containing scientific, technical, economic, and regulatory information relevant to low-level radioactive waste technology. The bibliography focuses on disposal site, environmental transport, and waste treatment studies as well as general reviews on the subject. The publication covers both domestic and foreign literature for the period 1951 to 1981. Major chapters selected are Chemical and Physical Aspects; Container Design and Performance; Disposal Site; Environmental Transport; General Studies and Reviews; Geology, Hydrology, and Site Resources; Regulatory and Economic Aspects; Social Aspects; Transportation Technology; Waste Production; and Waste Treatment. Entries in each of the chapters are further classified as a field study, laboratory study, theoretical study, or general overview involving one or more of these research areas.

  16. First Nations carbon collaborative - indigenous peoples and carbon markets: an annotated bibliography

    Dohan, Rosemary; Voora, Vivek [International Institute for Sustainable Development (Canada)


    According to the United Nations declaration on the rights of indigenous people, First Nations must be involved in the development of carbon markets which could affect their traditional and current land in Canada. The aim of this document is to provide First Nations with unbiased information on carbon markets so they can decide whether or not they want to take advantage of the economic opportunities that these markets offer. This annotated bibliography has been built using peer reviewed materials, working papers, government publications, technical reports, newspapers and online news websites. This paper provides the reader with information on the impacts that carbon markets could have on First Nations and is accessible to all with academic as well as popular resources. This bibliography highlighted that little information is available on First Nations in Canada and carbon markets and that this needs to be addressed so that indigenous people can participate actively in carbon markets.

  17. Annotated bibliography of the Russian languages literature on glaciology for 2015

    V. M. Kotlyakov


    Full Text Available The proposed annual bibliography continues annotated lists of the Russian‑language literature on glaciology that were regularly published in the past. It includes 245 references grouped into the following ten sections: 1  general issues of glaciology; 2  physics and chemistry of ice; 3  atmospheric ice; 4  snow cover; 5  ava‑ lanches and glacial mudflows; 6 sea ice; 7 river and lake ice; 8 icings and ground ice; 9 the glaciers and ice caps; 10 palaeoglaciology. In addition to the works of the current year, some works of earlier years are added, that, for various reasons, were not included in previous bibliographies.

  18. Environmental aspects of the transuranics. A selected, annotated bibliography. Volume 9

    Ensminger, J.T.; Fore, C.S.; Dailey, N.S.


    This ninth published bibliography of 589 references is compiled from the Nevada Applied Ecology Information Center's Data Base on the Environmental Aspects of the Transuranics. The data base was built to provide information support to the Nevada Applied Ecology Group (NAEG) of DOE's Nevada Operations Office. The general scope covers environmental aspects of uranium and the transuranic elements, with emphasis on plutonium. This annotated bibliography highlights literature on plutonium 238 and 239 and americium 241 in the critical organs of man and animals. Studies on the migration of plutonium and the transplutonics through the environment are also emphasized. Supporting information on ecology of the Nevada Test Site and reviews and summarizing literature on other radionuclides have been included at the request of the NAEG. The references are arranged by subject category with leading authors appearing alphabetically within each category. Indexes are provided for author(s), geographic location, keywords, taxonomic name, title, and publication description

  19. DOE Hydropower Program biennial report 1992--1993 (with an updated annotated bibliography)

    Cada, G.F.; Sale, M.J. [Oak Ridge National Lab., TN (United States); Francfort, J.E.; Rinehart, B.N.; Sommers, G.L. [EG and G Idaho, Inc., Idaho Falls, ID (United States)


    This report, the latest in a series of annual/biennial Hydropower Program reports sponsored by the US Department of Energy, summarizes the research and development and technology transfer activities of fiscal years 1992 and 1993. The report discusses the activities in the four areas of the hydropower program: Environmental research; resource assessment; research coat shared with industry; and technology transfer. The report also offers an annotated bibliography of reports pertinent to hydropower, written by persons in Federal and state agencies, cities, metropolitan water districts, irrigation companies, and public and independent utilities. Most reports are available from the National Technical Information Service.

  20. DOE Hydropower Program biennial report 1994--1995 with an updated annotated bibliography

    Rinehart, B.N.; Francfort, J.E.; Sommers, G.L. [Lockheed Idaho Technologies Co., Idaho Falls, ID (United States); Cada, G.F.; Sale, M.J. [Oak Ridge National Lab., TN (United States)


    This report, the latest in a series of annual/biennial Hydropower Program reports sponsored by the US Department of Energy, summarizes the research and development and technology transfer activities of fiscal years 1994 and 1995. The report discusses the activities in the four areas of the hydropower program: Environmental Research; Resource Assessment; Research Cost-Shared with Industry; and Technology Transfer. The report also includes an annotated bibliography of reports pertinent to hydropower, written by the staff of the Idaho National Engineering Laboratory, Oak Ridge National Laboratory, Federal and state agencies, cities, metropolitan water districts, irrigation companies, and public and independent utilities. Most reports are available from the National Technical Information Service.

  1. Annotated bibliography National Environmental Policy Act (NEPA) documents for Sandia National Laboratories

    Harris, J.M.


    The following annotated bibliography lists documents prepared by the Department of Energy (DOE), and predecessor agencies, to meet the requirements of the National Environmental Policy Act (NEPA) for activities and facilities at Sandia National Laboratories sites. For each NEPA document summary information and a brief discussion of content is provided. This information may be used to reduce the amount of time or cost associated with NEPA compliance for future Sandia National Laboratories projects. This summary may be used to identify model documents, documents to use as sources of information, or documents from which to tier additional NEPA documents.

  2. Annotated bibliography National Environmental Policy Act (NEPA) documents for Sandia National Laboratories

    Harris, J.M.


    The following annotated bibliography lists documents prepared by the Department of Energy (DOE), and predecessor agencies, to meet the requirements of the National Environmental Policy Act (NEPA) for activities and facilities at Sandia National Laboratories sites. For each NEPA document summary information and a brief discussion of content is provided. This information may be used to reduce the amount of time or cost associated with NEPA compliance for future Sandia National Laboratories projects. This summary may be used to identify model documents, documents to use as sources of information, or documents from which to tier additional NEPA documents

  3. Hydrologic bibliography of the Columbia River basalts in Washington with selected annotations

    Tanaka, H.; Wildrick, L.; Pearson, B.


    The objective of this compilation is to present a comprehensive listing of the published, unpublished, and open file references pertaining to the surface and subsurface hydrology of the Columbia River basalts within the State of Washington and is presented in support of Rockwell's hydrologic data compilation effort for the Basalt Waste Isolation Program. A comprehensive, annotated bibliography of the Pasco Basin (including the Hanford Site) hydrology has been prepared for Rockwell as part of the Pasco Basin hydrology studies. In order to avoid unnecessary duplication, no effort was made to include a complete list of bibliographic references on Hanford in this volume

  4. DOE Hydropower Program biennial report 1994--1995 with an updated annotated bibliography

    Rinehart, B.N.; Francfort, J.E.; Sommers, G.L.; Cada, G.F.; Sale, M.J.


    This report, the latest in a series of annual/biennial Hydropower Program reports sponsored by the US Department of Energy, summarizes the research and development and technology transfer activities of fiscal years 1994 and 1995. The report discusses the activities in the four areas of the hydropower program: Environmental Research; Resource Assessment; Research Cost-Shared with Industry; and Technology Transfer. The report also includes an annotated bibliography of reports pertinent to hydropower, written by the staff of the Idaho National Engineering Laboratory, Oak Ridge National Laboratory, Federal and state agencies, cities, metropolitan water districts, irrigation companies, and public and independent utilities. Most reports are available from the National Technical Information Service

  5. Thermal effects on aquatic organisms: an annotated bibliography of the 1976 literature

    Talmage, S.S. (comp.)


    This bibliography, containing 784 annotated references on the effects of temperature on aquatic organisms, is part of an assessment of the literature on the effects of thermal power plants on the environment. The effects of thermal discharges at power plant sites are emphasized. Laboratory and field studies on temperature tolerance and the effects of temperature changes on reproduction, development, growth, distribution, physiology, and sensitivity to other stresses are included. Indexes are provided for author, keywords, subject category, geographic location of the study, taxon, and title (alphabetical listing of keywords-in-context of nontrivial words in the title).

  6. Ecological investigations at power plant cooling lakes, reservoirs, and ponds: an annotated bibliography. Final report

    Yost, F.E.; Talmage, S.S.


    Presented as an annotated bibliography are 541 references dealing with ecological investigations at power plants which use cooling lakes, ponds, or reservoirs. The references were obtained from open literature and from environmental reports and impact statements prepared for or by the electric utility industry. The literature covers the period 1950 through mid-1980. Topics covered include site-specific studies at facilities using cooling lakes, ponds, or reservoirs, as well as special studies, engineering studies, and general studies. References are arranged alphabetically by author and indexes are provided to personal and corporate authors, facility names, regions, and taxonomic names

  7. Annotated bibliography of cultural resources literature for the Nevada Nuclear Waste Storage Investigations


    This annotated bibliography of the cultural resources literature pertinent for the Nevada Nuclear Waste Storage Investigations was assembled in order to (1) identify and evaluate the prehistoric and historic properties previously recorded in the Nevada Nuclear Waste Storage Investigations Project Area of southern Nye County, Nevada, (2) identify and develop research problems that have been and/or could be addressed by the cultural resources of this area, (3) isolate factors that might be important in the selection of a potential locality for a high level nuclear waste repository in the project area, and (4) critically evaluate the adequacy and current status of cultural resources knowledge in the project area. 195 references

  8. Annotated bibliography for liquid metal surface tensions of groups III-A, IV-A, and V-A metals

    Murtha, M.J.; Burnet, G.


    An annotated bibliography has been prepared which includes summaries of 82 publications dating from 1920 and dealing with the measurement of the surface tensions of Groups III-A, IV-A, and V-A metals in the liquid state. The bibliography is organized by key element investigated, and contains a tabulation of correlations for surface tension as a function of temperature. A brief discussion dealing with variables and methods has been included

  9. Hydrology and water resources overview for the Nevada Nuclear Waste Storage Investigations, Nevada Test Site, Nye County, Nevada: annotated bibliography

    French, R.H.; Elzeftawy, A.; Elliot, B.


    The literature available regarding hydrology and utilization of water resources in the southwestern Nevada Test Site area is reviewed. In the context of this annotated bibliography, hydrology is defined to include hydrometeorology, surface water resources, and groundwater resources. Water utilization includes water supply, demand and use; future supply, demand and use; and wastewater treatment and disposal. The bibliography is arranged in alphabetical order and indexed with both technical key words and geographical key words

  10. Bibliography Section.

    Totten, Sam


    This annotated listing describes materials dealing with nuclear warfare, including annotated bibliographies, nonfiction, fiction, organizations, journals, newsletters, and curriculum materials for elementary and secondary schools. (RM)

  11. Annotated Bibliography of Children's Literature Resources on War, Terrorism, and Disaster since 1945: By Continents/Countries for Grades K-8

    Gangi, Jane M.


    This article presents an annotated bibliography of children's literature resources on war, terrorism, and disaster since 1945. This annotated bibliography focuses on grades K-8 from different continents/countries, including (1) Africa; (2) Asia; (3) The Caribbean; (4) Central and South America; (5) Europe; and (6) The Middle East.

  12. Bibliography of Utah radioactive occurrences. Volume II

    Doelling, H.H.


    The references in this bibliography were assembled by reviewing published bibliographies of Utah geology, unpublished reports of the US Geological Survey and the Department of Energy, and various university theses. Each of the listings is cross-referenced by location and subject matter. This report is published in two volumes

  13. An Annotated Bibliography of HVDC Transmission and FACTS Devices, 1996-1997.

    Litzenberger, Wayne H.; Varma, Rajiv K.; Flanagan, John D. [eds.


    This edition of the Annotated Bibliography of HVDC Transmission and FACTS Devices continues work begun in 1962 by the late Erik Bromberg, Bonneville Power Administration Librarian. His original bibliography covered the period 1932--1962. Subsequent editions were compiled by Bromberg, Val S. Lava, and Wayne Litzenberger, all of Bonneville Power Administration. Beginning with the 1991--1993 edition, the scope of the bibliography was expanded to include flexible ac transmission (FACTS) devices. This 1996--1997 edition also contains information for 1998. Preparation of the present edition took place primarily in May-June of 1998. All pertinent references have been included that were available to the editors at the time of preparation. Papers for the 1998 IEEE Winter and Summer Power Meetings and 1998 T and D Conference have been included. This edition contains the organizational affiliation of the first-named author as an aid to accessing the reference. Unfortunately, space limitations prevented the inclusion of the affiliations of all authors. Some minor editorial changes have been made to abstracts to ensure consistency in style and syntax.

  14. Annotated Bibliographies.

    Totten, Sam; Alexander, Susan


    Intended for elementary, secondary, and college teachers, this listing cites print materials dealing with nuclear warfare. Included are nonfiction, fiction, journals, newsletters, curriculum materials, and organizations. (RM)

  15. An Annotated Bibliography of Articles in the "Journal of Speech and Language Pathology-Applied Behavior Analysis"

    Esch, Barbara E.; Forbes, Heather J.


    The open-source "Journal of Speech and Language Pathology-Applied Behavior Analysis" ("JSLP-ABA") was published online from 2006 to 2010. We present an annotated bibliography of 80 articles published in the now-defunct journal with the aim of representing its scholarly content to readers of "The Analysis of Verbal…

  16. The Suburban Press; First Steps toward an Annotated Bibliography. Suburban Press Research Series No. 16 and 17.

    Northern Illinois Univ., De Kalb. Suburban Press Research Center.

    This bibliography lists journal articles concerning various aspects of the suburban press. Annotated selections, arranged alphabetically according to journal title, are gathered from the following periodicals: "Advertising Age,""Business Week,""Columbia Journalism Review,""Editor and Publisher,""Grassroots Editor,""Journalism…

  17. Counselor's Information Service. A Quarterly Annotated Bibliography of Current Literature on Educational and Vocational Guidance. Volume 32, Number 1.

    B'nai B'rith, Washington, DC. Career and Counseling Services.

    This quarterly annotated bibliography of current literature on educational and vocational guidance describes various pamphlets, guides and brochures which provide occupational information, educational, vocational and personal guidance, guidance administration and procedures, information on student aids and aids for the teacher. Additional guidance…

  18. An Annotated Bibliography of the Literature Dealing with Adolescent Suicide and What Educators Can Do To Help Reduce This Problem.

    Van Dyke, Catherine A.

    The purpose of this study was to provide an overview of the complex and growing problem of adolescent suicide. The annotated bibliography consists of 7 articles on recent facts and data, 10 articles on causes determined by research, 11 items on indicators seen in adolescents, and 14 documents on how educators can help. A lack of secure social…

  19. An Annotated Bibliography of the Literature Dealing with the Incorporation of Right Brain Learning into Left Brain Oriented Schools.

    Lewallen, Martha

    Articles and documents concerning brain growth and hemispheric specialization, theories of cognitive style, educational implications of brain research, and right-brain learning activities are cited in this annotated bibliography. Citations are preceded by a glossary of terms and followed by a brief review of the assembled literature. Educational…

  20. Annotated Bibliography of Publications on Watershed Management and Ecological Studies at Coweeta Hydrologic Laboratory, 1934-1994

    Patricia L. Stickney; Lloyd W. Swift; Wayne T. Swank


    This annotated bibliography spans over60 years of research at Coweeta from 1934 through part of 1994, and includes earlier papers onforest influenteswritten atthe Appalachian Station beforethe establishment of Coweeta. It is a modification and update of previous compilations of research results at Coweeta and contains aseparatesection listing theses and dissertations....

  1. Annotated Bibliography of the Air Force Human Resources Laboratory Technical Reports - 1979.


    Conli I1t’s ii t he earl ier st id% were pred icted as well as flte emipirical crimn site; hiowe’ve r. ill this stwail. [te resol riItei re iii ich...various combinations of *’anchor" item calibration sample size and equating same size. (l pages) 70 Donahue, K.E., Medellin , A., & Loup, K. Bibliography

  2. Bibliography of Intelligence Literature. A Critical and Annotated Bibliography of Open-Source Literature.


    latter revealing the famous " pumpkin papers" - copies of confidential State Department material which Hiss, as an agent, had given Chambers for their...34Portland Naval Secrets" case. This book is unreliable, for the author’s text is written purely for Soviet propaganda and disinformation purposes, but it...diplomatic relations at the time world- wide respectively. Vols. II-IV are purely textual, based on the material described above, and appropriately

  3. Software engineering laboratory series: Annotated bibliography of software engineering laboratory literature

    Morusiewicz, Linda; Valett, Jon


    This document is an annotated bibliography of technical papers, documents, and memorandums produced by or related to the Software Engineering Laboratory. More than 100 publications are summarized. These publications cover many areas of software engineering and range from research reports to software documentation. This document has been updated and reorganized substantially since the original version (SEL-82-006, November 1982). All materials have been grouped into eight general subject areas for easy reference: (1) the Software Engineering Laboratory; (2) the Software Engineering Laboratory: Software Development Documents; (3) Software Tools; (4) Software Models; (5) Software Measurement; (6) Technology Evaluations; (7) Ada Technology; and (8) Data Collection. This document contains an index of these publications classified by individual author.

  4. Ground disposal of oil shale wastes: a review with an indexed annotated bibliography through 1976

    Routson, R.C.; Bean, R.M.


    This review covers the available literature concerning ground-disposed wastes and effluents of a potential oil shale industry. Ground disposal has been proposed for essentially all of the solid and liquid wastes produced (Pfeffer, 1974). Since an oil shale industry is not actually in operation, the review is anticipatory in nature. The section, Oil Shale Technology, provides essential background for interpreting the literature on potential shale oil wastes and the topics are treated more completely in the section entitled Environmental Aspects of the Potential Disposal of Oil Shale Wastes to Ground. The first section of the annotated bibliography cites literature concerning potential oil shale wastes and the second section cites literature concerning oil shale technology. Each section contains references arranged historically by year. An index is provided.

  5. DOE Hydropower Program biennial report 1996-1997 (with an updated annotated bibliography)

    Rinehart, B.N.; Francfort, J.E.; Sommers, G.L. [Lockheed Idaho Technologies Co., Idaho Falls, ID (United States); Cada, G.F.; Sale, M.J. [Oak Ridge National Lab., TN (United States)


    This report, the latest in a series of biennial Hydropower Program reports sponsored by the US Department of Energy, summarizes the research and development and technology transfer activities of fiscal years 1996 and 1997. The report discusses the activities in the six areas of the hydropower program: advanced hydropower turbine systems; environmental research; hydropower research and development; renewable Indian energy resources; resource assessment; and technology transfer. The report also includes an annotated bibliography of reports pertinent to hydropower, written by the staff of the Idaho National Engineering and Environmental Laboratory, Oak Ridge National Laboratory, Federal and state agencies, cities, metropolitan water districts, irrigation companies, and public and independent utilities. Most reports are available from the National Technical Information Service.

  6. Organic chemical aging mechanisms: An annotated bibliography. Waste Tank Safety Program

    Samuels, W.D.; Camaioni, D.M.; Nelson, D.A.


    An annotated bibliography has been compiled of the potential chemical and radiological aging mechanisms of the organic constituents (non-ferrocyanide) that would likely be found in the UST at Hanford. The majority of the work that has been conducted on the aging of organic chemicals used for extraction and processing of nuclear materials has been in conjunction with the acid or PUREX type processes. At Hanford the waste being stored in the UST has been stabilized with caustic. The aging factors that were used in this work were radiolysis, hydrolysis and nitrite/nitrate oxidation. The purpose of this work was two-fold: to determine whether or not research had been or is currently being conducted on the species associated with the Hanford UST waste, either as a mixture or as individual chemicals or chemical functionalities, and to determine what areas of chemical aging need to be addressed by further research.

  7. An annotated bibliography for lamprey habitat in the White Salmon River, Washington

    Allen, M. Brady


    The October 2011 decommissioning of Condit Dam on the White Salmon River at river kilometer (rkm) 5.3 removed a significant fish passage barrier from the White Salmon River basin for the first time in nearly a century. This affords an opportunity to regain a potentially important drainage basin for Pacific lamprey (Entosphenus tridentatus) production. In anticipation of Pacific lamprey recolonization or reintroduction, aquatic resource managers, such as the Yakama Nation (YN), are planning to perform surveys in the White Salmon River and its tributaries. The likely survey objectives will be to investigate the presence of lamprey, habitat conditions, and habitat availability. In preparation for this work, a compilation and review of the relevant aquatic habitat and biological information on the White Salmon River was conducted. References specific to the White Salmon River were collected and an annotated bibliography was produced including reports containing:

  8. Radioactive occurrences in veins and igneous and metamorphic rocks of New Mexico with annotated bibliography

    McLemore, V.T.


    From an extensive literature search and field examination of 96 nonsandstone radioactive occurrences, the author compiled an annotated bibliography of over 600 citations and a list of 327 radioactive occurrences in veins and igneous and metamorphic rocks of New Mexico. The citations are indexed by individual radioactive occurrence, geographic area, county, fluorspar deposits and occurrences, geochemical analyses, and geologic maps. In addition, the geology, mineralization, and uranium and thorium potential of 41 geographic areas in New Mexico containing known radioactive occurrences in veins and igneous and metamorphic rocks or that contain host rocks considered favorable for uranium or thorium mineralization are summarized. A list of aerial-radiometric, magnetic, hydrogeochemical, and stream-sediment survey reports is included

  9. Radioactive occurrences in veins and igneous and metamorphic rocks of New Mexico with annotated bibliography

    McLemore, V.T.


    The primary objectives of this report are to list known radioactive occurrences in veins and igneous and metamorphic rocks in New Mexico, and to provide an annotated bibliography of geologic reports concerning these regions. Only plutonic, metamorphic, vein, and Precambrian quartz-pebble conglomerate uranium deposits are considered in this report; other nonsandstone uranium deposits (such as shale, limestone, phosphorite, coal, evaporative precipitates, and fossil placer deposits) will be considered at a later time. These objectives were achieved through a literature search. Some field examinations of some of the radioactive occurrences have been completed. A table of known radioactive occurrences in veins and igneous and metamorphic rocks was compiled from the literature (Appendix I)

  10. Annotated bibliography on artificial recharge of ground water, 1955-67

    Signor, Donald C.; Growitz, Douglas J.; Kam, William


    Artificial ground-water recharge has become more important as water use by agriculture, industry, and municipalities increases. Water management agencies are increasingly interested in potential use of recharge for pollution abatement, waste-water disposal, and re-use and reclamation of locally available supplies. Research projects and theoretical analyses of operational recharge systems show increased scientific emphasis on the practice. Overall ground-water basin management systems generally now contain considerations of artificial recharge, whether by direct or indirect methods. Artificial ground-water recharge is a means of conserving surface runoff for future use in places where it would otherwise be lost, of protecting ground-water basins from salt-water encroachment along coastal areas, and of storing and distributing imported water. The biblio-graphy emphasizes technology; however, annotations of articles on waste-water reclamation, ground-water management and ground-water basin management are included. Subjects closely related to artificial recharge, including colloidal flow through porous media, field or laboratory instrumentation, and waste disposal by deep well injection are included where they specifically relate to potential recharge problems. Where almost the same material has been published in several journals, all references are included on the assumption that some publications may be more readily available to interested persons than others. Other publications, especially those of foreign literature, provided abstracts that were used freely as time limitations precluded obtaining and annotating all materials. Abstracts taken from published sources are noted. These are: "Abstracts of North American Geology," U.S. Department of the Interior, Geological Survey; "Abstracts of Recent Published Material on Foil and Water Conservation," ARS-41 series, Agricultural F.esearch Service, U.S. Department of Agriculture; "Water and1 Water

  11. An annotated bibliography of completed and in-progress behavioral research for the Office of Buildings and Community Systems. [About 1000 items, usually with abstracts

    Weijo, R.O.; Roberson, B.F.; Eckert, R.; Anderson, M.R.


    This report provides an annotated bibliography of completed and in-progress consumer decision research useful for technology transfer and commercialization planning by the US Department of Energy's (DOE) Office of Buildings and Community Systems (OBCS). This report attempts to integrate the consumer research studies conducted across several public and private organizations over the last four to five years. Some of the sources of studies included in this annotated bibliography are DOE National Laboratories, public and private utilities, trade associations, states, and nonprofit organizations. This study divides the articles identified in this annotated bibliography into sections that are consistent with or similar to the system of organization used by OBCS.


    Harvard Univ., Cambridge, MA. Graduate School of Education.


  13. Update of identification and estimation of socioeconomic impacts resulting from perceived risks and changing images: An annotated bibliography

    Nieves, L.A.; Clark, D.E.; Wernette, D.


    This annotated bibliography reviews selected literature published through August 1991 on the identification of perceived risks and methods for estimating the economic impacts of risk perception. It updates the literature review found in Argonne National Laboratory report ANL/EAIS/TM-24 (February 1990). Included in this update are (1) a literature review of the risk perception process, of the relationship between risk perception and economic impacts, of economic methods and empirical applications, and interregional market interactions and adjustments; (2) a working bibliography (that includes the documents abstracted in the 1990 report); (3) a topical index to the abstracts found in both reports; and (4) abstracts of selected articles found in this update

  14. Update of identification and estimation of socioeconomic impacts resulting from perceived risks and changing images: An annotated bibliography

    Nieves, L.A.; Clark, D.E.; Wernette, D.


    This annotated bibliography reviews selected literature published through August 1991 on the identification of perceived risks and methods for estimating the economic impacts of risk perception. It updates the literature review found in Argonne National Laboratory report ANL/EAIS/TM-24 (February 1990). Included in this update are (1) a literature review of the risk perception process, of the relationship between risk perception and economic impacts, of economic methods and empirical applications, and interregional market interactions and adjustments; (2) a working bibliography (that includes the documents abstracted in the 1990 report); (3) a topical index to the abstracts found in both reports; and (4) abstracts of selected articles found in this update.

  15. Association for Teacher Education in Europe (ATEE) Seminar on Practical Experience in Teacher Education (Gargnano, Italy, June 28-July 1, 1995). Select Annotated Bibliography.

    Macrae, Sheila, Comp.; Manning, Patricia, Comp; Moon, Bob, Comp.


    This annotated bibliography offers information from presentations at a 1995 seminar on practical teaching experience in preservice teacher education programs throughout Europe. Each entry includes a brief abstract of the presentation and a list of keywords. (SM)

  16. Approaches to Working with Children, Young People and Families for Traveller, Irish Traveller, Gypsy, Roma and Show People Communities. Annotated Bibliography for the Children's Workforce Development Council

    Robinson, Mark; Martin, Kerry; Wilkin, Carol


    This annoted bibliography relays a range of issues and approaches to working with Travellers, Irish Travellers, Gypsies, Roma and Show People. This is an accompanying document to the literature review report, ED501860.

  17. Hanford High-Level Waste Vitrification Program at the Pacific Northwest National Laboratory: technology development - annotated bibliography

    Larson, D.E.


    This report provides a collection of annotated bibliographies for documents prepared under the Hanford High-Level Waste Vitrification (Plant) Program. The bibliographies are for documents from Fiscal Year 1983 through Fiscal Year 1995, and include work conducted at or under the direction of the Pacific Northwest National Laboratory. The bibliographies included focus on the technology developed over the specified time period for vitrifying Hanford pretreated high-level waste. The following subject areas are included: General Documentation; Program Documentation; High-Level Waste Characterization; Glass Formulation and Characterization; Feed Preparation; Radioactive Feed Preparation and Glass Properties Testing; Full-Scale Feed Preparation Testing; Equipment Materials Testing; Melter Performance Assessment and Evaluations; Liquid-Fed Ceramic Melter; Cold Crucible Melter; Stirred Melter; High-Temperature Melter; Melter Off-Gas Treatment; Vitrification Waste Treatment; Process, Product Control and Modeling; Analytical; and Canister Closure, Decontamination, and Handling

  18. Psychomotor Battery Approaches to Performance Prediction and Evaluation in Hyperbaric, Thermal and Vibratory Environments: Annotated Bibliographies and Integrative Review


    W77-Mar78 and Vibratory Environments: Annotated Biblia - 4.-EFRIGOO EOT*_1 graphies and Integrative Review. I. CONTRACT OR GRANT NUMSER(a) David J...Papers In the third phase of the effort, the final version of the three speciai-environrneni performance battery bibliographies was corriiled and the...performance at much lower pressu. (e.g. 3 to 4 ATA when nitrogen is involved). The following sections will integrate the available liter - ature on the effects

  19. Annotated bibliography: Marine geologic hazards of the Hawaiian Islands with special focus on submarine slides and turbidity currents

    Normark, W.R.; Herring, H.H.


    This annotated bibliography was compiled to highlight the submarine geology of the Hawaiian Islands and identify known and potential marine geologic hazards with special emphasis on turbidity currents, submarine slides and tsunamis. Some references are included that are not specific to Hawaii but are needed to understand the geologic processes that can affect the integrity of submarine cables and other man-made structures. Entries specific to the Hawaiian Island area are shown in bold type.


    James Sorensen; Jaroslav Solc; Bethany Bolles


    The objective of this task as originally conceived was to compile an assessment of methane hydrate deposits in Alaska from available sources and to make a very preliminary evaluation of the technical and economic feasibility of producing methane from these deposits for remote power generation. Gas hydrates have recently become a target of increased scientific investigation both from the standpoint of their resource potential to the natural gas and oil industries and of their positive and negative implications for the global environment After we performed an extensive literature review and consulted with representatives of the U.S. Geological Survey (USGS), Canadian Geological Survey, and several oil companies, it became evident that, at the current stage of gas hydrate research, the available information on methane hydrates in Alaska does not provide sufficient grounds for reaching conclusions concerning their use for energy production. Hence, the original goals of this task could not be met, and the focus was changed to the compilation and review of published documents to serve as a baseline for possible future research at the Energy & Environmental Research Center (EERC). An extensive annotated bibliography of gas hydrate publications has been completed. The EERC will reassess its future research opportunities on methane hydrates to determine where significant initial contributions could be made within the scope of limited available resources.

  1. Selected, annotated bibliography of studies relevant to the isolation of nuclear wastes

    Hyder, L.K.; Fore, C.S.; Vaughan, N.D.; Faust, R.A.


    This annotated bibliography of 705 references represents the first in a series to be published by the Ecological Sciences Information Center containing scientific, technical, economic, and regulatory information relevant to nuclear waste isolation. Most references discuss deep geologic disposal, with fewer studies of deep seabed disposal; space disposal is also included. The publication covers both domestic and foreign literature for the period 1954 to 1980. Major chapters selected are Chemical and Physical Aspects; Container Design and Performance; Disposal Site; Envirnmental Transport; General Studies and Reviews; Geology, Hydrology and Site Resources; Regulatory and Economic Aspects; Repository Design and Engineering; Transportation Technology; Waste Production; and Waste Treatment. Specialized data fields have been incorporated to improve the ease and accuracy of locating pertinent references. Specific radionuclides for which data are presented are listed in the Measured Radionuclides field, and specific parameters which affect the migration of these radionuclides are presented in the Measured Parameters field. The references within each chapter are arranged alphabetically by leading author, corporate affiliation, or title of the document. When the author is not given, the corporate affiliation appears first. If these two levels of authorship are not given, the title of the document is used as the identifying level. Indexes are provided for author(s), keywords, subject category, title, geographic location, measured parameters, measured radionuclides, and publication description

  2. Resolving community conflict in the nuclear power issue: a report and annotated bibliography

    Burt, R.S.; Fischer, M.; Corbett, T.; Garrett, K.; Lundgren, M.


    This report is a scholarly discussion of the escalation and possible resolution of community conflict in the nuclear power issue. The concern is at all times with the social factors in this conflict; technical problems in nuclear power are only considered to the extent that such problems are raised in conflict over nuclear power. Social science research on conflict is only reviewed to the extent that it bears on community conflict over nuclear power. Chapter 1 describes the nature of community conflict escalation in the nuclear power issue: stages of escalation, typical individuals and groups involved, typical issues raised, typical manners in which participants become involved, and the basic social parameters of conflict escalation. Chapter 2 outlines the community level determinants of conflict escalation in the nuclear power issue: How is a community in which conflict over a nuclear facility is most likely different from a community in which such conflict is least likely. Chapter 3 is a detailed consideration of alternative methods of containing and resolving conflict. Chapter 4 summarizes principles for dealing with community conflict in the nuclear power issue. Finally, Chapter 5 is an annotated bibliography of the literature reviewed in the report. 840 references

  3. Resolving community conflict in the nuclear power issue: a report and annotated bibliography

    Burt, R.S.; Fischer, M.; Corbett, T.; Garrett, K.; Lundgren, M.


    This report is a scholarly discussion of the escalation and possible resolution of community conflict in the nuclear power issue. The concern is at all times with the social factors in this conflict; technical problems in nuclear power are only considered to the extent that such problems are raised in conflict over nuclear power. Social science research on conflict is only reviewed to the extent that it bears on community conflict over nuclear power. Chapter 1 describes the nature of community conflict escalation in the nuclear power issue: stages of escalation, typical individuals and groups involved, typical issues raised, typical manners in which participants become involved, and the basic social parameters of conflict escalation. Chapter 2 outlines the community level determinants of conflict escalation in the nuclear power issue: How is a community in which conflict over a nuclear facility is most likely different from a community in which such conflict is least likely. Chapter 3 is a detailed consideration of alternative methods of containing and resolving conflict. Chapter 4 summarizes principles for dealing with community conflict in the nuclear power issue. Finally, Chapter 5 is an annotated bibliography of the literature reviewed in the report. 840 references.

  4. Selected, annotated bibliography of studies relevant to the isolation of nuclear wastes. [705 references

    Hyder, L.K.; Fore, C.S.; Vaughan, N.D.; Faust, R.A.


    This annotated bibliography of 705 references represents the first in a series to be published by the Ecological Sciences Information Center containing scientific, technical, economic, and regulatory information relevant to nuclear waste isolation. Most references discuss deep geologic disposal, with fewer studies of deep seabed disposal; space disposal is also included. The publication covers both domestic and foreign literature for the period 1954 to 1980. Major chapters selected are Chemical and Physical Aspects; Container Design and Performance; Disposal Site; Envirnmental Transport; General Studies and Reviews; Geology, Hydrology and Site Resources; Regulatory and Economic Aspects; Repository Design and Engineering; Transportation Technology; Waste Production; and Waste Treatment. Specialized data fields have been incorporated to improve the ease and accuracy of locating pertinent references. Specific radionuclides for which data are presented are listed in the Measured Radionuclides field, and specific parameters which affect the migration of these radionuclides are presented in the Measured Parameters field. The references within each chapter are arranged alphabetically by leading author, corporate affiliation, or title of the document. When the author is not given, the corporate affiliation appears first. If these two levels of authorship are not given, the title of the document is used as the identifying level. Indexes are provided for author(s), keywords, subject category, title, geographic location, measured parameters, measured radionuclides, and publication description.

  5. Annotated Bibliography for Lake Erie. Volume II. Chemical,


    ural forces tending to restore equilibrium. Bieber , Glen F. - See: Frank J. Little, Jr., et al, No. 212. 37. Bird, John. 1966. Our dying waters...research should indicate more definite trends. 207. Leonard, Justin W. 1962. Environmental requirements of Ephemeroptera. In: Clarence M. Tarzwell (Ed... Bieber , Thomas J. Horst and Danley F. Brown. 1973. Possible accelerated eutrophication thresholds in the Great Lakes rela- tive to human population

  6. An annotated bibliography: social and economic factors associated with electric power generation 1978. Report for 1970-78

    Nakamura, S.


    A selective, annotated bibliography is presented concerning the socioeconomic impacts associated with electric power generation and related energy facilities. Abstracts were taken from studies, tables and figures in environmental reports and impact statements prepared by the energy industry, their consultants and regulatory agencies in connection with licensing and environmental requirements. The majority of the citations cover planned and operating nuclear and coal-fired steam electric generating stations and their associated transmission lines. Also included are citations covering other parts of the fossil and nuclear fuel cycles, such as mines and mills, fuel transportation and the breeder reactor. The bibliography is arranged by types of impacts including direct and indirect benefits of electricity production and transmission and internal and external costs. A state index and an author sponsor and plant name index are provided

  7. Annotated bibliography of selected references on shoreline barrier island deposits with emphasis on Patrick Draw Field, Sweetwater County, Wyoming

    Rawn-Schatzinger, V.; Schatzinger, R.A.


    This bibliography contains 290 annotated references on barrier island and associated depositional environments and reservoirs. It is not an exhaustive compilation of all references on the subject, but rather selected papers on barrier islands, and the depositional processes of formation. Papers that examine the morphology and internal architecture of barrier island deposits, exploration and development technologies are emphasized. Papers were selected that aid in understanding reservoir architecture and engineering technologies to help maximize recovery efficiency from barrier island oil reservoirs. Barrier islands from Wyoming, Montana and the Rocky Mountains basins are extensively covered.

  8. Bibliographie (Bibliography).

    Francais dans le Monde, 1981


    Presents a selective bibliography of dictionaries, books, and articles. References are grouped under three sections: I. Lexicology, II. Dictionaries and III. Didactics. Each item is followed by a concise critical note. The compilation is by the "Centre d'Etudes du Lexique" (CELEX, Paris-Villetaneuse). (MES)

  9. Asian Theatre: A Study Guide and Annotated Bibliography. "Theatre Perspectives" No. 1.

    Brandon, James R., Ed.; Wichmann, Elizabeth, Ed.

    This study guide/bibliography is intended to help the English language reader find materials for the study of Asian theatre. Containing 1,348 entries, the guide is the most extensive bibliography published to date. The guide is organized by geographical area: an initial chapter on Asia is followed by chapters on each of 16 countries: Burma,…

  10. Annotated bibliography of scientific research on greater sage-grouse published since January 2015

    Carter, Sarah K.; Manier, Daniel J.; Arkle, Robert S.; Johnston, Aaron; Phillips, Susan L.; Hanser, Steven E.; Bowen, Zachary H.


    resulted in the inclusion of 169 published products (2 of these products were published corrections to journal articles). The management topics most commonly addressed were GRSG behavior or demographics and GRSG habitat selection or habitat characteristics at broad or site scales. Few products addressed captive breeding, recreation, wild horses and burros, and range management structures (including fences). We include in this annotated bibliography the full citation, product summary, and management topics addressed by each product. The online version of this bibliography ( is searchable by topic and location and includes links to the original publications.A substantial body of literature has been compiled based on research explicitly related to the conservation, management, monitoring, and assessment of GRSG. These studies may inform planning and management actions that seek to balance conservation, economic, and social objectives and manage diverse resource uses and values across the western United States.The review process for this product included requesting input on each summary from one or more authors of the original peer-reviewed article or report and a formal review of the entire document by three independent reviewers and, subsequently, the USGS Bureau Approving Official. This process is consistent with USGS Fundamental Science Practices.

  11. The Geology of Burma (Myanmar): An Annotated Bibliography of Burma's Geology, Geography and Earth Science

    Hadden, Robert L


    A bibliography on Burma prepared by the Topographic Engineering Center (TEC) to assist with humanitarian efforts offered by the US Government after the devastating Cyclone Nargis hit Burma on May 2, 2008...

  12. Annotated Bibliography of MMPI Research Among College Populations: 1962-1970.

    Cornish, Richard D.

    The MMPI continues to be the focus of a large quantity of research. This article offers an aid to persons working with college student populations by annotating recent MMPI research relating to college populations. A total of 49 articles (each categorized in terms of content into one of 10 sections or subsections) were annotated. The Validity of…

  13. Annotated bibliography of the red tree vole (Arborimus longicaudus), Sonoma tree vole (A. pomo), and white-footed vole (A. albipes).

    James K. Swingle; Eric D. Forsman


    This annotated bibliography contains all citations that we could find on tree voles (Arborimus longicaudus, A. pomo) and white-footed voles (A. albipes), including many unpublished sources in museum archives, court proceedings, and agency documents. Some documents not readily available in published form or museum archives are...

  14. A DDC Bibliography on Computers in Information Sciences. Volume II. Information Sciences Series.

    Defense Documentation Center, Alexandria, VA.

    The unclassified and unlimited bibliography compiles references dealing specifically with the role of computers in information sciences. The volume contains 239 annotated references grouped under three major headings: Artificial and Programming Languages, Computer Processing of Analog Data, and Computer Processing of Digital Data. The references…

  15. Geological and geochemical aspects of uranium deposits. A selected, annotated bibliography

    Garland, P.A.; Thomas, J.M.; Brock, M.L.; Daniel, E.W. (comps.)


    A bibliography of 479 references encompassing the fields of uranium and thorium geochemistry and mineralogy, geology of uranium deposits, uranium mining, and uranium exploration techniques has been compiled by the Ecological Sciences Information Center of Oak Ridge National Laboratory. The bibliography was produced for the National Uranium Resource Evaluation Program, which is funded by the Grand Junction Office of the Department of Energy. The references contained in the bibliography have been divided into the following eight subject categories: (1) geology of deposits, (2) geochemistry, (3) genesis O deposits, (4) exploration, (5) mineralogy, (6) uranium industry, (7) reserves and resources, and (8) geology of potential uranium-bearing areas. All categories specifically refer to uranium and thorium; the last category contains basic geologic information concerning areas which the Grand Junction Office feels are particularly favorable for uranium deposition. The references are indexed by author, geographic location, quadrangle name, geoformational feature, taxonomic name, and keyword.

  16. Annotated bibliography of safety-related occurrences in nuclear power plans as reported in 1974

    Scott, R.L.; Gallaher, R.B.


    All abnormal occurrences at nuclear power plants reported in 1974 are reviewed and summarized. This bibliography covers the individual reports on each of the 1421 abnormal occurrences reported to the U. S. Nuclear Regulatory Commission, as well as some 455 other documents pertaining to these and other events of note. The review is intended to provide insight as to where additional effort can be expended to improve operations in nuclear power plants. The individual reports, abstracted by the Nuclear Safety Information Center, concern incidents and failures, design or construction deficiencies, and noncompliance citations for license violations. A bibliography is included which contains 100-word abstracts of each incident. For convenience, the bibliography is organized according to type of facility as follows: boiling-water reactors; pressurized-water reactors; non-water-cooled power reactors; and reactors, general. Key-word and permuted-title indexes are provided for each section. (U.S.)

  17. Geological and geochemical aspects of uranium deposits. A selected, annotated bibliography

    Garland, P.A.; Thomas, J.M.; Brock, M.L.; Daniel, E.W.


    A bibliography of 479 references encompassing the fields of uranium and thorium geochemistry and mineralogy, geology of uranium deposits, uranium mining, and uranium exploration techniques has been compiled by the Ecological Sciences Information Center of Oak Ridge National Laboratory. The bibliography was produced for the National Uranium Resource Evaluation Program, which is funded by the Grand Junction Office of the Department of Energy. The references contained in the bibliography have been divided into the following eight subject categories: (1) geology of deposits, (2) geochemistry, (3) genesis O deposits, (4) exploration, (5) mineralogy, (6) uranium industry, (7) reserves and resources, and (8) geology of potential uranium-bearing areas. All categories specifically refer to uranium and thorium; the last category contains basic geologic information concerning areas which the Grand Junction Office feels are particularly favorable for uranium deposition. The references are indexed by author, geographic location, quadrangle name, geoformational feature, taxonomic name, and keyword

  18. Geological and geochemical aspects of uranium deposits: a selected, annotated bibliography. [474 references

    Thomas, J.M.; Garland, P.A.; White, M.B.; Daniel, E.W.


    This bibliography, a compilation of 474 references, is the fourth in a series compiled from the National Uranium Resource Evaluation (NURE) Bibliographic Data Base. This data base was created for the Grand Junction Office of the Department of Energy's National Uranium Resource Evaluation Project by the Ecological Sciences Information Center, Oak Ridge National Laboratory. The references in the bibliography are arranged by subject category: (1) geochemistry, (2) exploration, (3) mineralogy, (4) genesis of deposits, (5) geology of deposits, (6) uranium industry, (7) geology of potential uranium-bearing areas, and (8) reserves and resources. The references are indexed by author, geographic location, quadrangle name, geoformational feature, and keyword.

  19. Geological and geochemical aspects of uranium deposits: a selected, annotated bibliography

    Thomas, J.M.; Garland, P.A.; White, M.B.; Daniel, E.W.


    This bibliography, a compilation of 474 references, is the fourth in a series compiled from the National Uranium Resource Evaluation (NURE) Bibliographic Data Base. This data base was created for the Grand Junction Office of the Department of Energy's National Uranium Resource Evaluation Project by the Ecological Sciences Information Center, Oak Ridge National Laboratory. The references in the bibliography are arranged by subject category: (1) geochemistry, (2) exploration, (3) mineralogy, (4) genesis of deposits, (5) geology of deposits, (6) uranium industry, (7) geology of potential uranium-bearing areas, and (8) reserves and resources. The references are indexed by author, geographic location, quadrangle name, geoformational feature, and keyword

  20. Annotated bibliography for biologic overview for the Nevada Nuclear Waste Storage Investigations, Nevada Test Site, Nye County, Nevada

    Collins, E.; O'Farrell, T.P.; Rhoads, W.A.


    This annotated bibliography was compiled to accompany the Biologic Overview for the Nevada Nuclear Waste Storage Investigations, Nevada Test Site, Nye County, Nevada, EG and G, Santa Barbara Operations Report No. EGG 1183-2443, which documents and synthesizes important biotic information related to Nevada Nuclear Waste Storage Investigations (NNWSI). As such, it is an important part of the NNWSI screening process that was designed to include a systematic, traceable, defensible, and documented basis for a decision to proceed or not with site-specific phases on NTS. Included are all published, and available but unpublished, baseline information on life histories, habitat requirements, distributions, and ecological relationships of the flora and fauna of the region. Special effort was made to include information on endangered, threatened, or sensitive species. 131 references

  1. Annotated bibliography of environmentally relevant investigations of uranium mining and milling in the Grants Mineral Belt, northwestern New Mexico

    Otton, James K.


    Studies of the natural environment in the Grants Mineral Belt in northwestern New Mexico have been conducted since the 1930s; however, few such investigations predate uranium mining and milling operations, which began in the early 1950s. This report provides an annotated bibliography of reports that describe the hydrology and geochemistry of groundwaters and surface waters and the geochemistry of soils and sediments in the Grants Mineral Belt and contiguous areas. The reports referenced and discussed provide a large volume of information about the environmental conditions in the area after mining started. Data presented in many of these studies, if evaluated carefully, may provide much basic information about the baseline conditions that existed over large parts of the Grants Mineral Belt prior to mining. Other data may provide information that can direct new work in efforts to discriminate between baseline conditions and the effects of the mining and milling on the natural environment.

  2. Nuclear criticality experiments from 1943 to 1978. An annotated bibliography: Volume 1, main listing

    Koponen, B.L.; Wilcox, T.P.; Hampel, V.E.


    This report only describes the bibliography which contains 1067 citations from the literature of critical and near-critical nuclear experiments. The bibliography provides an up-to-date index to reports containing useful data for many types of criticality studies. Most of the reports can provide specifications for relatively simple critical configurations necessary for validating nuclear constants and calculational techniques. The reports of more than 1143 experimentors at 38 international facilities since 1943 are cross-referenced. This collection contains the prototypes of many different designs of nuclear reactors and studies performed to ensure the safe use of fissile materials in chemical processing plants, storage facilities, and transportation containers. The bibliography has three volumes. Volume 1 contains the main listing of citations with abstracts. Volume 2 is a set of indexes organized by report number, publication date, experimental facility, and author name. Volume 3 provides a subject index, concorded on the significant keyphrases derived from titles, and an index of key terms extracted from titles and abstracts. The bibliography was printed by computer as a selection from a computerized system at Lawrence Livermore Laboratory containing information and data on criticality experiments

  3. Arms Control and Disarmament. A Quarterly Bibliography with Abstracts and Annotations.

    Arms Control and Disarmament Agency, Washington, DC.

    This bibliography is compiled from a survey of the literature on the subject received by the Library of Congress. Only those likely to be available in larger research and public libraries in the United States are included. Sources surveyed include books, monographs, publications of government agencies and international and national organizations,…

  4. Systematic Methods in School Planning and Design. A Selected and Annotated Bibliography.

    Murtha, D. Michael

    A selection of technical reports, journal articles and books on various aspects of systematic methods for school planning and design, are presented in this bibliography. The subject areas include the design process in terms of--(1) practice, (2) theory, (3) methods, (4) decision systems, and (5) computer applications. Criteria for design with…

  5. Physical Modeling in the Geological Sciences: An Annotated Bibliography. CEGS Programs Publication No. 16.

    Charlesworth, L. J., Jr.; Passero, Richard Nicholas

    The bibliography identifies, describes, and evaluates devices and techniques discussed in the world's literature to demonstrate or stimulate natural physical geologic phenomena in classroom or laboratory teaching or research situations. The aparatus involved ranges from the very simple and elementary to the highly complex, sophisticated, and…

  6. Understanding the links between ecosystem health and social system well-being: an annotated bibliography.

    Dawn M. Elmer; Harriet H. Christensen; Ellen M. Donoghue; [Compilers].


    This bibliography focuses on the links between social system well-being and ecosystem health. It is intended for public land managers and scientists and students of social and natural sciences. Multidisciplinary science that addresses the interconnections between the social system and the ecosystem is presented. Some of the themes and strategies presented are policy...

  7. Environmental aspects of the transuranics: a selected, annotated bibliography. [Pu-238, Pu-239

    Ensminger, J.T.; Martin, F.M.; Fore, C.S. (comps.)


    This eighth published bibliography of 427 references is compiled from the Nevada Applied Ecology Information Center's Data Base on the Environmental Aspects of the Transuranics. The data base was built to provide information support to the Nevada Applied Ecology Group (NAEG) of ERDA's Nevada Operations Office. The general scope covers environmental aspects of uranium and the transuranic elements, with emphasis on plutonium. This bibliography highlights literature on plutonium 238 and 239 and americium in the critical organs of man and animals. Supporting information on ecology of the Nevada Test Site and reviews and summarizing literature on other radionuclides have been included at the request of the NAEG. The references are arranged by subject category with leading authors appearing alphabetically in each category. Indexes are provided for author(s), geographic location, keyword(s), taxon, title, and publication description.

  8. Annotated catalog and bibliography of the cyclocephaline scarab beetles (Coleoptera, Scarabaeidae, Dynastinae, Cyclocephalini).

    Moore, Matthew R; Cave, Ronald D; Branham, Marc A


    Cyclocephaline scarab beetles represent the second largest tribe of the subfamily Dynastinae, and the group includes the most speciose genus of dynastines, Cyclocephala . The period following publication of Sebő Endrődi's The Dynastinae of the World has seen a huge increase in research interest on cyclocephalines, and much of this research has not been synthesized. The objective of this catalog and bibliography is to compile an exhaustive list of taxa in Cyclocephalini. This paper provides an updated foundation for understanding the taxonomy and classification of 14 genera and over 500 species in the tribe. It discusses the history of cataloging dynastine species, clarifies issues surrounding the neotype designations in Endrődi's revision of Cyclocephalini, synthesizes all published distribution data for cyclocephaline species, and increases accessibility to the voluminous literature on the group by providing an easily searchable bibliography for each species. We propose the nomen novum Cyclocephala rogerpauli , new replacement name , for C. nigra Dechambre.

  9. Methodology to assess the value of Florida wetlands to fish and wildlife: an annotated bibliography

    Leadon, Monica A.


    The following bibliography was compiled for use by the Cooperative Fish and Wildlife Unit and their cooperators as an aid in determining research priorities in Florida wetlands. Emphasis was placed on studies done on the economic value of wetlands, values to fish and wildlife, methods of sampling in a wetland area, and restoration practices. Material was generally gathered from studies done in the southeast, however, some relevant national papers were also included. (35 page...

  10. Energy efficiency and using less – a social sciences and humanities annotated bibliography

    Mourik, Ruth; Jeuken, Yvette; de Zeeuw, Mariska; Uitdenbogerd, Diana; van Summeren, Luc; Wilhite, Harold; Robison, Rosalyn A. V.; Heidenreich, Sara; Blahová, Michaela; Pidoux, Blandine; Kern-Gillard, Thomas; Arrobbio, Osman; Sonetti, Giulia; Throndsen, William; Fox, Emmet


    The challenge: \\ud * Technological progress and changes in energy supply are not sufficient for a transition to a low-carbon energy system; demand also needs to be considered. Energy efficiency and reducing total consumption - the topics of this bibliography - are typical elements of a demand side approach. \\ud * The uptake of energy efficient technologies, and understanding how we might use less energy, represent big challenges for researchers, policymakers, practitioners and end-users thems...

  11. Annotated bibliography of Accelerator Technology Division research and development, 1978-1985

    Jameson, R.A.; Nicol, C.S.; Cochran, M.A.


    A bibliography is presented of unclassified published and in-house technical material written by members of the Accelerator Technology Division, Los Alamos National Laboratory, since its inception in January, 1978. The author and subject concordances in this report provide cross-reference to detailed citations kept in a computer database and a microfilm file of the documents. The citations include an abstract and other notes, and can be searched for key words and phrases

  12. Nuclear criticality experiments from 1943 to 1978: an annotated bibliography. Volume 1. Main listing

    Koponen, B.L.; Wilcox, T.P.; Hampel, V.E.


    The bibliography contains 1067 citations from the literature of critical and near-critical nuclear experiments. It provides an up-to-date index to reports containing useful data for many types of criticality studies. Most of the reports can provide specifications for relatively simple critical configurations necessary for validating nuclear constants and calculational techniques. The reports of more than 1143 experimentors at 38 international facilities since 1943 are cross-referenced. The collection contains the prototypes of many different designs of nuclear reactors and studies performed to insure the safe use of fissile materials in chemical processing plants, storage facilities, and transportation containers. The bibliography has three volumes. Volume 1 contains the main listing of citations with abstracts. Volume 2 is a set of indexes organized by report number, publication date, experimental facility, and author name. Volume 3 provides a subject index, concorded on the significant keyphrases derived from titles, and an index of keyterms derived from titles, and an index of keyterms extracted from titles and abstracts. The bibliography was printed by computer as a selection from a computerized system at Lawrence Livermore Laboratory contaning information and data on criticality experiments.

  13. Procedures for the elicitation of expert judgements in the probabilistic risk analysis of the long-term effects of radioactive waste repositories: an annotated bibliography

    Watson, S.R.


    This annotated bibliography describes the key literature relevant to the elicitation of expert judgements in radioactive waste management. The bibliography is divided into seven sections; section 2 lists the literature exploring the proper interpretation of probabilities used in Probabilistic Risk Analysis (PRA). Section 3 lists literature describing other calculi for handling uncertainty in a numerical fashion. In section 4 comments are given on how to elicit probabilities from individuals as a measure of subjective degrees of belief and section 5 lists the literature concerning how expert judgements can be combined. Sections 6 and 7 list literature giving an overview of the issues involved in PRA for radioactive waste repositories. (author)

  14. Articles on Mass Communication in U.S. and Foreign Journals: A Selected Annotated Bibliography

    McKerns, Joseph P.; Delahaye, Alfred N.


    Lists and annotates 212 journal articles on mass communication, grouped according to topic. Topics include audience and communicator analysis, broadcasting, communication theory, courts and law, criticism and defense of media, journalism education, government and media, history and biography, international topics, and public relations. (GW)

  15. The Africa Collection: An Annotated Historical Resource Bibliography for the Student of Africa.

    Lynn, Karen

    This annotated bibliographic collection of resources on Africa including non-fiction, fiction, texts, poetry, draft papers, addresses, periodicals, film, records, and travel agencies is designed to aid secondary students and their teachers interested in research on Africa. An instructional approach is taken, drawing upon examples to demonstrate…

  16. Radionuclide movement in soils and uptake by plants. A selected, annotated bibliography

    Francis, C.W.; Talmage, S.S.; McMullin, B.B.


    This bibliography covers the world literature from 1948 to 1975 and contains 1397 references to information on how various chemical, physical, and biological factors influence the movement of radionuclides in soil and uptake by plants. Much of the data is related to the major fission products in radioactive fallout, with emphasis on 137 Cs and 90 Sr. References are included to data on nearly all fission products, a large number of biologically important activation products, and various naturally occurring radioactive nuclides such as uranium and thorium. Subject, author, geographic location, taxon, and permuted title indexes are included. (U.S.)

  17. Geological and geochemical aspects of uranium deposits: a selected, annotated bibliography. Vol. 2, Rev. 1

    Thomas, J.M.; Brock, M.L.; Garland, P.A.; White, M.B.; Daniel, E.W.


    This bibliography, a compilation of 490 references, is the second in a series compiled from the National Uranium Resource Evaluation (NURE) Bibliographic Data Base. This data base is one of six data bases created by the Ecological Sciences Information Center, Oak Ridge National Laboratory, for the Grand Junction Office of the Department of Energy. Major emphasis for this volume has been placed on uranium geology, encompassing deposition, genesis of ore deposits, and ore controls; and prospecting techniques, including geochemistry and aerial reconnaissance. The following indexes are provided to aid the user in locating references of interest: author, geographic location, quadrangle name, geoformational feature, taxonomic name, and keyword

  18. A review and evaluation of the Langley Research Center's Scientific and Technical Information Program. Results of phase 5. Design and evaluation of STI systems: A selected, annotated bibliography

    Pinelli, T. E.; Hinnebusch, P. A.; Jaffe, J. M.


    A selected, annotated bibliography of literature citations related to the design and evaluation of STI systems is presented. The use of manual and machine-readable literature searches; the review of numerous books, periodicals reports, and papers; and the selection and annotation of literature citations were required. The bibliography was produced because the information was needed to develop the methodology for the review and evaluation project, and a survey of the literature did not reveal the existence of a single published source of information pertinent to the subject. Approximately 200 citations are classified in four subject areas. The areas include information - general; information systems - design and evaluation, including information products and services; information - use and need; and information - economics.

  19. Biomedical and environmental aspects of the thorium fuel cycle: a selected, annotated bibliography

    Faust, R.A.; Fore, C.S.; Cone, M.V.; Meyer, H.R.; Till, J.E.


    This bibliography was compiled to assist in the evaluation of the health and environmental consequences of high specific activity thorium and related nuclides which could be released to the environment by activities related to the Thorium Fuel Cycle. The general scope covers studies regarding potential releases, environmental transport, metabolism, dosimetry, dose assessment, and overall risk assessment for radionuclides specific to the NASAP project. This publication of 740 abstracted references highlights the biological and medical aspects of thorium 228 and thorium 232 in man and animals. Similar studies on related nuclides such as radium 224, radium 226, radium 228, and thorium 230 are also emphasized. Additional categories relevant to these radionuclides are included as follows: chemical analysis; ecological aspects; energy; geological aspects; instrumentation; legal and political aspects; monitoring, measurement and analysis; physical aspects; production; radiation safety and control; and waste disposal and management. Environmental assessment and sources categories were used for entries which contain a multiple use of categories. Leading authors appear alphabetically within each category. Indexes are provided for : author(s), geographic location, keywords, title, and publication description. The bibliography contains literature dating from December 1925 to February 1978

  20. Annotated bibliography of radioactive waste management publications at Pacific Northwest Laboratory, January 1978 through July 1982


    This bibliography lists publications (831 abstracts) from the Pacific Northwest Laboratory's Department of Energy sponsored research and development programs from January 1978 through July of 1982. The abstracts are grouped in subject categories, as shown in the table of contents. Entries in the subject index also facilitate access by subject, e.g., High-Level Radioactive Wastes. Three indexes, each preceded by a brief description, are provided: personal author, subject, and report number. Cited are research reports, journal articles, books, patents, theses, and conference papers. Excluded are technical progress reports. Since 1978 the Nuclear Waste Management Quarterly Progress Report has been published under the series number PNL-3000. Beginning in 1982, this publication has been issued semiannually, under the series number PNL-4250. This bibliography is the successor to two others, BNWL-2201 (covering the years 1965-1976) and PNL-4050 (1975-1978). It is intended to provide a useful reference to literature in waste management written or compiled by PNL staff

  1. Biomedical and environmental aspects of the thorium fuel cycle: a selected, annotated bibliography

    Faust, R.A.; Fore, C.S.; Cone, M.V.; Meyer, H.R.; Till, J.E.


    This bibliography was compiled to assist in the evaluation of the health and environmental consequences of high specific activity thorium and related nuclides which could be released to the environment by activities related to the Thorium Fuel Cycle. The general scope covers studies regarding potential releases, environmental transport, metabolism, dosimetry, dose assessment, and overall risk assessment for radionuclides specific to the NASAP project. This publication of 740 abstracted references highlights the biological and medical aspects of thorium 228 and thorium 232 in man and animals. Similar studies on related nuclides such as radium 224, radium 226, radium 228, and thorium 230 are also emphasized. Additional categories relevant to these radionuclides are included as follows: chemical analysis; ecological aspects; energy; geological aspects; instrumentation; legal and political aspects; monitoring, measurement and analysis; physical aspects; production; radiation safety and control; and waste disposal and management. Environmental assessment and sources categories were used for entries which contain a multiple use of categories. Leading authors appear alphabetically within each category. Indexes are provided for : author(s), geographic location, keywords, title, and publication description. The bibliography contains literature dating from December 1925 to February 1978.

  2. An Annotated Bibliography of Hypobaric Decompression Sickness Research Conducted at the Crew Technology Division, USAF School of Aerospace Medicine, Brooks AFB, Texas from 1983 to 1988


    AN ANNOTATED BIBLIOGRAPHY OF HYPOBARIC DECOMPRESSION SICKNESS RESEARCH CONDUCTED AT THE CREW TECHNOLOGY DIVISION, USAF SCHOOL OF AEROSPACE MEDICINE...190 man-flights to four selected altitudes (30000, 27500, 25000, and 22500 ft pressure equivalent) in a hypobaric chamber. The subjects’ ages ranged...conditions and two of these developed delayed sy~rtcms. Three of these five subjects underwent hyperbaric oxygen treatment. Conclusion. Female subjects

  3. Annotated bibliography: hazard assessments for the geologic isolation of nuclear wastes. Final report. Center for Resource and Environmental Systems Studies report No. 41

    Suta, B.E.; Mara, S.J.; Radding, S.B.; Weisbecker, L.W.


    This report presents an annotated bibliography of risk assessments that are pertinent to constructing, operating, and decommissioning a federal repository for the underground storage of radioactive waste. This might be considered as a first phase in an assessment of the risks associated with radioactive waste storage. Only those documents judged to be the more pertinent are abstracted. The abstracts are grouped under 13 classifications. A subject and author index is provided

  4. Annotated bibliography: overview of energy and mineral resources for the Nevada nuclear-waste-storage investigations, Nevada Test Site, Nye County, Nevada

    Bell, E.J.; Larson, L.T.


    This Annotated Bibliography was prepared for the US Department of Energy as part of the Environmental Area Characterization for the Nevada Nuclear Waste Storage Investigations (NNWSI) at the Nevada Test Site (NTS). References were selected to specifically address energy resources including hydrocarbons, geothermal and radioactive fuel materials, mineral resources including base and precious metals and associated minerals, and industrial minerals and rock materials which occur in the vicinity of the NNWSI area

  5. Geological and geochemical aspects of uranium deposits. A selected, annotated bibliography. Vol. 1

    White, M.B.; Garland, P.A. (comps.)


    This bibliography was compiled by selecting 580 references from the Bibliographic Information Data Base of the Department of Energy's (DOE) National Uranium Resource Evaluation (NURE) Program. This data base and five others have been created by the Ecological Sciences Information Center to provide technical computer-retrievable data on various aspects of the nation's uranium resources. All fields of uranium geology are within the defined scope of the project, as are aerial surveying procedures, uranium reserves and resources, and universally applied uranium research. References used by DOE-NURE contractors in completing their aerial reconnaissance survey reports have been included at the request of the Grand Junction Office, DOE. The following indexes are provided to aid the user in locating reference of interest: author, keyword, geographic location, quadrangle name, geoformational index, and taxonomic name.

  6. Geological and geochemical aspects of uranium deposits. A selected, annotated bibliography. Vol. 1

    White, M.B.; Garland, P.A.


    This bibliography was compiled by selecting 580 references from the Bibliographic Information Data Base of the Department of Energy's (DOE) National Uranium Resource Evaluation (NURE) Program. This data base and five others have been created by the Ecological Sciences Information Center to provide technical computer-retrievable data on various aspects of the nation's uranium resources. All fields of uranium geology are within the defined scope of the project, as are aerial surveying procedures, uranium reserves and resources, and universally applied uranium research. References used by DOE-NURE contractors in completing their aerial reconnaissance survey reports have been included at the request of the Grand Junction Office, DOE. The following indexes are provided to aid the user in locating reference of interest: author, keyword, geographic location, quadrangle name, geoformational index, and taxonomic name

  7. Particle physics, one hundred years of dicoveries an annotated chronological bibliography

    Ezhela, Vladimir V; Lugovsky, S B; Polishchuk, B V; Striganov, S I; Stroganov, Y G; Armstrong, Betty; Barnett, Richard Michael; Groom, D E; Gee, P S; Trippe, Thomas G; Wohl, Charles G; Jackson, John David


    Several years before the official start of the 20th century, a series of milestone physics experiments pioneered the science which eventually became to be known as particle physics. A new book by several authors from the COMPAS group at the Institute for High Energy Physics, Protvino, near Moscow, and from the Particle Data Group effort at the Lawrence Berkeley Laboratory, reinforced by J.D. Jackson, has compiled a useful summary and bibliography of more than 500 key papers marking the development of particle physics from 1895 to the discovery of the top quark in 1995. Some 70 percent of the listed papers are post World War 2. The book is comprehensively indexed, including members of large collaborations and providing a useful benchmark. However actual entries confusingly use the first listed member of the collaboborations, even if a Nobel Prize was subsequently awarded to another member of the team.



  9. Annotated bibliography of literature relating to wind transport of plutonium-contaminated soils at the Nevada Test Site

    Lancaster, N.; Bamford, R.


    During the period from 1954 through 1963, a number of tests were conducted on the Nevada Test Site (NTS) and Tonopah Test Range (TTR) to determine the safety of nuclear devices with respect to storage, handling, transport, and accidents. These tests were referred to as ''safety shots.'' ''Safety'' in this context meant ''safety against fission reaction.'' The safety tests were comprised of chemical high explosive detonations with components of nuclear devices. The conduct of these tests resulted in the dispersion of plutonium, and some americium over areas ranging from several tens to several hundreds of hectares. Of the various locations used for safety tests, the site referred to as ''Plutonium Valley'' was subject to a significant amount of plutonium contamination. Plutonium Valley is located in Area 11 on the eastern boundary of the NTS at an elevation of about 1036 m (3400 ft). Plutonium Valley was the location of four safety tests (A,B,C, and D) conducted during 1956. A major environmental, health, and safety concern is the potential for inhalation of Pu 239,240 by humans as a result of airborne dust containing Pu particles. Thus, the wind transport of Pu 239,240 particles has been the subject of considerable research. This annotated bibliography was created as a reference guide to assist in the better understanding of the environmental characteristics of Plutonium Valley, the safety tests performed there, the processes and variables involved with the wind transport of dust, and as an overview of proposed clean-up procedures

  10. Community emergency response to nuclear power plant accidents: A selected and partially annotated bibliography

    Youngen, G.


    The role of responding to emergencies at nuclear power plants is often considered the responsibility of the personnel onsite. This is true for most, if not all, of the incidents that may happen during the course of the plant's operating lifetime. There is however, the possibility of a major accident occurring at anytime. Major nuclear accidents at Chernobyl and Three Mile Island have taught their respective countries and communities a significant lesson in local emergency preparedness and response. Through these accidents, the rest of the world can also learn a great deal about planning, preparing and responding to the emergencies unique to nuclear power. This bibliography contains books, journal articles, conference papers and government reports on emergency response to nuclear power plant accidents. It does not contain citations for ''onsite'' response or planning, nor does it cover the areas of radiation releases from transportation accidents. The compiler has attempted to bring together a sampling of the world's collective written experience on dealing with nuclear reactor accidents on the sate, local and community levels. Since the accidents at Three Mile Island and Chernobyl, that written experience has grown enormously

  11. Community emergency response to nuclear power plant accidents: A selected and partially annotated bibliography

    Youngen, G.


    The role of responding to emergencies at nuclear power plants is often considered the responsibility of the personnel onsite. This is true for most, if not all, of the incidents that may happen during the course of the plant`s operating lifetime. There is however, the possibility of a major accident occurring at anytime. Major nuclear accidents at Chernobyl and Three Mile Island have taught their respective countries and communities a significant lesson in local emergency preparedness and response. Through these accidents, the rest of the world can also learn a great deal about planning, preparing and responding to the emergencies unique to nuclear power. This bibliography contains books, journal articles, conference papers and government reports on emergency response to nuclear power plant accidents. It does not contain citations for ``onsite`` response or planning, nor does it cover the areas of radiation releases from transportation accidents. The compiler has attempted to bring together a sampling of the world`s collective written experience on dealing with nuclear reactor accidents on the sate, local and community levels. Since the accidents at Three Mile Island and Chernobyl, that written experience has grown enormously.

  12. Sand lance: A review of biology and predator relations and annotated bibliography

    Robards, Martin D.; Willson, Mary F.; Armstrong, Robert H.; Piatt, John F.


    Six species of sand lance (Ammodytes) in temperate and boreal regions are currently recognized. Sand lance can occupy a wide range of environmental conditions, but all appear to be dormant predominantly in winter, and one species is in summer also. They lack a swim bladder and spend much of their time buried in specific substrates. Copepods are the primary food. Spawning usually occurs in fall or winter (although some species also spawn in spring), eggs are demersal, and larvae may hatch at times of low food abundance. Sand lance usually occur in schools and are regarded as a relatively high-quality forage fish.Sand lance constitute a major prey for at least some populations of over 100 species of consumer, including 40 species of birds, 12 species of marine mammals, 45 species of fishes, and some invertebrates. Variation in the availability of sand lance (and other forage fishes) can have major effects on the breeding success and survival of their predators. Commercial fishing and other pressures on sand lance populations potentially have ramifying effects on many species of wildlife.The bibliography contains over 1,700 references on the family Ammodytidae, with an emphasis on the genus Ammodytes. Keywords are provided for each reference and have been further organized into taxonomic, geographic, subject, and predator indexes.

  13. Systematic reviews of complementary therapies – an annotated bibliography. Part 3: Homeopathy

    Linde, Klaus; Hondras, Maria; Vickers, Andrew; Riet, Gerben ter; Melchart, Dieter


    Background Complementary therapies are widespread but controversial. We aim to provide a comprehensive collection and a summary of systematic reviews of clinical trials in three major complementary therapies (acupuncture, herbal medicine, homeopathy). This article is dealing with homeopathy. Potentially relevant reviews were searched through the register of the Cochrane Complementary Medicine Field, the Cochrane Library, Medline, and bibliographies of articles and books. To be included articles had to review prospective clinical trials of homeopathy; had to describe review methods explicitly; had to be published; and had to focus on treatment effects. Information on conditions, interventions, methods, results and conclusions was extracted using a pretested form and summarized descriptively. Results Eighteen out of 22 potentially relevant reviews preselected in the screening process met the inclusion criteria. Six reviews addressed the question whether homeopathy is effective across conditions and interventions. The majority of available trials seem to report positive results but the evidence is not convincing. For isopathic nosodes for allergic conditions, oscillococcinum for influenza-like syndromes and galphimia for pollinosis the evidence is promising while in other areas reviewed the results are equivocal. Interpretation Reviews on homeopathy often address general questions. While the evidence is promising for some topics the findings of the available reviews are unlikely to end the controversy on this therapy. PMID:11527508

  14. Literature and History--A Focus on the Era of the Great Depression and World War II (1929-1945).

    Ahern, John; Sandmann, Alexa


    Provides an annotated bibliography and suggested teaching activities for units on the Great Depression and World War II. The materials support inquiry into the causes of the Great Depression and World War II and how these events transformed U.S. society. The annotated bibliography includes novels, memoirs, biographies, and political studies. (MJP)

  15. Urban Property Taxation: II. Land and Location. Exchange Bibliography 480.

    White, Anthony G.

    This is one of three related bibliographies listing publications dealing with the broad topic of property taxation. This particular volume concerns some specialized fields of study, including locational theory, land use and taxation, property markets and valuation, housing, and urban renewal and redevelopment. Citations are listed alphabetically…

  16. Hawaii Geothermal Project annotated bibliography: Biological resources of the geothermal subzones, the transmission corridors and the Puna District, Island of Hawaii

    Miller, S.E.; Burgett, J.M. [Fish and Wildlife Service, Honolulu, HI (United States). Pacific Islands Office


    Task 1 of the Hawaii Geothermal Project Interagency Agreement between the Fish and Wildlife Service and the Department of Energy-Oak Ridge National Laboratory (DOE) includes an annotated bibliography of published and unpublished documents that cover biological issues related to the lowland rain forest in Puna, adjacent areas, transmission corridors, and in the proposed Hawaii Geothermal Project (HGP). The 51 documents reviewed in this report cover the main body of biological information for these projects. The full table of contents and bibliography for each document is included along with two copies (as requested in the Interagency Agreement) of the biological sections of each document. The documents are reviewed in five main categories: (1) geothermal subzones (29 documents); (2) transmission cable routes (8 documents); (3) commercial satellite launching facility (Spaceport; 1 document); (4) manganese nodule processing facility (2 documents); (5) water resource development (1 document); and (6) ecosystem stability and introduced species (11 documents).

  17. Potential impacts of OCS oil and gas activities on fisheries. Volume 2. Annotated bibliography for OCS oil and gas impact studies. Final report

    Tear, L.M.


    The volume is the second of two volumes to the final report, Potential Impacts of OCS Oil and Gas Activities on Fisheries. The volume presents an annotated bibliography of published and grey literature related to OCS oil and gas activity impacts of finfish and shellfish in marine and estuaring waters. The studies presented in the bibliography include those related to the following pollutants or impact-causing activities: Rig/reef effects, Drilling discharges (muds or cuttings), Oil (petroleum hydrocarbons), Trace metals, Produced water, Habitat alteration, Debris, Rig placement (avoidance), Pipelines, and Socioeconomic effects. The studies are listed alphabetically by the primary author's last name. An index is provided to help the reader identify studies related to a specific impact

  18. Public regulation of site selection for nuclear power plants. Present procedures and reform proposals: an annotated bibliography

    Klema, E.D.; West, R.L.


    Part I of this bibliography contains literature which describes the process of power-plant siting as conducted by the utilities, siting procedures at the point of initiative, analytical tools employed or proposed for site assessment by enterprises in the industry, and the wide range of considerations which the utilities take into account in making site assessments. Part II contains studies and reports on the structure and process of public regulation of power plant siting: the licensing of nuclear facilities by the NRC under terms of the special Government powers in the field of nuclear energy that have evolved since World War II; the steady expansion of regulatory objectives bearing on site approval for nuclear power plants; local government, State, and other Federal agency regulation of siting; survey siting procedures in other countries; the role of regulatory delay in the long lead-time required for construction and operation of nuclear plants. Part III incudes citations on regulatory structure and practice that are unresponsive to the public interest; regulatory decision making's insufficient accessible to public scrutiny and participation; and regulatory procedures that encourage and protect inefficient practices of the regulated industries. Some legal decisions and case studies are included. Part IV, Reform Proposals, includes citations on regulatory reform and reform of siting regulations. Abstracts are provided with 157 of the citations with many more papers cited by title, author, and accession data

  19. Information pertinent to the migration of radionuclides in ground water at the Nevada Test Site. Part 2: annotated bibliography

    Borg, I.Y.; Stone, R.; Levy, H.B.; Ramspott, L.D.


    Part 2 of UCRL-52078 consists of the bibliography and abstracts that were compiled in the course of searching the literature for information on the migration of radionuclides in groundwater at the Nevada Test Site. The bibliography also includes numerous references to work done at foreign nuclear centers or contracted to outside agencies by these same centers

  20. The Geology of Burma (Myanmar): An Annotated Bibliography of Burma’s Geology, Geography and Earth Science


    Eichornia-Crassipes; Ephydatia-Fluviatilis; Hydrilla; Imperata ; Inle; Intha; Shan; Utricularia. Abstract: cultural data on the people and a bibliography...characterized by dipterocarpus Bibliography of Burman Earth Science September 2008 71 tuberculatus and associated plants; the other by imperata . The

  1. Subsurface waste disposal by means of wells - A selective annotated bibliography

    Rima, Donald Robert; Chase, Edith B.; Myers, Beverly M.


    Subsurface waste disposal by means of wells is the practice of using drilled wells to inject unwanted substances into underground rock formations. The use of wells for this purpose is not a new idea. As long ago as the end of the last century, it was common practice to drill wells for the express purpose of draining swamps and small lakes to reclaim the land for agricultural purposes. A few decades later in the 1920's and 1930's many oil companies began using injection wells to dispose of oil-field brines and to repressurize oil reservoirs. During World War II, the Atomic Energy Commission began using injection wells to dispose of certain types of radioactive wastes. More recently, injection wells have been drilled to dispose of a variety of byproducts of industrial processes. The number of such wells has increased rapidly since Congress passed the Clean Streams Act of 1966, which restricted the discharge of waste into surface waters.Many scientists and public officials question the propriety of using the term "disposal" when referring to the underground injection of wastes. Their reasons are that underground injection is not, as many advocates claim, "a complete and final answer" to the waste-disposal problem. Rather, it is merely a process wherein the injected wastes are committed to the subsurface with uncertainty as to their ultimate fate or limits of confinement. In effect, the wastes, undiminished and unchanged, are removed from the custody of man and placed in the custody of nature.Although the concept of waste-injection wells is relatively simple, the effects of waste injection can be very complex, particularly when dealing with the exotic and complex components of some industrial wastes. Besides the physical forces of injection, there are many varied interactions between the injected wastes and the materials within the injection zone. Because these changes occur out of sight in the subsurface, they are difficult to assess and not generally understood. In

  2. Bibliographie


    1. Livres Actas del II Congreso Internacional sobre los Dominicos y el Nuevo Mundo, Salamanca, 28 de marzo-1 de abril de 1989, (ed. José Barrado), Salamanca, ed. San Esteban, 1990. Acosta Saignes, Miguel, Estudios de folklore venezolano, Caracas, Imprenta universitaria, Instituto de Antropología e Historia, 1962. Acosta Saignes, Miguel, Vida de los esclavos negros en Venezuela, Caracas, Hispérides ed, 1967. Aguirre Beltran, Gonzalo, Medicina y magia. El proceso de aculturación en la estructur...

  3. PR Bibliography, 1997.

    Walker, Albert, Ed.


    Based on searches of nearly 200 periodicals as well as publishers' flyers and brochures from 30 major publishing houses and university presses, this annotated bibliography presents a representative collection of books and journal articles related to the knowledge and practice of public relations published in 1996. The annotated bibliography is…

  4. PR Bibliography, 1993.

    Walker, Albert, Ed.


    Based on searches of over 200 periodicals, this annotated bibliography of books and journal articles presents material related to the knowledge and practice of public relations published in 1992. The annotated bibliography is subdivided into more than 30 different categories ranging from business ethics to writing techniques. The largest…

  5. PR Bibliography, 1996.

    Walker, Albert, Ed.


    Based on searches of more than 100 periodicals as well as flyers and brochures from 24 major publishing houses and university presses, this annotated bibliography presents a representative collection of books and journal articles (published in 1995) related to the knowledge and practice of public relations. The annotated bibliography is divided…

  6. Gulf Coast geopressured-geothermal program summary report compilation. Volume 4: Bibliography (annotated only for all major reports)

    John, C.J.; Maciasz, G.; Harder, B.J.


    This bibliography contains US Department of Energy sponsored Geopressured-Geothermal reports published after 1984. Reports published prior to 1984 are documented in the Geopressured Geothermal bibliography Volumes 1, 2, and 3 that the Center for Energy Studies at the University of Texas at Austin compiled in May 1985. It represents reports, papers and articles covering topics from the scientific and technical aspects of geopressured geothermal reservoirs to the social, environmental, and legal considerations of exploiting those reservoirs for their energy resources.

  7. An Annotated Bibliography of the Literature Dealing with the Impact of Divorce upon the Academic Performance, Emotional Adjustment, Self-Concept, and Behavioral Changes of Children of Divorce and the Diagnosis of and Strategies for Alleviating Negative Symptoms of Divorce.

    Barrington, Diane M.

    Annotated citations in this bibliography are divided into two sections: (1) statistical studies concerning the impact of divorce on students, and (2) diagnostic studies and suggested strategies for dealing with the issue of marital separation and divorce and their effects in the classroom. A glossary of terms, a summary of findings, conclusions,…

  8. Conservation Reserve Program (CRP) contributions to wildlife habitat, management issues, challenges and policy choices--an annotated bibliography

    Allen, Arthur W.; Vandever, Mark W.


    The following bibliography presents brief summaries of documents relevant to Conservation Reserve Program relations to wildlife habitat, habitat management in agriculturally dominated landscapes, and conservation policies potentially affecting wildlife habitats in agricultural ecosystems. Because the literature summaries furnished provide only sweeping overviews, users are urged to obtain and evaluate those papers appearing useful to obtain a more complete understanding of study findings and their implications to conservation in agricultural ecosystems. The bibliography contains references to reports that reach beyond topics that directly relate to the Conservation Reserve Program. Sections addressing grassland management and landowner surveys/opinions, for example, furnish information useful for enhancing development and administration of conservation policies affecting lands beyond those enrolled in conservation programs. Some sections of the bibliography (for example, agricultural conservation policy, economics, soils) are far from inclusive of all relevant material written on the subject. Hopefully, these sections will serve as fundamental introductions to related issues. In a few instances, references may be presented in more than one section of the bibliography. For example, individual papers specifically addressing both non-game and game birds are included in respective sections of the bibliography. Duplication of citations and associated notes has, however, been kept to a minimum.

  9. Radioactive waste isolation in salt: geochemistry of brine in rock salt in temperature gradients and gamma-radiation fields - a selective annotated bibliography

    Hull, A.B.; Williams, L.B.


    Evaluation of the extensive research concerning brine geochemistry and transport is critically important to successful exploitation of a salt formation for isolating high-level radioactive waste. This annotated bibliography has been compiled from documents considered to provide classic background material on the interactions between brine and rock salt, as well as the most important results from more recent research. Each summary elucidates the information or data most pertinent to situations encountered in siting, constructing, and operating a mined repository in salt for high-level radioactive waste. The research topics covered include the basic geology, depositional environment, mineralogy, and structure of evaporite and domal salts, as well as fluid inclusions, brine chemistry, thermal and gamma-radiation effects, radionuclide migration, and thermodynamic properties of salts and brines. 4 figs., 6 tabs

  10. Radioactive waste isolation in salt: geochemistry of brine in rock salt in temperature gradients and gamma-radiation fields - a selective annotated bibliography

    Hull, A.B.; Williams, L.B.


    Evaluation of the extensive research concerning brine geochemistry and transport is critically important to successful exploitation of a salt formation for isolating high-level radioactive waste. This annotated bibliography has been compiled from documents considered to provide classic background material on the interactions between brine and rock salt, as well as the most important results from more recent research. Each summary elucidates the information or data most pertinent to situations encountered in siting, constructing, and operating a mined repository in salt for high-level radioactive waste. The research topics covered include the basic geology, depositional environment, mineralogy, and structure of evaporite and domal salts, as well as fluid inclusions, brine chemistry, thermal and gamma-radiation effects, radionuclide migration, and thermodynamic properties of salts and brines. 4 figs., 6 tabs.

  11. Articles on Mass Communication in U.S. and Foreign Journals: A Selected Annotated Bibliography--January, February, March 1979.

    McKerns, Joseph P.; Delahaye, Alfred N.


    Lists and annotates more than 200 articles on mass communication, grouped according to topic. Topics include advertising, broadcasting, courts and law, government and media, history and biography, international, management, public relations, and visual communication. (GT)

  12. Articles on Mass Communication in U.S. and Foreign Journals: A Selected Annotated Bibliography--October, November, December 1979.

    McKerns, Joseph P.; Delahaye, Alfred N.


    Lists and annotates more than 200 articles on mass communication, grouped according to topic. Topics include advertising, broadcasting, courts and law, criticism and defense of media, history and biography, international, public relations, visual communication, and women and media. (GT)

  13. Articles on Mass Communication in U.S. and Foreign Journals: A Selected Annotated Bibliography--April, May, June 1979.

    McKerns, Joseph P.; Delahaye, Alfred N.


    Lists and annotates 200 articles on mass communication, grouped according to topic. Topics include advertising, audience and communicator analysis, broadcasting, courts and law, education for journalism, government and media, international, management, public relations, and visual communication. (GT)

  14. Articles on Mass Communication in U.S. and Foreign Journals: A Selected Annotated Bibliography--July, August, September 1979.

    Delahaye, Alfred N.; McKerns, Joseph P.


    Lists and annotates more than 200 articles on mass communication, grouped according to topic. Topics include advertising, broadcasting, courts and law, journalism education, history and biography, international, public relations, visual communication, and women and media. (GT)

  15. Articles on Mass Communication in U.S. and Foreign Journals: A Selected Annotated Bibliography--October, November, December 1978.

    McKerns, Joseph P.; Delahaye, Alfred N.


    Lists and annotates more than 200 articles on mass communication, grouped according to topic. Topics include advertising, broadcasting, courts and law, education for journalism, international, management, public relations, and visual communications. (GT)

  16. Gifted Gay, Lesbian, Bisexual, and Transgender Annotated Bibliography: A Resource for Educators of Gifted Secondary GLBT Students

    Treat, Alena R.; Whittenburg, Becky


    This bibliography makes available to educators and others a comprehensive resource for information regarding gifted youth who are gay, lesbian, bisexual, transgender or questioning their sexual orientation and/or gender identity (G/GLBTQ). It includes articles, brochures, books, lesson plans, staff development, video media, and Web resources. As…

  17. Annotated bibliography of safety-related occurrences in pressurized-water nuclear power plants as reported in 1975

    Scott, R.L.; Gallaher, R.B.


    The bibliography presented contains 100-word abstracts of reports to the U.S. Nuclear Regulatory Commission concerning operational events that occurred at pressurized-water reactor nuclear power plants in 1975. The report includes 1097 abstracts, arranged alphabetically by reactor name and then chronologically for each reactor, that describe incidents, failures, and design or construction deficiencies experienced at the facilities. Key-word and permuted-title indexes are provided to facilitate location of the subjects of interest, and tables summarizing the information contained in the bibliography are presented. The information listed in the tables includes instrument failures, equipment failures, system failures, causes of failures, deficiencies noted, and the time of occurrence (i.e., during refueling, operation, testing, or construction). A few of the unique events that occurred during the year are reviewed in detail

  18. Annotated bibliography of safety-related occurrences in boiling-water nuclear power plants as reported in 1976

    Scott, R.L.; Gallaher, R.B.


    This bibliography contains 100-word abstracts of reports to the U.S. Nuclear Regulatory Commission concerning operational events that occurred at boiling-water reactor nuclear power plants in 1976. The report includes 1,253 abstracts that describe incidents, failures, and design or construction deficiencies that were experienced at the facilities. They are arranged alphabetically by reactor name and then chronologically for each reactor. Key-word and permuted-title indexes are provided to facilitate location of the subjects of interest, and tables that summarize the information contained in the bibliography are provided. The information listed in the tables includes instrument failures, equipment failures, system failures, causes of failures, deficiencies noted, and the time of occurrence (i.e., during refueling, operation, testing, or construction). Three of the unique events that occurred during the year are reviewed in detail

  19. Annotated bibliography of safety-related occurrences in pressurized-water nuclear power plants as reported in 1976

    Scott, R.L.; Gallaher, R.B.


    The bibliography contains 100-word abstracts of reports to the U.S. Nuclear Regulatory Commission concerning operational events that occurred at pressurized-water reactor nuclear power plants in 1976. Included are 1264 abstracts that describe incidents, failures, and design construction deficiencies experienced at the facilities. They are arranged alphabetically by reactor name and then chronologically for each reactor. Key-word and permuted-title indexes are provided to facilitate location of the subjects of interest, and tables summarizing the information contained in the bibliography are presented. The information listed in the tables includes instrument failures, equipment failures, system failures, causes of failures, deficiencies noted, and the time of occurrence (i.e., during refueling, operation, testing, or construction). A few of the unique events that occurred during the year are reviewed in detail

  20. Annotated bibliography of safety-related occurrences in boiling-water nuclear power plants as reported in 1976

    Scott, R.L.; Gallaher, R.B.


    This bibliography contains 100-word abstracts of reports to the U.S. Nuclear Regulatory Commission concerning operational events that occurred at boiling-water reactor nuclear power plants in 1976. The report includes 1,253 abstracts that describe incidents, failures, and design or construction deficiencies that were experienced at the facilities. They are arranged alphabetically by reactor name and then chronologically for each reactor. Key-word and permuted-title indexes are provided to facilitate location of the subjects of interest, and tables that summarize the information contained in the bibliography are provided. The information listed in the tables includes instrument failures, equipment failures, system failures, causes of failures, deficiencies noted, and the time of occurrence (i.e., during refueling, operation, testing, or construction). Three of the unique events that occurred during the year are reviewed in detail.

  1. Annotated bibliography of safety-related occurrences in pressurized-water nuclear power plants as reported in 1976

    Scott, R.L.; Gallaher, R.B.


    The bibliography contains 100-word abstracts of reports to the U.S. Nuclear Regulatory Commission concerning operational events that occurred at pressurized-water reactor nuclear power plants in 1976. Included are 1264 abstracts that describe incidents, failures, and design construction deficiencies experienced at the facilities. They are arranged alphabetically by reactor name and then chronologically for each reactor. Key-word and permuted-title indexes are provided to facilitate location of the subjects of interest, and tables summarizing the information contained in the bibliography are presented. The information listed in the tables includes instrument failures, equipment failures, system failures, causes of failures, deficiencies noted, and the time of occurrence (i.e., during refueling, operation, testing, or construction). A few of the unique events that occurred during the year are reviewed in detail.

  2. Annotated bibliography of safety-related occurrences in boiling-water nuclear power plants as reported in 1975

    Scott, R.L.; Gallaher, R.B.


    The bibliography presented contains 100-word abstracts of reports to the U.S. Nuclear Regulatory Commission concerning operational events that occurred at boiling-water reactor nuclear power plants in 1975. The report includes 1169 abstracts, arranged alphabetically by reactor name and then chronologically for each reactor, that describe incidents, failures, and design or construction deficiencies that were experienced at the facilities. Key-word and permuted-title indexes are provided to facilitate location of the subjects of interest, and tables that summarize the information contained in the bibliography are provided. The information listed in the tables includes instrument failures, equipment failures, system failures, causes of failures, deficiencies noted, and the time of occurrence (i.e., during refueling, operation, testing, or construction). Seven of the unique events that occurred during the year are reviewed in detail.

  3. Annotated bibliography of safety-related occurrences in pressurized-water nuclear power plants as reported in 1975

    Scott, R.L.; Gallaher, R.B.


    The bibliography presented contains 100-word abstracts of reports to the U.S. Nuclear Regulatory Commission concerning operational events that occurred at pressurized-water reactor nuclear power plants in 1975. The report includes 1097 abstracts, arranged alphabetically by reactor name and then chronologically for each reactor, that describe incidents, failures, and design or construction deficiencies experienced at the facilities. Key-word and permuted-title indexes are provided to facilitate location of the subjects of interest, and tables summarizing the information contained in the bibliography are presented. The information listed in the tables includes instrument failures, equipment failures, system failures, causes of failures, deficiencies noted, and the time of occurrence (i.e., during refueling, operation, testing, or construction). A few of the unique events that occurred during the year are reviewed in detail.

  4. Annotated bibliography of safety-related occurrences in boiling-water nuclear power plants as reported in 1975

    Scott, R.L.; Gallaher, R.B.


    The bibliography presented contains 100-word abstracts of reports to the U.S. Nuclear Regulatory Commission concerning operational events that occurred at boiling-water reactor nuclear power plants in 1975. The report includes 1169 abstracts, arranged alphabetically by reactor name and then chronologically for each reactor, that describe incidents, failures, and design or construction deficiencies that were experienced at the facilities. Key-word and permuted-title indexes are provided to facilitate location of the subjects of interest, and tables that summarize the information contained in the bibliography are provided. The information listed in the tables includes instrument failures, equipment failures, system failures, causes of failures, deficiencies noted, and the time of occurrence (i.e., during refueling, operation, testing, or construction). Seven of the unique events that occurred during the year are reviewed in detail

  5. Occupational dose reduction at nuclear power plants: Annotated bibliography of selected readings in radiation protection and ALARA

    Baum, J.W.; Khan, T.A.


    This report is the third in a series of bibliographies supporting the efforts at Brookhaven National Laboratory on dose reduction at nuclear power plants. Abstracts for this report were selected from papers presented at recent technical meetings, journals and research reports reviewed at the BNL ALARA Center, and searches of the DOE/RECON data base on energy-related publications. The references selected for inclusion in the bibliography relate not only to operational health physics topics but also to plant chemistry, stress corrosion cracking, and other aspects of plant operation which have important impacts on occupational exposure. Also included are references to improved design, planning, materials selection and other topics related to what might be called ALARA engineering. Thus, an attempt has been made to cover a broad spectrum of topics related directly or indirectly to occupational exposure reduction. The report contains 252 abstracts and both author and subject indices

  6. Articles on Mass Communication in U.S. and Foreign Journals: A Selected Annotated Bibliography--January, February, March 1980.

    McKerns, Joseph P.; Delahaye, Alfred N.


    Lists and annotates more than 250 articles on mass communication, grouped according to topic. Topics include advertising, audience and communicator analysis, broadcasting, community journalism, courts and law, criticism and defense of media, education for journalism, history and biography, international, management, public relations, visual…

  7. Annotated Bibliography of Publications on Watershed Management and Ecological Studies at Coweeta Hydrologic Laboratory, 1934,1984

    Julia W. Gaskin; James E. Douglass; Wayne T. Swank; [Compilers


    A collection of 470 citations and annotations for papers published by scientists associated with theCoweeta Hydrologic Laboratory. Major categories in a subject index include watershed management, hydrometeorology, plant-water relationships, soil relationships, stream-flow relationships, ground water, stream ecology, and terrestrial ecology.

  8. World War II Homefront.

    Garcia, Rachel


    Presents an annotated bibliography that provides Web sites focusing on the U.S. homefront during World War II. Covers various topics such as the homefront, Japanese Americans, women during World War II, posters, and African Americans. Includes lesson plan sources and a list of additional resources. (CMK)

  9. Geological and geochemical aspects of uranium deposits: a selected, annotated bibliography. Vol. 2, Rev. 1. [490 references

    Thomas, J.M.; Brock, M.L.; Garland, P.A.; White, M.B.; Daniel, E.W. (comps.)


    This bibliography, a compilation of 490 references, is the second in a series compiled from the National Uranium Resource Evaluation (NURE) Bibliographic Data Base. This data base is one of six data bases created by the Ecological Sciences Information Center, Oak Ridge National Laboratory, for the Grand Junction Office of the Department of Energy. Major emphasis for this volume has been placed on uranium geology, encompassing deposition, genesis of ore deposits, and ore controls; and prospecting techniques, including geochemistry and aerial reconnaissance. The following indexes are provided to aid the user in locating references of interest: author, geographic location, quadrangle name, geoformational feature, taxonomic name, and keyword.

  10. Bibliography [On Drugs].

    National Association of Student Personnel Administrators, Detroit, MI.

    A bibliography of materials on drugs is presented. The book and paper back entries are annotated. Selected technical references are listed under these major findings: (1) dependency, (2) barbiturates, (3) amphetamines, and (4) general pharmacology. (PS)

  11. Occupational dose reduction at nuclear power plants: Annotated bibliography of selected readings in radiation protection and ALARA. Volume 8

    Sullivan, S.G.; Khan, T.A.; Xie, J.W. [Brookhaven National Lab., Upton, NY (United States)


    The ALARA Center at Brookhaven National Laboratory publishes a series of bibliographies of selected readings in radiation protection and ALARA in a continuing effort to collect and disseminate information on radiation dose reduction at nuclear power plants. This volume 8 of the series. The abstracts in this bibliography were selected form proceedings of technical meetings and conference journals, research reports, and searches of the Energy Science and Technology database of the US Department of Energy. The subject material of these abstracts relates to the many aspects of radiation protection and dose reduction, and ranges form use of robotics, to operational health physics, to water chemistry. Material on the design, planning, and management of nuclear power stations is included, as well as information on decommissioning and safe storage efforts. Volume 8 contains 232 abstracts, an author index, and a subject index. The author index is specific for this volume. The subject index is cumulative and lists all abstract numbers from volumes 1 to 8. The numbers in boldface indicate the abstracts in this volume; the numbers not in boldface represent abstracts in previous volumes.

  12. Annotated bibliography of the geology of the Columbia Plateau (Columbia River Basalt) and adjacent areas of Oregon

    Bela, J.


    This bibliography containing approximately 2000 entries was prepared by the Oregon Department of Geology and Mineral Industries under Subcontract SA-913 with Rockwell Hanford Operations' Basalt Waste Isolation Program. The objective of the Basalt Waste Isolation Program is to determine the feasibility of storing nuclear waste within the Columbia River Basalt Group. Under the geologic portion of this program, the stratigraphic, structural, tectonic, seismic, and hydrologic aspects of the Columbia Plateau are being examined. Other aspects of the Basalt Waste Isolation Program are concerned with systems integration, engineered barriers, engineering testing, and construction of a near-surface test facility. The area covered in this bibliography comprises that area north of 43 0 30' latitude and east of the Willamette Meridian, which is located just west of Portland. The bibliographic entries are presented in two forms. The first is an alphabetized listing of all articles dealing with the geology of the Columbia Plateau (Columbia River Basalt) and adjacent areas of Oregon. The second form consists of an alphabetized listing of the entries subdivided under fourteen categories

  13. Occupational dose reduction at nuclear power plants: Annotated bibliography of selected readings in radiation protection and ALARA

    Kaurin, D.G.; Khan, T.A.; Sullivan, S.G.; Baum, J.W.


    The ALARA Center at Brookhaven National Laboratory publishes a series of bibliographies of selected readings in radiation protection and ALARA in the continuing effort to collect and disseminate information on radiation dose reduction at nuclear power plants. This is volume 7 of the series. The abstracts in this bibliography were selected from proceedings of technical meetings and conferences, journals, research reports, and searches of the Energy Science and Technology database of the US Department of Energy. The subject material of these abstracts relates to radiation protection and dose reduction, and ranges from use of robotics to operational health physics, to water chemistry. Material on the design, planning, and management of nuclear power stations is included, as well as information on decommissioning and safe storage efforts. Volume 7 contains 293 abstract, an author index, and a subject index. The author index is specific for this volume. The subject index is cumulative and lists all abstract numbers from volumes 1 to 7. The numbers in boldface indicate the abstracts in this volume; the numbers not in boldface represent abstracts in previous volumes

  14. Occupational dose reduction at nuclear power plants: Annotated bibliography of selected readings in radiation protection and ALARA. Volume 7

    Kaurin, D.G.; Khan, T.A.; Sullivan, S.G.; Baum, J.W. [Brookhaven National Lab., Upton, NY (United States)


    The ALARA Center at Brookhaven National Laboratory publishes a series of bibliographies of selected readings in radiation protection and ALARA in the continuing effort to collect and disseminate information on radiation dose reduction at nuclear power plants. This is volume 7 of the series. The abstracts in this bibliography were selected from proceedings of technical meetings and conferences, journals, research reports, and searches of the Energy Science and Technology database of the US Department of Energy. The subject material of these abstracts relates to radiation protection and dose reduction, and ranges from use of robotics to operational health physics, to water chemistry. Material on the design, planning, and management of nuclear power stations is included, as well as information on decommissioning and safe storage efforts. Volume 7 contains 293 abstract, an author index, and a subject index. The author index is specific for this volume. The subject index is cumulative and lists all abstract numbers from volumes 1 to 7. The numbers in boldface indicate the abstracts in this volume; the numbers not in boldface represent abstracts in previous volumes.

  15. Annotated bibliography for the design of waste packages for geologic disposal of spent fuel and high-level waste

    Wurm, K.J.; Miller, N.E.


    This bibliography identifies documents that are pertinent to the design of waste packages for geologic disposal of nuclear waste. The bibliography is divided into fourteen subject categories so that anyone wishing to review the subject of leaching, for example, can turn to the leaching section and review the abstracts of reports which are concerned primarily with leaching. Abstracts are also cross referenced according to secondary subject matter so that one can get a complete list of abstracts for any of the fourteen subject categories. All documents which by their title alone appear to deal with the design of waste packages for the geologic disposal of spent fuel or high-level waste were obtained and reviewed. Only those documents which truly appear to be of interest to a waste package designer were abstracted. The documents not abstracted are listed in a separate section. There was no beginning date for consideration of a document for review. About 1100 documents were reviewed and about 450 documents were abstracted

  16. Occupational dose reduction at nuclear power plants: Annotated bibliography of selected readings in radiation protection and ALARA. Volume 8

    Sullivan, S.G.; Khan, T.A.; Xie, J.W.


    The ALARA Center at Brookhaven National Laboratory publishes a series of bibliographies of selected readings in radiation protection and ALARA in a continuing effort to collect and disseminate information on radiation dose reduction at nuclear power plants. This volume 8 of the series. The abstracts in this bibliography were selected form proceedings of technical meetings and conference journals, research reports, and searches of the Energy Science and Technology database of the US Department of Energy. The subject material of these abstracts relates to the many aspects of radiation protection and dose reduction, and ranges form use of robotics, to operational health physics, to water chemistry. Material on the design, planning, and management of nuclear power stations is included, as well as information on decommissioning and safe storage efforts. Volume 8 contains 232 abstracts, an author index, and a subject index. The author index is specific for this volume. The subject index is cumulative and lists all abstract numbers from volumes 1 to 8. The numbers in boldface indicate the abstracts in this volume; the numbers not in boldface represent abstracts in previous volumes

  17. Occupational dose reduction at nuclear power plants: Annotated bibliography of selected readings in radiation protection and ALARA: Volume 4

    Khan, T.A.; Baum, J.W.


    This report is the fourth in the series of bibliographies supporting the efforts at the Brookhaven National Laboratory on dose reduction at nuclear power plants. Abstracts for this bibliography were selected from proceedings of technical meetings, journals, research reports and searches of the DOE's Energy Data Base. The abstracts included in this report to operational health physics as well as other subjects which have a bearing on dose reduction at nuclear power plants, such as stress corrosion, cracking, plant chemistry, use of robotics and remote devices, etc. Material on improved design, materials selection, planning and other topics which are related to dose reduction efforts are also included. The report contains 327 abstracts as well as subject and author indices. All information in the current volume is also available from the ALARA Center's bulletin board service which is accessible by personal computers with the help of a modem. The last section of the report explains the features of the bulletin board. The bulletin board will be kept up-to-date with new information and should be of help in keeping people current in the area of dose reduction

  18. Annotated bibliography of the geology of the Columbia Plateau (Columbia River Basalt) and adjacent areas of Oregon

    Bela, J.


    This bibliography containing approximately 2000 entries was prepared by the Oregon Department of Geology and Mineral Industries under Subcontract SA-913 with Rockwell Hanford Operations' Basalt Waste Isolation Program. The objective of the Basalt Waste Isolation Program is to determine the feasibility of storing nuclear waste within the Columbia River Basalt Group. Under the geologic portion of this program, the stratigraphic, structural, tectonic, seismic, and hydrologic aspects of the Columbia Plateau are being examined. Other aspects of the Basalt Waste Isolation Program are concerned with systems integration, engineered barriers, engineering testing, and construction of a near-surface test facility. The area covered in this bibliography comprises that area north of 43/sup 0/30' latitude and east of the Willamette Meridian, which is located just west of Portland. The bibliographic entries are presented in two forms. The first is an alphabetized listing of all articles dealing with the geology of the Columbia Plateau (Columbia River Basalt) and adjacent areas of Oregon. The second form consists of an alphabetized listing of the entries subdivided under fourteen categories. (RWR)

  19. Annotated bibliography of radioactive waste management publications at Pacific Northwest Laboratory, January 1978 through July 1982. [831 abstracts


    This bibliography lists publications (831 abstracts) from the Pacific Northwest Laboratory's Department of Energy sponsored research and development programs from January 1978 through July of 1982. The abstracts are grouped in subject categories, as shown in the table of contents. Entries in the subject index also facilitate access by subject, e.g., High-Level Radioactive Wastes. Three indexes, each preceded by a brief description, are provided: personal author, subject, and report number. Cited are research reports, journal articles, books, patents, theses, and conference papers. Excluded are technical progress reports. Since 1978 the Nuclear Waste Management Quarterly Progress Report has been published under the series number PNL-3000. Beginning in 1982, this publication has been issued semiannually, under the series number PNL-4250. This bibliography is the successor to two others, BNWL-2201 (covering the years 1965-1976) and PNL-4050 (1975-1978). It is intended to provide a useful reference to literature in waste management written or compiled by PNL staff.

  20. Potential impacts of OCS oil and gas activities on fisheries. Volume 1. Annotated bibliography and database descriptions for target-species distribution and abundance studies. Section 1, Part 2. Final report

    Tear, L.M.


    The purpose of the volume is to present an annotated bibliography of unpublished and grey literature related to the distribution and abundance of select species of finfish and shellfish along the coasts of the United States. The volume also includes descriptions of databases that contain information related to target species' distribution and abundance. An index is provided at the end of each section to help the reader locate studies or databases related to a particular species

  1. Potential impacts of OCS oil and gas activities on fisheries. Volume 1. Annotated bibliography and database descriptions for target species distribution and abundance studies. Section 1, Part 1. Final report

    Tear, L.M.


    The purpose of the volume is to present an annotated bibliography of unpublished and grey literature related to the distribution and abundance of select species of finfish and shellfish along the coasts of the United States. The volume also includes descriptions of databases that contain information related to target species' distribution and abundance. An index is provided at the end of each section to help the reader locate studies or databases related to a particular species

  2. PR Bibliography, 2001.

    Ramsey, Shirley, Ed.


    This annotated bibliography presents an overview of journal articles and books published in 2000 on public relations that can be helpful to teachers and students as well as to practitioners and managers. This bibliography is subdivided into 29 categories including campaigns; community relations; corporate image; education; employee relations;…

  3. PR Bibliography, 1998.

    Ramsey, Shirley, Ed.


    Encompassing both the practical and the scholarly, this annotated bibliography on public relations aims to provide a window into some of each of the offerings in academic and business journals, as well as in trade and professional journals published in 1997. The introduction notes that many entries in the bibliography deal with the Internet, the…

  4. PR Bibliography, 2002.

    Ramsey, Shirley, Ed.


    This annotated bibliography presents an overview of journal articles and books published in 2001 on public relations that can be helpful to teachers and students as well as to practitioners and managers. This bibliography is subdivided into 40 categories including campaigns; consumer relations; community relations; corporate social responsibility;…

  5. PR Bibliography, 1999.

    Ramsey, Shirley, Ed.


    This annotated bibliography presents an overview of journal articles and books on public relations that can be helpful to teachers and students as well as to practitioners and managers. New categories for this 1999 edition of the bibliography include Public Relations Theory, Feminist Issues in Public Relations, and Environmental Public Relations.…

  6. An Annotated Bibliography of Patents Related to Coastal Engineering. Volume II. 1971-1973. Appendix.


    implosive acoustic (,enerake Do Geophysique . Paris, Framn transmitter Filed July 31. 1970. Sir. No. S9.983 Claims priority. appicatioa Frame. Aug. i... Geophysique , Paris, France Filed Jan. 23, 1969, Ser. No. 793,41$ U.S. Cl. X.R. 116-137R; 3407; 340-17 Int. CL GOIv 1102 U.S. CL. 181--.5 H 7 Claims A

  7. Soil-characterization and soil-amendment use on coal surface mine lands: An annotated bibliography. Information Circular/1991

    Norland, M.R.; Veith, D.L.


    The U.S. Bureau of Mines Report on United States and Canadian Literature pertaining to soil characterization and the use of soil amendments as a part of the reclamation process of coal surface-mined lands contains 1,280 references. The references were published during the 1977 to 1988 period. Each reference is evaluated by keywords, providing the reader with a means of rapidly sorting through the references to locate those articles with the coal mining regions and subjects of interest. All references are annotated

  8. Bibliography of publications on Experimental Breeder Reactor No. II (ERB-II). 1955-July 1979

    Berg, D B [comp.


    This bibliography is divided into 15 broad areas, or categories, of interest. The same publication is listed in more than one category if its content applies to several areas of interest. Under each category, the publications are listed (1) by calendar year of publication and (2) then alphabetically by last name of the first author given. Publications that have no evident author (or compiler or editor) are listed alphabetically by title at the end of the listing for the calendar year in which they were published. Only open literature (that which can be obtained through libraries and other sources available to the public) are listed.

  9. Bibliography of publications on Experimental Breeder Reactor No. II (ERB-II). 1955-July 1979

    Berg, D.B.


    This bibliography is divided into 15 broad areas, or categories, of interest. The same publication is listed in more than one category if its content applies to several areas of interest. Under each category, the publications are listed (1) by calendar year of publication and (2) then alphabetically by last name of the first author given. Publications that have no evident author (or compiler or editor) are listed alphabetically by title at the end of the listing for the calendar year in which they were published. Only open literature (that which can be obtained through libraries and other sources available to the public) are listed

  10. Decontamination of metals by melt refining/slagging. An annotated bibliography: Update on stainless steel and steel

    Worchester, S.A.; Twidwell, L.G.; Paolini, D.J.; Weldon, T.A. [Montana Tech of the Univ., of Montana (United States); Mizia, R.E. [Lockheed Idaho Technologies Co., Idaho Falls, ID (United States)


    The following presentation is an update to a previous annotation, i.e., WINCO-1138. The literature search and annotated review covers all metals used in the nuclear industries but the emphasis of this update is directed toward work performed on mild steels. As the number of nuclear installations undergoing decontamination and decommissioning (D&D) increases, current radioactive waste storage space is consumed and establishment of new waste storage areas becomes increasingly difficult, the problem of handling and storing radioactive scrap metal (RSM) gains increasing importance in the DOE Environmental Restoration and Waste Management Program. To alleviate present and future waste problems, Lockheed Idaho Technologies Co (LITCO) is managing a program for the recycling of RSM for beneficial use within the DOE complex. As part of that effort, Montana Tech has been awarded a contract to help optimize melting and refining technology for the recycling of stainless steel RSM. The scope of the Montana Tech program includes a literature survey, a decontaminating slag design study, small wide melting studies to determine optimum slag compositions for removal of radioactive contaminant surrogates, analysis of preferred melting techniques, and coordination of large scale melting demonstrations (100--2,000 lbs) to be conducted at selected facilities. The program will support recycling and decontaminating stainless steel RSM for use in waste canisters for Idaho Waste Immobilization Facility densified high level waste and Pit 9/RWMC boxes. This report is the result of the literature search conducted to establish a basis for experimental melt/slag program development. The program plan will be jointly developed by Montana Tech and LITCO.

  11. Annotated bibliography on selected areas of coal mining research and development. Report prepared for the Committee on Science and Technology, US House of Representatives, Ninety-Sixth Congress, First Session by the Congressional Research Service, Library of Congress


    The Congressional Research Service has completed an annotated bibliography on coal mining research and development. Although the completion of the study was delayed in order to permit CRS analysts to search the libraries of Bituminous Coal, Research Inc., and the Bureau of Mines in the Pittsburgh area, current re-emphasis on the use of coal as an energy source indicates a sustained relevance. The bibliography presents key references to coal-mining R and D under six subject headings keyed to issues of central concern in coal production: (1) mine health and safety, (2) methane recovery, (3) 1-hour rescuer, (4) use of diesels underground, (5) coal preparation, and (6) manpower development in coal mining.

  12. Pulsed Power Bibliography. Volume 2. Annotated Bibliography.


    5-ten In doscrIed for erodocino recaglrple pt I La. dleniainna Late. In MMns s I g’,k Atit~ betl eon. I ai I0 ncCaimlce Iuse changed5 o C1-F.T:11!T...Pulsod Poiir Conference Proceedings. Piper o11-1 (1119761. Prialry ilt IEEE.: EPrFESI PEBanks o e n This reoor describes e procedure for designing

  13. Thermokarst and thaw-related landscape dynamics -- an annotated bibliography with an emphasis on potential effects on habitat and wildlife

    Jones, Benjamin M.; Amundson, Courtney L.; Koch, Joshua C.; Grosse, Guido


    , and heat and mass transfer processes. Typical Arctic thermokarst landforms include thermokarst lakes, collapsed pingos, sinkholes, and pits. Thermokarst is differentiated from thermal erosion, which refers to the erosion of the land surface by thermal and mechanical processes (Mackay, 1970; van Everdingen, 1998). Typical thermal erosional features include thermo-erosional gullies. Thermal abrasion is further differentiated from thermokarst and thermal erosion by association with the reworking of ocean, river, and lake bluffs (Are, 1988). Typical thermo-abrasion features include erosional niches at the base of bluffs. Thermal denudation is another distinct term that refers to the effect of incoming solar energy on the thaw of frozen slopes and permafrost bodies that subsequently become transported downhill by gravity (Shur and Osterkamp, 2007). Active layer detachment slides and thaw slumps are typical thermal denudation features. Shur and Osterkamp (2007) noted that these various transport processes may occur together with thermokarst or in instances that would not be considered thermokarst. This compilation of references regarding thermokarst and other thaw-related features is focused on the Arctic and the Subarctic. References were drawn from North America as well as Siberia. English-language literature mostly was targeted, with 167 references annotated in version 1.0; however, an additional 28 Russian-language references were taken from Shur and Osterkamp (2007) and are provided at the end of this document. This compilation may be missing key references and inevitably will become outdated soon after publication. We hope that this document, version 1.0, will serve as the foundation for a comprehensive compilation of thermokarst and permafrost-terrain stability references, and that it will be updated continually over the coming years.

  14. Information Hiding: an Annotated Bibliography

    Anderson, Ross


    ... so. These steganography, copyright marking, the study of covert channels in operating systems, low-probability of intercept communications, and the study of subliminal channels in digital signature schemes...

  15. Annotated Bibliography of Psychomotor Testing.


    of observation and comparison were administered four times in one week to 394 adolescent boys enrolled in a trade school. Observations and subjective...44 Time Production Test: 15 Torque Test: 48,49,64,65 Tremor: 2 U Underwater depth, effects of: 2,3,11 U.S. Employment Service Pegboard: 16 V Videogame

  16. Annotated Bibliography: Polymers in Concrete.


    Berka , L., "Determination of the Creeping and Relaxation Functions . from the Results of the Creeping and Relaxation Tests," RILE. Symposium on Synthetic...However, for both foamed glass and . Mearlcrete concretes the agreement between prediction and experiment is not too bad . The reason for the serious...chemical resistance of various concretes is in the following order: (good) PIAC > AC > WCC ( bad ). The aggressive chemical agents that attack markedly

  17. Information Hiding: an Annotated Bibliography

    1999-04-13 html>. [325] 063213, ‘A Multiversion Transaction Scheduler for Centralized Multilevel Se- MLS DBMS. The authors pro- pose getting around these problems by using multiversion schedulers. An abstract model is developed and shown to

  18. Annotated Bibliography on Relative Motion


    displace the sheave, and motive means operating the power ram. Preferably, the power run is subjected to i constant upward pneumatic force to provide...NCIEI- Report N- 1187 (Oct 1971). The theory is de\\ eloped for the swinging rmotion induced in a wire suspended load due to the hori7zontal motion of a

  19. Nuclear energy and public safety (Part II): a bibliography of technical resources

    Gabriel, M.R.


    Part 2 of the bibliography focuses on technical information of interest to those concerned with the operation of nuclear power plants and the subjects of safety and accidents. A subject index included after the bibliography provides a breakdown of the references into seven categories. There is also an author index. The material cited is available through the National Technical Information Service (NTIS) in Springfield, Virginia

  20. ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.1278 >orf19.1278; Contig19-10104; complement(13162...4..>132028); ; conserved hypothetical protein; truncated protein IQNNKCSGCNLKLDFPVIHFKCKHSFHQKCLSTNLIATSTESS

  1. ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.3361 >orf19.3361; Contig19-10173; 157397..>158185;... YAT2*; carnitine acetyltransferase; gene family | truncated protein MSTYRFQETLEKLPIPDLVQTCNAYLEALKPLQTEQEHE

  2. ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.7258 >orf19.7258; Contig19-2507; 88880..89851; DDI1*; response to DNA alkyl...ation; MQLTISLDHSGDIISVDVPDSLCLEDFKAYLSAETGLEASVQVLKFNGRELVGNATLSELQIHDNDLLQLSKKQVA

  3. ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.2370 >orf19.2370; Contig19-10147; complement(50671..52716); DSL1*; ER-to-golgi transport; MPSIEQQLEDQELYLKDIEQNINKTLSKINKTTLENDNDFRKQFEEIPQDSNTTESN

  4. ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Full Text Available ruitment factor; MAKTRSKSAATAAATSPKASPTAAKVTKNKVTKPSTASPSKTTKTKAVKKTTTKKATPKKEEEEKK... Ca19AnnotatedDec2004aaSeq orf19.124 >orf19.124; Contig19-10035; 67601..68698; CIC1*; protease substrate rec

  5. ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive


  6. ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.4711 >orf19.4711; Contig19-10212; complement(29836...7..>300616); ; acidic repetitive protein; truncated protein DRSDYNEEDNNDFTRKLNEIQSKESNHEDLAQSEVQEGQKDEPDSVNQ

  7. Selected Resources and Bibliography

    New Directions for Higher Education, 2011


    This chapter provides an annotated bibliography of resources pertaining to international branch campuses (IBCs). This collection of references has been selected to represent the breadth of emerging scholarship on cross-border higher education and is intended to provide further resources on a range of concerns surrounding cross-border higher…

  8. PR Bibliography, 2000.

    Hiebert, Ray E., Ed.


    This annotated bibliography presents an overview of journal articles and books on public relations that can be helpful to teachers and students as well as to practitioners and managers. Categories for this 2000 edition correspond to knowledge needed by public relations undergraduate majors, as determined in a study conducted by the 1999 Commission…

  9. The Development of Stereotype-Free Teaching Materials for the K-12 Levels. A Selected and Annotated List of Bibliographies on Latin American Studies for Teachers K-12.

    Woods, Richard D.

    This document contains suggestions and materials for developing stereotype-free teaching materials. The paper is divided into five parts: (1) introduction, (2) bibliographies, (3) proverbs, (4) Spanish names, and (5) Spanish loan words. The introduction outlines 17 suggestions for developing units on cultural enrichment. Multiple resources for…

  10. ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.6649; Contig19-10251; complement(36800..38461); BR...87398.1| ... TFIIB related subunit of TFIIIB (BRF1) [Candida ... albicans] pir||B55483 transcr...L Transcription factor IIIB 70 kDa ... subunit (TFIIIB) (B-related factor)

  11. ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.710 >orf19.710; Contig19-10065; complement(47186.....>47710); LSC2*; succinate-CoA ligase beta subunit; truncated protein | overlap LGFDDNASFRQEEVFSWRDPTQEDPQEAE

  12. ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.2029; Contig19-10139; 79190..80278; RFC5*; DNA replicationn factor C | strand elongation mismatch repair ... (ATPase); >1a5t0 2 329 7 339 1e-22 ... gb|EAL00

  13. What's New in Children's Literature for the Children of Louisiana? A Selected Annotated Bibliography with Readability Levels (Selected) and Associated Louisiana Content Standards

    Webre, Elizabeth C.


    An annotated list of children's books published within the last 15 years and related to Louisiana culture, environment, and economics are linked to the Louisiana Content Standards. Readability levels of selected books are included, providing guidance as to whether a book is appropriate for independent student use. The thirty-three books listed are…

  14. ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Full Text Available chizosaccharomyces pombe] ref|NP_594201.1| spindle poison ... sensitivity related protein. [Schizosac...charomyces pombe] ... pir||T11624 spindle poison sensitivity protein - fis...inger protein | spindle poison sensitivity related protein; >1rgoA 8 70 40 92 2e-04 ... emb|CAB16391.1| scp3 [S... Ca19AnnotatedDec2004aaSeq orf19.7385; Contig19-2513; 105328..106833; LEE1*; zinc f

  15. Alcohol fuels bibliography, 1901-March 1980


    This annotated bibliography is subdivided by subjects, as follows: general; feedstocks-general; feedstocks-sugar; feedstocks-starch; feedstocks-cellulose crops and residues; production; coproducts; economics; use as vehicle fuel; government policies; and environmental effects and safety. (MHR)

  16. A Bibliography for the Study of Magazines.

    Schacht, J. H.

    This annotated bibliography contains a list of readings compiled for a course in magazine editing at the University of Illinois. This bibliography includes materials on the history of magazines, advertising in magazines, readership and audience studies, analyses of magazine content, information on magazine circulation, editorial research and its…

  17. Bibliography on augmentation of convective heat and mass transfer-II

    Bergles, A.E.; Nirmalan, V.; Junkhan, G.H.; Webb, R.L.


    Heat transfer augmentation has developed into a major specialty area in heat transfer research and development. This report presents and updated bibliography of world literature on augmentation. The literature is classified into passive augmentation techniques, which require no external power, and active techniques, which do require external power. The fifteen techniques are grouped in terms of their applications to the various modes of heat transfer. Mass transfer is included for completeness. Key words are included with each citation for technique/mode identification. The total number of publications cited is 3045, including 135 surveys of various techniques and 86 papers on performance evaluation of passive techniques. Patents are not included, as they are the subject of a separate bibliographic report.

  18. Marketing Nature-Oriented Tourism or Rural Development and Wildlands Management in Developing Countries: A Bibliography

    C. Denise Ingram; Patrick B. Durst


    Annotated bibliography that specifically links tourism marketing and wildlands management. The bibliography is divided into five sections: Information Sources, Wildlands Management, Planning and Development, Tourism Impacts, Marketing and Promotion.Indexed by author and geographical location.

  19. The cicadas (Hemiptera: Cicadidae) of India, Bangladesh, Bhutan, Myanmar, Nepal and Sri Lanka: an annotated provisional catalogue, regional checklist and bibliography.

    Price, Benjamin Wills; Allan, Elizabeth Louise; Marathe, Kiran; Sarkar, Vivek; Simon, Chris; Kunte, Krushnamegh


    The cicadas of the Indian subcontinent, like many other insects in the region, have remained understudied since the early part of the 20th Century, and await modern taxonomic, systematic and phylogenetic treatment. This paper presents an updated systematic catalogue of cicadas (Hemiptera: Cicadidae) from India, Bangladesh, Bhutan, Myanmar, Nepal and Sri Lanka, the first in over a century. This paper treats 281 species, including: India and Bangladesh (189 species), Bhutan (19 species), Myanmar (81 species), Nepal (46 species) and Sri Lanka (22 species). For each species all recognized junior synonyms are included with information on the type material and additional specimens where relevant. The global distributional range and notes on the taxonomy of each species are included where appropriate. Two lists are provided: (1) species known to occur in India and Bangladesh (treated as a geographic unit), Bhutan, Myanmar, Nepal and Sri Lanka; and (2) species previously listed from these countries in error. A bibliography of species descriptions is provided, with the papers containing the original descriptions provided where copyright allows.

  20. Bibliografia comentada sobre a assistência ao parto no Brasil (1972-2002 An annotated bibliography on childbirth in Brazil (1972-2002

    Maria Lucia Mott


    Full Text Available A organização desta bibliografia teve por objetivos: 1 divulgar trabalhos sobre a assistência ao parto no Brasil, produzidos em diferentes áreas de conhecimento (história, antropologia, enfermagem, medicina, assistência social, psicologia e sociologia; 2 colocar em contacto pesquisadores que trabalham o tema; 3 dar espaço para assuntos, abordagens e autores não contemplados no dossiê. Foram referenciados e resumidos 77 trabalhos (artigos, dissertações, teses, relatórios, cartilha, produzidos por cerca de 50 autores, publicados ou realizados entre 1972 e 2002.The organization of this bibliography aimed at 1 publishing studies on birth assistency in Brazil, produced in different fields of knowledge (history, anthropology, nursing, medicine, social assistance, psychology, and sociology, 2 bringing researchers - on the into contact and 3 opening space for subjects, approaches and authors not included in the Dossier. The list references and summarizes 76 works (papers, theses, dissertations, reports, primers by about 50 authors, published or produced between 1972 and 2002.

  1. Artificial Intelligence: A Selected Bibliography.

    Smith, Linda C., Comp.


    This 19-item annotated bibliography introducing the literature of artificial intelligence (AI) is arranged by type of material--handbook, books (general interest, textbooks, collected readings), journals and newsletters, and conferences and workshops. The availability of technical reports from AI laboratories at universities and private companies…

  2. Emergency Health Services Selected Bibliography.

    Health Services and Mental Health Administration (DHEW), Bethesda, MD.

    This annotated bibliography contains books, journal articles, visual aids, and other documents pertaining to emergency health care, which are organized according to: (1) publications dealing with day-to-day health emergencies that occur at home, work, and play, (2) documents that will help communities prepare for emergencies, including natural…


    Children's Bureau (DHEW), Washington, DC.


  4. Children and Advertising: A Bibliography.

    Council of Better Business Bureaus, Inc., New York, NY. Clearinghouse for Research on Children's Advertising.

    More than 600 entries are contained in this annotated bibliography of materials concerning the effects of television advertising on children. Entries are alphabetized by author and are divided into the following categories: special interest articles; general interest articles; books and pamphlets; government publications; transcripts of oral…

  5. A Select Bibliography of Books on Labor Issues.

    American Federation of Labor and Congress of Industrial Organizations, Washington, DC.

    This annotated bibliography of 90 books on labor issues presents selections in the following areas: labor history, biographies, contemporary issues, labor economics and labor relations, labor law, labor unions, women and work, and reference books. (DB)

  6. Bibliography on the stochastic processes in plasma and related problems

    Polovin, R.V.


    Stochastic processes in plasma and related matters. The bibliography contains 500 references and was compiled from the open literature only. Some references are annotated or completed with short abstracts. There are subject and authors indexes

  7. Nuclear materials safeguards. Volume II. 1975--March 1976 (a bibliography with abstracts). Report for 1975--Mar 1976

    Grooms, D.W.


    Citations cover the methods of safeguarding nuclear materials through effective management, accountability, nondestructive assays, instrumentation, and automated continuous inventory systems. Problem areas and recommendations for improving the management of nuclear materials are included. (Contains 88 abstracts) See also NTIS/PS-76/0200, Nuclear Materials Safeguards. Vol. 1. 1964-1974 (A title bibliography)

  8. Southern California Coastal Processes Annotated Bibliography.


    05/01/71 TITLE : Avalon Transportation Wharf CITATION : Journal of Waterways, Harbors and Coastal Engineering Division, ASCE, N. Y., Vol. 97, No. WW2 ...105, No. WW2 ; ASCE, N. Y., pp. 131-147 DESCRIPTION s Effect of various offshore structures as significant barriers to normal wave progress...California, 33 pp. DESCRIPTION Infrared satellite images are shown for each of two areas near +- the California coast, Cape Mendocino and Point

  9. An Annotated Bibliography on Second Language Acquisition


    In a study of third graders (Spanish- English), students were interviewed by a monolingual English- speaker and an English-dominant Hispanic...phonological measures with the monolingual interviewer. it was interpreted that there was greater accuracy with the Hispanic interviewer, and greater risk... dictionary containing all the difficult words plus distractors were provided, 3. a short lesson on how to inference was given, and 9 4. no cue was

  10. Water Data Report: An Annotated Bibliography

    Dunham Whitehead, Camilla; Melody, Moya


    This report and its accompanying Microsoft Excel workbooksummarize water data we found to support efforts of the EnvironmentalProtection Agency s WaterSense program. WaterSense aims to extend theoperating life of water and wastewater treatment facilities and prolongthe availability of water resourcesby reducing residential andcommercial water consumption through the voluntary replacement ofinefficient water-using products with more efficient ones. WaterSense hasan immediate need for water consumption data categorized by sector and,for the residential sector, per capita data available by region. Thisinformation will assist policy makers, water and wastewater utilityplanners, and others in defining and refining program possibilities.Future data needs concern water supply, wastewater flow volumes, waterquality, and watersheds. This report focuses primarily on the immediateneed for data regarding water consumption and product end-use. We found avariety of data on water consumption at the national, state, andmunicipal levels. We also found several databases related towater-consuming products. Most of the data are available in electronicform on the Web pages of the data-collecting organizations. In addition,we found national, state, and local data on water supply, wastewater,water quality, and watersheds.

  11. Situation Awareness: Papers and Annotated Bibliography


    training, twelve college- aged subjects flew three sessions (two or three blocks per session, six flights per block) of simulated air-to-ground attacks...either substantively discusses the potential usefulness of phisiological measures of SA or reviews an evaluation that used physiological measures to

  12. Service Quality Management Systems: An Annotated Bibliography


    customers, Fortune, 122, 38-48. Key words: Consumer preferences , customer expectations Abstract: Rice presents a profile of the 1990 U.S. process, 16 competitive advantage, 6, 10 consumer, 5 consumer affairs department, 19 consumer preferences , 30 consumer research, 10,24

  13. Measures of effectiveness:an annotated bibliography.

    Campbell, Philip LaRoche


    The purpose of this report is to provide guidance, from the open literature, on developing a set of ''measures of effectiveness'' (MoEs) and using them to evaluate a system. Approximately twenty papers and books are reviewed. The papers that provide the clearest understanding of MoEs are identified (Sproles [46], [48], [50]). The seminal work on value-focused thinking (VFT), an approach that bridges the gap between MoEs and a system, is also identified (Keeney [25]). And finally three examples of the use of VFT in evaluating a system based on MoEs are identified (Jackson et al. [21], Kerchner & Deckro [27], and Doyle et al. [14]). Notes are provided of the papers and books to pursue in order to take this study to the next level of detail.

  14. Work and Family: An Annotated Bibliography


    Worker adjustment to the four day week : A .. longitudinal study. Journal of Applied Psychology, 1973, 58, 60-66. %*- ;• A longitudinal, exploratory...the patterns of response changed with time. After 1 year, differing effects of the four - day week seemed to be associated with ’. job pace, worker plans

  15. Black cohosh Actaea racemosa: an annotated bibliography

    Mary L. Predny; Patricia De Angelis; James L. Chamberlain


    Black cohosh (Actaea racemosa, Syn.: Cimicifuga racemosa), a member of the buttercup family (Ranunculaceae), is an erect perennial found in rich cove forests of Eastern North America from Georgia to Ontario. Native Americans used black cohosh for a variety of ailments including rheumatism, malaria, sore throats, and complications...

  16. Organizational Social Effectiveness: An Annotated Bibliography


    Results for two new tests . British Journal of Psychology , 101(3), 563-578. Emotional intelligence (EI) has received increasing attention as a...influence. Self-Monitoring Self-monitoring is a concept, related to impression management, that is largely discussed in the social psychology ...was further demonstrated by Phelps , Ramsden Zbylut, and Brunner (2009) in research which examined how the interpersonal skills exhibited by advisors

  17. Skin Cancer Education Materials: Selected Annotations.

    National Cancer Inst. (NIH), Bethesda, MD.

    This annotated bibliography presents 85 entries on a variety of approaches to cancer education. The entries are grouped under three broad headings, two of which contain smaller sub-divisions. The first heading, Public Education, contains prevention and general information, and non-print materials. The second heading, Professional Education,…

  18. Social Sciences of Sport: Bibliographies on Educational Topics No. 3.

    ERIC Clearinghouse on Teacher Education, Washington, DC.

    This publication is one of a series of annotated bibliographies in physical education. There are four sections--sport history, sport psychology, sport sociology, and sport philosophy. Each section consists of a brief introduction, the annotated bibliographic entries arranged alphabetically by author, and a list of cross references for documents…

  19. Sickle Cell: A Selected Resource Bibliography.

    National Center for Education in Maternal and Child Health, Washington, DC.

    This annotated, selective bibliography lists the following types of educational and informational material on both sickle cell disease and trait: (1) professional education materials; (2) fact sheets, pamphlets, and brochures; and (3) audiovisual material. A selected list of references is provided for the following topic areas: (1) genetic…




  1. Science and Parascience: A Select Bibliography.

    Roszak, Betty, Comp.

    This annotated bibliography identifies over 140 books, essays, and newsletters which are concerned with the convergence of the sciences with parapsychology. Most entries were published since 1950 although some date back to the early 1900s. Entries are presented alphabetically by author within four categories: psychological-metaphysical critiques…

  2. Biotechnology bibliographies

    Beaudette, L.A.; McCready, R.G.L.


    Four bibliographies are included in this document, covering articles and scientific papers from around the world written mostly in English. Citations are presented alphabetically by author under the topics of: acid mine drainage (coal and metals) and bioadsorption of metals; solution mining; metabolism and physiology of thiobacillus and other microorganisms; and bacterial leaching of metals.

  3. Biotechnology bibliographies

    Beaudette, L.A.; McCready, R.G.L.


    This bibliography consists of articles and scientific papers on biotechnology in areas in which BIOMINET is currently involved. The reports are categorized in four areas: 1) acid mine drainage (coals and metals) and bioadsorption of metals; 2) solution mining; 3) metabolism and physiology of Thiobacillus and other microorganisms; and 4) bacterial leaching of metals.

  4. Multiphoton bibliography

    Eberly, J.H.; Gallagher, J.W.


    A bibliography is presented of approximately 275 references from literature published since 1980 on multiphoton research. A subject list is provided which divides the references into four subdivisions, i.e., ionization, bound-bound transitions, dissociation, and free-free transitions. An author index is included

  5. LOGO Bibliography.

    Proud, Jim

    This bibliography lists 168 articles, books, and instructional materials for anyone interested in learning more about the LOGO programming language. Items listed range from research reports and program descriptions to lesson plans and activities. Specific titles include "A Beginner's Guide to LOGO"; "LOGO Music"; "Printing…

  6. 1979 bibliography of atomic and molecular processes. [Bibliography



    This annotated bibliography lists 2146 works on atomic and molecular processes reported in publications dated 1979. Sources include scientific journals, conference proceedings, and books. Each entry is designated by one or more of the 114 categories of atomic and molecular processes used by the Controlled Fusion Atomic Data Center, Oak Ridge National Laboratory, to classify data. Also indicated is whether the work was experimental or theoretical, what energy range was covered, what reactants were investigated, and the country of origin of the first author. Following the bibliographical listing are indexes of reactants and authors.

  7. 1978 bibliography of atomic and molecular processes. [Bibliography


    This annotated bibliography lists 2557 works on atomic and molecular processes reported in publications dated 1978. Sources include scientific journals, conference proceedings, and books. Each entry is designated by one or more of the 114 categories of atomic and molecular processes used by the Controlled Fusion Atomic Data Center to classify data. Also indicated is whether the work was experimental or theoretical, what energy range was covered, what reactants were investigated, and the country of origin of the first author. Following the bibliographical listing are indexes of reactants and authors.

  8. Asbestos bibliography

    Jentschke, M


    The publication of this special bibliography meets the desire for information on the problem of asbestos from the viewpoint of safety at work. It was compiled from the information stored at the Central Institute for Safety at work in Dresden, the Central Institute of Occupational Medicine in Berlin, the Authority for Safety at Work with the Ministry of Building in Berlin and the Medical Service of the Transport Business in Berlin, as well as with specialists from the institutions mentioned and of the authority for Safety at work, occupational hygiene and toxicology in the chemical industry of Halle and the inspector of occupational hygiene of the council of the district of Schwerin. The bibliography is a selection of the information sources available at the above-mentioned institutions. It makes no claim to completeness.

  9. Open Bibliography

    Murray-Rust, Peter; Pollock, Rufus; MacGillivray, Mark; O'Steen, Ben; Waites, William


    Poster presented at the VSMF Symposium held at the Unilever Centre on 2011-01-17. More research is published currently than can be understood or followed by a researcher without the aid of a computer. We need Open shareable information on research publications, an Open Bibliography, to build the services that enable researchers to explore their field and discover the research they need. Producers of bibliographic data such as libraries, publishers, universities, scholars or social referenc...

  10. Bibliography section



    This bibliography contains 2180 references. They are arranged according to the following subjects: gas chromatography, column chromatography, paper chromatography, thin-layer chromatography, and electrophoretic techniques. Each subject is in principle divided into 36 categories. The following category falls within the INIS scope: radioactive and other isotope compounds. For the above mentioned subjects there are 21 references in this category. Other categories that might be partially in scope are: reviews and books; fundamentals, theory and general; techniques; pollution

  11. IIS--Integrated Interactome System: a web-based platform for the annotation, analysis and visualization of protein-metabolite-gene-drug interactions by integrating a variety of data sources and tools.

    Carazzolle, Marcelo Falsarella; de Carvalho, Lucas Miguel; Slepicka, Hugo Henrique; Vidal, Ramon Oliveira; Pereira, Gonçalo Amarante Guimarães; Kobarg, Jörg; Meirelles, Gabriela Vaz


    High-throughput screening of physical, genetic and chemical-genetic interactions brings important perspectives in the Systems Biology field, as the analysis of these interactions provides new insights into protein/gene function, cellular metabolic variations and the validation of therapeutic targets and drug design. However, such analysis depends on a pipeline connecting different tools that can automatically integrate data from diverse sources and result in a more comprehensive dataset that can be properly interpreted. We describe here the Integrated Interactome System (IIS), an integrative platform with a web-based interface for the annotation, analysis and visualization of the interaction profiles of proteins/genes, metabolites and drugs of interest. IIS works in four connected modules: (i) Submission module, which receives raw data derived from Sanger sequencing (e.g. two-hybrid system); (ii) Search module, which enables the user to search for the processed reads to be assembled into contigs/singlets, or for lists of proteins/genes, metabolites and drugs of interest, and add them to the project; (iii) Annotation module, which assigns annotations from several databases for the contigs/singlets or lists of proteins/genes, generating tables with automatic annotation that can be manually curated; and (iv) Interactome module, which maps the contigs/singlets or the uploaded lists to entries in our integrated database, building networks that gather novel identified interactions, protein and metabolite expression/concentration levels, subcellular localization and computed topological metrics, GO biological processes and KEGG pathways enrichment. This module generates a XGMML file that can be imported into Cytoscape or be visualized directly on the web. We have developed IIS by the integration of diverse databases following the need of appropriate tools for a systematic analysis of physical, genetic and chemical-genetic interactions. IIS was validated with yeast two

  12. Tests in Print II: An Index to Tests, Test Reviews, and the Literature on Specific Tests.

    Buros, Oscar K., Ed.

    Tests in Print II is a comprehensive, annotated bibliography of all in-print tests published as separates for use with English-speaking subjects. The 1,155 two-column pages list 2,467 tests in print as of early 1974; 16,574 references through 1971 on specific tests; a reprinting of the 1974 APA-AERA-NCME Standards for Educational andPsychological…

  13. A Selected Bibliography of Dictionaries. General Information Series, No. 9. Indochinese Refugee Education Guides.

    Center for Applied Linguistics, Arlington, VA.

    This is a selected, annotated bibliography of dictionaries useful to Indochinese refugees. The purpose of this guide is to provide the American teacher or sponsor with information on the use, limitations and availability of monolingual and bilingual dictionaries which can be used by refugees. The bibliography is preceded by notes on problems with…

  14. Adult Nutrition Education Materials. January 1982-October 1988. Quick Bibliography Series.

    Irving, Holly Berry

    This annotated bibliography of materials available from the National Agricultural Library through interlibrary loan to local libraries focuses on nutrition and dietetics as they relate to physical health and special health problems. The bibliography was derived from online searches of the AGRICOLA database, and materials include audiovisuals,…

  15. Selected Bibliography of Egyptian Educational Materials, Vol. 1, No. 3, 1975.

    Al-Ahram Center for Scientific Translations, Cairo (Egypt).

    There are 101 selected entries in this annotated bibliography of Egyptian materials on education published in 1975. Materials include journal articles, books, and government documents. The bibliography covers the following topics: academic certificates and dissertations, art education, audiovisual aids, camps, civics curricula, conferences and…

  16. Selected Bibliography of Egyptian Educational Materials, Vol. 1, No. 2, 1975.

    Al-Ahram Center for Scientific Translations, Cairo (Egypt).

    There are 108 selected entries in this annotated bibliography of Egyptian materials on education published in 1975. Materials include journal articles, books, and government documents. The bibliography covers the following topics: adolescence, art education, child upbringing, comprehensive schools, curricula, educational change, educational aids,…

  17. International nuclear service centers: a bibliography

    Petty, G.M.; Yokota, M.


    The literature relating specifically to international nuclear fuel service centers would appear to be relatively scarce, based on the results of searches of the Energy Data Base, the libraries of the University of California at Los Angeles, and The Rand Corporation, and other sources. Works specifically relating to international service centers are annotated in this bibliography. Also listed, without annotation, are studies of various kinds of multinational public enterprises. In addition, there are references to many of the studies of the one-nation nuclear energy center concept. Most of these resulted from the survey of possible sites for these centers mandated by the US Energy Reorganization Act of 1974

  18. BioAnnote: a software platform for annotating biomedical documents with application in medical learning environments.

    López-Fernández, H; Reboiro-Jato, M; Glez-Peña, D; Aparicio, F; Gachet, D; Buenaga, M; Fdez-Riverola, F


    Automatic term annotation from biomedical documents and external information linking are becoming a necessary prerequisite in modern computer-aided medical learning systems. In this context, this paper presents BioAnnote, a flexible and extensible open-source platform for automatically annotating biomedical resources. Apart from other valuable features, the software platform includes (i) a rich client enabling users to annotate multiple documents in a user friendly environment, (ii) an extensible and embeddable annotation meta-server allowing for the annotation of documents with local or remote vocabularies and (iii) a simple client/server protocol which facilitates the use of our meta-server from any other third-party application. In addition, BioAnnote implements a powerful scripting engine able to perform advanced batch annotations. Copyright © 2013 Elsevier Ireland Ltd. All rights reserved.

  19. Bibliography of greenhouse-gas reduction strategies

    Tompkins, M.M.; Mintz, M.M.


    A bibliography of greenhouse-gas reduction strategies has been compiled to assist the Climate change Action Plan Task Force in their consideration of strategies to reduce greenhouse-gas emissions from personal motor vehicles. The document contains a summary of the literature, including it major directions and implications; and annotated listing of 32 recent pertinent documents; and a listing of a larger group of related reports.

  20. Selected Bibliography of Educational Materials: Maghreb, Algeria, Libya, Morocco, Tunisia. Vol. 9, No. 3, 1975.

    Azzouz, Azzedine, Comp.; And Others

    The bibliography presents 91 English language annotations of newspaper articles, journals, and government publications about education in Algeria, Libya, Morocco, and Tunisia. Although the title also includes Maghreb, this issue does not contain any annotations for that country. All articles were published during the period July-September 1975.…

  1. Selected Bibliography of Egyptian Educational Materials. Vol. 5, No. 1, 1979.

    Al-Ahram Center for Scientific Translations, Cairo (Egypt).

    This annotated bibliography contains 166 English language annotations of newspaper, journal, and government publications from Egypt on the topic of education. All items were published in 1979. The items are categorized by subject areas including: adult education, art education; basic education; child care, education and psychology; demographic…

  2. Job Sharing for Teachers. Bibliographies in Education. No. 79.

    Canadian Teachers' Federation, Ottawa (Ontario).

    This annotated bibliography focusing on job sharing for teachers contains 37 book citations and 94 journal article citations. While the particular focus was on job sharing for teachers, general works which provide useful information on such arrangements have been included. A special effort was made to include all Canadian references related to job…

  3. Odors and Air Pollution: A Bibliography with Abstracts.

    Environmental Protection Agency, Research Triangle Park, NC. Office of Air Programs.

    The annotated bibliography presents a compilation of abstracts which deal with odors as they relate to air pollution. The abstracts are arranged within the following categories: Emission sources; Control methods; Measurement methods; Air quality measurements; Atmospheric interaction; Basic science and technology; Effects-human health;…

  4. Geopressured geothermal bibliography. Volume I. Citation extracts. Second edition

    Sepehrnoori, K.; Carter, F.; Schneider, R.; Street, S.; McGill, K.


    This annoted bibliography contains 1131 citations. It represents reports, papers, and articles appearing over the past eighteen years covering topics from the scientific and technical aspects of geopressured geothermal reservoirs to the social, environmental, and legal considerations of exploiting those reservoirs for their energy resources. Six indexes include: author, conference title, descriptor, journal title, report number, and sponsor. (MHR)

  5. Bibliographies in nuclear science and technology. Section 2

    Fischer, E.; Jakubick, V.; Kalus, W.


    The present issue of the annotated bibliography contains 159 items. The content is divided into the following main headings: general aspects, radioecology and contamination. Literature on decontamination of food is missed in this issue. A detailed index section is annexed. (MG) [de

  6. An Interdisciplinary Bibliography for Computers and the Humanities Courses.

    Ehrlich, Heyward


    Presents an annotated bibliography of works related to the subject of computers and the humanities. Groups items into textbooks and overviews; introductions; human and computer languages; literary and linguistic analysis; artificial intelligence and robotics; social issue debates; computers' image in fiction; anthologies; writing and the…

  7. Bibliografia Especializada: Educacion Basica (Specialized Bibliography: Basic Education).

    Boletin del Centro Nacional de Documentacion e Informacion Educativa, 1971


    This specialized international bibliography on basic education lists almost 50 documents written between 1969 and 1971 in Spanish, French, and Italian on the topic of elementary education. Annotations are provided for nine of the articles. Specific topics range from elementary reading and math education to curriculum planning. (VM)

  8. Terrorism: Supplement to the Second Edition. A Selected Bibliography.

    Boston, Guy D.

    The annotated bibliography describes 85 materials related to terrorism which were collected by the National Criminal Reference Service. Although no consensus exists on the definition of terrorism, the term is interpreted in this document to include both illegal and destructive acts against society and governments and violent means undertaken to…

  9. Multicultural Bibliography: Kindergarten-Grade 8 Library Books.

    San Diego County Office of Education, CA.

    This annotated bibliography includes approximately 375 elementary-level books on history, biography, folklore, fiction, poetry, arts and crafts, and contemporary life of Blacks, Native Americans, Pan Asian Americans, Puerto Ricans, and other ethnic groups. The books cited are deemed to be non-stereotyped and appropriate for developing a…

  10. Behavior Modification in the Classroom: An Abstract Bibliography.

    Kremer, Barbara, Comp.

    An annotated selective bibliography of documents on operation conditioning which are found in the ERIC microfiche collection and in journal literature is presented. Abstracts of these documents were taken from Research in Education (RIE) and Current Index to Journals in Education (CIJE). Included are published and unpublished studies focusing on…

  11. Communication and Culture in East Asia: A Bibliography.

    Dei, Sharon

    This annotated bibliography lists books, articles, and other related sources dealing with the areas of Asian culture and communication. The 87 citations are organized under the following headings: (1) Asian Culture and Communication (in general); (2) China; (3) Japan; and (4) Korea. (HB)

  12. Bibliography of Selected SCSD, URBS, SSP, SEF, and RAS Publications.

    Stanford Univ., CA. School Planning Lab.

    The annotated bibliography contains publications and report listings of the following sources--(1) School Construction Systems Development (SCSD), (2) University Residential Building Systems (URBS), (3) Florida Schoolhouse Systems Project (SSP), (4) Study of Educational Facilities (SEF), and (5) Recherches en Amenagements Scolaires (RAS) Building…

  13. Hyperactivity--Drug Therapy/Food Additives/Allergies. A Selective Bibliography. Exceptional Child Bibliography Series No. 602.

    ERIC Clearinghouse on Handicapped and Gifted Children, Reston, VA.

    The annotated bibliography on Hyperactivity--Drug Therapy/Food Additives/Allergies contains approximately 65 abstracts and associated indexing information for documents or journal articles published from 1968 to 1975 and selected from the computer files of the Council for Exceptional Children's Information Services and the Education Resources…

  14. Indoor air: Reference bibliography

    Campbell, D.; Staves, D.; McDonald, S.


    The U. S. Environmental Protection Agency initially established the indoor air Reference Bibliography in 1987 as an appendix to the Indoor Air Quality Implementation Plan. The document was submitted to Congress as required under Title IV--Radon Gas and Indoor Air Quality Research of the Superfund Amendments and Reauthorization Act of 1986. The Reference Bibliography is an extensive bibliography of reference materials on indoor air pollution. The Bibliography contains over 4500 citations and continues to increase as new articles appear

  15. Chernobyl bibliography

    Carr, F. Jr.; Mahaffey, J.A.


    The purpose of the DOE/OHER Chernobyl Database project is to create and maintain an information system to provide usable information for research studies related to the nuclear accident. The system is the official United States repository for information about the Chernobyl accident and its consequences, and currently includes an extensive bibliography and diverse radiological measurements with supporting information. PNL has established two resources: original (not summarized) measurement data, currently about 80,000 measurements, with ancillary information; and about 2,200 bibliographic citations, some including abstracts. Major organizations that have contributed radiological measurement data include the Washington State Department of Social and Health Services; United States Environmental Protection Agency (domestic and foreign data); United States Nuclear Regulatory Commission; Stone Webster; Brookhaven National Laboratory; Commissariat A L'energie Atomique in France; Ministry of Agriculture, Fisheries, and Food in the United Kingdom; Japan National Institute of Radiological Sciences; and the Finnish Centre For Radiation and Nuclear Safety (STUK). Scientists in Australia, Austria, Belgium, Canada, China, Denmark, England, Federal Republic of Germany, Finland, France, Ireland, Italy, Japan, the Netherlands, Romania, Scotland, Spain, Sweden, Switzerland, United States, Wales, and Yugoslavia have made contributions. Bibliographic materials have been obtained from scientists in the above countries that have replied to requests. In addition, literature searches have been conducted, including a search of the DOE Energy Database. The last search was conducted in January, 1989. This document lists the bibliographic information in the DOE/OHER Chernobyl Database at the current time.

  16. Chernobyl bibliography

    Carr, F. Jr.; Mahaffey, J.A.


    The purpose of the DOE/OHER Chernobyl Database project is to create and maintain an information system to provide usable information for research studies related to the nuclear accident. The system is the official United States repository for information about the Chernobyl accident and its consequences, and currently includes an extensive bibliography and diverse radiological measurements with supporting information. PNL has established two resources: original (not summarized) measurement data, currently about 80,000 measurements, with ancillary information; and about 2,200 bibliographic citations, some including abstracts. Major organizations that have contributed radiological measurement data include the Washington State Department of Social and Health Services; United States Environmental Protection Agency (domestic and foreign data); United States Nuclear Regulatory Commission; Stone ampersand Webster; Brookhaven National Laboratory; Commissariat A L'energie Atomique in France; Ministry of Agriculture, Fisheries, and Food in the United Kingdom; Japan National Institute of Radiological Sciences; and the Finnish Centre For Radiation and Nuclear Safety (STUK). Scientists in Australia, Austria, Belgium, Canada, China, Denmark, England, Federal Republic of Germany, Finland, France, Ireland, Italy, Japan, the Netherlands, Romania, Scotland, Spain, Sweden, Switzerland, United States, Wales, and Yugoslavia have made contributions. Bibliographic materials have been obtained from scientists in the above countries that have replied to requests. In addition, literature searches have been conducted, including a search of the DOE Energy Database. The last search was conducted in January, 1989. This document lists the bibliographic information in the DOE/OHER Chernobyl Database at the current time

  17. Dungeness bibliography

    Riley, H.


    This report is a bibliography of material relating to the ecology of Dungeness in Kent and has been produced, under contract, for the Nature Conservancy Council. Since its first appearance in 1985, much new material has been published or has come to light, and is included in this 1989 edition. The area concerned comprises the system of shingle beaches between Jury's Gap and Greatstone-on-Sea on the south Kent/Sussex coast, and is a site of international conservation importance. It is one of the finest examples of an apposition shingle beach in the world and in terms of physiography, botany, entomology and ornithology it is an area of high scientific interest. As well as being of great scientific importance, Dungeness is subject to a high degree of 'human' pressure: excavation and building operations, military activity, vehicular damage and trampling threaten to destroy what is left of the natural shingle ecosystem at Dungeness. In recognition of this the Nature Conservancy Council is supporting a renewed programme of research into the ecology of the site, to try to determine how best to protect the remaining intact areas. (author)

  18. The Slovenian bibliography

    Lidija Wagner


    Full Text Available The Slovenian bibliography is our national bibliography. We want to show the criteria of the selection of the particular materials, which are included in the Slovenian bibliography. We described the bibliographic description and classification of the records with UDC and the descriptors. The printing and the CD-ROM issues of the Slovenian bibli¬ography are described. We compared UNESCO guidelines for the national bibliography on the field of the selection, bibliographic description and classification, arrangement of the records and the useful of the national bibliography.

  19. Municipal solid waste management: A bibliography of U.S. Department of Energy contractor reports through 1995



    This bibliography is an updated version of Municipal Solid Waste Management: A Bibliography of US Department of Energy Contractor Reports Through 1994 (NREL/TP-430-7886). The original bibliography, entitled Municipal Waste to Energy: An Annotated Bibliography of US Department of Energy Contractor Reports, by Caroline Brooks, was published in 1987. Like its predecessor, this bibliography provides information about technical reports on energy from municipal waste that were prepared under grants or contracts from the US Department of Energy. The reports listed focus on energy from municipal waste technologies and energy conservation in wastewater treatment. The bibliography contains three indexes-an author index, a subject index, and a title index. The reports are listed alphabetically in the subject areas and may appear under more than one subject. All of the reports cited in the original MSW bibliography are also included in this update

  20. Municipal solid waste management: A bibliography of U.S. Department of Energy contractor reports through 1995



    This bibliography is an updated version of Municipal Solid Waste Management: A Bibliography of US Department of Energy Contractor Reports Through 1994 (NREL/TP-430-7886). The original bibliography, entitled Municipal Waste to Energy: An Annotated Bibliography of US Department of Energy Contractor Reports, by Caroline Brooks, was published in 1987. Like its predecessor, this bibliography provides information about technical reports on energy from municipal waste that were prepared under grants or contracts from the US Department of Energy. The reports listed focus on energy from municipal waste technologies and energy conservation in wastewater treatment. The bibliography contains three indexes--an author index, a subject index, and a title index. The reports are listed alphabetically in the subject areas and may appear under more than one subject. All of the reports cited in the original MSW bibliography are also included in this update.

  1. Alignment-Annotator web server: rendering and annotating sequence alignments.

    Gille, Christoph; Fähling, Michael; Weyand, Birgit; Wieland, Thomas; Gille, Andreas


    Alignment-Annotator is a novel web service designed to generate interactive views of annotated nucleotide and amino acid sequence alignments (i) de novo and (ii) embedded in other software. All computations are performed at server side. Interactivity is implemented in HTML5, a language native to web browsers. The alignment is initially displayed using default settings and can be modified with the graphical user interfaces. For example, individual sequences can be reordered or deleted using drag and drop, amino acid color code schemes can be applied and annotations can be added. Annotations can be made manually or imported (BioDAS servers, the UniProt, the Catalytic Site Atlas and the PDB). Some edits take immediate effect while others require server interaction and may take a few seconds to execute. The final alignment document can be downloaded as a zip-archive containing the HTML files. Because of the use of HTML the resulting interactive alignment can be viewed on any platform including Windows, Mac OS X, Linux, Android and iOS in any standard web browser. Importantly, no plugins nor Java are required and therefore Alignment-Anotator represents the first interactive browser-based alignment visualization. and © The Author(s) 2014. Published by Oxford University Press on behalf of Nucleic Acids Research.

  2. Hydrologic bibliography of the Columbia River basalts in Washington

    Tanaka, H.H.; Wildrick, L.


    This bibliography is part of the hydrologic data compilation effort of the Columbia Plateau Hydrology Study, Rockwell Hanford Operations' Waste Isolation Program. It includes references on both surface and subsurface hydrology directly or indirectly related to the Washington State portion of the Columbia River basalts. A comprehensive, annotated bibliography of the Pasco Basin (including the Hanford site) hydrology has been prepared for Rockwell Hanford Operations under the Pasco Basin Hydrology Study. In order to avoid unnecessary duplication, no effort was made to include a complete list of bibliographic references on Hanford in this volume

  3. 1985 bibliography of atomic and molecular processes

    Barnett, C.F.; Gilbody, H.B.; Gregory, D.C.; Griffin, P.M.; Havener, C.C.; Howald, A.M.; Kirkpatrick, M.I.; McDaniel, E.W.; Meyer, F.W.; Morgan, T.J. (comps.)


    This annotated bibliography includes papers on atomic and molecular processes published during 1985. Sources include scientific journals, conference proceedings, and books. Each entry is designated by one or more of the 114 categories of atomic and molecular processes used by the Controlled Fusion Atomic Data Center, Oak Ridge National Laboratory to classify data. Also indicated is whether the work was experimental or theoretical, what energy range was covered, what reactants were investigated, and the country of origin of the first author. Following the bibliographical listing, the entries are indexed according to the categories and according to reactants within each subcategory.

  4. 1984 Bibliography of atomic and molecular processes

    Barnett, C.F.; Gilbody, H.B.; Gregory, D.C.


    This annotated bibliography includes papers on atomic and molecular processes published during 1984. Sources include scientific journals, conference proceedings, and books. Each entry is designated by one or more of the 114 categories of atomic and molecular processes used by the Controlled Fusion Atomic Data Center, Oak Ridge National Laboratory to classify data. Also indicated is whether the work was experimental or theoretical, what energy range was covered, what reactants were investigated, and the country of origin of the first author. Following the bibliographical listing, the entries are indexed according to the categories and according to reactants within each subcategory

  5. Bibliography of atomic and molecular processes, 1983

    Barnett, C.F.; Crandall, D.H.; Gilbody, H.B.; Gregory, D.C.; Kirkpatrick, M.I.; McDaniel, E.W.; McKnight, R.H.; Meyer, F.W.; Morgan, T.J.; Phaneuf, R.A. (comps.)


    This annotated bibliography includes papers on atomic and molecular processes published during 1983. Sources include scientific journals, conference proceedings, and books. Each entry is designated by one or more of the 114 categories of atomic and molecular processes used by the Controlled Fusion Atomic Data Center, Oak Ridge National Laboratory to classify data. Also indicated is whether the work was experimental or theoretical, what energy range was covered, what reactants were investigated, and the country of origin of the first author. Following the bibliographical listing, the entries are indexed according to the categories and according to reactants within each subcategory.

  6. Bibliography of atomic and molecular processes, 1983

    Barnett, C.F.; Crandall, D.H.; Gilbody, H.B.


    This annotated bibliography includes papers on atomic and molecular processes published during 1983. Sources include scientific journals, conference proceedings, and books. Each entry is designated by one or more of the 114 categories of atomic and molecular processes used by the Controlled Fusion Atomic Data Center, Oak Ridge National Laboratory to classify data. Also indicated is whether the work was experimental or theoretical, what energy range was covered, what reactants were investigated, and the country of origin of the first author. Following the bibliographical listing, the entries are indexed according to the categories and according to reactants within each subcategory

  7. 1982 bibliography of atomic and molecular processes

    Barnett, C.F.; Crandall, D.H.; Gilbody, H.B.


    This annotated bibliography includes papers on atomic and molecular processes published during 1982. Sources include scientific journals, conference proceedings, and books. Each entry is designated by one or more of the 114 categories of atomic and molecular processes used by the Controlled Fusion Atomic Data Center, Oak Ridge National Laboratory to classify data. Also indicated is whether the work was experimental or theoretical, what energy range was covered, what reactants were investigated, and the country of origin of the first author. Following the bibliographical listing, the entries are indexed according to the categories and according to reactants within each subcategory

  8. 1985 bibliography of atomic and molecular processes

    Barnett, C.F.; Gilbody, H.B.; Gregory, D.C.


    This annotated bibliography includes papers on atomic and molecular processes published during 1985. Sources include scientific journals, conference proceedings, and books. Each entry is designated by one or more of the 114 categories of atomic and molecular processes used by the Controlled Fusion Atomic Data Center, Oak Ridge National Laboratory to classify data. Also indicated is whether the work was experimental or theoretical, what energy range was covered, what reactants were investigated, and the country of origin of the first author. Following the bibliographical listing, the entries are indexed according to the categories and according to reactants within each subcategory

  9. 1978 bibliography of atomic and molecular processes


    This annotated bibliography lists 2557 works on atomic and molecular processes reported in publications dated 1978. Sources include scientific journals, conference proceedings, and books. Each entry is designated by one or more of the 114 categories of atomic and molecular processes used by the Controlled Fusion Atomic Data Center to classify data. Also indicated is whether the work was experimental or theoretical, what energy range was covered, what reactants were investigated, and the country of origin of the first author. Following the bibliographical listing are indexes of reactants and authors

  10. 1982 bibliography of atomic and molecular processes

    Barnett, C.F.; Crandall, D.H.; Gilbody, H.B.; Gregory, D.C.; Kirkpatrick, M.I.; McDaniel, E.W.; McKnight, R.H.; Meyer, F.W.; Morgan, T.J.; Phaneuf, R.A. (comps.)


    This annotated bibliography includes papers on atomic and molecular processes published during 1982. Sources include scientific journals, conference proceedings, and books. Each entry is designated by one or more of the 114 categories of atomic and molecular processes used by the Controlled Fusion Atomic Data Center, Oak Ridge National Laboratory to classify data. Also indicated is whether the work was experimental or theoretical, what energy range was covered, what reactants were investigated, and the country of origin of the first author. Following the bibliographical listing, the entries are indexed according to the categories and according to reactants within each subcategory.

  11. 1979 bibliography of atomic and molecular processes


    This annotated bibliography lists 2146 works on atomic and molecular processes reported in publications dated 1979. Sources include scientific journals, conference proceedings, and books. Each entry is designated by one or more of the 114 categories of atomic and molecular processes used by the Controlled Fusion Atomic Data Center, Oak Ridge National Laboratory, to classify data. Also indicated is whether the work was experimental or theoretical, what energy range was covered, what reactants were investigated, and the country of origin of the first author. Following the bibliographical listing are indexes of reactants and authors

  12. 1980 bibliography of atomic and molecular processes


    This annotated bibliography lists 2866 works on atomic and molecular processes reported in publications dated 1980. Sources include scientific journals, conference proceedings, and books. Each entry is designated by one or more of the 114 categories of atomic and molecular processes used by the Controlled Fusion Atomic Data Center, Oak Ridge National Laboratory, to classify data. Also indicated is whether the work was experimental or theoretical, what energy range was covered, what reactants were investigated, and the country of origin of the first author. Following the bibliographical listing are indexes of reactants and authors

  13. Bibliography on transuranium elements

    Sood, D.D.


    A selective bibliography of prominent publications on transuranium elements is compiled. Heading papers, symposia proceedings and the textbooks are included in the bibliography. The bibliography is arranged under the headings: (1)Books, Symposia Proceedings, Reviews etc., (2)Discovery, (3)Weighable Isolation, (4)Metal Preparation, (5)Nuclear Properties, (6)Plutonium as Reactor Fuel, (7)Fuel Reprocessing, (8)Solid State Chemistry, Thermochemistry and Spectroscopy, (9)Radiation Safety, (10)Applications, and (11)Some Typical Indian Papers. Total number of references cited are 298. The bibliography, though selective, will serve as a starting point for comprehensive literature search on transuranium elements. (author)

  14. Alaska Wilderness: A Bibliography for Secondary Students on Marine Vertebrates, Birds, Small or Fur Bearing Mammals and Game Animals of Alaska.

    Symons, Ann

    This is an annotated bibliography for secondary school students. It contains fourteen entries on marine vertebrates, nine entries on birds, twenty-nine entries on mammals, and one on amphibians and reptiles. Some of the entries are fiction. (BB)

  15. Bibliography of molecular dissociation in heavy particle collisions, 1950--75

    McDaniel, E.W.; Barnett, C.F.; Crandall, D.H.; Gilbody, H.B.; Kirkpatrick, M.I.; Phaneuf, R.A.; Thomas, E.W.


    This annotated bibliography lists published work on molecular dissociation in heavy particle collisions for the period 1950 to 1975. Sources include scientific journals, abstract compilations, conference proceedings, books, and reports. The bibliography is arranged alphabetically by author. Each entry indicates whether the work was experimental or theoretical, what energy range was covered, and what reactants were investigated. Following the bibliographical listing are indexes of reactants and authors.

  16. Bibliography of molecular dissociation in heavy particle collisions, 1950--75

    McDaniel, E.W.; Barnett, C.F.; Crandall, D.H.; Gilbody, H.B.; Kirkpatrick, M.I.; Phaneuf, R.A.; Thomas, E.W.


    This annotated bibliography lists published work on molecular dissociation in heavy particle collisions for the period 1950 to 1975. Sources include scientific journals, abstract compilations, conference proceedings, books, and reports. The bibliography is arranged alphabetically by author. Each entry indicates whether the work was experimental or theoretical, what energy range was covered, and what reactants were investigated. Following the bibliographical listing are indexes of reactants and authors

  17. Bibliography of ionization and stripping in heavy particle collisions, 1950--1975

    Hawthorne, S.W.; McDaniel, E.W.; Barnett, C.F.; Crandall, D.H.; Gilbody, H.B.; Kirkpatrick, M.I.; Phaneuf, R.A.; Thomas, E.W.


    This annotated bibliography lists published work on ionization and stripping in heavy particle collisions for the period 1950 to 1975. Sources include scientific journals, abstract compilations, conference proceedings, books, and reports. The bibliography is arranged alphabetically by author. Each entry indicates whether the work was experimental or theoretical, what energy range was covered, and what reactants were investigated. Following the bibliographical listing are indexes of reactants and authors

  18. Bibliography of atomic and molecular excitation in heavy particle collisions, 1950--1975

    Hawthorne, S.W.; Thomas, E.W.; Barnett, C.F.; Crandall, D.H.; Gilbody, H.B.; Kirkpatrick, M.I.; McDaniel, E.W.; Phaneuf, R.A.


    This annotated bibliography lists published work on atomic and molecular excitation in heavy particle collisions for the period 1950 to 1975. Sources include scientific journals, abstract compilations, conference proceedings, books, and reports. The bibliography is arranged alphabetically by author. Each entry indicates whether the work was experimental or theoretical, what energy range was covered, and what reactants were investigated. Following the bibliographical listing are indexes of reactions and authors

  19. Bibliography of electron transfer in heavy particle collisions, 1950--1975

    Hawthorne, S.W.; Barnett, C.F.; Crandall, D.H.; Gilbody, H.B.; Kirkpatrick, M.I.; McDaniel, E.; Phaneuf, R.A.; Thomas, E.W.


    This annotated bibliography lists published work on electron transfer in heavy particle collisions for the period 1950 to 1975. Sources include scientific journals, abstract compilations, conference proceedings, books, and reports. The bibliography is arranged alphabetically by author. Each entry indicates whether the work was experimental or theoretical, what energy range was covered, and what reactants were investigated. Following the bibliographical listing are indexes of reactants and authors

  20. The Preparation of an Annotated Bibliographical Guide to Selected Research Studies Related to the Small College, 1965-1971. Final Report.

    Askew, Thomas A.

    This document presents an outline of the processes used in compiling and annotating an approximately 560-entry bibliography dealing with the small college. The entries are comprised of books, articles, dissertations, and other studies published on the small college from 1965 through 1971. The actual bibliography is to be published soon by the…

  1. Women: A Select Bibliography.

    Kusnerz, Peggy A., Comp.; Pollack, Ann M., Comp.

    This select bibliography lists books, monographs, journals and newsletters which relate to feminism, women's studies, and other perspectives on women. Selections are organized by topic: general, bibliographies, art and literature, biography/autobiography, economics, education, family and marriage, history, politics and sex roles. Also included is…

  2. Intracultural Communication: Selected Bibliography.

    Byrd, Marquita L.

    The 63 books and journal articles listed in this bibliography address the problem of intracultural communication. A short introduction to the bibliography defines intracultural communication as the creation and sharing of meaning among citizens of the same geo-political system who come from various tributary cultures (groups distinguishable from…

  3. Art Therapy: A Bibliography.

    Gantt, Linda, Comp.; Schmal, Marilyn Strauss, Comp.

    The bibliography on art therapy presents 1175 citations (1940-1973) drawn from searches of the medical indexes, computer systems of the National Library of Medicine and the National Institute of Mental Health, other bibliographies, Centre International de Documentation Concernant les Expressions Plastiques, and the American Journal of Art Therapy.…

  4. Ubiquitous Annotation Systems

    Hansen, Frank Allan


    Ubiquitous annotation systems allow users to annotate physical places, objects, and persons with digital information. Especially in the field of location based information systems much work has been done to implement adaptive and context-aware systems, but few efforts have focused on the general...... requirements for linking information to objects in both physical and digital space. This paper surveys annotation techniques from open hypermedia systems, Web based annotation systems, and mobile and augmented reality systems to illustrate different approaches to four central challenges ubiquitous annotation...... systems have to deal with: anchoring, structuring, presentation, and authoring. Through a number of examples each challenge is discussed and HyCon, a context-aware hypermedia framework developed at the University of Aarhus, Denmark, is used to illustrate an integrated approach to ubiquitous annotations...

  5. Selected bibliography for the extraction of uranium from seawater: chemical process and plant design feasibility study

    Binney, S.E.; Polkinghorne, S.T.; Jante, R.R.; Rodman, M.R.; Chen, A.C.T.; Gordon, L.I.


    A selected annotated bibliography of 521 references was prepared as a part of a feasibility study of the extraction of uranium from seawater. For the most part, these references are related to the chemical processes whereby the uranium is removed from the seawater. A companion docment contains a similar bibliography of 471 references related to oceanographic and uranium extraction plant siting considerations, although some of the references are in common. The bibliography was prepared by computer retrieval from Chemical Abstracts, Nuclear Science Abstracts, Energy Data Base, NTIS, and Oceanic Abstracts. References are listed by author, country of author, and selected keywords.

  6. Selected bibliography for the extraction of uranium from seawater: chemical process and plant design feasibility study

    Binney, S.E.; Polkinghorne, S.T.; Jante, R.R.; Rodman, M.R.; Chen, A.C.T.; Gordon, L.I.


    A selected annotated bibliography of 521 references was prepared as a part of a feasibility study of the extraction of uranium from seawater. For the most part, these references are related to the chemical processes whereby the uranium is removed from the seawater. A companion docment contains a similar bibliography of 471 references related to oceanographic and uranium extraction plant siting considerations, although some of the references are in common. The bibliography was prepared by computer retrieval from Chemical Abstracts, Nuclear Science Abstracts, Energy Data Base, NTIS, and Oceanic Abstracts. References are listed by author, country of author, and selected keywords

  7. Human Factors Topics in Flight Simulation: An Annotated Bibliography


    A flight simulator study of missile control performance as a function of concurrent workload. AGARD CP-146, 1974. HUMAN PERFORMANCE. CREELMAN , J.A...aircraft flight simulators. Aviation Psychological Research Centre, Western European Association for Aviation Psychology , Brussels, Belgium. fighter pilots. AIAA 72-161, 1972. TRAINING. FRISBY, C.B. Field research in flying training. Occupational Psychology , 1947, 21, 24-33

  8. At Issue: Helicopter Parents and Millennial Students, an Annotated Bibliography

    Pricer, Wayne F.


    Technological advances have made it easy for parents and children--many of them students--to communicate instantaneously. Devices and technologies such as cell phones, laptops, texting, and e-mail all enable various forms of instant communication. "Helicopter parents" are regarded as very overprotective and overly involved in the affairs of their…

  9. The Landforms of Granitic Rocks: An Annotated Bibliography


    vertical joints are dominant. Duricrust and rock basins are common. The latter are independent of jointing and are associated with the older, thicker... duricrust . 15 Davis, W. M. 1933. Granitic domes of the Mohave Desert, California. Transactions of the San Diego Society of Natural History, vol. 7, pp

  10. Aviation Medicine Translations: Annotated Bibliography of Recently Translated Material. X,


    Professionnelles (France), 24:1-45, 1963. Legal provisions relative to working hours and the principal work schedules used in France are reviewed. Their...month, an extra morning shift was included to comply with the legal working hours of 46 hours a week. The group was investigated for 3 years before and...e degli operatori-radar. (Psychopathology of air traffic controllers and radar operators.) Rivista di Medicina Aeronautica e Spaziale (Italian), 39

  11. An Annotated Bibliography of Latin American Military Journals.



  12. Annotated Bibliography of REMR Technical Reports Through September 1992


    that rippability and litho-stratigraphic discontinuity may serve as a good point of departure in describing the relative resistance to erosion of rocks...phasize rock-mass ratings or classification systems (e.g. rippability ) which, when combined with lithostratigraphic discontinuity and hydraulic data

  13. Large River Sediment Transport and Deposition: An Annotated Bibliography.


    Guttenberg, Iowa, to Cairo, Illinois. Maps are developed by using 1:24,000 color infrared aerial photography flown in mid-August 1975. Aquatic, marsh...National Technical Information Service, Springfield, Virginia. Technical Report M-76-6. 56 pp. Sequential color- infrared aerial photos and corresponding...Journal of Waterways, Harbors, and Coastlines (Engineering Division) 102( WW2 ): 189-202. The Potamology Section of the U.S. Army Corps of Engineers

  14. An annotated ornithological bibliography of Guinea-Bissau

    Hazevoet, C.J.


    Guinea-Bissau, a former Portuguese colony, is a small country (36,125 km²) in West Africa bordered by Senegal in the north and Guinea (Conakry) in the east and south. Little is known about the country’s ornithology and comparatively few papers on its birds have been published. The following is an

  15. Fatigue in Military Operational Environments: An Annotated Bibliography


    metabolism, hematological and immunological changes, autonomic nervous system activity, epilepsy , physical working capacity, antidepressant effects...performance of the Wingate Anaerobic Power Test, simple reaction time, the blood lactate response to cycle exercise at 70% VO2max, and most of the

  16. Annotated Bibliography for Lake Erie. Volume III. Engineering,


    the ecology is examined. 83. Bar- Kochba , Y. and A. J. Simon. 1971. Rainfall and floods in Northeastern Ohio. Dept. of Eng. Univ. Akron. 87 p. This...Bar- Kochba , Y. Bergs, A. Dept. of Civil Eng. 1 Yonge Street University of Akron Toronto, Ontario Akron, Ohio 44304 Canada Barnhouse Associates Bethlehem

  17. Annotated Bibliography on the Teaching of Psychology: 1997.

    Johnson, David E.; Schroder, Simone I.


    Includes materials on: (1) abnormal and clinical psychology, and personality; (2) career issues; (3) cognition and learning; (4) educational technology; (5) faculty evaluation; (6) graduate education; (7) high school instruction; (8) history of psychology; (9) introductory psychology; (10) perception, and physiological and comparative psychology;…

  18. Dredging: An Annotated Bibliography on Operations, Equipment, and Processes. Revision.


    aggregate mining. 0006 APGAR , W. J. and BASCO, D. R. 1973 (Oct). "An Experimental and Theoretical Study of the Flow Field Surrounding a Suction Pipe...modes. Sub-systems designed in way that in case of emergency they can operate independently, or, if necessary, can be over- ruled by manual control...0442 VANONI, V. A. (Editor). 1975. Sedimentation Engineering, Manuals and Reports on Engineering Practice No. 54, ASCE, New York. Contents: Nature of

  19. An Annotated Bibliography of Literature Integrating Organizational and Systems Theory


    aspects of OR which are cotmmonly misunderstood: the stereotyped notions of what the scientist is like, the nature of the problem to be solved, what...effort. Four themes characterize this volume: (1) Laboratory Approach as a Genus - a way of learning which is at once convenient and potent. -154- stereotyping . Keller, R. T. Role conflict and ambiguity: Correlates with ’ob satisfaction and values. -rsnn.! Psuchoscy, 1975, 28, 57-64. This

  20. Disability history: suggested readings--an annotated bibliography.

    Burch, Susan


    Scholars in Disability history and Disability studies have produced a substantive corpus of works in the last two decades. The range of topics represent the diverse nature of this field. This essay is intended as an introductory historiography, and thus presents only a narrow sampling of books. It includes general works in both Disability history and Disability studies, focusing primarily on three topics in Disability history: representation, science/technology/eugenics, and memoirs.

  1. Northern white-cedar (Thuja occidentalis L.): an annotated bibliography

    Philip V. Hofmeyer; Laura S. Kenefic; Robert S. Seymour


    Northern white-cedar (Thuja occidentalis L.) is arguably one of the least studied commercial tree species in United States and Canada. It is an important source of wildlife habitat and forage, as well as commodities such as fence posts, shingles and siding. Much of the research on this species comes from the Lake States and Canada; few studies have...

  2. High-Level waste process and product data annotated bibliography

    Stegen, G.E.


    The objective of this document is to provide information on available issued documents that will assist interested parties in finding available data on high-level waste and transuranic waste feed compositions, properties, behavior in candidate processing operations, and behavior on candidate product glasses made from those wastes. This initial compilation is only a partial list of available references

  3. A Skeptic's Bookshelf: Scientific Responses to Pseudoscience. An Annotated Bibliography.

    Fraknoi, Andrew


    Lists nontechnical books and articles on the various claims of "paranormal" events. Includes general references and materials on: astrology; unidentified flying objects (UFO's); ancient astronauts; lunacy and the moon; Velikovsky and "Worlds in Collision"; the Bermuda triangle; Sirius B and the Dogon; the Tunguska event; creationism; and…

  4. Navy Job-Related Male-Female Differences: Annotated Bibliography.


    and 50 female Caucasian South African healing sciences students and 44 male and 43 female American medical, dental, physiotherapy students were...lesser extent, even the primary differences. The subjects used in the cited research, especially in the cognitive areas, were usually college students ...that may make college students atypical of and noncomparable to Navy enlisted personnel of the same general age. This appears more likely for males

  5. Annotated Bibliography on Human Factors in Software Development



  6. Concussion and Mild Traumatic Brain Injury: An Annotated Bibliography


    Stroop Test, demonstrating support for impairment in focused attention following mTBI. Belanger, H.G., Kretzmer, T., Vanderploeg, R.D., and French , L.M...Johnstrom, P., Salvador, R., Pickard, J.D., and Harris , N.G. 2004. Relationship between flow-metabolism uncoupling and evolving axonal injury a need for an evidence base from which to create separate high quality guidelines for concussion management in adults and children. 22 Potter

  7. Annotated bibliography of GEND-sponsored TMI-2 reports


    In the continuing effort to distribute information about the TMI-2 cleanup and recovery effort, the GEND group has sponsored publication of 70 reports to date on various aspects of the Technical Information and Examination Program. Each report is indicated below by number, title, and date of publication, and followed by a brief description. For the formal reports, the National Technical Information Service price codes are indicated within parentheses following the date of publication (where available). The first code is for printed copy; the second is for microfiche

  8. Use of wildlife webcams - Literature review and annotated bibliography

    Ratz, Joan M.; Conk, Shannon J.


    The U.S. Fish and Wildlife Service National Conservation Training Center requested a literature review product that would serve as a resource to natural resource professionals interested in using webcams to connect people with nature. The literature review focused on the effects on the public of viewing wildlife through webcams and on information regarding installation and use of webcams. We searched the peer reviewed, published literature for three topics: wildlife cameras, virtual tourism, and technological nature. Very few publications directly addressed the effect of viewing wildlife webcams. The review of information on installation and use of cameras yielded information about many aspects of the use of remote photography, but not much specifically regarding webcams. Aspects of wildlife camera use covered in the literature review include: camera options, image retrieval, system maintenance and monitoring, time to assemble, power source, light source, camera mount, frequency of image recording, consequences for animals, and equipment security. Webcam technology is relatively new and more publication regarding the use of the technology is needed. Future research should specifically study the effect that viewing wildlife through webcams has on the viewers' conservation attitudes, behaviors, and sense of connectedness to nature.

  9. Hispanics and the Military: A Selected Annotated Bibliography.


    assigned to Puerto Rico as the com- mander of the 65th, which, he says, was what "the Pentagon brass referred to as a ’rum and Coca Cola ’ outfit." Hayes...over- represenation of blacks, Hispanics, and economically disad- vantaged whites. Under sponsorship of the Department of Defense, an additional sample

  10. Critical Thinking in Higher Education: An Annotated Bibliography

    Mary Shriner, MLS


    Full Text Available An overwhelming number of books and full-text articles on various databases are available that suggest ways to teach critical thinking. Most educators agree that this skill is becoming increasingly important as classes become more diversified and the curriculum becomes more global. An institution’s library is an often-overlooked faculty development resource; this article offers relevant articles on critical thinking from the many databases available through Park University's McAfee Memorial Library.

  11. Research Sources and Microforms in Black Studies: An Annotated Bibliography.

    Ridinger, Robert B. Marks


    Analyzes 93 reference works and 23 microform collections concerning the Black American experience in 13 subject areas of the social sciences (anthropology, biography, race relations and civil rights, the Black church, communication studies, economics, education, dance, genealogy, Black history, sports, women's studies, and literature and language)…

  12. An Annotated Bibliography on Operator Mental Workload Assessment


    secondary task difficulty for the variable-allocatnon model * of attention. It is shown ,’ hiit such an interaction is indeed obtained if task...intividual functioning characteristics #.f ze cardio •,asculn.r and sympathetic-oir& systems. Moral, intillectual, willpower, emotioaal, and other

  13. An Annotated Bibliography of Objective Pilot Performance Measures


    realism . (Author) 224 NAVTRAEQUIPCEN IH-330 t 667. PROPHET, Wallace W., and Caro, Paul W., Simulation and Aircrew Training and Performance, Human... cinematic simulation and air training appears to be the most promising cost-effective method of developing NOE visual perception skills. Of other...flight and control dynamics. Informal trials were run with research staff and carrier-qualified pilots to evaluate realism of the displays; amount of

  14. Aircraft Wake Vortices: An Annotated Bibliography (1923-1990)


    leading-edge vortex when set at incidence. The engine noise was simulated by a Hartmann whistle mounted above the engine intake. The results are...Tilmann, P., "PROPAGATION OF SOUND RADIATION THROUGH VORTICES: A CONTRIBUTION TO THE THEORY OF FLOW MEASUREMENT WITH ULTRASOUND ," Report 6/1972, 1972, Max

  15. The Literature on Military Families, 1980: An Annotated Bibliography.


    Group Psychotherapy , 1964, 14, 374-377. This article examined group psychotherapy which was offered to ser- vice personnel and dependents in the...force. 43 Dobrofsky, L. R. The wife: from military dependent to feminist ? In E. Hunter (ED.), Changing families in a changing military system. (DTIC No...because officers’ wives are more socio- economically and educationally like NOW militant feminists . Dobrofsky, L. R., & Batterson, C. T. The military

  16. Annotated Bibliography on the Physiological Effects of Acceleration in Aircraft.


    pulse wave deflection was reduced and the dicrotic notch was deepened. d. The size of the cardiac silhouette was reduced in all subjects during the...gradient and single pressure suits; arterial occlusion suit; p-essure transmission factors in suits; pneumatic lever suit... factors in anti-"g" suits. (Yale) CAM No. 129. 10 Dec. 42. a, Directly underneath pressurizing air bladders, the pressure is the same as in the

  17. Annotated Bibliography for Lake Erie. Volume IV. Physical,


    cruise 69-101, February 6-27; cruise 69-103, May 29-June 4; cruise 69-104, July 2-6; cruise 69-105, July 28-August 2, 1969. Canadian Oceano - graphic...ber 13 and covered 64 sampling locations. 98. Canada Centre for Inland Waters. 1969. Lake Erie cruise 66-11, August 8-14, 1966. Canadian Oceano - 59... sol - uble phosphorus is remarkably uniform at any one place in Lake Erie, with occasional variations. Concentrations gen- erally decrease from shore

  18. Synthesis Reports on Intensive Academic and Behavioral Intervention: Annotated Bibliography

    Casasanto-Ferro, Julia; Gandhi, Allison; Shami, Muna; Danielson, Lou; Bzura, Robin


    This document is the first in a series of products that will be developed under the knowledge production service area of the National Center on Intensive Intervention (NCII), with the purpose of describing and communicating the results of research on intensive intervention. The synthesis studies summarized here, and others to be identified, will…

  19. The Army Enlistment Decision: A Selected, Annotated Bibliography


    the draft necessitates changes in manpower management - management must now be more responsive to labor and other considerations - this not needed or...with sociological Approach:variables related to instituitional values, Data Sapl 1983 Army Recruit Surivey for spring and summer 1983, * 8,605 non...AFQT equlvalerywo ’es - participation Ir pt’it’de testing Analysis frequencies, crosstnrlmlations, magnitude estimation 76 Findings: o Financial

  20. Environmental effects of postfire logging: literature review and annotated bibliography.

    James D. McIver; Lynn Starr


    The scientific literature on logging after wildfire is reviewed, with a focus on environmental effects of logging and removal of large woody structure. Rehabilitation, the practice of planting or seeding after logging, is not reviewed here. Several publications are cited that can be described as “commentaries,” intended to help frame the public debate. We review 21...

  1. Annotated Bibliography for Lake Erie. Volume I. Biological,


    maculosa Le Sueur; calico bass, or Lake Erie bass, Pomoxis sparoides Lacepede. (SM) 52. Reardslee, Clark S. 1944. Bonapart’s gull on the Niagara...of the burbot, Lota lota maculosa (LeSueur), in Lake Erie. Trans. Am. Fish. Soc. 80:163-173. Growth studies were made on 2,329 Lake Erie burbot...almo -- hystus; whitefish, oe onus albus; common shad salmon, Coregonus a upelformis; aobony pike, Lepisosteus bison; spotted burbot, Lota maculosa ; and

  2. Annotated Bibliography of Underwater Acoustic Research, 1942-1945.


    easily be produced in underwater-telephony adapter was quantities by existing facilities at sea-tested on USS LIONFISH . The New the Submarine Base...including 7500 lacquering, waxing, making and yd, with the LIONFISH operating fitting pointers, and maintenance, underway at periscope deptn and the Two...R61 1-452 D24/R62i -462 * USS PERCH (SS-313) USS JORDAN (DE204) D24/R736-564 P42 /R75 9-584 D16/R1388-i 152 D24/R780-603 054 /R992-783 USS LIONFISH (SS

  3. Annotated Bibliography of Water Optical Properties of Ocean Waters.


    chlorophyll concentrations as low as 1-0 mg/m 61. Environmental Planning Study (Strategic Straits)(U)(1947-1980). Informal Reports, CR Special Publications...Effect of Uniform Minero - genic Suspensions. Tellus (5), 306-307. The distribution of matter suspended in ocean water was studied during the Swedish...are presented. Future cruises and plans are discussed. 189. Matsuike, Kanau (1968). Study on the Optical Characteristics of Three Oceans, Part 1

  4. An Annotated Bibliography of the Open Literature on Deception.


    Potter, 1961, pp. 82, 102-103; ch. 8, "For Righteous or Sinners,", pp. 87-104. Arendt , Hannah , "Lying in Politics: Reflections on the Pentagon Papers...79 Ardamatskiy, Vasiliy Ivanovich............................. 103 Arendt , Hannah ...34 New York Review of Books, Vol. 17, No. 8, November 18, 1971, pp. 30-39; in H. Arendt , Lying in Politics. New York- Harcourt, Brace, Jovanovich


    A selected list of references in the fields of astronautics and re-entry mechanics is classified and discussed, and a comprehensive subject and author index is included for ease in locating the references. (Author)


    Contents: Map of political divisions of Africa; Map of Angola; Sources with abstracts listed alphabetically by author; Alphabetical author index ; Subject heading index with period of record; Subject heading index with map scales.

  7. Recruiting and Retaining Army Nurses: An Annotated Bibliography


    reimbursement and the need to maintain qwality, developed a comprehensive program to improve nurses’ professional accountability. The project was based on...aspects of their jobs. The report is based on the results of a comprehensive survey using a 18-page questionnaire to explore factors associated with...projections made by the Division of Nursing. Weisman, C.S., ’% ecrit fran Within:Hospital Nurse Retention in the 1980s", in Journal of NursinM Administration

  8. The Pajarito Plateau: A bibliography

    Mathien, Frances Joan; Steen, Charlie R.; Allen, Craig D.


    This bibliography is the result of two initially independent projects. As the consulting archaeologist at Los Alamos National Laboratory (LANL), Charlie R. Steen collected entries at the suggestion of the staff of the Environmental Surveillance Group of the Health, Safety, and Environmental Division, HSE-8. The primary purpose was to aid the staff in evaluating cultural resources on LANL lands. In addition to works that related to the archaeology and history of the area, Steen included notations of a few books and articles in other fields such as geology and natural history. It was hoped that they also would be of value to other organizations and to students of past human activities on the Pajarito Plateau.At the same time, the National Park Service (NPS) was planning a major survey of Bandelier National Monument (BNM). As part of this plan, the author was asked to prepare a background document that described research previously carried out in the area, including an annotated bibliography. Although the survey would be limited to the park boundaries, the larger Pajarito Plateau is a more logical study area from physiographic, environmental, and cultural perspectives; hence the focus was on this larger region. Mathien (1986) also included some references to natural resources studies, particularly those initiated by NPS within Bandelier National Monument.Both bibliographies were made available to Colleen Olinger and Beverly Larson of the Health and Environmental Services Group at Los Alamos. They realized that while neither was complete, each included entries missing from the other. Larson suggested the two bibliographies be combined. (At this time, Craig Allen was studying the landscape of the Jemez Mountains [Allen 1984c, 1989]. His investigations included much detailed information on natural resource studies and were added in 1991 and 1992.)To limit the scope of their work, Steen and Mathien had chosen their parameter: the Pajarito Plateau. Geographically, the

  9. Resources on Campus Governance and Employment Relations, 1967-1977. With Essay, Annotations, and Indexes.

    Tice, Terrence N.

    An annotated bibliography containing 1,110 items from 1967 through early 1977 and other relevant resources covers virtually all the significant material on campus collective bargaining and closely related issues regarding campus governance and employment relations. It complements five publications from 1972-76 and indexes both authors and…

  10. Bibliographies: The Librarian's Bookshelf.

    Bourdon, Cathleen


    This selective bibliography is organized by subject headings that include administration and personnel; bibliographic instruction/information literacy; cataloging and classification; children's and young adults; collection development; copyright; customer service; distance education; electronic libraries; evaluation of library services; fund…

  11. Bibliographies. The Librarian's Bookshelf.

    Bourdon, Cathleen


    This bibliography for materials helpful to librarians includes works relating to administration and personnel; bibliographic instruction; information literacy; cataloging and classification; children's and adolescent services and materials; collection development; copyright; distance education; electronic libraries; evaluation; fund raising;…

  12. Coastal Wetland Restoration Bibliography

    Yozzo, David


    This bibliography was compiled to provide biologists, engineers, and planners at Corps Districts and other agencies/ institutions with a guide to the diverse body of literature on coastal wetland restoration...

  13. Bibliography of Fynbos ecology

    Jarman, ML


    Full Text Available References to 814 publications are presented, together with keyword listings and a keyword index. This bibliography forms part of the Phase I review and synthesis activity of the Fynbos Biome Project....

  14. Bibliography on Collegiate Athletics.

    Francois, Denise; And Others


    A bibliography on collegiate athletics with approximately 400 items is presented. Topics include: sports administration, sports histories, women's athletics, physical education, problems and scandals, sports organizations, sports and health, and references on many specific sports, especially football. (JMD)

  15. Energy transition. Selective bibliography


    At the occasion of the promulgation on August 17, 2015 of law no. 2015-992 relative to energy transition, this bibliography reviews the legal, economical and political aspects of the recent evolutions in the energy domain. Basic and synthetic documents are listed first. Then follow documents dealing with: general data, energy models, sustainable agriculture, green technologies, energy conservation, waste processing, renewable energy sources, sustainable cities and buildings. The bibliography ends with a selection of relevant web sites

  16. Bibliography of Unpublished Materials Pertaining to Hispanic Culture in the New Mexico WPA Writers' Files.

    Cordova, Benito, Comp.

    The bibliography consists of unpublished manuscripts relating to the Hispano culture from the New Mexico Writer's Project. The nearly 600 different items, written 3 or 4 decades ago as part of a WPA project, present a fresh look at a variety of indigenous New Mexico folklore. Most of the entries are annotated, dated, and sources and contributors…

  17. The News about High School Journalism: Focused Access to Selected Topics (FAST) Bibliography No. 4.

    Cowles, Margaret Haining

    This annotated bibliography contains 33 items from the ERIC database on high school journalism topics of interest to student writers and editors, journalism instructors, publications advisers, and school administrators. The first section contains overviews. Ensuing sections address how journalism benefits students; legal issues in high school…

  18. Safari Adventures: A Bibliography for Young Readers Preschool through Junior High.

    Sumner, Mary Ann, Comp.

    This annotated bibliography contains books for blind or physically handicapped youngsters from preschool through junior high. The books are available in braille, on audiocassette, or recorded discs. The approximately 400 titles listed were produced in Florida or obtained from the National Library Service for the Blind and Physically Handicapped.…

  19. A Bibliography of English as a Second Language Materials: Grades K-3.

    National Clearinghouse for Bilingual Education, Arlington, VA.

    This annotated bibliography of English as a second language (ESL) materials for grades K-3 is divided into four parts. The first part, ESL texts, lists a number of series or single texts that are designed to teach the spoken language and reading to the elementary school child. The second part is a list of readers that, although were mostly…

  20. Coping: Books About Young People Surviving Special Problems. A Bibliography Based on the Acquisitions of EDMARC.

    Billings, Mary DeWitt

    This annotated bibliography lists and describes books in the Educational Materials Review Center (EDMARC) collection for children and young adults which deal with some facet of mental health, physical handicaps, or family life. The mental health category includes books about retardation, severe depression, alcohol and drug abuse, suicide, dealing…

  1. An Online Bibliography of Resources for the Study of Woman Suffrage

    Sparacino, Elizabeth Kenny


    The purpose of this annotated bibliography is twofold. The first purpose is to address the question raised by Phyllis Holman Wiesbard, "Where are women on the 'net?" The second purpose is to explore how teachers can use the documents found on the world wide web to teach woman suffrage in their classrooms. Woman suffrage has proved to be a fruitful…

  2. Information on Child Abuse: A Selected Bibliography of Federal Government Publications. Research Guide.

    Dodge, Timothy

    The overall topic of this annotated bibliography, directed to users of the Auburn University libraries, is child abuse. It contains 63 federal government publications in 4 major areas: (1) definitions and prevalence of child abuse, including child pornography and pedophilia, family violence, abductions, and emotional abuse; (2) recent legislation,…

  3. New Publications for Planning Libraries (List No. 18: Urban and Regional Planning). Exchange Bibliography 905.

    Vance, Mary, Comp.

    This general bibliography contains current sources on urban and regional planning. Most citations date from 1973 through 1975, and some are annotated. The bulk of the documents are commercially published books, bulletins, project reports, and studies on urban studies, urban planning, regional planning, and city planning and problems. Citations are…

  4. New Publications for Planning Libraries (List No. 20). Exchange Bibliography 928.

    Vance, Mary, Comp.

    This partially annotated bibliography contains current listings on a variety of topics including architecture, economics, energy, environmental education, geography, housing, land use, politics, urban planning, recreation, and transportation. The bulk of the documents are project reports, commercially published books, and studies. Most date from…

  5. New Publications for Planning Libraries (List No. 19). Exchange Bibliography 927.

    Vance, Mary, Comp.

    This partially annotated bibliography contains current sources on a variety of topics including architecture, economics, environmental education, energy, geography, land use, urban planning, politics, recreation, and open space. The sources date from 1973 through 1975. The bulk of the documents are project reports, commercially published books,…

  6. Selected Bibliography of Egyptian Educational Materials, Vol. 2, No. 3, 1976.

    Al-Ahram Center for Scientific Translations, Cairo (Egypt).

    The selective annotated bibliography of Egyptian educational publications contains 109 entries on 42 topics. Included are journal articles, books, and government documents published during 1976. Content includes the following topics: adult education, art education, audiovisual aids, care for distinguished students, educational planning,…

  7. Nutrition Education Materials: Grades Preschool through 6. 1979-March 1987. Quick Bibliography Series.

    Irving, Holly Berry

    The citations in this annotated bibliography are of audiovisuals and books focusing on basic nutrition education for children in preschool through the sixth grade. There are 306 citations derived from online searches of the AGRICOLA database. Information is provided on obtaining the materials. (JD)

  8. Maternal and Infant Nutrition Education Materials. January 1981-October 1988. Quick Bibliography Series.

    Irving, Holly Berry

    The materials cited in this annotated bibliography focus on maternal and infant health and the critical importance of good nutrition. Audiovisuals and books are listed in 152 citations derived from online searches of the AGRICOLA database. Materials are available from the National Agricultural Library or through interlibrary loan to a local…

  9. Nutrition Education Materials: Grades 7 through 12. 1979-March 1987. Quick Bibliography Series.

    Irving, Holly Berry

    The citations in this annotated bibliography are of audiovisuals and books focusing on basic nutrition education for children in junior high and secondary schools. There are 233 citations derived from online searches of the AGRICOLA database. Information is provided on obtaining the materials. (JD)

  10. Selected Bibliography of Egyptian Educational Materials. Vol. 5, No. 2, 1979.

    Al-Ahram Center for Scientific Translations, Cairo (Egypt).

    One hundred and forty two books, articles, and government publications dealing with education in Egypt are cited in this annotated bibliography. Items cited were published in 1979 and examine education for all age groups and ability levels. The material is presented under 84 headings including adult education, art education, children's books,…

  11. Selected Bibliography of Egyptian Educational Materials, Vol. 2, No. 2, 1976.

    Al-Ahram Center for Scientific Translations, Cairo (Egypt).

    One hundred fourteen entries on 58 topics are contained in the selective annotated bibliography of Egyptian publications on education. Included are journal articles, books, and government documents published during 1976. Content includes the following topics: adult education, Arabic language, audiovisual aids, child upbringing, civics, economics…

  12. Selected Bibliography of Egyptian Educational Materials, Vol. 1, No. 4, 1975.

    Al-Ahram Center for Scientific Translations, Cairo (Egypt).

    This annotated bibliography of Egyptian publications on education contains 108 entries. Publications include journal articles, books, and government documents. The following educational topics are covered: adult education, teaching Arabic language, art education, audiovisual aids, teaching civics, formation of committees, secondary school courses…

  13. Selected Bibliography of Egyptian Educational Materials, Vol. 2, No. 1, 1976.

    Al-Ahram Center for Scientific Translations, Cairo (Egypt).

    This selective annotated bibliography of Egyptian publications on education contains 126 entries on 55 topics. Publications include journal articles, books, and government documents published during 1976 or late 1975. Among the 55 topics are the following: adult education, agricultural schools, art education, child upbringing, compulsory…

  14. Selected Bibliography of Egyptian Educational Materials, Vol. 3, No. 1, 1977.

    Al-Ahram Center for Scientific Translations, Cairo (Egypt).

    This annotated bibliography lists 135 selected educational materials from Egypt covering the period 1976-1977. The materials are drawn from a variety of Egyptian newspapers, journals, government publications, and university research reports. The entries are organized into 55 categories, including Adolescence; Adult Education; Art Education; Basic…

  15. Selected Bibliography of Egyptian Educational Materials. Vol. 3, No. 4, 1977.

    Al-Ahram Center for Scientific Translations, Cairo (Egypt).

    Over 130 citations of books, journals, government publications, and newspapers dealing with education in Egypt are included in this annotated bibliography. Materials cited were published in 1977. Sixty-two alphabetically arranged categories cover such topics as agricultural schools, Arabic language, basic education, child care, curricula,…

  16. Selected Bibliography of Egyptian Educational Materials, Vol. 2, No. 4, 1976.

    Al-Ahram Center for Scientific Translations, Cairo (Egypt).

    One hundred seventy entries on 69 topics are contained in the selective annotated bibliography of Egyptian publications on education. Included are journal articles, books, and government documents published during 1976. Content includes the following topics: Arabic language, art education, civics, commercial schools, comparative education,…

  17. Selected Bibliography of Egyptian Educational Materials, Vol. 3, No. 2, 1977.

    Al-Ahram Center for Scientific Translations, Cairo (Egypt).

    The annotated bibliography identifies 134 selected educational materials from Egypt published during 1977. The materials are drawn from Egyptian newspapers, journals, government publications, and university research reports. The entries are organized into 54 categories, including Art Education, Arabic Language, Commercial Schools, Curricula,…

  18. Selecting Materials on the Iranian Revolution: A Short Bibliography of Materials Now in Print.

    Sanchez, James Joseph

    Appropriate for adult reading, 27 books published between 1969 and 1982 are listed in this annotated bibliography for those studying the Iranian Revolution. Works are arranged into two categories: (1) "Background Materials: Islam and Petroleum," which lists basic works that make it easier to place events in Iran within an intelligible…

  19. Native American Arts and Crafts of the United States. Bibliography 1.

    Indian Arts and Crafts Board, Washington, DC.

    The selected readings listed in this annotated bibliography are suggested as an introduction to the varied arts and crafts created from prehistoric to modern times by Native American peoples of the United States. The publications are organized by culture area to encompass major media practiced by Native American artists and craftsmen of these…

  20. More Materiales Tocante Los Latinos. A Bibliography of Materials on the Spanish-American.

    Harrigan, Joan, Comp.

    A bibliography of materials published between 1964 and 1969 on the Spanish American is presented to assist librarians and educators in locating Hispano instructional aids. Over 120 annotated entries list audio-visual aids and reading materials for students of all ages, professional materials for educators including librarians, ERIC materials…