WorldWideScience

Sample records for ii annotated bibliography

  1. A Selected Annotated Bibliography on Work Time Options.

    Science.gov (United States)

    Ivantcho, Barbara

    This annotated bibliography is divided into three sections. Section I contains annotations of general publications on work time options. Section II presents resources on flexitime and the compressed work week. In Section III are found resources related to these reduced work time options: permanent part-time employment, job sharing, voluntary…

  2. GSV Annotated Bibliography

    Energy Technology Data Exchange (ETDEWEB)

    Roberts, Randy S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Pope, Paul A. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Jiang, Ming [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Trucano, Timothy G. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Aragon, Cecilia R. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Ni, Kevin [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Wei, Thomas [Argonne National Lab. (ANL), Argonne, IL (United States); Chilton, Lawrence K. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Bakel, Alan [Argonne National Lab. (ANL), Argonne, IL (United States)

    2010-09-14

    The following annotated bibliography was developed as part of the geospatial algorithm verification and validation (GSV) project for the Simulation, Algorithms and Modeling program of NA-22. Verification and Validation of geospatial image analysis algorithms covers a wide range of technologies. Papers in the bibliography are thus organized into the following five topic areas: Image processing and analysis, usability and validation of geospatial image analysis algorithms, image distance measures, scene modeling and image rendering, and transportation simulation models. Many other papers were studied during the course of the investigation including. The annotations for these articles can be found in the paper "On the verification and validation of geospatial image analysis algorithms".

  3. Annotated bibliography

    International Nuclear Information System (INIS)

    1997-08-01

    Under a cooperative agreement with the U.S. Department of Energy's Office of Science and Technology, Waste Policy Institute (WPI) is conducting a five-year research project to develop a research-based approach for integrating communication products in stakeholder involvement related to innovative technology. As part of the research, WPI developed this annotated bibliography which contains almost 100 citations of articles/books/resources involving topics related to communication and public involvement aspects of deploying innovative cleanup technology. To compile the bibliography, WPI performed on-line literature searches (e.g., Dialog, International Association of Business Communicators Public Relations Society of America, Chemical Manufacturers Association, etc.), consulted past years proceedings of major environmental waste cleanup conferences (e.g., Waste Management), networked with professional colleagues and DOE sites to gather reports or case studies, and received input during the August 1996 Research Design Team meeting held to discuss the project's research methodology. Articles were selected for annotation based upon their perceived usefulness to the broad range of public involvement and communication practitioners

  4. GSV Annotated Bibliography

    Energy Technology Data Exchange (ETDEWEB)

    Roberts, Randy S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Pope, Paul A. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Jiang, Ming [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Trucano, Timothy G. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Aragon, Cecilia R. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Ni, Kevin [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Wei, Thomas [Argonne National Lab. (ANL), Argonne, IL (United States); Chilton, Lawrence K. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Bakel, Alan [Argonne National Lab. (ANL), Argonne, IL (United States)

    2011-06-14

    The following annotated bibliography was developed as part of the Geospatial Algorithm Veri cation and Validation (GSV) project for the Simulation, Algorithms and Modeling program of NA-22. Veri cation and Validation of geospatial image analysis algorithms covers a wide range of technologies. Papers in the bibliography are thus organized into the following ve topic areas: Image processing and analysis, usability and validation of geospatial image analysis algorithms, image distance measures, scene modeling and image rendering, and transportation simulation models.

  5. Music journals in South Africa 1854-2010: an annotated bibliography

    African Journals Online (AJOL)

    Music journals in South Africa 1854-2010: an annotated bibliography. ... The article focuses on presenting an annotated bibliography of music journalism in South Africa from as early as 1854 until 2010. Most of ... Key words: annotated bibliography, electronic journals, music journals, periodicals, South African music history ...

  6. Persuasion: A Selected, Annotated Bibliography.

    Science.gov (United States)

    McDermott, Steven T.

    Designed to reflect the diversity of approaches to persuasion, this annotated bibliography cites materials selected for their contribution to that diversity as well as for being relatively current and/or especially significant representatives of particular approaches. The bibliography starts with a list of 17 general textbooks on approaches to…

  7. Systems Theory and Communication. Annotated Bibliography.

    Science.gov (United States)

    Covington, William G., Jr.

    This annotated bibliography presents annotations of 31 books and journal articles dealing with systems theory and its relation to organizational communication, marketing, information theory, and cybernetics. Materials were published between 1963 and 1992 and are listed alphabetically by author. (RS)

  8. Impingement: an annotated bibliography

    International Nuclear Information System (INIS)

    Uziel, M.S.; Hannon, E.H.

    1979-04-01

    This bibliography of 655 annotated references on impingement of aquatic organisms at intake structures of thermal-power-plant cooling systems was compiled from the published and unpublished literature. The bibliography includes references from 1928 to 1978 on impingement monitoring programs; impingement impact assessment; applicable law; location and design of intake structures, screens, louvers, and other barriers; fish behavior and swim speed as related to impingement susceptibility; and the effects of light, sound, bubbles, currents, and temperature on fish behavior. References are arranged alphabetically by author or corporate author. Indexes are provided for author, keywords, subject category, geographic location, taxon, and title

  9. Review of actinide-sediment reactions with an annotated bibliography

    Energy Technology Data Exchange (ETDEWEB)

    Ames, L.L.; Rai, D.; Serne, R.J.

    1976-02-10

    The annotated bibliography is divided into sections on chemistry and geochemistry, migration and accumulation, cultural distributions, natural distributions, and bibliographies and annual reviews. (LK)

  10. Special Issue: Annotated Bibliography for Volumes XIX-XXXII.

    Science.gov (United States)

    Pullin, Richard A.

    1998-01-01

    This annotated bibliography lists 310 articles from the "Journal of Cooperative Education" from Volumes XIX-XXXII, 1983-1997. Annotations are presented in the order they appear in the journal; author and subject indexes are provided. (JOW)

  11. Consumer energy research: an annotated bibliography

    Energy Technology Data Exchange (ETDEWEB)

    Anderson, C.D.; McDougall, G.H.G.

    1980-01-01

    This document is an updated and expanded version of an earlier annotated bibliography by Dr. C. Dennis Anderson and Carman Cullen (A Review and Annotation of Energy Research on Consumers, March 1978). It is the final draft of the major report that will be published in English and French and made publicly available through the Consumer Research and Evaluation Branch of Consumer and Corporate Affairs, Canada. Two agencies granting permission to include some of their energy abstracts are the Rand Corporation and the DOE Technical Information Center. The bibliography consists mainly of empirical studies, including surveys and experiments. It also includes a number of descriptive and econometric studies that utilize secondary data. Many of the studies provide summaries of research is specific areas, and point out directions for future research efforts. 14 tables.

  12. Public Relations: Selected, Annotated Bibliography.

    Science.gov (United States)

    Demo, Penny

    Designed for students and practitioners of public relations (PR), this annotated bibliography focuses on recent journal articles and ERIC documents. The 34 citations include the following: (1) surveys of public relations professionals on career-related education; (2) literature reviews of research on measurement and evaluation of PR and…

  13. Persuasion: Attitude/Behavior Change. A Selected, Annotated Bibliography.

    Science.gov (United States)

    Benoit, William L.

    Designed for teachers, students and researchers of the psychological dimensions of attitude and behavior change, this annotated bibliography lists books, bibliographies and articles on the subject ranging from general introductions and surveys through specific research studies, and from theoretical position essays to literature reviews. The 42…

  14. An Informally Annotated Bibliography of Sociolinguistics.

    Science.gov (United States)

    Tannen, Deborah

    This annotated bibliography of sociolinguistics is divided into the following sections: speech events, ethnography of speaking and anthropological approaches to analysis of conversation; discourse analysis (including analysis of conversation and narrative), ethnomethodology and nonverbal communication; sociolinguistics; pragmatics (including…

  15. Resources for Achieving Sex Equity: An Annotated Bibliography.

    Science.gov (United States)

    Miller, Susan W., Comp.

    This annotated bibliography provides a list of resources dealing with sex equity in vocational education. The bibliography first provides operational definitions of "sexism,""sex fair,""sex affirmative,""sex bias," and "affirmative action." It then lists resources under the following topics and/or bibliographic forms: (1) sex role definition, (2)…

  16. Potential use of geothermal resources in the Snake River Basin: an environmental overview. Volume II. Annotated bibliography

    Energy Technology Data Exchange (ETDEWEB)

    Spencer, S.G.; Russell, B.F.; Sullivan, J.F. (eds.)

    1979-09-01

    This volume is a partially annotated bibliography of reference materials pertaining to the seven KGRA's. The bibliography is divided into sections by program element as follows: terrestrial ecology, aquatic ecology, heritage resources, socioeconomics and demography, geology, geothermal, soils, hydrology and water quality, seismicity, and subsidence. Cross-referencing is available for those references which are applicable to specific KGRA's. (MHR)

  17. Rural Development Literature 1976-1977: An Updated Annotated Bibliography.

    Science.gov (United States)

    Buzzard, Shirley, Comp.

    More than 100 books and articles on rural development published during 1976-77 are annotated in this selective bibliography. Concentrating on social science literature, the bibliography is interdisciplinary in nature, spanning agricultural economics, anthropology, community development, community health, and rural sociology. Types of works…

  18. GRADUATE AND PROFESSIONAL EDUCATION, AN ANNOTATED BIBLIOGRAPHY.

    Science.gov (United States)

    HEISS, ANN M.; AND OTHERS

    THIS ANNOTATED BIBLIOGRAPHY CONTAINS REFERENCES TO GENERAL GRADUATE EDUCATION AND TO EDUCATION FOR THE FOLLOWING PROFESSIONAL FIELDS--ARCHITECTURE, BUSINESS, CLINICAL PSYCHOLOGY, DENTISTRY, ENGINEERING, LAW, LIBRARY SCIENCE, MEDICINE, NURSING, SOCIAL WORK, TEACHING, AND THEOLOGY. (HW)

  19. Legal Information Sources: An Annotated Bibliography.

    Science.gov (United States)

    Conner, Ronald C.

    This 25-page annotated bibliography describes the legal reference materials in the special collection of a medium-sized public library. Sources are listed in 12 categories: cases, dictionaries, directories, encyclopedias, forms, references for the lay person, general, indexes, laws and legislation, legal research aids, periodicals, and specialized…

  20. Argumentation Theory. [A Selected Annotated Bibliography].

    Science.gov (United States)

    Benoit, William L.

    Materials dealing with aspects of argumentation theory are cited in this annotated bibliography. The 50 citations are organized by topic as follows: (1) argumentation; (2) the nature of argument; (3) traditional perspectives on argument; (4) argument diagrams; (5) Chaim Perelman's theory of rhetoric; (6) the evaluation of argument; (7) argument…

  1. The Community Junior College: An Annotated Bibliography.

    Science.gov (United States)

    Rarig, Emory W., Jr., Ed.

    This annotated bibliography on the junior college is arranged by topic: research tools, history, functions and purposes, organization and administration, students, programs, personnel, facilities, and research. It covers publications through the fall of 1965 and has an author index. (HH)

  2. Great Basin Experimental Range: Annotated bibliography

    Science.gov (United States)

    E. Durant McArthur; Bryce A. Richardson; Stanley G. Kitchen

    2013-01-01

    This annotated bibliography documents the research that has been conducted on the Great Basin Experimental Range (GBER, also known as the Utah Experiment Station, Great Basin Station, the Great Basin Branch Experiment Station, Great Basin Experimental Center, and other similar name variants) over the 102 years of its existence. Entries were drawn from the original...

  3. Simulator fidelity and training effectiveness: a comprehensive bibliography with selected annotations

    International Nuclear Information System (INIS)

    Rankin, W.L.; Bolton, P.A.; Shikiar, R.; Saari, L.M.

    1984-05-01

    This document contains a comprehensive bibliography on the topic of simulator fidelity and training effectiveness, prepared during the preliminary phases of work on an NRC-sponsored project on the Role of Nuclear Power Plant Simulators in Operator Licensing and Training. Section A of the document is an annotated bibliography consisting of articles and reports with relevance to the psychological aspects of simulator fidelity and the effectiveness of training simulators in a variety of settings, including military. The annotated items are drawn from a more comprehensive bibliography, presented in Section B, listing documents treating the role of simulators in operator training both in the nuclear industry and elsewhere

  4. Entrainment: an annotated bibliography. Interim report

    International Nuclear Information System (INIS)

    Carrier, R.F.; Hannon, E.H.

    1979-04-01

    The 604 annotated references in this bibliography on the effects of pumped entrainment of aquatic organisms through the cooling systems of thermal power plants were compiled from published and unpublished literature and cover the years 1947 through 1977. References to published literature were obtained by searching large-scale commercial data bases, ORNL in-house-generated data bases, relevant journals, and periodical bibliographies. The unpublished literature is a compilation of Sections 316(a) and 316(b) demonstrations, environmental impact statements, and environmental reports prepared by the utilities in compliance with Federal Water Pollution Control Administration regulations. The bibliography includes references on monitoring studies at power plant sites, laboratory studies of physical and biological effects on entrained organisms, engineering strategies for the mitigation of entrainment effects, and selected theoretical studies concerned with the methodology for determining entrainment effects

  5. Geothermal wetlands: an annotated bibliography of pertinent literature

    Energy Technology Data Exchange (ETDEWEB)

    Stanley, N.E.; Thurow, T.L.; Russell, B.F.; Sullivan, J.F.

    1980-05-01

    This annotated bibliography covers the following topics: algae, wetland ecosystems; institutional aspects; macrophytes - general, production rates, and mineral absorption; trace metal absorption; wetland soils; water quality; and other aspects of marsh ecosystems. (MHR)

  6. Ion implantation: an annotated bibliography

    International Nuclear Information System (INIS)

    Ting, R.N.; Subramanyam, K.

    1975-10-01

    Ion implantation is a technique for introducing controlled amounts of dopants into target substrates, and has been successfully used for the manufacture of silicon semiconductor devices. Ion implantation is superior to other methods of doping such as thermal diffusion and epitaxy, in view of its advantages such as high degree of control, flexibility, and amenability to automation. This annotated bibliography of 416 references consists of journal articles, books, and conference papers in English and foreign languages published during 1973-74, on all aspects of ion implantation including range distribution and concentration profile, channeling, radiation damage and annealing, compound semiconductors, structural and electrical characterization, applications, equipment and ion sources. Earlier bibliographies on ion implantation, and national and international conferences in which papers on ion implantation were presented have also been listed separately

  7. Annotated bibliography of highly ionized atoms of importance to plasmas

    International Nuclear Information System (INIS)

    Schmieder, R.W.

    1975-04-01

    A bibliography is presented of the literature on highly ionized atoms which have relevance to plasmas. The bibliography is annotated with keywords, and indexed by subjects and authors. It should be of greatest use to researchers working on the problems of impurity cooling and diagnostics of CTR plasmas. (U.S.)

  8. Systemic Planning: An Annotated Bibliography and Literature Guide. Exchange Bibliography No. 91.

    Science.gov (United States)

    Catanese, Anthony James

    Systemic planning is an operational approach to using scientific rigor and qualitative judgment in a complementary manner. It integrates rigorous techniques and methods from systems analysis, cybernetics, decision theory, and work programing. The annotated reference sources in this bibliography include those works that have been most influential…

  9. Nutrition & Adolescent Pregnancy: A Selected Annotated Bibliography.

    Science.gov (United States)

    National Agricultural Library (USDA), Washington, DC.

    This annotated bibliography on nutrition and adolescent pregnancy is intended to be a source of technical assistance for nurses, nutritionists, physicians, educators, social workers, and other personnel concerned with improving the health of teenage mothers and their babies. It is divided into two major sections. The first section lists selected…

  10. Annotated Bibliography of Law-Related Pollution Prevention Sources.

    Science.gov (United States)

    Lynch, Holly; Murphy, Elaine

    This annotated bibliography of law-related pollution prevention sources was prepared by the National Pollution Prevention Center for Higher Education. Some topics of the items include waste reduction, hazardous wastes, risk reduction, environmental policy, pollution prevention, environmental protection, environmental leadership, environmental…

  11. Douglas-fir tussock moth: an annotated bibliography.

    Science.gov (United States)

    Robert W. Campbell; Lorna C. Youngs

    1978-01-01

    This annotated bibliography includes references to 338 papers. Each deals in some way with either the Douglas-fir tussock moth, Orgyia pseudotsugata (McDunnough), or a related species. Specifically, 210 publications and 82 unpublished documents make some reference, at least, to the Douglas-fir tussock moth; 55 are concerned with other species in...

  12. Consumer energy research: an annotated bibliography. Vol. 3

    Energy Technology Data Exchange (ETDEWEB)

    Anderson, D.C.; McDougall, G.H.G.

    1983-04-01

    This annotated bibliography attempts to provide a comprehensive package of existing information in consumer related energy research. A concentrated effort was made to collect unpublished material as well as material from journals and other sources, including governments, utilities research institutes and private firms. A deliberate effort was made to include agencies outside North America. For the most part the bibliography is limited to annotations of empiracal studies. However, it includes a number of descriptive reports which appear to make a significant contribution to understanding consumers and energy use. The format of the annotations displays the author, date of publication, title and source of the study. Annotations of empirical studies are divided into four parts: objectives, methods, variables and findings/implications. Care was taken to provide a reasonable amount of detail in the annotations to enable the reader to understand the methodology, the results and the degree to which the implications fo the study can be generalized to other situations. Studies are arranged alphabetically by author. The content of the studies reviewed is classified in a series of tables which are intended to provide a summary of sources, types and foci of the various studies. These tables are intended to aid researchers interested in specific topics to locate those studies most relevant to their work. The studies are categorized using a number of different classification criteria, for example, methodology used, type of energy form, type of policy initiative, and type of consumer activity. A general overview of the studies is also presented. 17 tabs.

  13. Annotated Bibliography of Textbooks and Reference Materials in Marine Sciences. Provisional Edition. Intergovernmental Oceanographic Commission, Technical Series.

    Science.gov (United States)

    United Nations Educational, Scientific, and Cultural Organization, Paris (France). Intergovernmental Oceanographic Commission.

    Presented is an annotated bibliography based on selected materials from a preliminary survey of existing bibliographies, publishers' listings, and other sources. It is intended to serve educators and researchers, especially those in countries where marine sciences are just developing. One hundred annotated and 450 non-annotated entries are…

  14. Annotated Bibliography of EDGE2D Use

    Energy Technology Data Exchange (ETDEWEB)

    J.D. Strachan and G. Corrigan

    2005-06-24

    This annotated bibliography is intended to help EDGE2D users, and particularly new users, find existing published literature that has used EDGE2D. Our idea is that a person can find existing studies which may relate to his intended use, as well as gain ideas about other possible applications by scanning the attached tables.

  15. Annotated Bibliography of EDGE2D Use

    International Nuclear Information System (INIS)

    Strachan, J.D.; Corrigan, G.

    2005-01-01

    This annotated bibliography is intended to help EDGE2D users, and particularly new users, find existing published literature that has used EDGE2D. Our idea is that a person can find existing studies which may relate to his intended use, as well as gain ideas about other possible applications by scanning the attached tables

  16. Annotated Bibliography on Koreans in America. Working Papers on Asian American Studies.

    Science.gov (United States)

    Kim, Christopher; Takabashi, Michiko, Ed.

    This annotated bibliography lists bibliographies, directories, articles, unpublished papers, manuals, citations, conference reports, and other documents dealing with Koreans in America. Topics considered include general history, immigration history, deportation cases, Korean students, State and Federal legislation affecting Koreans in America,…

  17. Sex Discrimination in Higher Education and the Professions: An Annotated Bibliography.

    Science.gov (United States)

    Donovan, Mary

    An annotated bibliography on sex discrimination in higher education and the professions is presented. Sex discrimination remains a major workplace problem and is found in virtually all levels of employment. The bibliography consists of 124 citations which appeared from 1984-1988. It excludes court cases and the "popular press," and although not…

  18. A selective annotated bibliography for clinical audiology (1989-2009): books.

    Science.gov (United States)

    Ferrer-Vinent, Susan T; Ferrer-Vinent, Ignacio J

    2010-12-01

    This is the 2nd in a series of 3 planned companion articles that present a selected, annotated, and indexed bibliography of clinical audiology publications from 1989 through 2009. Research and preparation of the bibliography were based on published guidelines, professional audiology experience, and professional librarian experience. The first article in the series covered reference works. This article focuses on other books. The planned third companion article will present periodicals and online resources. Audiologists and librarians can use this bibliography to help them identify relevant clinical audiology literature.

  19. Annotated bibliography of South African indigenous evergreen forest ecology

    CSIR Research Space (South Africa)

    Geldenhuys, CJ

    1985-01-01

    Full Text Available Annotated references to 519 publications are presented, together with keyword listings and keyword, regional, place name and taxonomic indices. This bibliography forms part of the first phase of the activities of the Forest Biome Task Group....

  20. Pertinent Discussions Toward Modeling the Social Edition: Annotated Bibliographies

    NARCIS (Netherlands)

    Siemens, R.; Timney, M.; Leitch, C.; Koolen, C.; Garnett, A.

    2012-01-01

    The two annotated bibliographies present in this publication document and feature pertinent discussions toward the activity of modeling the social edition, first exploring reading devices, tools and social media issues and, second, social networking tools for professional readers in the Humanities.

  1. Eastern gas shales bibliography selected annotations: gas, oil, uranium, etc. Citations in bituminous shales worldwide

    Energy Technology Data Exchange (ETDEWEB)

    Hall, V.S. (comp.)

    1980-06-01

    This bibliography contains 2702 citations, most of which are annotated. They are arranged by author in numerical order with a geographical index following the listing. The work is international in scope and covers the early geological literature, continuing through 1979 with a few 1980 citations in Addendum II. Addendum I contains a listing of the reports, well logs and symposiums of the Unconventional Gas Recovery Program (UGR) through August 1979. There is an author-subject index for these publications following the listing. The second part of Addendum I is a listing of the UGR maps which also has a subject-author index following the map listing. Addendum II includes several important new titles on the Devonian shale as well as a few older citations which were not found until after the bibliography had been numbered and essentially completed. A geographic index for these citations follows this listing.

  2. Classic Religious Books for Children: An Annotated Bibliography.

    Science.gov (United States)

    Campbell, Carol, Comp.

    This annotated bibliography of religious books for children contains approximately 450 books, one-fifth of which are Judaic. The books' current availability has been verified using Web sites such as those of individual publishers, the Library of Congress, Amazon.com, or Barnes&Noble.com. New subject headings have been added, such as Kwanza,…

  3. Annotated Bibliography of Materials for Elementary Foreign Language Programs.

    Science.gov (United States)

    Dobb, Fred

    An annotated bibliography contains about 70 citations of instructional materials and materials concerning curriculum development for elementary school foreign language programs. Citations are included for Arabic, classical languages, French, German, Hebrew, Italian, Japanese, and Spanish. Items on exploratory language courses and general works on…

  4. WORKSHOPS FOR THE HANDICAPPED, AN ANNOTATED BIBLIOGRAPHY--NO. 3.

    Science.gov (United States)

    PERKINS, DOROTHY C.; AND OTHERS

    THESE 126 ANNOTATIONS ARE THE THIRD VOLUME OF A CONTINUING SERIES OF BIBLIOGRAPHIES LISTING ARTICLES APPEARING IN JOURNALS AND CONFERENCE, RESEARCH, AND PROJECT REPORTS. LISTINGS INCLUDE TESTS, TEST RESULTS, STAFF TRAINING PROGRAMS, GUIDES FOR COUNSELORS AND TEACHERS, AND ARCHITECTURAL PLANNING, AND RELATE TO THE MENTALLY RETARDED, EMOTIONALLY…

  5. Annotated Bibliography of Dr Salmani Nodoushan's Research on Education and Language Teaching

    Science.gov (United States)

    Etemadfar Kashani, Abbas Ali

    2016-01-01

    This is an annotated bibliography of the research conducted on education and language teaching and assessment by Dr. Mohammad Ali Salmani Nodoushan in the past 25 years. This bibliography is a precise picture of the current state of education and language teaching and assessment in Iran. Dr. Salmani Nodoushan is the most distinguished Iranian…

  6. Education--An Annotated Bibliography of Current Issues, July-September, 1989.

    Science.gov (United States)

    Wardell, David

    This annotated bibliography of newspaper and magazine articles on a wide variety of topics in education includes entries from the following publications: "Asahi Evening News,""Asian Wall Street Journal,""Daily Yomiuri,""International Herald Tribune,""Japan Times,""Mainichi Daily…

  7. Workshops for the Handicapped; An Annotated Bibliography - No. 6.

    Science.gov (United States)

    Perkins, Dorothy C., Comp.; And Others

    An annotated bibliography of workshops for the handicapped covers the literature on work programs for the period July, 1968 through June, 1969. One hundred and fifty four publications were reviewed; the number of articles on administration, management, and planning of facilities and programs has increased since the last edition. (Author/RJ)

  8. Annotated bibliography of uranium in Australia, 1970-1987

    International Nuclear Information System (INIS)

    O'Faircheallaigh, C.; Webb, A.; Wade-Marshall, D.

    1989-01-01

    The bibliography contains 845 separate numbered items which deal with uranium mining in Australia during the period 1970-1987, which it was feasible to annotate, which are publicly available, and which are not of a highly technical nature. The bibliography is not restricted to material originating in Australia. The items are organised into nine major subject areas on the basis of their principal subject matter, with cross references being added in cases where more than one subject area is dealt with. The nine sections deal with the development and structure of the Australian uranium industry; the uranium debate; uranium policies; uranium and Aborigines; economic issues; domestic processing and utilisation of Australian uranium; environmental issues; nuclear proliferation and safeguards; and the major individual uranium projects. The bibliography is preceded by a chapter on its scope, organisation and sources and by an overview providing background information on the nuclear fuel cycle, uranium in Australia and Australian uranium policy and is followed by an author index

  9. Adolescent Literacy Resources: An Annotated Bibliography. Second Edition 2009

    Science.gov (United States)

    Center on Instruction, 2009

    2009-01-01

    This annotated bibliography updated from a 2007 edition, is intended as a resource for technical assistance providers as they work with states on adolescent literacy. This revision includes current research and documents of practical use in guiding improvements in grades 4-12 reading instruction in the content areas and in interventions for…

  10. Annotated bibliography of remote sensing methods for monitoring desertification

    Science.gov (United States)

    Walker, A.S.; Robinove, Charles J.

    1981-01-01

    Remote sensing techniques are valuable for locating, assessing, and monitoring desertification. Remotely sensed data provide a permanent record of the condition of the land in a format that allows changes in land features and condition to be measured. The annotated bibliography of 118 items discusses remote sensing methods that may be applied to desertification studies.

  11. Legal and Political Aspects of Satellite Telecommunication: An Annotated Bibliography.

    Science.gov (United States)

    Shervis, Katherine, Comp.

    The potential of satellites for telecommunication is enormous; however, it is possible that political and legal barriers rather than technological considerations will ultimately shape the utilization of satellite systems. This annotated bibliography is designed for use by lawyers, political scientists, technicians, engineers, and scholars who need…

  12. An Annotated Bibliography of Education for Medical Librarianship, 1940-1968

    Science.gov (United States)

    Shirley, Sherrilynne

    1969-01-01

    An attempt has been made in this bibliography to represent the various viewpoints concerning education for medical librarianship equally. The topics covered include: general background reading and readings for those interested in establishing courses in medical librarianship. The former includes annotations on the history and international aspects of the subject. The latter consists of annotations of articles on early courses and present courses in medical librarianship. A final area discussed is the Medical Library Association's Code for the Training and Certification of Medical Librarians. PMID:4898629

  13. Annotated Bibliography; Freedom of Information Center Reports and Summary Papers.

    Science.gov (United States)

    Freedom of Information Center, Columbia, MO.

    This bibliography lists and annotates almost 400 information reports, opinion papers, and summary papers dealing with freedom of information. Topics covered include the nature of press freedom and increased press efforts toward more open access to information; the press situation in many foreign countries, including France, Sweden, Communist…

  14. By the Book: An Annotated Bibliography of Music-Based Picture Books.

    Science.gov (United States)

    Sotherden, Emily

    2002-01-01

    Provides an annotated bibliography of music related picture books that can be used in the music classroom. Discusses the benefits of using picture books for all ages. Includes books in ten categories, such as instruments, ensembles, and styles of music. (CMK)

  15. Health Education Intervention. An Annotated Bibliography. Nutrition Education Series Issue 13.

    Science.gov (United States)

    United Nations Educational, Scientific, and Cultural Organization, Paris (France).

    This annotated bibliography contains 73 citations describing health education programs around the world. Countries represented include: Bangladesh, Egypt, Gambia, Gilbert Islands, Guatemala, Haiti, Honduras, Jamaica, Kenya, Indonesia, Nicaragua, Peru, Philippines, Swaziland, Thailand, Tunisia, Australia, Colombia, India, United Kingdom, Canada,…

  16. Thermal effects on aquatic organisms: an annotated bibliography of the 1977 literature

    International Nuclear Information System (INIS)

    Talmage, S.S.

    1978-12-01

    This bibliography, containing 537 references from the 1977 literature, is the seventh in a series of annotated bibliographies on the effects of heat on aquatic organisms. The effects of thermal discharges at power plant sites are emphasized. Laboratory and field studies on temperature tolerance and the effects of temperature changes on reproduction, development, growth, distribution, physiology, and sensitivity to other stresses are included. References in the bibliography are divided into three subject categories: marine systems, freshwater systems, and estuaries. The references are arranged alphabetically by first author. Indexes are provided for author, keywords, subject category, geographic location of the study, taxon, and title

  17. Recruiting and Retaining Army Nurses: An Annotated Bibliography

    OpenAIRE

    Roberts, Benjamin J.; Kocher, Kathryn M.

    1988-01-01

    This listing of annotated references includes studies dealing with the labor market behavior of registered nurses. References describing both the military and the civilian working environments for RNs are contained in the bibliography. Because the Army must recruit and retain nurses in the context of the national labor market for nurses, a broad perspective was maintained in selecting publication. Studies dealing with the factors influential in attracting and retaining Army Active Duty and Re...

  18. Cultural Influences on Intertemporal Reasoning: An Annotated Bibliography

    Science.gov (United States)

    2011-11-30

    relative. Loans have moral connotations. Both parties are “loved by Allah” (p. 117). But to ask for a loan implies that one is not self-sufficient...to Pukhtun. Debts to Pukhtuns must be repaid. When debts are owed to outsiders, there is no moral obligation to repay. Among themselves, Pukhtun...what truth is.” (p. 25) Annotated Bibliography 29 NOTE: In other sections of the book, Shuon discusses the relativism of Christianity in

  19. Entrepreneurship Education for Agriculture. Phase "O" Planning Project Report. Performance Report. Volume II: Bibliography and Storyboard Scripts.

    Science.gov (United States)

    Lee and Associates, Starkville, MS.

    Volume 2 of this report is supplementary and contains three bibliographies: (1) Annotated Bibliography on Minority Entrepreneurship in Agriculture; (2) Annotated Bibliography on Entrepreneurship Education in Agriculture; (3) Bibliography on Entrepreneurship. The next section presents three storyboard scripts for instructional videotapes on…

  20. A selective annotated bibliography for clinical audiology (1988-2008): reference works.

    Science.gov (United States)

    Ferrer-Vinent, Susan T; Ferrer-Vinent, Ignacio J

    2009-06-01

    This is the 1st in a series of 3 planned companion articles that present a selected, annotated, and indexed bibliography of clinical audiology publications from 1988 to 2008. Research and preparation of the bibliography were based on published guidelines, professional audiology experience, and professional librarian experience. This article presents reference works (dictionaries, encyclopedias, handbooks, and manuals). The future planned articles will cover other monographs, periodicals, and online resources. Audiologists and librarians can use these lists as a guide when seeking clinical audiology literature.

  1. Environmental Support to Amphibious Craft, Patrol Boats, and Coastal Ships: An Annotated Bibliography

    National Research Council Canada - National Science Library

    Bachmann, Charles M; Fusina, Robert A; Nichols, C. R; McDermid, Jack

    2008-01-01

    This annotated bibliography is a selection of citations to books, articles, documents, and data bases highlighting environmental conditions that impact the safety and performance of amphibious craft...

  2. Annotated bibliography on artificial recharge of ground water, 1955-67

    Science.gov (United States)

    Signor, Donald C.; Growitz, Douglas J.; Kam, William

    1970-01-01

    Artificial ground-water recharge has become more important as water use by agriculture, industry, and municipalities increases. Water management agencies are increasingly interested in potential use of recharge for pollution abatement, waste-water disposal, and re-use and reclamation of locally available supplies. Research projects and theoretical analyses of operational recharge systems show increased scientific emphasis on the practice. Overall ground-water basin management systems generally now contain considerations of artificial recharge, whether by direct or indirect methods. Artificial ground-water recharge is a means of conserving surface runoff for future use in places where it would otherwise be lost, of protecting ground-water basins from salt-water encroachment along coastal areas, and of storing and distributing imported water. The biblio-graphy emphasizes technology; however, annotations of articles on waste-water reclamation, ground-water management and ground-water basin management are included. Subjects closely related to artificial recharge, including colloidal flow through porous media, field or laboratory instrumentation, and waste disposal by deep well injection are included where they specifically relate to potential recharge problems. Where almost the same material has been published in several journals, all references are included on the assumption that some publications may be more readily available to interested persons than others. Other publications, especially those of foreign literature, provided abstracts that were used freely as time limitations precluded obtaining and annotating all materials. Abstracts taken from published sources are noted. These are: "Abstracts of North American Geology," U.S. Department of the Interior, Geological Survey; "Abstracts of Recent Published Material on Foil and Water Conservation," ARS-41 series, Agricultural F.esearch Service, U.S. Department of Agriculture; "Water and1 Water

  3. Annotated bibliography of Software Engineering Laboratory literature

    Science.gov (United States)

    Morusiewicz, Linda; Valett, Jon D.

    1991-01-01

    An annotated bibliography of technical papers, documents, and memorandums produced by or related to the Software Engineering Laboratory is given. More than 100 publications are summarized. These publications cover many areas of software engineering and range from research reports to software documentation. All materials have been grouped into eight general subject areas for easy reference: The Software Engineering Laboratory; The Software Engineering Laboratory: Software Development Documents; Software Tools; Software Models; Software Measurement; Technology Evaluations; Ada Technology; and Data Collection. Subject and author indexes further classify these documents by specific topic and individual author.

  4. Pulsed power bibliography. Volume 2: Annotated bibliography

    Science.gov (United States)

    Bemesderfer, J.; Druce, R. L.; Frantz, B.; Guenther, A. H.; Kristiansen, M.; Oloughlin, J. P.; Pendleton, W. K.

    1983-08-01

    Pulsed power and high-voltage technologies are playing an ever increasing role in weapons' effects simulation, fusion power research, power distribution, materials processing and medical research. It is a rapidly expanding field of applied physics as evidenced by the growth in published literature. Three years ago, the Air Force Weapons Laboratory (AFWL) initiated a project to compile a computerized data base of pulsed power research papers. The data base is stored on our IBM System 2000. This AFWL Technical Report is the first release of the bibliography to date. It contains about 2,500 full bibliographic citations, original sources, availability, key words and abstracts. There are three indices: Subject, Personal Author, and Corporate. There are 30 main subject headings, from Breakdown Studies to Switching. Volume II contains the citations. In addition to these entries, the data base contains about 7,500 additional titles. As these titles are added to the full bibliography, they will be published.

  5. Ethical Issues in Health Services: A Report and Annotated Bibliography.

    Science.gov (United States)

    Carmody, James

    This publication identifies, discusses, and lists areas for further research for five ethical issues related to health services: 1) the right to health care; 2) death and euthanasia; 3) human experimentation; 4) genetic engineering; and, 5) abortion. Following a discussion of each issue is a selected annotated bibliography covering the years 1967…

  6. An Annotated Bibliography of the Gestalt Methods, Techniques, and Therapy

    Science.gov (United States)

    Prewitt-Diaz, Joseph O.

    The purpose of this annotated bibliography is to provide the reader with a guide to relevant research in the area of Gestalt therapy, techniques, and methods. The majority of the references are journal articles written within the last 5 years or documents easily obtained through interlibrary loans from local libraries. These references were…

  7. Fluid inclusions in salt: an annotated bibliography

    International Nuclear Information System (INIS)

    Isherwood, D.J.

    1979-01-01

    An annotated bibliography is presented which was compiled while searching the literature for information on fluid inclusions in salt for the Nuclear Regulatory Commission's study on the deep-geologic disposal of nuclear waste. The migration of fluid inclusions in a thermal gradient is a potential hazard to the safe disposal of nuclear waste in a salt repository. At the present time, a prediction as to whether this hazard precludes the use of salt for waste disposal can not be made. Limited data from the Salt-Vault in situ heater experiments in the early 1960's (Bradshaw and McClain, 1971) leave little doubt that fluid inclusions can migrate towards a heat source. In addition to the bibliography, there is a brief summary of the physical and chemical characteristics that together with the temperature of the waste will determine the chemical composition of the brine in contact with the waste canister, the rate of fluid migration, and the brine-canister-waste interactions

  8. DOE Hydropower Program biennial report 1990--1991 (with updated annotated bibliography)

    Energy Technology Data Exchange (ETDEWEB)

    Chappell, J.R.; Rinehart, B.N.; Sommers, G.L. (Idaho National Engineering Lab., Idaho Falls, ID (United States)); Sale, M.J. (Oak Ridge National Lab., TN (United States))

    1991-07-01

    This report summarizes the activities of the US Department of Energy's (DOE) Hydropower Program for fiscal years 1990 and 1991, and provides an annotated bibliography of research, engineering, operations, regulations, and costs of projects pertinent to hydropower development. The Hydropower Program is organized as follows: background (including Technology Development and Engineering Research and Development); Resource Assessment; National Energy Strategy; Technology Transfer; Environmental Research; and, the bibliography discusses reports written by both private and non-Federal Government sectors. Most reports are available from the National Technical Information Service. 5 figs., 2 tabs.

  9. Annotated Bibliography of Children's Literature Resources on War, Terrorism, and Disaster since 1945: By Continents/Countries for Grades K-8

    Science.gov (United States)

    Gangi, Jane M.

    2009-01-01

    This article presents an annotated bibliography of children's literature resources on war, terrorism, and disaster since 1945. This annotated bibliography focuses on grades K-8 from different continents/countries, including (1) Africa; (2) Asia; (3) The Caribbean; (4) Central and South America; (5) Europe; and (6) The Middle East.

  10. Annotated bibliography of the physical data of Rainier Mesa and Yucca Mountain

    International Nuclear Information System (INIS)

    Russell, C.E.

    1988-09-01

    Yucca Mountain, located on and adjacent to the Nevada Test Site (NTS) has been designated as the only site to undergo characterization to determine if it meets the criteria to become the Nation's first high-level nuclear waste repository. During this process, care must be taken to not compromise the site's integrity through excessive testing. In order to supplement the limited data to be gathered at Yucca Mountain, analog areas are to be considered. This annotated bibliography was compiled by the Desert Research Institute to help investigate ways in which Rainier Mesa could either be used as a supplemental repository test site or where existing Rainier Mesa data can be used either to support or refute test results from Yucca Mountain. Rainier Mesa, the location of numerous underground nuclear tests on the NTS, possesses some geologic characteristics similar to those of Yucca Mountain, which makes it a likely candidate for comparison. Almost 500 references regarding geology, hydrology, meteorology, biology, and archaeology were annotated and entered alpha-numerically into the bibliography. These references were categorized into 50 topics which are defined in Section 2 and presented in Section 3. Each reference is categorized as to whether it contains Yucca Mountain data, Rainier Mesa data, or both, and a final category consists of those reports that contain Rainier Mesa data that have already been applied to Yucca Mountain research. The annotated bibliography is presented in Section 4

  11. Impingement and entrainment: an updated annotated bibliography. Final report

    International Nuclear Information System (INIS)

    Yost, F.E.; Uziel, M.S.

    1981-05-01

    Presented as an annotated bibliography are 1343 references dealing with entrainment and impingement effects on aquatic organisms passing through the cooling systems of thermal power plants. The references were obtained from open literature and from environmental reports and impact statements prepared by or for the electric utility industry. Two earlier bibliographies contain literature from 1950 through 1976. This update contains additional literature acquired since 1976. Topics covered are site-specific field studies at facilities located on lakes, reservoirs, rivers, or estuaries. The studies include special engineering studies, laboratory studies, studies of biological effects, reviews and methodologies, and studies of the mitigation of effects. References are arranged alphabetically by author, and indexes are provided to personal and corporate authors, and to facility, waterbody, and taxonomic names

  12. Radicalization: An Overview and Annotated Bibliography of Open-Source Literature

    Science.gov (United States)

    2006-12-15

    particularly with liberal, democratic, and humanistic Muslims Phares points to Jihadism as the main root cause of terrorism and suggests that defending...An Overview and Annotated Bibliography of Open-Source Literature 155 of ambiguity), epistemic and existential needs theory (need for closure...This book presents Terror Management Theory, which addresses behavioral and psychological responses to terrorist events. An existential

  13. Annotated Bibliography of Bird Hazards to Aircraft: Bird Strike Committee Citations 1967-1997

    National Research Council Canada - National Science Library

    Short, Jeffrey

    1998-01-01

    .... This annotated bibliography of bird hazards to aircraft, termed ABBHA, is a compilation of citations with abstracts on a wide range of related topics such as bird strike tolerance engineering, bird...

  14. ANNOTATED BIBLIOGRAPHY OF RUSSIAN LITERATURE ON GLACIOLOGY IN 2010

    Directory of Open Access Journals (Sweden)

    V. M. Kotlyakov

    2012-01-01

    Full Text Available This bibliography includes 294 books and articles published mostly in 2010. Annotated books and articles relate to ten thematic sections of glaciology:1. General problems of glaciology2. Physics and chemistry of ice3. Ice in atmosphere4. Snow cover5. Snow avalanches and glacial mudflows6. Sea ice7. River and lake ice8. Icings and ground ice9. Glaciers and ice sheets10. Paleoglaciology

  15. Teaching Diversity and Aging through Active Learning Strategies: An Annotated Bibliography.

    Science.gov (United States)

    Fried, Stephen B.; Mehrotra, Chandra M.

    Covering 10 topical areas, this annotated bibliography offers a guide to journal articles, book chapters, monographs, and books useful for teaching diversity and aging through active learning. Active learning experiences may help expand students' awareness of elements of their own diversity, broaden their world view, and enhance their culturally…

  16. Teacher-to-Teacher: An Annotated Bibliography on DNA and Genetic Engineering.

    Science.gov (United States)

    Mertens, Thomas R., Comp.

    1984-01-01

    Presented is an annotated bibliography of 24 books on DNA and genetic engineering. Areas considered in these books include: basic biological concepts to help understand advances in genetic engineering; applications of genetic engineering; social, legal, and moral issues of genetic engineering; and historical aspects leading to advances in…

  17. The UNO Aviation Monograph Series: Aviation Security: An Annotated Bibliography of Responses to the Gore Commission

    Science.gov (United States)

    Carrico, John S.; Schaaf, Michaela M.

    1998-01-01

    This monograph is a companion to UNOAI Monograph 96-2, "The Image of Airport Security: An Annotated Bibliography," compiled in June 1996. The White House Commission on Aviation Safety and Security, headed by Vice President Al Gore, was formed as a result of the TWA Flight 800 crash in August 1996. The Commission's final report included 31 recommendations addressed toward aviation security. The recommendations were cause for security issues to be revisited in the media and by the aviation industry. These developments necessitated the need for an updated bibliography to review the resulting literature. Many of the articles were written in response to the recommendations made by the Gore Commission. "Aviation Security: An Annotated Bibliography of Responses to the Gore Commission" is the result of this need.

  18. Thermal effects on aquatic organisms: an annotated bibliography of the 1977 literature

    Energy Technology Data Exchange (ETDEWEB)

    Talmage, S.S. (comp.)

    1978-12-01

    This bibliography, containing 537 references from the 1977 literature, is the seventh in a series of annotated bibliographies on the effects of heat on aquatic organisms. The effects of thermal discharges at power plant sites are emphasized. Laboratory and field studies on temperature tolerance and the effects of temperature changes on reproduction, development, growth, distribution, physiology, and sensitivity to other stresses are included. References in the bibliography are divided into three subject categories: marine systems, freshwater systems, and estuaries. The references are arranged alphabetically by first author. Indexes are provided for author, keywords, subject category, geographic location of the study, taxon, and title (alphabetical listing of keywords-in-context of nontrivial words in the title).

  19. Annotated bibliography for the humpback chub (Gila cypha) with emphasis on the Grand Canyon population.

    Energy Technology Data Exchange (ETDEWEB)

    Goulet, C. T.; LaGory, K. E.; Environmental Science Division

    2009-10-05

    Glen Canyon Dam is a hydroelectric facility located on the Colorado River in Arizona that is operated by the U.S. Bureau of Reclamation (Reclamation) for multiple purposes including water storage, flood control, power generation, recreation, and enhancement of fish and wildlife. Glen Canyon Dam operations have been managed for the last several years to improve conditions for the humpback chub (Gila cypha) and other ecosystem components. An extensive amount of literature has been produced on the humpback chub. We developed this annotated bibliography to assist managers and researchers in the Grand Canyon as they perform assessments, refine management strategies, and develop new studies to examine the factors affecting humpback chub. The U.S. Geological Survey recently created a multispecies bibliography (including references on the humpback chub) entitled Bibliography of Native Colorado River Big Fishes (available at www.fort.usgs.gov/Products/data/COFishBib). That bibliography, while quite extensive and broader in scope than ours, is not annotated, and, therefore, does not provide any of the information in the original literature. In developing this annotated bibliography, we have attempted to assemble abstracts from relevant published literature. We present here abstracts taken unmodified from individual reports and articles except where noted. The bibliography spans references from 1976 to 2009 and is organized in five broad topical areas, including: (1) biology, (2) ecology, (3) impacts of dam operations, (4) other impacts, and (5) conservation and management, and includes twenty subcategories. Within each subcategory, we present abstracts alphabetically by author and chronologically by year. We present relevant articles not specific to either the humpback chub or Glen Canyon Dam, but cited in other included reports, under the Supporting Articles subcategory. We provide all citations in alphabetical order in Section 7.

  20. Research on College Board Programs and Services: Annotated Bibliography 2012. Research in Review 2012-2

    Science.gov (United States)

    Barry, Carol; Bausmith, Jennifer; Cooney, Siobhan; Laitusis, Vytas; Matos-Elefonte, Haifa; McKillip, Mary; Niu, Sunny; Rawls, Anita

    2012-01-01

    This annotated bibliography contains summaries of research studies examining a number of College Board assessments and programs. To be included in the bibliography, each study needed to meet a number of criteria. First, articles must have been published (as a College Board research report, in an external journal, or as an ETS research report).…

  1. Low-level radioactive waste technology: a selected, annotated bibliography

    International Nuclear Information System (INIS)

    Fore, C.S.; Carrier, R.F.; Brewster, R.H.; Hyder, L.K.; Barnes, K.A.

    1981-10-01

    This annotated bibliography of 416 references represents the third in a series to be published by the Hazardous Materials Information Center containing scientific, technical, economic, and regulatory information relevant to low-level radioactive waste technology. The bibliography focuses on disposal site, environmental transport, and waste treatment studies as well as general reviews on the subject. The publication covers both domestic and foreign literature for the period 1951 to 1981. Major chapters selected are Chemical and Physical Aspects; Container Design and Performance; Disposal Site; Environmental Transport; General Studies and Reviews; Geology, Hydrology, and Site Resources; Regulatory and Economic Aspects; Social Aspects; Transportation Technology; Waste Production; and Waste Treatment. Entries in each of the chapters are further classified as a field study, laboratory study, theoretical study, or general overview involving one or more of these research areas

  2. Questionnaires for research: an annotated bibliography on design, construction, and use.

    Science.gov (United States)

    Dale R. Potter; Kathryn M. Sharpe; John C. Hendee; Roger N. Clark

    1972-01-01

    Questionnaires as social science tools are used increasingly to study people aspects of outdoor recreation and other natural resource fields. An annotated bibliography including subjective evaluations of each article and a keyword list is presented for 193 references to aid researchers and managers in the design, construction, and use of mail questionnaires.

  3. Consumer energy research: an annotated bibliography. Vol. 1. [Some text in French

    Energy Technology Data Exchange (ETDEWEB)

    Anderson, D.C.; McDougall, G.H.G.

    1983-01-01

    This annotated bibliography attempts to provide a comprehensive package of existing information in consumer related energy research. A concentrated effort was made to collect unpublished material as well as material from journals and other sources, including governments, utilities, research institutes and private firms. A deliberate effort was made to include agencies outside North America. For the most part the bibliography is limited to annotations of empirical studies. However, it includes a number of descriptive reports which appear to make a significant contribution to understanding consumers and energy use. The format of the annotations diplays the author, date of publication, title and source of the study. Annotations of empirical studies are divided into four parts: objectives, methods, variables and findings/implications. Care was taken to provide a reasonable amount of detail in the annotations to enable the reader to understand the methodology, the results and the degree to which the implications of the study can be generalized to other situations. Studies are arranged alphabetically by author. The content of the studies reviewed is classified in a series of tables which are intended to provide a summary of sources, types and foci of the various studies. These tables are intended to aid researchers interested in specific topics to locate those studies most relevant to their work. The studies are categorized using a number of different classification criteria, for example, methodology used, type of energy form, type of policy initiative, and type of consumer activity. A general overview of the studies is also presented. 20 tabs.

  4. Thermal effects on aquatic organisms: annotated bibliography of the 1974 literature

    International Nuclear Information System (INIS)

    Coutant, C.C.; Talmage, S.S.; Carrier, R.F.; Collier, B.N.

    1975-06-01

    The annotated bibliography covers the 1974 literature concerning thermal effects on aquatic organisms. Emphasis is placed on the effects of the release of thermal effluents on aquatic ecosystems. Indexes are provided for: author, keywords, subject category, geographic location, taxon, and title (alphabetical listing of keyword-in-context of the nontrivial words in the title). (CH)

  5. An Annotated and Cross-Referenced Bibliography on Computer Security and Access Control in Computer Systems.

    Science.gov (United States)

    Bergart, Jeffrey G.; And Others

    This paper represents a careful study of published works on computer security and access control in computer systems. The study includes a selective annotated bibliography of some eighty-five important published results in the field and, based on these papers, analyzes the state of the art. In annotating these works, the authors try to be…

  6. Geomicrobiology and its relevance to nuclear waste disposal - a further annotated bibliography

    International Nuclear Information System (INIS)

    West, J.M.; Arme, S.C.

    1984-07-01

    Scientific investigations into the disposal of high/intermediate level radioactive waste into deep geological formations includes work in the field of geomicrobiology. It has been shown that microbes exist in deep and shallow geological formations and that they could alter the geochemical environment of a waste repository and influence radionuclide migration. A preliminary literature survey indicated a lack of annotated material and an initial report (West, McKinley and Christofi, 1982) provided the first bibliography. This report is an updated annotated bibliography of relevant geomicrobiological research published since 1982 and should be used in conjunction with the previous report. Those without specific biological experience may find the glossary of common terms in the initial report of use. A major area of work which has not been referenced widely here is near surface disposal of both radioactive and conventional industrial waste. This vast topic can be accessed via some of the general reviews in this report. (author)

  7. Annotated Bibliography of Alcohol, Other Drug, and Violence Prevention Resources, 2006-2008

    Science.gov (United States)

    Segars, Lance, Ed.; Akinola, Olayinka, Ed.

    2009-01-01

    The U.S. Department of Education's Higher Education Center for Alcohol and Other Drug Abuse and Violence Prevention has developed this annotated bibliography to provide those interested in prevention at colleges and universities--and in surrounding communities--with a ready reference of current, important, and available information resources.…

  8. Individualization and Modularization of Vocational Education Instructional Materials. An Annotated Bibliography of Publications and Projects. Bibliography Series No. 32.

    Science.gov (United States)

    Magisos, Joel H., Comp.; Stakelon, Anne E., Comp.

    This annotated bibliography is designed to assist applicants for research grants under part C (section 131a) of the amendments to the Vocational Education Act of 1963 by providing access to documents, journal articles, and current projects related to the individualization and modularization of vocational education instructional materials. The…

  9. Promoting positive parenting: an annotated bibliography.

    Science.gov (United States)

    Ahmann, Elizabeth

    2002-01-01

    Positive parenting is built on respect for children and helps develop self-esteem, inner discipline, self-confidence, responsibility, and resourcefulness. Positive parenting is also good for parents: parents feel good about parenting well. It builds a sense of dignity. Positive parenting can be learned. Understanding normal development is a first step, so that parents can distinguish common behaviors in a stage of development from "problems." Central to positive parenting is developing thoughtful approaches to child guidance that can be used in place of anger, manipulation, punishment, and rewards. Support for developing creative and loving approaches to meet special parenting challenges, such as temperament, disabilities, separation and loss, and adoption, is sometimes necessary as well. This annotated bibliography offers resources to professionals helping parents and to parents wishing to develop positive parenting skills.

  10. Working Papers on Asian American Studies: Annotated Bibliography on Koreans in America.

    Science.gov (United States)

    Kim, Christopher

    This classified annotated bibliography on Koreans in America includes references on the following topics: (1) Korean American directories, (2) immigration history, (3) deportation cases, (4) Korean students in the U.S., (5) Korean Americans in the Asian American Movement, (6) state and federal legislation affecting Koreans in America, (7) Korean…

  11. Annotated bibliography of software engineering laboratory literature

    Science.gov (United States)

    Kistler, David; Bristow, John; Smith, Don

    1994-01-01

    This document is an annotated bibliography of technical papers, documents, and memorandums produced by or related to the Software Engineering Laboratory. Nearly 200 publications are summarized. These publications cover many areas of software engineering and range from research reports to software documentation. This document has been updated and reorganized substantially since the original version (SEL-82-006, November 1982). All materials have been grouped into eight general subject areas for easy reference: (1) The Software Engineering Laboratory; (2) The Software Engineering Laboratory: Software Development Documents; (3) Software Tools; (4) Software Models; (5) Software Measurement; (6) Technology Evaluations; (7) Ada Technology; and (8) Data Collection. This document contains an index of these publications classified by individual author.

  12. Forestry-based biomass economic and financial information and tools: An annotated bibliography

    Science.gov (United States)

    Dan Loeffler; Jason Brandt; Todd Morgan; Greg Jones

    2010-01-01

    This annotated bibliography is a synthesis of information products available to land managers in the western United States regarding economic and financial aspects of forestry-based woody biomass removal, a component of fire hazard and/or fuel reduction treatments. This publication contains over 200 forestry-based biomass papers, financial models, sources of biomass...

  13. Annotated bibliography of the Russian languages literature on glaciology for 2015

    Directory of Open Access Journals (Sweden)

    V. M. Kotlyakov

    2017-01-01

    Full Text Available The proposed annual bibliography continues annotated lists of the Russian‑language literature on glaciology that were regularly published in the past. It includes 245 references grouped into the following ten sections: 1  general issues of glaciology; 2  physics and chemistry of ice; 3  atmospheric ice; 4  snow cover; 5  ava‑ lanches and glacial mudflows; 6 sea ice; 7 river and lake ice; 8 icings and ground ice; 9 the glaciers and ice caps; 10 palaeoglaciology. In addition to the works of the current year, some works of earlier years are added, that, for various reasons, were not included in previous bibliographies.

  14. An Annotated Bibliography on Silicon Nitride for Structural Applications

    Science.gov (United States)

    1977-03-01

    annotated in this bibliography with each entry under the name of the specific author. 16. Canteloup, J., and Mocellin , A., "Synthesis of...thinning. Oxidation of the SJ3N4 grains started at the grain boundaries. 81. Torre, J. P., and Mocellin , A., "On the Existence of Si-AI-O-N Solid...Torre, J. P., and Mocellin , A., "Some Effects of Al and O2 on the Nitridation of Silicon Compacts", J. Mater. Sei., 11., 1725-1733(1976). Highest final

  15. Annotated Bibliography: Denmark

    DEFF Research Database (Denmark)

    Rytter, Jens Elo; Gøtze, Michael

    2008-01-01

    The bibliography includes the most important DaNISH BOOKS OF GENERAL INTEREST IN THE FIELD OF PUBLIC LAW IN THE PERIOD FROM 2006 - 2007.......The bibliography includes the most important DaNISH BOOKS OF GENERAL INTEREST IN THE FIELD OF PUBLIC LAW IN THE PERIOD FROM 2006 - 2007....

  16. Pulsed power bibliography. Volume 2. Annotated bibliography. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Bemesderfer, J.; Druce, R.L.; Frantz, B.; Guenther, A.H.; Kristiansen, M.

    1983-08-01

    Pulsed power and high-voltage technologies are playing an ever increasing role in weapons' effects simulation, fusion power research, power distribution, materials processing and medical research. It is a rapidly expanding field of applied physics as evidenced by the growth in published literature. Three years ago, the Air Force Weapons Laboratory (AFWL) initiated a project to compile a computerized data base of pulsed power research papers. The data base is stored on our IBM System 2000. This AFWL Technical Report is the first release of the bibliography to date. It contains about 2,500 full bibliographic citations, original sources, availability, key words and abstracts. There are three indices: Subject, Personal Author, and Corporate. There are 30 main subject headings, from Breakdown Studies to Switching. Volume II contains the citations. In addition to these entries, the data base contains about 7,500 additional titles. As these titles are added to the full bibliography, they will be published.

  17. Annotated Bibliography on School Finance: Policy and Political Issues; Federal Government; State Issues; Non-Public Schools; Accountability.

    Science.gov (United States)

    Gipson, Joella

    Limited to periodical literature, this annotated bibliography on school finance contains 81 references grouped in 5 categories: (1) policy and politica issues, (2) federal government, (3) state issues, (4) aid to nonpublic schools, and (5) accountability. Following the bibliographic citations, annotations range from 4 to 15 lines and conclude by…

  18. An annotated bibliography of completed and in-progress behavioral research for the Office of Buildings and Community Systems. [About 1000 items, usually with abstracts

    Energy Technology Data Exchange (ETDEWEB)

    Weijo, R.O.; Roberson, B.F.; Eckert, R.; Anderson, M.R.

    1988-05-01

    This report provides an annotated bibliography of completed and in-progress consumer decision research useful for technology transfer and commercialization planning by the US Department of Energy's (DOE) Office of Buildings and Community Systems (OBCS). This report attempts to integrate the consumer research studies conducted across several public and private organizations over the last four to five years. Some of the sources of studies included in this annotated bibliography are DOE National Laboratories, public and private utilities, trade associations, states, and nonprofit organizations. This study divides the articles identified in this annotated bibliography into sections that are consistent with or similar to the system of organization used by OBCS.

  19. School Sexuality Education: Opposition and Answers. Materials from the Katharine Dexter McCormick Library: A Selective, Annotated Bibliography.

    Science.gov (United States)

    Modig, Zeau D., Ed.

    This annotated bibliography was compiled as a guide for educators, administrators, counselors, parents, and everyone concerned about the opponents of sexuality education in schools, their arguments, and their tactics. Entries were chosen to represent a variety of materials in terms of both format and content. This bibliography is divided into…

  20. Assessment and management of animal damage in Pacific Northwest forests: an annotated bibliography.

    Science.gov (United States)

    D.M. Loucks; H.C. Black; M.L. Roush; S.R. Radosevich

    1990-01-01

    This annotated bibliography of published literature provides a comprehensive source of information on animal damage assessment and management for forest land managers and others in the Pacific Northwest. Citations and abstracts from more than 900 papers are indexed by subject and author. The publication complements and supplements A Silvicultural Approach to...

  1. Grass buffers for playas in agricultural landscapes: An annotated bibliography

    Science.gov (United States)

    Melcher, Cynthia P.; Skagen, Susan K.

    2005-01-01

    This bibliography and associated literature synthesis (Melcher and Skagen, 2005) was developed for the Playa Lakes Joint Venture (PLJV). The PLJV sought compilation and annotation of the literature on grass buffers for protecting playas from runoff containing sediments, nutrients, pesticides, and other contaminants. In addition, PLJV sought information regarding the extent to which buffers may attenuate the precipitation runoff needed to fill playas, and avian use of buffers. We emphasize grass buffers, but we also provide information on other buffer types.

  2. Annotated Bibliography. Conference Materials: Strategy Conference on Education and the Economy (Washington, D.C., September 22-24, 1981).

    Science.gov (United States)

    Center for Law and Education, Boston, MA.

    The 22 items included in a packet distributed to participants at a 1981 conference on education and the economy are listed in this annotated bibliography, with sources for the items identified. The materials include articles, chapters from books, and monographs, as well as a resource guide and bibliography concerning rural economic and community…

  3. An Annotated Bibliography of Research on Reading and Adults Learning English as a Second Language.

    Science.gov (United States)

    Burt, Miriam, Comp.; Florez, MaryAnn, Comp.; Terrill, Lynda, Comp.; Van Duzer, Carol, Comp.

    This annotated bibliography contains 27 references regarding research on reading and adults learning English as a Second Language (ESL). None of the resources are more than 10 years old. (Adjunct ERIC Clearinghouse for ESL Literacy Education) (KFT)

  4. College and University Rankings: Part 2--An Annotated Bibliography of Analysis, Criticism, and Evaluation.

    Science.gov (United States)

    Hattendorf, Lynn C.

    1987-01-01

    This annotated bibliography of recent articles and books on academic rankings updates an article in the Spring 1986 "RQ." Items are listed by subject and ranking in general; individual guides; subject areas including accounting, advertising, biogeography, business, communications, data communications, economics, music, publishing,…

  5. An Annotated Bibliography of HVDC Transmission and FACTS Devices, 1996-1997.

    Energy Technology Data Exchange (ETDEWEB)

    Litzenberger, Wayne H.; Varma, Rajiv K.; Flanagan, John D. [eds.

    1998-06-01

    This edition of the Annotated Bibliography of HVDC Transmission and FACTS Devices continues work begun in 1962 by the late Erik Bromberg, Bonneville Power Administration Librarian. His original bibliography covered the period 1932--1962. Subsequent editions were compiled by Bromberg, Val S. Lava, and Wayne Litzenberger, all of Bonneville Power Administration. Beginning with the 1991--1993 edition, the scope of the bibliography was expanded to include flexible ac transmission (FACTS) devices. This 1996--1997 edition also contains information for 1998. Preparation of the present edition took place primarily in May-June of 1998. All pertinent references have been included that were available to the editors at the time of preparation. Papers for the 1998 IEEE Winter and Summer Power Meetings and 1998 T and D Conference have been included. This edition contains the organizational affiliation of the first-named author as an aid to accessing the reference. Unfortunately, space limitations prevented the inclusion of the affiliations of all authors. Some minor editorial changes have been made to abstracts to ensure consistency in style and syntax.

  6. Basic environmental bookshelf: An annotated bibliography. Current issue paper No. 116

    Energy Technology Data Exchange (ETDEWEB)

    Yeager, L.

    1995-11-01

    This bibliography is intended to provide objective basic information on science and the environment, and includes books and journal articles that should be understandable to the nonspecialist. The bibliographic entries are arranged alphabetically by author within broad categories such as acid precipitation, air quality, climate change, ecology and ecosystems, energy, environmental assessment, hazardous wastes, law, natural history, ozone depletion, parks and urban issues, public policy, toxic chemicals, and water resources. Most entries have brief annotations.

  7. Low-level radioactive waste technology: a selected, annotated bibliography. [416 references

    Energy Technology Data Exchange (ETDEWEB)

    Fore, C.S.; Carrier, R.F.; Brewster, R.H.; Hyder, L.K.; Barnes, K.A.

    1981-10-01

    This annotated bibliography of 416 references represents the third in a series to be published by the Hazardous Materials Information Center containing scientific, technical, economic, and regulatory information relevant to low-level radioactive waste technology. The bibliography focuses on disposal site, environmental transport, and waste treatment studies as well as general reviews on the subject. The publication covers both domestic and foreign literature for the period 1951 to 1981. Major chapters selected are Chemical and Physical Aspects; Container Design and Performance; Disposal Site; Environmental Transport; General Studies and Reviews; Geology, Hydrology, and Site Resources; Regulatory and Economic Aspects; Social Aspects; Transportation Technology; Waste Production; and Waste Treatment. Entries in each of the chapters are further classified as a field study, laboratory study, theoretical study, or general overview involving one or more of these research areas.

  8. Women, Islam, and Pakistan: A Selected Annotated Bibliography. Fulbright-Hays Summer Seminar Abroad Project.

    Science.gov (United States)

    Phillips, Brenda

    This bibliography features selected books, book chapters, research projects, and journal articles, published between 1953 and 1994, about the social, legal, economic, educational political, and professional position of Muslim Pakistani women. Sixteen of the references are annotated. An additional 41 bibliographic references to other materials, not…

  9. Chest x-ray screening practices: an annotated bibliography

    International Nuclear Information System (INIS)

    Torchia, M.; DuChez, J.

    1980-03-01

    This annotated bibliography is a review of the scientific literature on the selection of asymptomatic patients for chest x-ray screening examinations. Selected articles cover a period of time from 1969 through 1979. The articles are organized under 10 main topics which correspond to various categories of chest x-ray screening examinations performed in the United States today. Within each main topic, the articles are presented in chronological order. To aid the reader in identifying specific citations, an author index and a list of citations by journal have been included for user reference. The standard format for each citation includes the title of each article, the author(s), journal, volume, page, date, and abstract

  10. Policies and Background Literature for Self-Education on Research Data Management: An Annotated Bibliography

    Science.gov (United States)

    Goben, Abigail; Raszewski, Rebecca

    2015-01-01

    Librarians navigating research data management self-education have an increasing body of literature to choose from, which may become overwhelming. This annotated bibliography reviews: (1) U.S. federal policies; (2) articles; and (3) books to assist librarians who are self-educating on research data management or are seeking background reading…

  11. Annotated bibliography for liquid metal surface tensions of groups III-A, IV-A, and V-A metals

    International Nuclear Information System (INIS)

    Murtha, M.J.; Burnet, G.

    1976-04-01

    An annotated bibliography has been prepared which includes summaries of 82 publications dating from 1920 and dealing with the measurement of the surface tensions of Groups III-A, IV-A, and V-A metals in the liquid state. The bibliography is organized by key element investigated, and contains a tabulation of correlations for surface tension as a function of temperature. A brief discussion dealing with variables and methods has been included

  12. Annotated bibliography of coal in the Caribbean region. [Lignite

    Energy Technology Data Exchange (ETDEWEB)

    Orndorff, R.C.

    1985-01-01

    The purpose of preparing this annotated bibliography was to compile information on coal localities for the Caribbean region used for preparation of a coal map of the region. Also, it serves as a brief reference list of publications for future coal studies in the Caribbean region. It is in no way an exhaustive study or complete listing of coal literature for the Caribbean. All the material was gathered from published literature with the exception of information from Cuba which was supplied from a study by Gordon Wood of the US Geological Survey, Branch of Coal Resources. Following the classification system of the US Geological Survey (Wood and others, 1983), the term coal resources has been used in this report for reference to general estimates of coal quantities even though authors of the material being annotated may have used the term coal reserves in a similar denotation. The literature ranges from 1857 to 1981. The countries listed include Colombia, Mexico, Venezuela, Cuba, the Dominican Republic, Haiti, Jamaica, Puerto Rico, and the countries of Central America.

  13. Low-level radioactive waste technology: a selected, annotated bibliography

    International Nuclear Information System (INIS)

    Fore, C.S.; Vaughan, N.D.; Hyder, L.K.

    1980-10-01

    This annotated bibliography of 447 references contains scientific, technical, economic, and regulatory information relevant to low-level radioactive waste technology. The bibliography focuses on environmental transport, disposal site, and waste treatment studies. The publication covers both domestic and foreign literature for the period 1952 to 1979. Major chapters selected are Chemical and Physical Aspects; Container Design and Performance; Disposal Site; Environmental Transport; General Studies and Reviews; Geology, Hydrology and Site Resources; Regulatory and Economic Aspects; Transportation Technology; Waste Production; and Waste Treatment. Specialized data fields have been incorporated into the data file to improve the ease and accuracy of locating pertinent references. Specific radionuclides for which data are presented are listed in the Measured Radionuclides field, and specific parameters which affect the migration of these radionuclides are presented in the Measured Parameters field. In addition, each document referenced in this bibliography has been assigned a relevance number to facilitate sorting the documents according to their pertinence to low-level radioactive waste technology. The documents are rated 1, 2, 3, or 4, with 1 indicating direct applicability to low-level radioactive waste technology and 4 indicating that a considerable amount of interpretation is required for the information presented to be applied. The references within each chapter are arranged alphabetically by leading author, corporate affiliation, or title of the document. Indexes are provide for (1) author(s), (2) keywords, (3) subject category, (4) title, (5) geographic location, (6) measured parameters, (7) measured radionuclides, and (8) publication description

  14. Low-level radioactive waste technology: a selected, annotated bibliography

    Energy Technology Data Exchange (ETDEWEB)

    Fore, C.S.; Vaughan, N.D.; Hyder, L.K.

    1980-10-01

    This annotated bibliography of 447 references contains scientific, technical, economic, and regulatory information relevant to low-level radioactive waste technology. The bibliography focuses on environmental transport, disposal site, and waste treatment studies. The publication covers both domestic and foreign literature for the period 1952 to 1979. Major chapters selected are Chemical and Physical Aspects; Container Design and Performance; Disposal Site; Environmental Transport; General Studies and Reviews; Geology, Hydrology and Site Resources; Regulatory and Economic Aspects; Transportation Technology; Waste Production; and Waste Treatment. Specialized data fields have been incorporated into the data file to improve the ease and accuracy of locating pertinent references. Specific radionuclides for which data are presented are listed in the Measured Radionuclides field, and specific parameters which affect the migration of these radionuclides are presented in the Measured Parameters field. In addition, each document referenced in this bibliography has been assigned a relevance number to facilitate sorting the documents according to their pertinence to low-level radioactive waste technology. The documents are rated 1, 2, 3, or 4, with 1 indicating direct applicability to low-level radioactive waste technology and 4 indicating that a considerable amount of interpretation is required for the information presented to be applied. The references within each chapter are arranged alphabetically by leading author, corporate affiliation, or title of the document. Indexes are provide for (1) author(s), (2) keywords, (3) subject category, (4) title, (5) geographic location, (6) measured parameters, (7) measured radionuclides, and (8) publication description.

  15. PR Bibliography, 1993.

    Science.gov (United States)

    Walker, Albert, Ed.

    1993-01-01

    Based on searches of over 200 periodicals, this annotated bibliography of books and journal articles presents material related to the knowledge and practice of public relations published in 1992. The annotated bibliography is subdivided into more than 30 different categories ranging from business ethics to writing techniques. The largest…

  16. PR Bibliography, 1997.

    Science.gov (United States)

    Walker, Albert, Ed.

    1997-01-01

    Based on searches of nearly 200 periodicals as well as publishers' flyers and brochures from 30 major publishing houses and university presses, this annotated bibliography presents a representative collection of books and journal articles related to the knowledge and practice of public relations published in 1996. The annotated bibliography is…

  17. PR Bibliography, 1996.

    Science.gov (United States)

    Walker, Albert, Ed.

    1996-01-01

    Based on searches of more than 100 periodicals as well as flyers and brochures from 24 major publishing houses and university presses, this annotated bibliography presents a representative collection of books and journal articles (published in 1995) related to the knowledge and practice of public relations. The annotated bibliography is divided…

  18. Enhanced oil recovery using improved aqueous fluid-injection methods: an annotated bibliography. [328 citations

    Energy Technology Data Exchange (ETDEWEB)

    Meister, M.J.; Kettenbrink, G.K.; Collins, A.G.

    1976-10-01

    This annotated bibliography contains abstracts, prepared by the authors, of articles published between 1968 and early 1976 on tests of improved aqueous fluid injection methods (i.e., polymer and surfactant floods). The abstracts have been written and organized to facilitate studies of the oil recovery potential of polymer and surfactant floods under known reservoir conditions. 328 citations.

  19. Frame on frames: an annotated bibliography

    International Nuclear Information System (INIS)

    Wright, T.; Tsao, H.J.

    1983-01-01

    The success or failure of any sample survey of a finite population is largely dependent upon the condition and adequacy of the list or frame from which the probability sample is selected. Much of the published survey sampling related work has focused on the measurement of sampling errors and, more recently, on nonsampling errors to a lesser extent. Recent studies on data quality for various types of data collection systems have revealed that the extent of the nonsampling errors far exceeds that of the sampling errors in many cases. While much of this nonsampling error, which is difficult to measure, can be attributed to poor frames, relatively little effort or theoretical work has focused on this contribution to total error. The objective of this paper is to present an annotated bibliography on frames with the hope that it will bring together, for experimenters, a number of suggestions for action when sampling from imperfect frames and that more attention will be given to this area of survey methods research

  20. Bibliography Section.

    Science.gov (United States)

    Totten, Sam

    1983-01-01

    This annotated listing describes materials dealing with nuclear warfare, including annotated bibliographies, nonfiction, fiction, organizations, journals, newsletters, and curriculum materials for elementary and secondary schools. (RM)

  1. Annotated bibliography of selected reports relating to the isolation of nuclear waste in crystalline rock

    International Nuclear Information System (INIS)

    1988-06-01

    BMI/OCRD-29 is an annotated bibliography of published reports that have been produced for the US Department of Energy Crystalline Repository Project Office or the Swedish-American Cooperative Program on Radioactive Waste Storage in Mined Caverns. This document consists of a main report listing of citations and abstracts and a topical index

  2. Environmental aspects of the transuranics. A selected, annotated bibliography. Volume 9

    International Nuclear Information System (INIS)

    Ensminger, J.T.; Fore, C.S.; Dailey, N.S.

    1978-09-01

    This ninth published bibliography of 589 references is compiled from the Nevada Applied Ecology Information Center's Data Base on the Environmental Aspects of the Transuranics. The data base was built to provide information support to the Nevada Applied Ecology Group (NAEG) of DOE's Nevada Operations Office. The general scope covers environmental aspects of uranium and the transuranic elements, with emphasis on plutonium. This annotated bibliography highlights literature on plutonium 238 and 239 and americium 241 in the critical organs of man and animals. Studies on the migration of plutonium and the transplutonics through the environment are also emphasized. Supporting information on ecology of the Nevada Test Site and reviews and summarizing literature on other radionuclides have been included at the request of the NAEG. The references are arranged by subject category with leading authors appearing alphabetically within each category. Indexes are provided for author(s), geographic location, keywords, taxonomic name, title, and publication description

  3. The Suburban Press; First Steps toward an Annotated Bibliography. Suburban Press Research Series No. 16 and 17.

    Science.gov (United States)

    Northern Illinois Univ., De Kalb. Suburban Press Research Center.

    This bibliography lists journal articles concerning various aspects of the suburban press. Annotated selections, arranged alphabetically according to journal title, are gathered from the following periodicals: "Advertising Age,""Business Week,""Columbia Journalism Review,""Editor and Publisher,""Grassroots Editor,""Journalism…

  4. A Review and Annotated Bibliography of the Literature Pertaining to Team and Small Group Performance (1989 to 1999)

    National Research Council Canada - National Science Library

    LaJoie, Andrew

    1999-01-01

    .... Training and military doctrine has been evolving to reflect this emphasis on teamwork. The purpose of this annotated bibliography is to review literature published over the last ten years concerning team and small group performance...

  5. An Annotated Selective Bibliography on Human Performance in Fault Diagnosis Tasks. Technical Report 435. Final Report.

    Science.gov (United States)

    Johnson, William B.; And Others

    This annotated bibliography developed in connection with an ongoing investigation of the use of computer simulations for fault diagnosis training cites 61 published works taken predominantly from the disciplines of engineering, psychology, and education. A review of the existing literature included computer searches of the past ten years of…

  6. Literature and History--A Focus on the Era of the Great Depression and World War II (1929-1945).

    Science.gov (United States)

    Ahern, John; Sandmann, Alexa

    1997-01-01

    Provides an annotated bibliography and suggested teaching activities for units on the Great Depression and World War II. The materials support inquiry into the causes of the Great Depression and World War II and how these events transformed U.S. society. The annotated bibliography includes novels, memoirs, biographies, and political studies. (MJP)

  7. Monitoring of radioactivity in the UK environment: an annotated bibliography of current programmes

    International Nuclear Information System (INIS)

    Cotter, A.J.R.; Hunt, G.J.

    1992-01-01

    In the UK, many organisations carry out regular radioactivity monitoring programmes, and summaries of these programmes have been published in 1983 and 1988. The number of organisations carrying out radioactivity monitoring has increased rapidly in recent years, particularly in the local authority sector. The present report updates the previous summarises in the form of an annotated bibliography, giving synopses of all regular UK programmes whose results are published in report form. (author)

  8. An Annotated Bibliography of Articles in the "Journal of Speech and Language Pathology-Applied Behavior Analysis"

    Science.gov (United States)

    Esch, Barbara E.; Forbes, Heather J.

    2017-01-01

    The open-source "Journal of Speech and Language Pathology-Applied Behavior Analysis" ("JSLP-ABA") was published online from 2006 to 2010. We present an annotated bibliography of 80 articles published in the now-defunct journal with the aim of representing its scholarly content to readers of "The Analysis of Verbal…

  9. Annotated Bibliography of Publications on Watershed Management and Ecological Studies at Coweeta Hydrologic Laboratory, 1934-1994

    Science.gov (United States)

    Patricia L. Stickney; Lloyd W. Swift; Wayne T. Swank

    1994-01-01

    This annotated bibliography spans over60 years of research at Coweeta from 1934 through part of 1994, and includes earlier papers onforest influenteswritten atthe Appalachian Station beforethe establishment of Coweeta. It is a modification and update of previous compilations of research results at Coweeta and contains aseparatesection listing theses and dissertations....

  10. Bibliographies.

    Science.gov (United States)

    Halsted, Ann L., Comp.

    1983-01-01

    Two annotated bibliographies of books are compiled, one devoted to Roosevelt and the New Deal, the other concerned with Hitler, the Weimar Republic, and the rise of Nazism. Annotations indicate scope of the work and occasionally point out bias or point of view. (CS)

  11. First Nations carbon collaborative - indigenous peoples and carbon markets: an annotated bibliography

    Energy Technology Data Exchange (ETDEWEB)

    Dohan, Rosemary; Voora, Vivek [International Institute for Sustainable Development (Canada)

    2010-11-15

    According to the United Nations declaration on the rights of indigenous people, First Nations must be involved in the development of carbon markets which could affect their traditional and current land in Canada. The aim of this document is to provide First Nations with unbiased information on carbon markets so they can decide whether or not they want to take advantage of the economic opportunities that these markets offer. This annotated bibliography has been built using peer reviewed materials, working papers, government publications, technical reports, newspapers and online news websites. This paper provides the reader with information on the impacts that carbon markets could have on First Nations and is accessible to all with academic as well as popular resources. This bibliography highlighted that little information is available on First Nations in Canada and carbon markets and that this needs to be addressed so that indigenous people can participate actively in carbon markets.

  12. Hanford High-Level Waste Vitrification Program at the Pacific Northwest National Laboratory: technology development - annotated bibliography

    International Nuclear Information System (INIS)

    Larson, D.E.

    1996-09-01

    This report provides a collection of annotated bibliographies for documents prepared under the Hanford High-Level Waste Vitrification (Plant) Program. The bibliographies are for documents from Fiscal Year 1983 through Fiscal Year 1995, and include work conducted at or under the direction of the Pacific Northwest National Laboratory. The bibliographies included focus on the technology developed over the specified time period for vitrifying Hanford pretreated high-level waste. The following subject areas are included: General Documentation; Program Documentation; High-Level Waste Characterization; Glass Formulation and Characterization; Feed Preparation; Radioactive Feed Preparation and Glass Properties Testing; Full-Scale Feed Preparation Testing; Equipment Materials Testing; Melter Performance Assessment and Evaluations; Liquid-Fed Ceramic Melter; Cold Crucible Melter; Stirred Melter; High-Temperature Melter; Melter Off-Gas Treatment; Vitrification Waste Treatment; Process, Product Control and Modeling; Analytical; and Canister Closure, Decontamination, and Handling

  13. Hydrology and water resources overview for the Nevada Nuclear Waste Storage Investigations, Nevada Test Site, Nye County, Nevada: annotated bibliography

    International Nuclear Information System (INIS)

    French, R.H.; Elzeftawy, A.; Elliot, B.

    1984-06-01

    The literature available regarding hydrology and utilization of water resources in the southwestern Nevada Test Site area is reviewed. In the context of this annotated bibliography, hydrology is defined to include hydrometeorology, surface water resources, and groundwater resources. Water utilization includes water supply, demand and use; future supply, demand and use; and wastewater treatment and disposal. The bibliography is arranged in alphabetical order and indexed with both technical key words and geographical key words

  14. Algae from the arid southwestern United States: an annotated bibliography

    Energy Technology Data Exchange (ETDEWEB)

    Thomas, W.H.; Gaines, S.R.

    1983-06-01

    Desert algae are attractive biomass producers for capturing solar energy through photosynthesis of organic matter. They are probably capable of higher yields and efficiencies of light utilization than higher plants, and are already adapted to extremes of sunlight intensity, salinity and temperature such as are found in the desert. This report consists of an annotated bibliography of the literature on algae from the arid southwestern United States. It was prepared in anticipation of efforts to isolate desert algae and study their yields in the laboratory. These steps are necessary prior to setting up outdoor algal culture ponds. Desert areas are attractive for such applications because land, sunlight, and, to some extent, water resources are abundant there. References are sorted by state.

  15. DOE Hydropower Program biennial report 1992--1993 (with an updated annotated bibliography)

    Energy Technology Data Exchange (ETDEWEB)

    Cada, G.F.; Sale, M.J. [Oak Ridge National Lab., TN (United States); Francfort, J.E.; Rinehart, B.N.; Sommers, G.L. [EG and G Idaho, Inc., Idaho Falls, ID (United States)

    1993-07-01

    This report, the latest in a series of annual/biennial Hydropower Program reports sponsored by the US Department of Energy, summarizes the research and development and technology transfer activities of fiscal years 1992 and 1993. The report discusses the activities in the four areas of the hydropower program: Environmental research; resource assessment; research coat shared with industry; and technology transfer. The report also offers an annotated bibliography of reports pertinent to hydropower, written by persons in Federal and state agencies, cities, metropolitan water districts, irrigation companies, and public and independent utilities. Most reports are available from the National Technical Information Service.

  16. Annotated bibliography National Environmental Policy Act (NEPA) documents for Sandia National Laboratories

    International Nuclear Information System (INIS)

    Harris, J.M.

    1995-04-01

    The following annotated bibliography lists documents prepared by the Department of Energy (DOE), and predecessor agencies, to meet the requirements of the National Environmental Policy Act (NEPA) for activities and facilities at Sandia National Laboratories sites. For each NEPA document summary information and a brief discussion of content is provided. This information may be used to reduce the amount of time or cost associated with NEPA compliance for future Sandia National Laboratories projects. This summary may be used to identify model documents, documents to use as sources of information, or documents from which to tier additional NEPA documents

  17. Annotated bibliography National Environmental Policy Act (NEPA) documents for Sandia National Laboratories

    Energy Technology Data Exchange (ETDEWEB)

    Harris, J.M.

    1995-04-01

    The following annotated bibliography lists documents prepared by the Department of Energy (DOE), and predecessor agencies, to meet the requirements of the National Environmental Policy Act (NEPA) for activities and facilities at Sandia National Laboratories sites. For each NEPA document summary information and a brief discussion of content is provided. This information may be used to reduce the amount of time or cost associated with NEPA compliance for future Sandia National Laboratories projects. This summary may be used to identify model documents, documents to use as sources of information, or documents from which to tier additional NEPA documents.

  18. Thermal effects on aquatic organisms: an annotated bibliography of the 1976 literature

    Energy Technology Data Exchange (ETDEWEB)

    Talmage, S.S. (comp.)

    1978-05-01

    This bibliography, containing 784 annotated references on the effects of temperature on aquatic organisms, is part of an assessment of the literature on the effects of thermal power plants on the environment. The effects of thermal discharges at power plant sites are emphasized. Laboratory and field studies on temperature tolerance and the effects of temperature changes on reproduction, development, growth, distribution, physiology, and sensitivity to other stresses are included. Indexes are provided for author, keywords, subject category, geographic location of the study, taxon, and title (alphabetical listing of keywords-in-context of nontrivial words in the title).

  19. Hydrologic bibliography of the Columbia River basalts in Washington with selected annotations

    International Nuclear Information System (INIS)

    Tanaka, H.; Wildrick, L.; Pearson, B.

    1979-08-01

    The objective of this compilation is to present a comprehensive listing of the published, unpublished, and open file references pertaining to the surface and subsurface hydrology of the Columbia River basalts within the State of Washington and is presented in support of Rockwell's hydrologic data compilation effort for the Basalt Waste Isolation Program. A comprehensive, annotated bibliography of the Pasco Basin (including the Hanford Site) hydrology has been prepared for Rockwell as part of the Pasco Basin hydrology studies. In order to avoid unnecessary duplication, no effort was made to include a complete list of bibliographic references on Hanford in this volume

  20. Counselor's Information Service. A Quarterly Annotated Bibliography of Current Literature on Educational and Vocational Guidance. Volume 32, Number 1.

    Science.gov (United States)

    B'nai B'rith, Washington, DC. Career and Counseling Services.

    This quarterly annotated bibliography of current literature on educational and vocational guidance describes various pamphlets, guides and brochures which provide occupational information, educational, vocational and personal guidance, guidance administration and procedures, information on student aids and aids for the teacher. Additional guidance…

  1. Software engineering laboratory series: Annotated bibliography of software engineering laboratory literature

    Science.gov (United States)

    Morusiewicz, Linda; Valett, Jon

    1992-01-01

    This document is an annotated bibliography of technical papers, documents, and memorandums produced by or related to the Software Engineering Laboratory. More than 100 publications are summarized. These publications cover many areas of software engineering and range from research reports to software documentation. This document has been updated and reorganized substantially since the original version (SEL-82-006, November 1982). All materials have been grouped into eight general subject areas for easy reference: (1) the Software Engineering Laboratory; (2) the Software Engineering Laboratory: Software Development Documents; (3) Software Tools; (4) Software Models; (5) Software Measurement; (6) Technology Evaluations; (7) Ada Technology; and (8) Data Collection. This document contains an index of these publications classified by individual author.

  2. World War II Homefront.

    Science.gov (United States)

    Garcia, Rachel

    2002-01-01

    Presents an annotated bibliography that provides Web sites focusing on the U.S. homefront during World War II. Covers various topics such as the homefront, Japanese Americans, women during World War II, posters, and African Americans. Includes lesson plan sources and a list of additional resources. (CMK)

  3. DOE Hydropower Program biennial report 1994--1995 with an updated annotated bibliography

    Energy Technology Data Exchange (ETDEWEB)

    Rinehart, B.N.; Francfort, J.E.; Sommers, G.L. [Lockheed Idaho Technologies Co., Idaho Falls, ID (United States); Cada, G.F.; Sale, M.J. [Oak Ridge National Lab., TN (United States)

    1995-05-01

    This report, the latest in a series of annual/biennial Hydropower Program reports sponsored by the US Department of Energy, summarizes the research and development and technology transfer activities of fiscal years 1994 and 1995. The report discusses the activities in the four areas of the hydropower program: Environmental Research; Resource Assessment; Research Cost-Shared with Industry; and Technology Transfer. The report also includes an annotated bibliography of reports pertinent to hydropower, written by the staff of the Idaho National Engineering Laboratory, Oak Ridge National Laboratory, Federal and state agencies, cities, metropolitan water districts, irrigation companies, and public and independent utilities. Most reports are available from the National Technical Information Service.

  4. DOE Hydropower Program biennial report 1994--1995 with an updated annotated bibliography

    International Nuclear Information System (INIS)

    Rinehart, B.N.; Francfort, J.E.; Sommers, G.L.; Cada, G.F.; Sale, M.J.

    1995-05-01

    This report, the latest in a series of annual/biennial Hydropower Program reports sponsored by the US Department of Energy, summarizes the research and development and technology transfer activities of fiscal years 1994 and 1995. The report discusses the activities in the four areas of the hydropower program: Environmental Research; Resource Assessment; Research Cost-Shared with Industry; and Technology Transfer. The report also includes an annotated bibliography of reports pertinent to hydropower, written by the staff of the Idaho National Engineering Laboratory, Oak Ridge National Laboratory, Federal and state agencies, cities, metropolitan water districts, irrigation companies, and public and independent utilities. Most reports are available from the National Technical Information Service

  5. An Annotated Bibliography of the Literature Dealing with the Incorporation of Right Brain Learning into Left Brain Oriented Schools.

    Science.gov (United States)

    Lewallen, Martha

    Articles and documents concerning brain growth and hemispheric specialization, theories of cognitive style, educational implications of brain research, and right-brain learning activities are cited in this annotated bibliography. Citations are preceded by a glossary of terms and followed by a brief review of the assembled literature. Educational…

  6. A DDC Bibliography on Computers in Information Sciences. Volume II. Information Sciences Series.

    Science.gov (United States)

    Defense Documentation Center, Alexandria, VA.

    The unclassified and unlimited bibliography compiles references dealing specifically with the role of computers in information sciences. The volume contains 239 annotated references grouped under three major headings: Artificial and Programming Languages, Computer Processing of Analog Data, and Computer Processing of Digital Data. The references…

  7. PR Bibliography, 2001.

    Science.gov (United States)

    Ramsey, Shirley, Ed.

    2001-01-01

    This annotated bibliography presents an overview of journal articles and books published in 2000 on public relations that can be helpful to teachers and students as well as to practitioners and managers. This bibliography is subdivided into 29 categories including campaigns; community relations; corporate image; education; employee relations;…

  8. PR Bibliography, 2002.

    Science.gov (United States)

    Ramsey, Shirley, Ed.

    2002-01-01

    This annotated bibliography presents an overview of journal articles and books published in 2001 on public relations that can be helpful to teachers and students as well as to practitioners and managers. This bibliography is subdivided into 40 categories including campaigns; consumer relations; community relations; corporate social responsibility;…

  9. Annotated bibliography of the red tree vole (Arborimus longicaudus), Sonoma tree vole (A. pomo), and white-footed vole (A. albipes).

    Science.gov (United States)

    James K. Swingle; Eric D. Forsman

    2016-01-01

    This annotated bibliography contains all citations that we could find on tree voles (Arborimus longicaudus, A. pomo) and white-footed voles (A. albipes), including many unpublished sources in museum archives, court proceedings, and agency documents. Some documents not readily available in published form or museum archives are...

  10. DOE Hydropower Program biennial report 1996-1997 (with an updated annotated bibliography)

    Energy Technology Data Exchange (ETDEWEB)

    Rinehart, B.N.; Francfort, J.E.; Sommers, G.L. [Lockheed Idaho Technologies Co., Idaho Falls, ID (United States); Cada, G.F.; Sale, M.J. [Oak Ridge National Lab., TN (United States)

    1997-06-01

    This report, the latest in a series of biennial Hydropower Program reports sponsored by the US Department of Energy, summarizes the research and development and technology transfer activities of fiscal years 1996 and 1997. The report discusses the activities in the six areas of the hydropower program: advanced hydropower turbine systems; environmental research; hydropower research and development; renewable Indian energy resources; resource assessment; and technology transfer. The report also includes an annotated bibliography of reports pertinent to hydropower, written by the staff of the Idaho National Engineering and Environmental Laboratory, Oak Ridge National Laboratory, Federal and state agencies, cities, metropolitan water districts, irrigation companies, and public and independent utilities. Most reports are available from the National Technical Information Service.

  11. PR Bibliography, 1999.

    Science.gov (United States)

    Ramsey, Shirley, Ed.

    1999-01-01

    This annotated bibliography presents an overview of journal articles and books on public relations that can be helpful to teachers and students as well as to practitioners and managers. New categories for this 1999 edition of the bibliography include Public Relations Theory, Feminist Issues in Public Relations, and Environmental Public Relations.…

  12. Update of identification and estimation of socioeconomic impacts resulting from perceived risks and changing images: An annotated bibliography

    International Nuclear Information System (INIS)

    Nieves, L.A.; Clark, D.E.; Wernette, D.

    1991-08-01

    This annotated bibliography reviews selected literature published through August 1991 on the identification of perceived risks and methods for estimating the economic impacts of risk perception. It updates the literature review found in Argonne National Laboratory report ANL/EAIS/TM-24 (February 1990). Included in this update are (1) a literature review of the risk perception process, of the relationship between risk perception and economic impacts, of economic methods and empirical applications, and interregional market interactions and adjustments; (2) a working bibliography (that includes the documents abstracted in the 1990 report); (3) a topical index to the abstracts found in both reports; and (4) abstracts of selected articles found in this update

  13. Update of identification and estimation of socioeconomic impacts resulting from perceived risks and changing images: An annotated bibliography

    Energy Technology Data Exchange (ETDEWEB)

    Nieves, L.A.; Clark, D.E.; Wernette, D.

    1991-08-01

    This annotated bibliography reviews selected literature published through August 1991 on the identification of perceived risks and methods for estimating the economic impacts of risk perception. It updates the literature review found in Argonne National Laboratory report ANL/EAIS/TM-24 (February 1990). Included in this update are (1) a literature review of the risk perception process, of the relationship between risk perception and economic impacts, of economic methods and empirical applications, and interregional market interactions and adjustments; (2) a working bibliography (that includes the documents abstracted in the 1990 report); (3) a topical index to the abstracts found in both reports; and (4) abstracts of selected articles found in this update.

  14. Annotated bibliography of cultural resources literature for the Nevada Nuclear Waste Storage Investigations

    International Nuclear Information System (INIS)

    1983-11-01

    This annotated bibliography of the cultural resources literature pertinent for the Nevada Nuclear Waste Storage Investigations was assembled in order to (1) identify and evaluate the prehistoric and historic properties previously recorded in the Nevada Nuclear Waste Storage Investigations Project Area of southern Nye County, Nevada, (2) identify and develop research problems that have been and/or could be addressed by the cultural resources of this area, (3) isolate factors that might be important in the selection of a potential locality for a high level nuclear waste repository in the project area, and (4) critically evaluate the adequacy and current status of cultural resources knowledge in the project area. 195 references

  15. Acid precipitation; an annotated bibliography

    Science.gov (United States)

    Wiltshire, Denise A.; Evans, Margaret L.

    1984-01-01

    This collection of 1660 bibliographies references on the causes and environmental effects of acidic atmospheric deposition was compiled from computerized literature searches of earth-science and chemistry data bases. Categories of information are (1) atmospheric chemistry (gases and aerosols), (2) precipitation chemistry, (3) transport and deposition (wet and dry), (4) aquatic environments (biological and hydrological), (5) terrestrial environments, (6) effects on materials and structures, (7) air and precipitation monitoring and data collection, and (8) modeling studies. References date from the late 1800 's through December 1981. The bibliography includes short summaries of most documents. Omitted are unpublished manuscripts, publications in press, master 's theses and doctoral dissertations, newspaper articles, and book reviews. Coauthors and subject indexes are included. (USGS)

  16. PR Bibliography, 1998.

    Science.gov (United States)

    Ramsey, Shirley, Ed.

    1998-01-01

    Encompassing both the practical and the scholarly, this annotated bibliography on public relations aims to provide a window into some of each of the offerings in academic and business journals, as well as in trade and professional journals published in 1997. The introduction notes that many entries in the bibliography deal with the Internet, the…

  17. An annotated bibliography: social and economic factors associated with electric power generation 1978. Report for 1970-78

    International Nuclear Information System (INIS)

    Nakamura, S.

    1978-01-01

    A selective, annotated bibliography is presented concerning the socioeconomic impacts associated with electric power generation and related energy facilities. Abstracts were taken from studies, tables and figures in environmental reports and impact statements prepared by the energy industry, their consultants and regulatory agencies in connection with licensing and environmental requirements. The majority of the citations cover planned and operating nuclear and coal-fired steam electric generating stations and their associated transmission lines. Also included are citations covering other parts of the fossil and nuclear fuel cycles, such as mines and mills, fuel transportation and the breeder reactor. The bibliography is arranged by types of impacts including direct and indirect benefits of electricity production and transmission and internal and external costs. A state index and an author sponsor and plant name index are provided

  18. Poverty in America: An Annotated Bibliography. Magill Bibliographies.

    Science.gov (United States)

    Pressman, Steven

    This bibliography is a comprehensive treatment of poverty in the United States. It summarizes the major economic, literary, sociological, historical, and other social-science literature written over the past century on this topic. In addition to general descriptions of the measurement, causes, and consequences of poverty, individual chapters…

  19. Annotated bibliography of LAMPF research and development

    Energy Technology Data Exchange (ETDEWEB)

    Jameson, R.A.; Roybal, E.U.

    1978-08-01

    A bibliography on published and in-house technical material written on LAMPF activities since its inception is presented. Subject and author concordances provide cross-reference to detailed citations, which include an abstract and notes on the material. The bibliography resides in a computer database that can be searched for key words and phrases.

  20. Annotated bibliography of LAMPF research and development

    International Nuclear Information System (INIS)

    Jameson, R.A.; Roybal, E.U.

    1978-08-01

    A bibliography on published and in-house technical material written on LAMPF activities since its inception is presented. Subject and author concordances provide cross-reference to detailed citations, which include an abstract and notes on the material. The bibliography resides in a computer database that can be searched for key words and phrases

  1. An Annotated Bibliography of the Literature Dealing with Adolescent Suicide and What Educators Can Do To Help Reduce This Problem.

    Science.gov (United States)

    Van Dyke, Catherine A.

    The purpose of this study was to provide an overview of the complex and growing problem of adolescent suicide. The annotated bibliography consists of 7 articles on recent facts and data, 10 articles on causes determined by research, 11 items on indicators seen in adolescents, and 14 documents on how educators can help. A lack of secure social…

  2. Association for Teacher Education in Europe (ATEE) Seminar on Practical Experience in Teacher Education (Gargnano, Italy, June 28-July 1, 1995). Select Annotated Bibliography.

    Science.gov (United States)

    Macrae, Sheila, Comp.; Manning, Patricia, Comp; Moon, Bob, Comp.

    1996-01-01

    This annotated bibliography offers information from presentations at a 1995 seminar on practical teaching experience in preservice teacher education programs throughout Europe. Each entry includes a brief abstract of the presentation and a list of keywords. (SM)

  3. Annotated bibliography on high-intensity linear accelerators

    International Nuclear Information System (INIS)

    Jameson, R.A.; Roybal, E.U.

    1978-01-01

    A technical bibliography covering subjects important to the design of high-intensity beam transport systems and linear accelerators is presented. Space charge and emittance growth are stressed. Subject and author concordances provide cross-reference to detailed citations, which include an abstract and notes on the material. The bibliography resides in a computer database that can be searched for key words and phrases

  4. Organic chemical aging mechanisms: An annotated bibliography. Waste Tank Safety Program

    Energy Technology Data Exchange (ETDEWEB)

    Samuels, W.D.; Camaioni, D.M.; Nelson, D.A.

    1993-09-01

    An annotated bibliography has been compiled of the potential chemical and radiological aging mechanisms of the organic constituents (non-ferrocyanide) that would likely be found in the UST at Hanford. The majority of the work that has been conducted on the aging of organic chemicals used for extraction and processing of nuclear materials has been in conjunction with the acid or PUREX type processes. At Hanford the waste being stored in the UST has been stabilized with caustic. The aging factors that were used in this work were radiolysis, hydrolysis and nitrite/nitrate oxidation. The purpose of this work was two-fold: to determine whether or not research had been or is currently being conducted on the species associated with the Hanford UST waste, either as a mixture or as individual chemicals or chemical functionalities, and to determine what areas of chemical aging need to be addressed by further research.

  5. Ecological investigations at power plant cooling lakes, reservoirs, and ponds: an annotated bibliography. Final report

    International Nuclear Information System (INIS)

    Yost, F.E.; Talmage, S.S.

    1981-06-01

    Presented as an annotated bibliography are 541 references dealing with ecological investigations at power plants which use cooling lakes, ponds, or reservoirs. The references were obtained from open literature and from environmental reports and impact statements prepared for or by the electric utility industry. The literature covers the period 1950 through mid-1980. Topics covered include site-specific studies at facilities using cooling lakes, ponds, or reservoirs, as well as special studies, engineering studies, and general studies. References are arranged alphabetically by author and indexes are provided to personal and corporate authors, facility names, regions, and taxonomic names

  6. Annotated bibliography: Marine geologic hazards of the Hawaiian Islands with special focus on submarine slides and turbidity currents

    Energy Technology Data Exchange (ETDEWEB)

    Normark, W.R.; Herring, H.H.

    1993-10-01

    This annotated bibliography was compiled to highlight the submarine geology of the Hawaiian Islands and identify known and potential marine geologic hazards with special emphasis on turbidity currents, submarine slides and tsunamis. Some references are included that are not specific to Hawaii but are needed to understand the geologic processes that can affect the integrity of submarine cables and other man-made structures. Entries specific to the Hawaiian Island area are shown in bold type.

  7. A review and evaluation of the Langley Research Center's Scientific and Technical Information Program. Results of phase 5. Design and evaluation of STI systems: A selected, annotated bibliography

    Science.gov (United States)

    Pinelli, T. E.; Hinnebusch, P. A.; Jaffe, J. M.

    1981-01-01

    A selected, annotated bibliography of literature citations related to the design and evaluation of STI systems is presented. The use of manual and machine-readable literature searches; the review of numerous books, periodicals reports, and papers; and the selection and annotation of literature citations were required. The bibliography was produced because the information was needed to develop the methodology for the review and evaluation project, and a survey of the literature did not reveal the existence of a single published source of information pertinent to the subject. Approximately 200 citations are classified in four subject areas. The areas include information - general; information systems - design and evaluation, including information products and services; information - use and need; and information - economics.

  8. Annotated Bibliography of the Air Force Human Resources Laboratory Technical Reports - 1979.

    Science.gov (United States)

    1981-05-01

    Conli I1t’s ii t he earl ier st id% were pred icted as well as flte emipirical crimn site; hiowe’ve r. ill this stwail. [te resol riItei re iii ich...various combinations of *’anchor" item calibration sample size and equating same size. (l pages) 70 Donahue, K.E., Medellin , A., & Loup, K. Bibliography

  9. Approaches to Working with Children, Young People and Families for Traveller, Irish Traveller, Gypsy, Roma and Show People Communities. Annotated Bibliography for the Children's Workforce Development Council

    Science.gov (United States)

    Robinson, Mark; Martin, Kerry; Wilkin, Carol

    2008-01-01

    This annoted bibliography relays a range of issues and approaches to working with Travellers, Irish Travellers, Gypsies, Roma and Show People. This is an accompanying document to the literature review report, ED501860.

  10. Psychomotor Battery Approaches to Performance Prediction and Evaluation in Hyperbaric, Thermal and Vibratory Environments: Annotated Bibliographies and Integrative Review

    Science.gov (United States)

    1980-10-01

    W77-Mar78 and Vibratory Environments: Annotated Biblia - 4.-EFRIGOO EOT*_1 graphies and Integrative Review. I. CONTRACT OR GRANT NUMSER(a) David J...Papers In the third phase of the effort, the final version of the three speciai-environrneni performance battery bibliographies was corriiled and the...performance at much lower pressu. (e.g. 3 to 4 ATA when nitrogen is involved). The following sections will integrate the available liter - ature on the effects

  11. Annotated bibliography of human factors applications literature

    International Nuclear Information System (INIS)

    McCafferty, D.B.

    1984-01-01

    This bibliography was prepared as part of the Human Factors Technology Project, FY 1984, sponsored by the Office of Nuclear Safety, US Department of Energy. The project was conducted by Lawrence Livermore National Laboratory, with Essex Corporation as a subcontractor. The material presented here is a revision and expansion of the bibliographic material developed in FY 1982 as part of a previous Human Factors Technology Project. The previous bibliography was published September 30, 1982, as Attachment 1 to the FY 1982 Project Status Report

  12. Annotated bibliography of human factors applications literature

    Energy Technology Data Exchange (ETDEWEB)

    McCafferty, D.B.

    1984-09-30

    This bibliography was prepared as part of the Human Factors Technology Project, FY 1984, sponsored by the Office of Nuclear Safety, US Department of Energy. The project was conducted by Lawrence Livermore National Laboratory, with Essex Corporation as a subcontractor. The material presented here is a revision and expansion of the bibliographic material developed in FY 1982 as part of a previous Human Factors Technology Project. The previous bibliography was published September 30, 1982, as Attachment 1 to the FY 1982 Project Status Report.

  13. An annotated bibliography for lamprey habitat in the White Salmon River, Washington

    Science.gov (United States)

    Allen, M. Brady

    2012-01-01

    The October 2011 decommissioning of Condit Dam on the White Salmon River at river kilometer (rkm) 5.3 removed a significant fish passage barrier from the White Salmon River basin for the first time in nearly a century. This affords an opportunity to regain a potentially important drainage basin for Pacific lamprey (Entosphenus tridentatus) production. In anticipation of Pacific lamprey recolonization or reintroduction, aquatic resource managers, such as the Yakama Nation (YN), are planning to perform surveys in the White Salmon River and its tributaries. The likely survey objectives will be to investigate the presence of lamprey, habitat conditions, and habitat availability. In preparation for this work, a compilation and review of the relevant aquatic habitat and biological information on the White Salmon River was conducted. References specific to the White Salmon River were collected and an annotated bibliography was produced including reports containing:

  14. Bibliography [On Drugs].

    Science.gov (United States)

    National Association of Student Personnel Administrators, Detroit, MI.

    A bibliography of materials on drugs is presented. The book and paper back entries are annotated. Selected technical references are listed under these major findings: (1) dependency, (2) barbiturates, (3) amphetamines, and (4) general pharmacology. (PS)

  15. Radioactive occurrences in veins and igneous and metamorphic rocks of New Mexico with annotated bibliography

    International Nuclear Information System (INIS)

    McLemore, V.T.

    1982-01-01

    From an extensive literature search and field examination of 96 nonsandstone radioactive occurrences, the author compiled an annotated bibliography of over 600 citations and a list of 327 radioactive occurrences in veins and igneous and metamorphic rocks of New Mexico. The citations are indexed by individual radioactive occurrence, geographic area, county, fluorspar deposits and occurrences, geochemical analyses, and geologic maps. In addition, the geology, mineralization, and uranium and thorium potential of 41 geographic areas in New Mexico containing known radioactive occurrences in veins and igneous and metamorphic rocks or that contain host rocks considered favorable for uranium or thorium mineralization are summarized. A list of aerial-radiometric, magnetic, hydrogeochemical, and stream-sediment survey reports is included

  16. Radioactive occurrences in veins and igneous and metamorphic rocks of New Mexico with annotated bibliography

    International Nuclear Information System (INIS)

    McLemore, V.T.

    1982-02-01

    The primary objectives of this report are to list known radioactive occurrences in veins and igneous and metamorphic rocks in New Mexico, and to provide an annotated bibliography of geologic reports concerning these regions. Only plutonic, metamorphic, vein, and Precambrian quartz-pebble conglomerate uranium deposits are considered in this report; other nonsandstone uranium deposits (such as shale, limestone, phosphorite, coal, evaporative precipitates, and fossil placer deposits) will be considered at a later time. These objectives were achieved through a literature search. Some field examinations of some of the radioactive occurrences have been completed. A table of known radioactive occurrences in veins and igneous and metamorphic rocks was compiled from the literature (Appendix I)

  17. Annotated Tsunami bibliography: 1962-1976

    International Nuclear Information System (INIS)

    Pararas-Carayannis, G.; Dong, B.; Farmer, R.

    1982-08-01

    This compilation contains annotated citations to nearly 3000 tsunami-related publications from 1962 to 1976 in English and several other languages. The foreign-language citations have English titles and abstracts

  18. A Bibliography for the Study of Magazines.

    Science.gov (United States)

    Schacht, J. H.

    This annotated bibliography contains a list of readings compiled for a course in magazine editing at the University of Illinois. This bibliography includes materials on the history of magazines, advertising in magazines, readership and audience studies, analyses of magazine content, information on magazine circulation, editorial research and its…

  19. An Annotated Bibliography for Environmental Educators.

    Science.gov (United States)

    Stitt, Thomas R.

    This bibliography is organized according to occupations: biology and agriculture, business, marketing, management, health, industrial, and public service. In addition, entries are further classified as air, water, public water supply, land pollution, noise, atomic radiation, and general. Over 130 books, publications, and articles are cited, with…

  20. Procedures for the elicitation of expert judgements in the probabilistic risk analysis of the long-term effects of radioactive waste repositories: an annotated bibliography

    International Nuclear Information System (INIS)

    Watson, S.R.

    1993-01-01

    This annotated bibliography describes the key literature relevant to the elicitation of expert judgements in radioactive waste management. The bibliography is divided into seven sections; section 2 lists the literature exploring the proper interpretation of probabilities used in Probabilistic Risk Analysis (PRA). Section 3 lists literature describing other calculi for handling uncertainty in a numerical fashion. In section 4 comments are given on how to elicit probabilities from individuals as a measure of subjective degrees of belief and section 5 lists the literature concerning how expert judgements can be combined. Sections 6 and 7 list literature giving an overview of the issues involved in PRA for radioactive waste repositories. (author)

  1. Ground disposal of oil shale wastes: a review with an indexed annotated bibliography through 1976

    Energy Technology Data Exchange (ETDEWEB)

    Routson, R.C.; Bean, R.M.

    1977-12-01

    This review covers the available literature concerning ground-disposed wastes and effluents of a potential oil shale industry. Ground disposal has been proposed for essentially all of the solid and liquid wastes produced (Pfeffer, 1974). Since an oil shale industry is not actually in operation, the review is anticipatory in nature. The section, Oil Shale Technology, provides essential background for interpreting the literature on potential shale oil wastes and the topics are treated more completely in the section entitled Environmental Aspects of the Potential Disposal of Oil Shale Wastes to Ground. The first section of the annotated bibliography cites literature concerning potential oil shale wastes and the second section cites literature concerning oil shale technology. Each section contains references arranged historically by year. An index is provided.

  2. How to Write: A Barely Annotated Bibliography. Research Report.

    Science.gov (United States)

    Miller, Lance A.

    The references in this bibliography tend toward practical or "how to" strategies for writing. The 718 references are listed alphabetically in the bibliography section, with each citation followed by a code denoting its topical categories: (1) general "how to write," (2) "how to write" business letters, (3) stylistics,…

  3. Annotated bibliography: overview of energy and mineral resources for the Nevada nuclear-waste-storage investigations, Nevada Test Site, Nye County, Nevada

    International Nuclear Information System (INIS)

    Bell, E.J.; Larson, L.T.

    1982-09-01

    This Annotated Bibliography was prepared for the US Department of Energy as part of the Environmental Area Characterization for the Nevada Nuclear Waste Storage Investigations (NNWSI) at the Nevada Test Site (NTS). References were selected to specifically address energy resources including hydrocarbons, geothermal and radioactive fuel materials, mineral resources including base and precious metals and associated minerals, and industrial minerals and rock materials which occur in the vicinity of the NNWSI area

  4. Potential impacts of OCS oil and gas activities on fisheries. Volume 2. Annotated bibliography for OCS oil and gas impact studies. Final report

    International Nuclear Information System (INIS)

    Tear, L.M.

    1989-10-01

    The volume is the second of two volumes to the final report, Potential Impacts of OCS Oil and Gas Activities on Fisheries. The volume presents an annotated bibliography of published and grey literature related to OCS oil and gas activity impacts of finfish and shellfish in marine and estuaring waters. The studies presented in the bibliography include those related to the following pollutants or impact-causing activities: Rig/reef effects, Drilling discharges (muds or cuttings), Oil (petroleum hydrocarbons), Trace metals, Produced water, Habitat alteration, Debris, Rig placement (avoidance), Pipelines, and Socioeconomic effects. The studies are listed alphabetically by the primary author's last name. An index is provided to help the reader identify studies related to a specific impact

  5. Promotores de salud and community health workers: an annotated bibliography.

    Science.gov (United States)

    WestRasmus, Emma K; Pineda-Reyes, Fernando; Tamez, Montelle; Westfall, John M

    2012-01-01

    For underserved and disenfranchised communities in the United States, affordable, effective health care can be nearly inaccessible, which often leads to the exclusion of these communities from relevant medical information and care. Barriers to care are especially salient in minority communities, where language, traditions and customs, socioeconomics, and access to education can serve as additional roadblocks to accessing health care information and services. These factors have contributed to a national health disparity crisis that unnecessarily places some communities in a vulnerable position without adequate prevention and treatment opportunities. One solution to the exclusion some communities face in the health care system may be the promotores de salud (PdS)/community health worker (CHW), an approach to culturally competent health care delivery whose popularity in the mainstream health care system has been steadily growing in recent decades. Known by a wide variety of names and broad in the spectrum of health issues they address, the PdS/CHW serves as cultural brokers between their own community and the formal health care system and can play a crucial role in promoting health and wellness within their community. This annotated bibliography was created to educate the reader about the history, definition, key features, utility, outcomes, and broad potential of the CHW approach in a variety of populations. Intended to serve as a reference point to a vast body of information on the CHW/PdS approach, this document is a resource for those wishing to effect change in the disparities within the health care system, and to improve the access to, quality, and cost of health care for underserved patients and their communities. Promotores de Salud is a Spanish term that translates to Health Promoter. A female health worker may be referred to as a Promotora, a male as a Promotor, and the plural of both is Promotores. For the purposes of this bibliography, the terms community

  6. An Annotated Bibliography of Concept Mapping

    Science.gov (United States)

    Garcia, GNA

    2008-01-01

    A rich narrative-style bibliography of concept mapping (reviewing six articles published between 1992-2005). Articles reviewed include: (1) Cognitive mapping: A qualitative research method for social work (C. Bitoni); (2) Collaborative concept mapping: Provoking and supporting meaningful discourse (C. Boxtel, J. Linden, E. Roelofs, and G. Erkens);…

  7. An Annotated Bibliography of Accelerated Learning

    Science.gov (United States)

    Garcia, GNA

    2007-01-01

    A rich narrative-style bibliography of accelerated learning (reviewing six articles published between 1995-2003). Articles reviewed include: (1) Accelerative learning and the Emerging Science of Wholeness (D. D. Beale); (2) Effective Teaching in Accelerated Learning Programs (D. Boyd); (3) A Critical Theory Perspective on Accelerated Learning (S.…

  8. Annotated bibliography of selected references on shoreline barrier island deposits with emphasis on Patrick Draw Field, Sweetwater County, Wyoming

    Energy Technology Data Exchange (ETDEWEB)

    Rawn-Schatzinger, V.; Schatzinger, R.A.

    1993-07-01

    This bibliography contains 290 annotated references on barrier island and associated depositional environments and reservoirs. It is not an exhaustive compilation of all references on the subject, but rather selected papers on barrier islands, and the depositional processes of formation. Papers that examine the morphology and internal architecture of barrier island deposits, exploration and development technologies are emphasized. Papers were selected that aid in understanding reservoir architecture and engineering technologies to help maximize recovery efficiency from barrier island oil reservoirs. Barrier islands from Wyoming, Montana and the Rocky Mountains basins are extensively covered.

  9. Annotated geothermal bibliography of Utah

    Energy Technology Data Exchange (ETDEWEB)

    Budding, K.E.; Bugden, M.H. (comps.)

    1986-01-01

    The bibliography includes all the Utah geothermal references through 1984. Some 1985 citations are listed. Geological, geophysical, and tectonic maps and reports are included if they cover a high-temperature thermal area. The references are indexed geographically either under (1) United States (national studies), (2) regional - western United States or physiographic province, (3) Utah - statewide and regional, or (4) county. Reports concerning a particular hot spring or thermal area are listed under both the thermal area and the county names.

  10. Sugar pine management—an annotated bibliography

    Science.gov (United States)

    James L. Averell; John C. Crowell; Clarence R. Quick; Gilbert H. Schubert

    1955-01-01

    The purposes of this bibliography are to enumerate and describe publications that have a bearing on the growing of sugar pine for timber production. It is intended primarily for the information of forest managers, and it includes mainly those articles which appeared to pertain rather directly to management. Although a careful search was made for titles, no claim is...

  11. Annotated bibliography on high-intensity linear accelerators. [240 citations

    Energy Technology Data Exchange (ETDEWEB)

    Jameson, R.A.; Roybal, E.U.

    1978-01-01

    A technical bibliography covering subjects important to the design of high-intensity beam transport systems and linear accelerators is presented. Space charge and emittance growth are stressed. Subject and author concordances provide cross-reference to detailed citations, which include an abstract and notes on the material. The bibliography resides in a computer database that can be searched for key words and phrases.

  12. Annotated bibliography: hazard assessments for the geologic isolation of nuclear wastes. Final report. Center for Resource and Environmental Systems Studies report No. 41

    International Nuclear Information System (INIS)

    Suta, B.E.; Mara, S.J.; Radding, S.B.; Weisbecker, L.W.

    1977-11-01

    This report presents an annotated bibliography of risk assessments that are pertinent to constructing, operating, and decommissioning a federal repository for the underground storage of radioactive waste. This might be considered as a first phase in an assessment of the risks associated with radioactive waste storage. Only those documents judged to be the more pertinent are abstracted. The abstracts are grouped under 13 classifications. A subject and author index is provided

  13. PR Bibliography, 2000.

    Science.gov (United States)

    Hiebert, Ray E., Ed.

    2000-01-01

    This annotated bibliography presents an overview of journal articles and books on public relations that can be helpful to teachers and students as well as to practitioners and managers. Categories for this 2000 edition correspond to knowledge needed by public relations undergraduate majors, as determined in a study conducted by the 1999 Commission…

  14. Partially annotated bibliography for computer protection and related topics

    Energy Technology Data Exchange (ETDEWEB)

    Huskamp, J.C.

    1976-07-20

    References for the commonly cited technical papers in the area of computer protection are given. Great care is taken to exclude papers with no technical content or merit. For the purposes of this bibliography, computer protection is broadly defined to encompass all facets of the protection problem. The papers cover, but are not limited to, the topics of protection features in operating systems (e.g., MULTICS and HYDRA), hardware implementations of protection facilities (e.g., Honeywell 6180, System 250, BCC 5000, B6500), data base protection controls, confinement and protection models. Since computer protection is related to many other areas in computer science and electrical engineering, a bibliography of related areas is included after the protection bibliography. These sections also include articles of general interest in the named areas which are not necessarily related to protection.

  15. GAS METHANE HYDRATES-RESEARCH STATUS, ANNOTATED BIBLIOGRAPHY, AND ENERGY IMPLICATIONS

    Energy Technology Data Exchange (ETDEWEB)

    James Sorensen; Jaroslav Solc; Bethany Bolles

    2000-07-01

    The objective of this task as originally conceived was to compile an assessment of methane hydrate deposits in Alaska from available sources and to make a very preliminary evaluation of the technical and economic feasibility of producing methane from these deposits for remote power generation. Gas hydrates have recently become a target of increased scientific investigation both from the standpoint of their resource potential to the natural gas and oil industries and of their positive and negative implications for the global environment After we performed an extensive literature review and consulted with representatives of the U.S. Geological Survey (USGS), Canadian Geological Survey, and several oil companies, it became evident that, at the current stage of gas hydrate research, the available information on methane hydrates in Alaska does not provide sufficient grounds for reaching conclusions concerning their use for energy production. Hence, the original goals of this task could not be met, and the focus was changed to the compilation and review of published documents to serve as a baseline for possible future research at the Energy & Environmental Research Center (EERC). An extensive annotated bibliography of gas hydrate publications has been completed. The EERC will reassess its future research opportunities on methane hydrates to determine where significant initial contributions could be made within the scope of limited available resources.

  16. Selected Resources and Bibliography

    Science.gov (United States)

    New Directions for Higher Education, 2011

    2011-01-01

    This chapter provides an annotated bibliography of resources pertaining to international branch campuses (IBCs). This collection of references has been selected to represent the breadth of emerging scholarship on cross-border higher education and is intended to provide further resources on a range of concerns surrounding cross-border higher…

  17. Alcohol fuels bibliography, 1901-March 1980

    Energy Technology Data Exchange (ETDEWEB)

    1981-04-01

    This annotated bibliography is subdivided by subjects, as follows: general; feedstocks-general; feedstocks-sugar; feedstocks-starch; feedstocks-cellulose crops and residues; production; coproducts; economics; use as vehicle fuel; government policies; and environmental effects and safety. (MHR)

  18. Hawaii Geothermal Project annotated bibliography: Biological resources of the geothermal subzones, the transmission corridors and the Puna District, Island of Hawaii

    Energy Technology Data Exchange (ETDEWEB)

    Miller, S.E.; Burgett, J.M. [Fish and Wildlife Service, Honolulu, HI (United States). Pacific Islands Office

    1993-10-01

    Task 1 of the Hawaii Geothermal Project Interagency Agreement between the Fish and Wildlife Service and the Department of Energy-Oak Ridge National Laboratory (DOE) includes an annotated bibliography of published and unpublished documents that cover biological issues related to the lowland rain forest in Puna, adjacent areas, transmission corridors, and in the proposed Hawaii Geothermal Project (HGP). The 51 documents reviewed in this report cover the main body of biological information for these projects. The full table of contents and bibliography for each document is included along with two copies (as requested in the Interagency Agreement) of the biological sections of each document. The documents are reviewed in five main categories: (1) geothermal subzones (29 documents); (2) transmission cable routes (8 documents); (3) commercial satellite launching facility (Spaceport; 1 document); (4) manganese nodule processing facility (2 documents); (5) water resource development (1 document); and (6) ecosystem stability and introduced species (11 documents).

  19. Selected Bibliography of Egyptian Educational Materials, Vol. 1, No. 3, 1975.

    Science.gov (United States)

    Al-Ahram Center for Scientific Translations, Cairo (Egypt).

    There are 101 selected entries in this annotated bibliography of Egyptian materials on education published in 1975. Materials include journal articles, books, and government documents. The bibliography covers the following topics: academic certificates and dissertations, art education, audiovisual aids, camps, civics curricula, conferences and…

  20. Selected Bibliography of Egyptian Educational Materials, Vol. 1, No. 2, 1975.

    Science.gov (United States)

    Al-Ahram Center for Scientific Translations, Cairo (Egypt).

    There are 108 selected entries in this annotated bibliography of Egyptian materials on education published in 1975. Materials include journal articles, books, and government documents. The bibliography covers the following topics: adolescence, art education, child upbringing, comprehensive schools, curricula, educational change, educational aids,…

  1. Selected annotated bibliographies for adaptive filtering of digital image data

    Science.gov (United States)

    Mayers, Margaret; Wood, Lynnette

    1988-01-01

    Digital spatial filtering is an important tool both for enhancing the information content of satellite image data and for implementing cosmetic effects which make the imagery more interpretable and appealing to the eye. Spatial filtering is a context-dependent operation that alters the gray level of a pixel by computing a weighted average formed from the gray level values of other pixels in the immediate vicinity.Traditional spatial filtering involves passing a particular filter or set of filters over an entire image. This assumes that the filter parameter values are appropriate for the entire image, which in turn is based on the assumption that the statistics of the image are constant over the image. However, the statistics of an image may vary widely over the image, requiring an adaptive or "smart" filter whose parameters change as a function of the local statistical properties of the image. Then a pixel would be averaged only with more typical members of the same population. This annotated bibliography cites some of the work done in the area of adaptive filtering. The methods usually fall into two categories, (a) those that segment the image into subregions, each assumed to have stationary statistics, and use a different filter on each subregion, and (b) those that use a two-dimensional "sliding window" to continuously estimate the filter either the spatial or frequency domain, or may utilize both domains. They may be used to deal with images degraded by space variant noise, to suppress undesirable local radiometric statistics while enforcing desirable (user-defined) statistics, to treat problems where space-variant point spread functions are involved, to segment images into regions of constant value for classification, or to "tune" images in order to remove (nonstationary) variations in illumination, noise, contrast, shadows, or haze.Since adpative filtering, like nonadaptive filtering, is used in image processing to accomplish various goals, this bibliography

  2. At Issue: Academic Integrity, an Annotated Bibliography

    Science.gov (United States)

    Pricer, Wayne F.

    2009-01-01

    Academic integrity is central to the heart of any academic institution, yet the topic is a complex one. This bibliography addresses the subjects of copyright and plagiarism. Resources for exploring common campus copyright and fair use issues seek to answer common, frequently misunderstood questions such as what exactly does "copyright" mean? What…

  3. The Evaluation of Teachers. ERS Annotated Bibliography.

    Science.gov (United States)

    Baral, Laurie R., Comp.

    To provide a useful reference to published and unpublished documents relating to teacher evaluation, a search was made of the Education Index, Research in Education (RIE), and Current Index to Journals in Education (CIJE), which resulted in this 125-item bibliography. The source for each entry is indicated, along with pricing and ordering…

  4. Artificial Intelligence: A Selected Bibliography.

    Science.gov (United States)

    Smith, Linda C., Comp.

    1984-01-01

    This 19-item annotated bibliography introducing the literature of artificial intelligence (AI) is arranged by type of material--handbook, books (general interest, textbooks, collected readings), journals and newsletters, and conferences and workshops. The availability of technical reports from AI laboratories at universities and private companies…

  5. An Annotated Bibliography of Hypobaric Decompression Sickness Research Conducted at the Crew Technology Division, USAF School of Aerospace Medicine, Brooks AFB, Texas from 1983 to 1988

    Science.gov (United States)

    1990-06-01

    AN ANNOTATED BIBLIOGRAPHY OF HYPOBARIC DECOMPRESSION SICKNESS RESEARCH CONDUCTED AT THE CREW TECHNOLOGY DIVISION, USAF SCHOOL OF AEROSPACE MEDICINE...190 man-flights to four selected altitudes (30000, 27500, 25000, and 22500 ft pressure equivalent) in a hypobaric chamber. The subjects’ ages ranged...conditions and two of these developed delayed sy~rtcms. Three of these five subjects underwent hyperbaric oxygen treatment. Conclusion. Female subjects

  6. Bibliographie (Bibliography).

    Science.gov (United States)

    Francais dans le Monde, 1981

    1981-01-01

    Presents a selective bibliography of dictionaries, books, and articles. References are grouped under three sections: I. Lexicology, II. Dictionaries and III. Didactics. Each item is followed by a concise critical note. The compilation is by the "Centre d'Etudes du Lexique" (CELEX, Paris-Villetaneuse). (MES)

  7. Social Sciences of Sport: Bibliographies on Educational Topics No. 3.

    Science.gov (United States)

    ERIC Clearinghouse on Teacher Education, Washington, DC.

    This publication is one of a series of annotated bibliographies in physical education. There are four sections--sport history, sport psychology, sport sociology, and sport philosophy. Each section consists of a brief introduction, the annotated bibliographic entries arranged alphabetically by author, and a list of cross references for documents…

  8. PHENYLKETONURIA, A COMPREHENSIVE BIBLIOGRAPHY, 1964.

    Science.gov (United States)

    Children's Bureau (DHEW), Washington, DC.

    INTENDED AS AN AID TO PROFESSIONAL AND TECHNICAL PERSONS INTERESTED IN PHENYLKETONURIA (PKU), THE BIBLIOGRAPHY LISTS AND ANNOTATES 817 ITEMS. CONTENT DIVISIONS ARE (1) GENERAL--MONOGRAPHS AND ARTICLES, (2) BIOCHEMISTRY--METABOLISM, EXPERIMENTS, TESTS, AND CASES IN WHICH THE EMPHASIS IS ON BIOCHEMISTRY, (3) GENETICS--GENE STUDIES, HEREDITARY…

  9. Children and Advertising: A Bibliography.

    Science.gov (United States)

    Council of Better Business Bureaus, Inc., New York, NY. Clearinghouse for Research on Children's Advertising.

    More than 600 entries are contained in this annotated bibliography of materials concerning the effects of television advertising on children. Entries are alphabetized by author and are divided into the following categories: special interest articles; general interest articles; books and pamphlets; government publications; transcripts of oral…

  10. Adult Nutrition Education Materials. January 1982-October 1988. Quick Bibliography Series.

    Science.gov (United States)

    Irving, Holly Berry

    This annotated bibliography of materials available from the National Agricultural Library through interlibrary loan to local libraries focuses on nutrition and dietetics as they relate to physical health and special health problems. The bibliography was derived from online searches of the AGRICOLA database, and materials include audiovisuals,…

  11. Hyperactivity--Drug Therapy/Food Additives/Allergies. A Selective Bibliography. Exceptional Child Bibliography Series No. 602.

    Science.gov (United States)

    ERIC Clearinghouse on Handicapped and Gifted Children, Reston, VA.

    The annotated bibliography on Hyperactivity--Drug Therapy/Food Additives/Allergies contains approximately 65 abstracts and associated indexing information for documents or journal articles published from 1968 to 1975 and selected from the computer files of the Council for Exceptional Children's Information Services and the Education Resources…

  12. Fire in South African ecosystems: an annotated bibliography.

    CSIR Research Space (South Africa)

    Schrige, GU

    1978-10-01

    Full Text Available References to 258 publications are presented together with summaries, keyword listings and a keyword index. This bibliography forms part of the South African contribution to the SCOPE project "The ecological effects of fire", 1977-1980....

  13. Annotated Bibliography for the DEWPOINT project

    Energy Technology Data Exchange (ETDEWEB)

    Oehmen, Christopher S.

    2009-04-21

    This bibliography covers aspects of the Detection and Early Warning of Proliferation from Online INdicators of Threat (DEWPOINT) project including 1) data management and querying, 2) baseline and advanced methods for classifying free text, and 3) algorithms to achieve the ultimate goal of inferring intent from free text sources. Metrics for assessing the quality and correctness of classification are addressed in the second group. Data management and querying include methods for efficiently storing, indexing, searching, and organizing the data we expect to operate on within the DEWPOINT project.

  14. Emergency Health Services Selected Bibliography.

    Science.gov (United States)

    Health Services and Mental Health Administration (DHEW), Bethesda, MD.

    This annotated bibliography contains books, journal articles, visual aids, and other documents pertaining to emergency health care, which are organized according to: (1) publications dealing with day-to-day health emergencies that occur at home, work, and play, (2) documents that will help communities prepare for emergencies, including natural…

  15. Systematic reviews of herbal medicines--an annotated bibliography

    NARCIS (Netherlands)

    Linde, K.; ter Riet, G.; Hondras, M.; Vickers, A.; Saller, R.; Melchart, D.

    2003-01-01

    OBJECTIVE: To provide a comprehensive collection and a summary of systematic reviews of clinical trials on herbal medicines. METHODS: Potentially relevant reviews were searched through the register of the Cochrane Complementary Medicine Field, the Cochrane Library, Medline, and bibliographies of

  16. Selected Bibliography of Egyptian Educational Materials. Vol. 5, No. 1, 1979.

    Science.gov (United States)

    Al-Ahram Center for Scientific Translations, Cairo (Egypt).

    This annotated bibliography contains 166 English language annotations of newspaper, journal, and government publications from Egypt on the topic of education. All items were published in 1979. The items are categorized by subject areas including: adult education, art education; basic education; child care, education and psychology; demographic…

  17. Resolving community conflict in the nuclear power issue: a report and annotated bibliography

    International Nuclear Information System (INIS)

    Burt, R.S.; Fischer, M.; Corbett, T.; Garrett, K.; Lundgren, M.

    1978-02-01

    This report is a scholarly discussion of the escalation and possible resolution of community conflict in the nuclear power issue. The concern is at all times with the social factors in this conflict; technical problems in nuclear power are only considered to the extent that such problems are raised in conflict over nuclear power. Social science research on conflict is only reviewed to the extent that it bears on community conflict over nuclear power. Chapter 1 describes the nature of community conflict escalation in the nuclear power issue: stages of escalation, typical individuals and groups involved, typical issues raised, typical manners in which participants become involved, and the basic social parameters of conflict escalation. Chapter 2 outlines the community level determinants of conflict escalation in the nuclear power issue: How is a community in which conflict over a nuclear facility is most likely different from a community in which such conflict is least likely. Chapter 3 is a detailed consideration of alternative methods of containing and resolving conflict. Chapter 4 summarizes principles for dealing with community conflict in the nuclear power issue. Finally, Chapter 5 is an annotated bibliography of the literature reviewed in the report. 840 references

  18. Resolving community conflict in the nuclear power issue: a report and annotated bibliography

    Energy Technology Data Exchange (ETDEWEB)

    Burt, R.S.; Fischer, M.; Corbett, T.; Garrett, K.; Lundgren, M.

    1978-02-01

    This report is a scholarly discussion of the escalation and possible resolution of community conflict in the nuclear power issue. The concern is at all times with the social factors in this conflict; technical problems in nuclear power are only considered to the extent that such problems are raised in conflict over nuclear power. Social science research on conflict is only reviewed to the extent that it bears on community conflict over nuclear power. Chapter 1 describes the nature of community conflict escalation in the nuclear power issue: stages of escalation, typical individuals and groups involved, typical issues raised, typical manners in which participants become involved, and the basic social parameters of conflict escalation. Chapter 2 outlines the community level determinants of conflict escalation in the nuclear power issue: How is a community in which conflict over a nuclear facility is most likely different from a community in which such conflict is least likely. Chapter 3 is a detailed consideration of alternative methods of containing and resolving conflict. Chapter 4 summarizes principles for dealing with community conflict in the nuclear power issue. Finally, Chapter 5 is an annotated bibliography of the literature reviewed in the report. 840 references.

  19. Product Modelling for Building Design: Annotated Bibliography (2nd Edition)

    DEFF Research Database (Denmark)

    Galle, Per

    1999-01-01

    This bibliography concerns research publications from 1976 to 1994-5, on product modelling in computer aided architectural design and computer aided engineering design of buildings and their surroundings. For each item of literature, full bibliographic information is given whenever available...... of literature is offered on machine interpretation of drawings, which may be relevant in the context of information exchange among different product models. Although the bibliography is fairly comprehensive as far as it goes, no completeness of coverage is claimed....

  20. THE BERBER LANGUAGES. A SELECTED BIBLIOGRAPHY.

    Science.gov (United States)

    APPLEGATE, JOSEPH R.

    ORGANIZED INTO TWO MAIN SECTIONS--BOOKS AND ARTICLES AND SERIAL PUBLICATIONS AND PUBLISHERS--THIS BIBLIOGRAPHY OF THE BERBER LANGUAGES REPRESENTS 758 ENTRIES, SOME OF WHICH ARE ANNOTATED. SUBDIVISIONS INCLUDE GENERAL LINGUISTICS, DIALECT GEOGRAPHY, PHONOLOGY, MORPHOLOGY, SYNTAX, LEXICON, TEXTS AND TRANSLATIONS, HISTORICAL AND COMPARATIVE STUDIES,…

  1. Fish passage at road crossings: an annotated bibliography.

    Science.gov (United States)

    Lynette Anderson; Mason. Bryant

    1980-01-01

    A report of special interest to fishery biologists, resource managers, hydrologists, and road engineers, this bibliography lists publications pertinent to road crossings of salmon and trout streams. Topics include bridge and culvert installation, design criteria, mechanics, hydraulics, and economics, as well as their biological effects.

  2. Marketing Nature-Oriented Tourism or Rural Development and Wildlands Management in Developing Countries: A Bibliography

    Science.gov (United States)

    C. Denise Ingram; Patrick B. Durst

    1987-01-01

    Annotated bibliography that specifically links tourism marketing and wildlands management. The bibliography is divided into five sections: Information Sources, Wildlands Management, Planning and Development, Tourism Impacts, Marketing and Promotion.Indexed by author and geographical location.

  3. Stakeholder involvement techniques. A short guide and annotated bibliography

    International Nuclear Information System (INIS)

    2005-01-01

    The Forum on Stakeholder Confidence (FSC) was created under a mandate from the Radioactive Waste Management Committee (RWMC) of the OECD Nuclear Energy Agency (NEA) to facilitate the sharing of international experience in addressing the societal dimension of radioactive waste management. It explores means of ensuring an effective dialogue amongst all stakeholders, and considers ways to strengthen confidence in decision-making processes. FSC documents may be obtained online at www.nea.fr/html/rwrnifsc.html. OECD countries are increasingly implementing forms of participatory democracy that will require new or enhanced forms of dialogue amongst a broader range of concerned parties. The 4. regular FSC meeting held in Paris in May 2003 included a topical session on Stakeholder involvement tools: Criteria for choice and evaluation. The internal Minutes of the 4. meeting noted, in response to the discussions initiated by this topical session: 'Given that FSC members have one specific issue - radioactive waste management (RWM) - to deal with, a continuing relationship and dialogue among stakeholders seems important. What is desired is a well-informed citizen, because this is - in the end - an issue of democracy. Perhaps we have suffered in our field from a lack of recognition that RWM, like others, is an issue of democracy as well as a technical one'. At the close of the topical session, it was agreed that the FSC would prepare a short guide on stakeholder involvement techniques. The present guide approaches the topic from the point of view of radioactive waste management. However, because dialogue and deliberation techniques can be used in many fields, it will be of interest to a wide readership. It includes an annotated bibliography pointing to easily accessible handbooks and other resources. (author)

  4. Skin Cancer Education Materials: Selected Annotations.

    Science.gov (United States)

    National Cancer Inst. (NIH), Bethesda, MD.

    This annotated bibliography presents 85 entries on a variety of approaches to cancer education. The entries are grouped under three broad headings, two of which contain smaller sub-divisions. The first heading, Public Education, contains prevention and general information, and non-print materials. The second heading, Professional Education,…

  5. Annotated bibliography for biologic overview for the Nevada Nuclear Waste Storage Investigations, Nevada Test Site, Nye County, Nevada

    International Nuclear Information System (INIS)

    Collins, E.; O'Farrell, T.P.; Rhoads, W.A.

    1981-12-01

    This annotated bibliography was compiled to accompany the Biologic Overview for the Nevada Nuclear Waste Storage Investigations, Nevada Test Site, Nye County, Nevada, EG and G, Santa Barbara Operations Report No. EGG 1183-2443, which documents and synthesizes important biotic information related to Nevada Nuclear Waste Storage Investigations (NNWSI). As such, it is an important part of the NNWSI screening process that was designed to include a systematic, traceable, defensible, and documented basis for a decision to proceed or not with site-specific phases on NTS. Included are all published, and available but unpublished, baseline information on life histories, habitat requirements, distributions, and ecological relationships of the flora and fauna of the region. Special effort was made to include information on endangered, threatened, or sensitive species. 131 references

  6. A Select Bibliography of Books on Labor Issues.

    Science.gov (United States)

    American Federation of Labor and Congress of Industrial Organizations, Washington, DC.

    This annotated bibliography of 90 books on labor issues presents selections in the following areas: labor history, biographies, contemporary issues, labor economics and labor relations, labor law, labor unions, women and work, and reference books. (DB)

  7. Sickle Cell: A Selected Resource Bibliography.

    Science.gov (United States)

    National Center for Education in Maternal and Child Health, Washington, DC.

    This annotated, selective bibliography lists the following types of educational and informational material on both sickle cell disease and trait: (1) professional education materials; (2) fact sheets, pamphlets, and brochures; and (3) audiovisual material. A selected list of references is provided for the following topic areas: (1) genetic…

  8. Science and Parascience: A Select Bibliography.

    Science.gov (United States)

    Roszak, Betty, Comp.

    This annotated bibliography identifies over 140 books, essays, and newsletters which are concerned with the convergence of the sciences with parapsychology. Most entries were published since 1950 although some date back to the early 1900s. Entries are presented alphabetically by author within four categories: psychological-metaphysical critiques…

  9. Spacecraft Fire Safety 1956 to 1999: An Annotated Bibliography

    Science.gov (United States)

    Friedman, Robert; Ruff, Gary A.

    2013-01-01

    Knowledge of fire safety in spacecraft has resulted from over 50 years of investigation and experience in space flight. Current practices and procedures for the operation of the Space Transportation System (STS) shuttle and the International Space Station (ISS) have been developed from this expertise, much of which has been documented in various reports. Extending manned space exploration from low Earth orbit to lunar or Martian habitats and beyond will require continued research in microgravity combustion and fire protection in low gravity. This descriptive bibliography has been produced to document and summarize significant work in the area of spacecraft fire safety that was published between 1956 and July 1999. Although some important work published in the late 1990s may be missing, these citations as well as work since 2000 can generally be found in Web-based resources that are easily accessed and searched. In addition to the citation, each reference includes a short description of the contents and conclusions of the article. The bibliography contains over 800 citations that are cross-referenced both by topic and the authors and editors. There is a DVD that accompanies this bibliography (available by request from the Center for Aerospace Information) containing the full-text articles of selected citations as well as an electronic version of this report that has these citations as active links to their corresponding full-text article.

  10. Bibliography of molecular dissociation in heavy particle collisions, 1950--75

    Energy Technology Data Exchange (ETDEWEB)

    McDaniel, E.W.; Barnett, C.F.; Crandall, D.H.; Gilbody, H.B.; Kirkpatrick, M.I.; Phaneuf, R.A.; Thomas, E.W.

    1979-02-01

    This annotated bibliography lists published work on molecular dissociation in heavy particle collisions for the period 1950 to 1975. Sources include scientific journals, abstract compilations, conference proceedings, books, and reports. The bibliography is arranged alphabetically by author. Each entry indicates whether the work was experimental or theoretical, what energy range was covered, and what reactants were investigated. Following the bibliographical listing are indexes of reactants and authors.

  11. Bibliography of molecular dissociation in heavy particle collisions, 1950--75

    International Nuclear Information System (INIS)

    McDaniel, E.W.; Barnett, C.F.; Crandall, D.H.; Gilbody, H.B.; Kirkpatrick, M.I.; Phaneuf, R.A.; Thomas, E.W.

    1979-02-01

    This annotated bibliography lists published work on molecular dissociation in heavy particle collisions for the period 1950 to 1975. Sources include scientific journals, abstract compilations, conference proceedings, books, and reports. The bibliography is arranged alphabetically by author. Each entry indicates whether the work was experimental or theoretical, what energy range was covered, and what reactants were investigated. Following the bibliographical listing are indexes of reactants and authors

  12. Bibliography of electron transfer in heavy particle collisions, 1950--1975

    International Nuclear Information System (INIS)

    Hawthorne, S.W.; Barnett, C.F.; Crandall, D.H.; Gilbody, H.B.; Kirkpatrick, M.I.; McDaniel, E.; Phaneuf, R.A.; Thomas, E.W.

    1979-02-01

    This annotated bibliography lists published work on electron transfer in heavy particle collisions for the period 1950 to 1975. Sources include scientific journals, abstract compilations, conference proceedings, books, and reports. The bibliography is arranged alphabetically by author. Each entry indicates whether the work was experimental or theoretical, what energy range was covered, and what reactants were investigated. Following the bibliographical listing are indexes of reactants and authors

  13. Environmental aspects of the transuranics: a selected, annotated bibliography

    Energy Technology Data Exchange (ETDEWEB)

    Fore, C.S.; Martin, F.M.; Faust, R.A. (comp.)

    1976-07-01

    This bibliography of 500 references is compiled from the Data Base on the Environmental Aspects of the Transuranics built to provide information support to the Nevada Applied Ecology Group (NAEG) of ERDA`s Nevada Operations Office. The general scope is environmental aspects of uranium and the transuranic elements, with emphasis on plutonium. Laboratory and field studies dealing with the effects of plutonium-239 on animals are highlighted in this bibliography. Supporting information on ecology of the Nevada Test Site and reviews on the effects of other radionuclides upon man and his environment has been included at the request of the NAEG. The references are arranged by subject category with first authors appearing alphabetically in each category. Indexes are given for author, geographic location, keywords, taxons, permuted title and publication description.

  14. Environmental aspects of the transuranics: a selected, annotated bibliography

    International Nuclear Information System (INIS)

    Fore, C.S.; Martin, F.M.; Faust, R.A.

    1976-07-01

    This bibliography of 500 references is compiled from the Data Base on the Environmental Aspects of the Transuranics built to provide information support to the Nevada Applied Ecology Group (NAEG) of ERDA's Nevada Operations Office. The general scope is environmental aspects of uranium and the transuranic elements, with emphasis on plutonium. Laboratory and field studies dealing with the effects of plutonium-239 on animals are highlighted in this bibliography. Supporting information on ecology of the Nevada Test Site and reviews on the effects of other radionuclides upon man and his environment has been included at the request of the NAEG. The references are arranged by subject category with first authors appearing alphabetically in each category. Indexes are given for author, geographic location, keywords, taxons, permuted title and publication description

  15. Environmental aspects of the transuranics. A selected, annotated bibliography

    International Nuclear Information System (INIS)

    Martin, F.M.; Faust, R.A.; Sanders, C.T.

    1975-07-01

    This bibliography of 470 references is from the computer file built to provide information support to the Nevada Applied Ecology Group (NAEG) of ERDA's Nevada Operations Office. The general scope is environmental aspects of uranium and the transuranic elements, with emphasis on plutonium. Biological aspects of the transuranics is highlighted in this bibliography. In addition, supporting materials involving basic ecology studies, ecology of the Nevada Test Site, and reviews on other radionuclides are entered at the request of the NAEG. Significant numeric data is shown in tabular display or is noted for reference to the original document. The references are arranged by subject category with first authors arranged alphabetically within the category. Indexes are given for author, keywords, geographic location, permuted title, taxons, and publication description. (U.S.)

  16. Selected, annotated bibliography of studies relevant to the isolation of nuclear wastes

    International Nuclear Information System (INIS)

    Hyder, L.K.; Fore, C.S.; Vaughan, N.D.; Faust, R.A.

    1980-09-01

    This annotated bibliography of 705 references represents the first in a series to be published by the Ecological Sciences Information Center containing scientific, technical, economic, and regulatory information relevant to nuclear waste isolation. Most references discuss deep geologic disposal, with fewer studies of deep seabed disposal; space disposal is also included. The publication covers both domestic and foreign literature for the period 1954 to 1980. Major chapters selected are Chemical and Physical Aspects; Container Design and Performance; Disposal Site; Envirnmental Transport; General Studies and Reviews; Geology, Hydrology and Site Resources; Regulatory and Economic Aspects; Repository Design and Engineering; Transportation Technology; Waste Production; and Waste Treatment. Specialized data fields have been incorporated to improve the ease and accuracy of locating pertinent references. Specific radionuclides for which data are presented are listed in the Measured Radionuclides field, and specific parameters which affect the migration of these radionuclides are presented in the Measured Parameters field. The references within each chapter are arranged alphabetically by leading author, corporate affiliation, or title of the document. When the author is not given, the corporate affiliation appears first. If these two levels of authorship are not given, the title of the document is used as the identifying level. Indexes are provided for author(s), keywords, subject category, title, geographic location, measured parameters, measured radionuclides, and publication description

  17. 1978 bibliography of atomic and molecular processes. [Bibliography

    Energy Technology Data Exchange (ETDEWEB)

    1980-03-01

    This annotated bibliography lists 2557 works on atomic and molecular processes reported in publications dated 1978. Sources include scientific journals, conference proceedings, and books. Each entry is designated by one or more of the 114 categories of atomic and molecular processes used by the Controlled Fusion Atomic Data Center to classify data. Also indicated is whether the work was experimental or theoretical, what energy range was covered, what reactants were investigated, and the country of origin of the first author. Following the bibliographical listing are indexes of reactants and authors.

  18. 1979 bibliography of atomic and molecular processes. [Bibliography

    Energy Technology Data Exchange (ETDEWEB)

    None

    1980-08-01

    This annotated bibliography lists 2146 works on atomic and molecular processes reported in publications dated 1979. Sources include scientific journals, conference proceedings, and books. Each entry is designated by one or more of the 114 categories of atomic and molecular processes used by the Controlled Fusion Atomic Data Center, Oak Ridge National Laboratory, to classify data. Also indicated is whether the work was experimental or theoretical, what energy range was covered, what reactants were investigated, and the country of origin of the first author. Following the bibliographical listing are indexes of reactants and authors.

  19. Annotated Bibliography for Drying Nuclear Fuel

    Energy Technology Data Exchange (ETDEWEB)

    Rebecca E. Smith

    2011-09-01

    Internationally, the nuclear industry is represented by both commercial utilities and research institutions. Over the past two decades many of these entities have had to relocate inventories of spent nuclear fuel from underwater storage to dry storage. These efforts were primarily prompted by two factors: insufficient storage capacity (potentially precipitated by an open-ended nuclear fuel cycle) or deteriorating quality of existing underwater facilities. The intent of developing this bibliography is to assess what issues associated with fuel drying have been identified, to consider where concerns have been satisfactorily addressed, and to recommend where additional research would offer the most value to the commercial industry and the U. S. Department of Energy.

  20. Environmental aspects of the transuranics: a selected, annotated bibliography

    International Nuclear Information System (INIS)

    Ensminger, J.T.; Martin, F.M.; Fore, C.S.

    1977-03-01

    This eighth published bibliography of 427 references is compiled from the Nevada Applied Ecology Information Center's Data Base on the Environmental Aspects of the Transuranics. The data base was built to provide information support to the Nevada Applied Ecology Group (NAEG) of ERDA's Nevada Operations Office. The general scope covers environmental aspects of uranium and the transuranic elements, with emphasis on plutonium. This bibliography highlights literature on plutonium 238 and 239 and americium in the critical organs of man and animals. Supporting information on ecology of the Nevada Test Site and reviews and summarizing literature on other radionuclides have been included at the request of the NAEG. The references are arranged by subject category with leading authors appearing alphabetically in each category. Indexes are provided for author(s), geographic location, keyword(s), taxon, title, and publication description

  1. Deburring: an annotated bibliography. Volume V

    International Nuclear Information System (INIS)

    Gillespie, L.K.

    1978-01-01

    An annotated summary of 204 articles and publications on burrs, burr prevention and deburring is presented. Thirty-seven deburring processes are listed. Entries cited include English, Russian, French, Japanese and German language articles. Entries are indexed by deburring processes, author, and language. Indexes also indicate which references discuss equipment and tooling, how to use a process, economics, burr properties, and how to design to minimize burr problems. Research studies are identified as are the materials deburred

  2. Asian Theatre: A Study Guide and Annotated Bibliography. "Theatre Perspectives" No. 1.

    Science.gov (United States)

    Brandon, James R., Ed.; Wichmann, Elizabeth, Ed.

    This study guide/bibliography is intended to help the English language reader find materials for the study of Asian theatre. Containing 1,348 entries, the guide is the most extensive bibliography published to date. The guide is organized by geographical area: an initial chapter on Asia is followed by chapters on each of 16 countries: Burma,…

  3. Communication and Culture in East Asia: A Bibliography.

    Science.gov (United States)

    Dei, Sharon

    This annotated bibliography lists books, articles, and other related sources dealing with the areas of Asian culture and communication. The 87 citations are organized under the following headings: (1) Asian Culture and Communication (in general); (2) China; (3) Japan; and (4) Korea. (HB)

  4. Bibliographies in nuclear science and technology. Section 2

    International Nuclear Information System (INIS)

    Fischer, E.; Jakubick, V.; Kalus, W.

    1976-06-01

    The present issue of the annotated bibliography contains 159 items. The content is divided into the following main headings: general aspects, radioecology and contamination. Literature on decontamination of food is missed in this issue. A detailed index section is annexed. (MG) [de

  5. Geological and geochemical aspects of uranium deposits. A selected, annotated bibliography

    Energy Technology Data Exchange (ETDEWEB)

    Garland, P.A.; Thomas, J.M.; Brock, M.L.; Daniel, E.W. (comps.)

    1980-06-01

    A bibliography of 479 references encompassing the fields of uranium and thorium geochemistry and mineralogy, geology of uranium deposits, uranium mining, and uranium exploration techniques has been compiled by the Ecological Sciences Information Center of Oak Ridge National Laboratory. The bibliography was produced for the National Uranium Resource Evaluation Program, which is funded by the Grand Junction Office of the Department of Energy. The references contained in the bibliography have been divided into the following eight subject categories: (1) geology of deposits, (2) geochemistry, (3) genesis O deposits, (4) exploration, (5) mineralogy, (6) uranium industry, (7) reserves and resources, and (8) geology of potential uranium-bearing areas. All categories specifically refer to uranium and thorium; the last category contains basic geologic information concerning areas which the Grand Junction Office feels are particularly favorable for uranium deposition. The references are indexed by author, geographic location, quadrangle name, geoformational feature, taxonomic name, and keyword.

  6. Geological and geochemical aspects of uranium deposits. A selected, annotated bibliography

    International Nuclear Information System (INIS)

    Garland, P.A.; Thomas, J.M.; Brock, M.L.; Daniel, E.W.

    1980-06-01

    A bibliography of 479 references encompassing the fields of uranium and thorium geochemistry and mineralogy, geology of uranium deposits, uranium mining, and uranium exploration techniques has been compiled by the Ecological Sciences Information Center of Oak Ridge National Laboratory. The bibliography was produced for the National Uranium Resource Evaluation Program, which is funded by the Grand Junction Office of the Department of Energy. The references contained in the bibliography have been divided into the following eight subject categories: (1) geology of deposits, (2) geochemistry, (3) genesis O deposits, (4) exploration, (5) mineralogy, (6) uranium industry, (7) reserves and resources, and (8) geology of potential uranium-bearing areas. All categories specifically refer to uranium and thorium; the last category contains basic geologic information concerning areas which the Grand Junction Office feels are particularly favorable for uranium deposition. The references are indexed by author, geographic location, quadrangle name, geoformational feature, taxonomic name, and keyword

  7. Multicultural Bibliography: Kindergarten-Grade 8 Library Books.

    Science.gov (United States)

    San Diego County Office of Education, CA.

    This annotated bibliography includes approximately 375 elementary-level books on history, biography, folklore, fiction, poetry, arts and crafts, and contemporary life of Blacks, Native Americans, Pan Asian Americans, Puerto Ricans, and other ethnic groups. The books cited are deemed to be non-stereotyped and appropriate for developing a…

  8. Bibliography of Utah radioactive occurrences. Volume II

    International Nuclear Information System (INIS)

    Doelling, H.H.

    1983-07-01

    The references in this bibliography were assembled by reviewing published bibliographies of Utah geology, unpublished reports of the US Geological Survey and the Department of Energy, and various university theses. Each of the listings is cross-referenced by location and subject matter. This report is published in two volumes

  9. A Selected Bibliography of Dictionaries. General Information Series, No. 9. Indochinese Refugee Education Guides.

    Science.gov (United States)

    Center for Applied Linguistics, Arlington, VA.

    This is a selected, annotated bibliography of dictionaries useful to Indochinese refugees. The purpose of this guide is to provide the American teacher or sponsor with information on the use, limitations and availability of monolingual and bilingual dictionaries which can be used by refugees. The bibliography is preceded by notes on problems with…

  10. Odors and Air Pollution: A Bibliography with Abstracts.

    Science.gov (United States)

    Environmental Protection Agency, Research Triangle Park, NC. Office of Air Programs.

    The annotated bibliography presents a compilation of abstracts which deal with odors as they relate to air pollution. The abstracts are arranged within the following categories: Emission sources; Control methods; Measurement methods; Air quality measurements; Atmospheric interaction; Basic science and technology; Effects-human health;…

  11. Annotated Bibliography of MMPI Research Among College Populations: 1962-1970.

    Science.gov (United States)

    Cornish, Richard D.

    The MMPI continues to be the focus of a large quantity of research. This article offers an aid to persons working with college student populations by annotating recent MMPI research relating to college populations. A total of 49 articles (each categorized in terms of content into one of 10 sections or subsections) were annotated. The Validity of…

  12. Bibliography on the stochastic processes in plasma and related problems

    International Nuclear Information System (INIS)

    Polovin, R.V.

    1976-01-01

    Stochastic processes in plasma and related matters. The bibliography contains 500 references and was compiled from the open literature only. Some references are annotated or completed with short abstracts. There are subject and authors indexes

  13. Bibliography of ionization and stripping in heavy particle collisions, 1950--1975

    International Nuclear Information System (INIS)

    Hawthorne, S.W.; McDaniel, E.W.; Barnett, C.F.; Crandall, D.H.; Gilbody, H.B.; Kirkpatrick, M.I.; Phaneuf, R.A.; Thomas, E.W.

    1979-02-01

    This annotated bibliography lists published work on ionization and stripping in heavy particle collisions for the period 1950 to 1975. Sources include scientific journals, abstract compilations, conference proceedings, books, and reports. The bibliography is arranged alphabetically by author. Each entry indicates whether the work was experimental or theoretical, what energy range was covered, and what reactants were investigated. Following the bibliographical listing are indexes of reactants and authors

  14. Selected Bibliography of Educational Materials: Maghreb, Algeria, Libya, Morocco, Tunisia. Vol. 9, No. 3, 1975.

    Science.gov (United States)

    Azzouz, Azzedine, Comp.; And Others

    The bibliography presents 91 English language annotations of newspaper articles, journals, and government publications about education in Algeria, Libya, Morocco, and Tunisia. Although the title also includes Maghreb, this issue does not contain any annotations for that country. All articles were published during the period July-September 1975.…

  15. Bibliografia Especializada: Educacion Basica (Specialized Bibliography: Basic Education).

    Science.gov (United States)

    Boletin del Centro Nacional de Documentacion e Informacion Educativa, 1971

    1971-01-01

    This specialized international bibliography on basic education lists almost 50 documents written between 1969 and 1971 in Spanish, French, and Italian on the topic of elementary education. Annotations are provided for nine of the articles. Specific topics range from elementary reading and math education to curriculum planning. (VM)

  16. International nuclear service centers: a bibliography

    International Nuclear Information System (INIS)

    Petty, G.M.; Yokota, M.

    1978-03-01

    The literature relating specifically to international nuclear fuel service centers would appear to be relatively scarce, based on the results of searches of the Energy Data Base, the libraries of the University of California at Los Angeles, and The Rand Corporation, and other sources. Works specifically relating to international service centers are annotated in this bibliography. Also listed, without annotation, are studies of various kinds of multinational public enterprises. In addition, there are references to many of the studies of the one-nation nuclear energy center concept. Most of these resulted from the survey of possible sites for these centers mandated by the US Energy Reorganization Act of 1974

  17. Bibliography of atomic and molecular excitation in heavy particle collisions, 1950--1975

    International Nuclear Information System (INIS)

    Hawthorne, S.W.; Thomas, E.W.; Barnett, C.F.; Crandall, D.H.; Gilbody, H.B.; Kirkpatrick, M.I.; McDaniel, E.W.; Phaneuf, R.A.

    1979-02-01

    This annotated bibliography lists published work on atomic and molecular excitation in heavy particle collisions for the period 1950 to 1975. Sources include scientific journals, abstract compilations, conference proceedings, books, and reports. The bibliography is arranged alphabetically by author. Each entry indicates whether the work was experimental or theoretical, what energy range was covered, and what reactants were investigated. Following the bibliographical listing are indexes of reactions and authors

  18. An Interdisciplinary Bibliography for Computers and the Humanities Courses.

    Science.gov (United States)

    Ehrlich, Heyward

    1991-01-01

    Presents an annotated bibliography of works related to the subject of computers and the humanities. Groups items into textbooks and overviews; introductions; human and computer languages; literary and linguistic analysis; artificial intelligence and robotics; social issue debates; computers' image in fiction; anthologies; writing and the…

  19. Geological and geochemical aspects of uranium deposits: a selected, annotated bibliography

    International Nuclear Information System (INIS)

    Thomas, J.M.; Garland, P.A.; White, M.B.; Daniel, E.W.

    1980-09-01

    This bibliography, a compilation of 474 references, is the fourth in a series compiled from the National Uranium Resource Evaluation (NURE) Bibliographic Data Base. This data base was created for the Grand Junction Office of the Department of Energy's National Uranium Resource Evaluation Project by the Ecological Sciences Information Center, Oak Ridge National Laboratory. The references in the bibliography are arranged by subject category: (1) geochemistry, (2) exploration, (3) mineralogy, (4) genesis of deposits, (5) geology of deposits, (6) uranium industry, (7) geology of potential uranium-bearing areas, and (8) reserves and resources. The references are indexed by author, geographic location, quadrangle name, geoformational feature, and keyword

  20. Tests in Print II: An Index to Tests, Test Reviews, and the Literature on Specific Tests.

    Science.gov (United States)

    Buros, Oscar K., Ed.

    Tests in Print II is a comprehensive, annotated bibliography of all in-print tests published as separates for use with English-speaking subjects. The 1,155 two-column pages list 2,467 tests in print as of early 1974; 16,574 references through 1971 on specific tests; a reprinting of the 1974 APA-AERA-NCME Standards for Educational andPsychological…

  1. Hydrologic bibliography of the Columbia River basalts in Washington

    International Nuclear Information System (INIS)

    Tanaka, H.H.; Wildrick, L.

    1978-07-01

    This bibliography is part of the hydrologic data compilation effort of the Columbia Plateau Hydrology Study, Rockwell Hanford Operations' Waste Isolation Program. It includes references on both surface and subsurface hydrology directly or indirectly related to the Washington State portion of the Columbia River basalts. A comprehensive, annotated bibliography of the Pasco Basin (including the Hanford site) hydrology has been prepared for Rockwell Hanford Operations under the Pasco Basin Hydrology Study. In order to avoid unnecessary duplication, no effort was made to include a complete list of bibliographic references on Hanford in this volume

  2. Behavior Modification in the Classroom: An Abstract Bibliography.

    Science.gov (United States)

    Kremer, Barbara, Comp.

    An annotated selective bibliography of documents on operation conditioning which are found in the ERIC microfiche collection and in journal literature is presented. Abstracts of these documents were taken from Research in Education (RIE) and Current Index to Journals in Education (CIJE). Included are published and unpublished studies focusing on…

  3. Bibliography of greenhouse-gas reduction strategies

    Energy Technology Data Exchange (ETDEWEB)

    Tompkins, M.M.; Mintz, M.M.

    1995-03-01

    A bibliography of greenhouse-gas reduction strategies has been compiled to assist the Climate change Action Plan Task Force in their consideration of strategies to reduce greenhouse-gas emissions from personal motor vehicles. The document contains a summary of the literature, including it major directions and implications; and annotated listing of 32 recent pertinent documents; and a listing of a larger group of related reports.

  4. Potential impacts of OCS oil and gas activities on fisheries. Volume 1. Annotated bibliography and database descriptions for target-species distribution and abundance studies. Section 1, Part 2. Final report

    International Nuclear Information System (INIS)

    Tear, L.M.

    1989-10-01

    The purpose of the volume is to present an annotated bibliography of unpublished and grey literature related to the distribution and abundance of select species of finfish and shellfish along the coasts of the United States. The volume also includes descriptions of databases that contain information related to target species' distribution and abundance. An index is provided at the end of each section to help the reader locate studies or databases related to a particular species

  5. Potential impacts of OCS oil and gas activities on fisheries. Volume 1. Annotated bibliography and database descriptions for target species distribution and abundance studies. Section 1, Part 1. Final report

    International Nuclear Information System (INIS)

    Tear, L.M.

    1989-10-01

    The purpose of the volume is to present an annotated bibliography of unpublished and grey literature related to the distribution and abundance of select species of finfish and shellfish along the coasts of the United States. The volume also includes descriptions of databases that contain information related to target species' distribution and abundance. An index is provided at the end of each section to help the reader locate studies or databases related to a particular species

  6. Bats and wind energy: a literature synthesis and annotated bibliography

    Science.gov (United States)

    Ellison, Laura E.

    2012-01-01

    Turbines have been used to harness energy from wind for hundreds of years. However, with growing concerns about climate change, wind energy has only recently entered the mainstream of global electricity production. Since early on in the development of wind-energy production, concerns have arisen about the potential impacts of turbines to wildlife; these concerns have especially focused on the mortality of birds. Despite recent improvements to turbines that have resulted in reduced mortality of birds, there is clear evidence that bat mortality at wind turbines is of far greater conservation concern. Bats of certain species are dying by the thousands at turbines across North America, and the species consistently affected tend to be those that rely on trees as roosts and most migrate long distances. Turbine-related bat mortalities are now affecting nearly a quarter of all bat species occurring in the United States and Canada. Most documented bat mortality at wind-energy facilities has occurred in late summer and early fall and has involved tree bats, with hoary bats (Lasiurus cinereus) being the most prevalent among fatalities. This literature synthesis and annotated bibliography focuses on refereed journal publications and theses about bats and wind-energy development in North America (United States and Canada). Thirty-six publications and eight theses were found, and their key findings were summarized. These publications date from 1996 through 2011, with the bulk of publications appearing from 2007 to present, reflecting the relatively recent conservation concerns about bats and wind energy. The idea for this Open-File Report formed while organizing a joint U.S. Fish and Wildlife Service/U.S. Geological Survey "Bats and Wind Energy Workshop," on January 25-26, 2012. The purposes of the workshop were to develop a list of research priorities to support decision making concerning bats with respect to siting and operations of wind-energy facilities across the United

  7. Selected, annotated bibliography of studies relevant to the isolation of nuclear wastes. [705 references

    Energy Technology Data Exchange (ETDEWEB)

    Hyder, L.K.; Fore, C.S.; Vaughan, N.D.; Faust, R.A.

    1980-09-01

    This annotated bibliography of 705 references represents the first in a series to be published by the Ecological Sciences Information Center containing scientific, technical, economic, and regulatory information relevant to nuclear waste isolation. Most references discuss deep geologic disposal, with fewer studies of deep seabed disposal; space disposal is also included. The publication covers both domestic and foreign literature for the period 1954 to 1980. Major chapters selected are Chemical and Physical Aspects; Container Design and Performance; Disposal Site; Envirnmental Transport; General Studies and Reviews; Geology, Hydrology and Site Resources; Regulatory and Economic Aspects; Repository Design and Engineering; Transportation Technology; Waste Production; and Waste Treatment. Specialized data fields have been incorporated to improve the ease and accuracy of locating pertinent references. Specific radionuclides for which data are presented are listed in the Measured Radionuclides field, and specific parameters which affect the migration of these radionuclides are presented in the Measured Parameters field. The references within each chapter are arranged alphabetically by leading author, corporate affiliation, or title of the document. When the author is not given, the corporate affiliation appears first. If these two levels of authorship are not given, the title of the document is used as the identifying level. Indexes are provided for author(s), keywords, subject category, title, geographic location, measured parameters, measured radionuclides, and publication description.

  8. Bibliography of Selected SCSD, URBS, SSP, SEF, and RAS Publications.

    Science.gov (United States)

    Stanford Univ., CA. School Planning Lab.

    The annotated bibliography contains publications and report listings of the following sources--(1) School Construction Systems Development (SCSD), (2) University Residential Building Systems (URBS), (3) Florida Schoolhouse Systems Project (SSP), (4) Study of Educational Facilities (SEF), and (5) Recherches en Amenagements Scolaires (RAS) Building…

  9. An Annotated Bibliography of Isotonic Weight-Training Methods.

    Science.gov (United States)

    Wysong, John V.

    This literature study was conducted to compare and evaluate various types and techniques of weight lifting so that a weight lifting program could be selected or devised for a secondary school. Annotations of 32 research reports, journal articles, and monographs on isotonic strength training are presented. The literature in the first part of the…

  10. Annotated bibliography of environmentally relevant investigations of uranium mining and milling in the Grants Mineral Belt, northwestern New Mexico

    Science.gov (United States)

    Otton, James K.

    2011-01-01

    Studies of the natural environment in the Grants Mineral Belt in northwestern New Mexico have been conducted since the 1930s; however, few such investigations predate uranium mining and milling operations, which began in the early 1950s. This report provides an annotated bibliography of reports that describe the hydrology and geochemistry of groundwaters and surface waters and the geochemistry of soils and sediments in the Grants Mineral Belt and contiguous areas. The reports referenced and discussed provide a large volume of information about the environmental conditions in the area after mining started. Data presented in many of these studies, if evaluated carefully, may provide much basic information about the baseline conditions that existed over large parts of the Grants Mineral Belt prior to mining. Other data may provide information that can direct new work in efforts to discriminate between baseline conditions and the effects of the mining and milling on the natural environment.

  11. Terrorism: Supplement to the Second Edition. A Selected Bibliography.

    Science.gov (United States)

    Boston, Guy D.

    The annotated bibliography describes 85 materials related to terrorism which were collected by the National Criminal Reference Service. Although no consensus exists on the definition of terrorism, the term is interpreted in this document to include both illegal and destructive acts against society and governments and violent means undertaken to…

  12. Selected Bibliography of Egyptian Educational Materials, Vol. 1, No. 4, 1975.

    Science.gov (United States)

    Al-Ahram Center for Scientific Translations, Cairo (Egypt).

    This annotated bibliography of Egyptian publications on education contains 108 entries. Publications include journal articles, books, and government documents. The following educational topics are covered: adult education, teaching Arabic language, art education, audiovisual aids, teaching civics, formation of committees, secondary school courses…

  13. Selected Bibliography of Egyptian Educational Materials, Vol. 3, No. 2, 1977.

    Science.gov (United States)

    Al-Ahram Center for Scientific Translations, Cairo (Egypt).

    The annotated bibliography identifies 134 selected educational materials from Egypt published during 1977. The materials are drawn from Egyptian newspapers, journals, government publications, and university research reports. The entries are organized into 54 categories, including Art Education, Arabic Language, Commercial Schools, Curricula,…

  14. Selected Bibliography of Egyptian Educational Materials, Vol. 2, No. 3, 1976.

    Science.gov (United States)

    Al-Ahram Center for Scientific Translations, Cairo (Egypt).

    The selective annotated bibliography of Egyptian educational publications contains 109 entries on 42 topics. Included are journal articles, books, and government documents published during 1976. Content includes the following topics: adult education, art education, audiovisual aids, care for distinguished students, educational planning,…

  15. Radioactive waste isolation in salt: geochemistry of brine in rock salt in temperature gradients and gamma-radiation fields - a selective annotated bibliography

    International Nuclear Information System (INIS)

    Hull, A.B.; Williams, L.B.

    1985-07-01

    Evaluation of the extensive research concerning brine geochemistry and transport is critically important to successful exploitation of a salt formation for isolating high-level radioactive waste. This annotated bibliography has been compiled from documents considered to provide classic background material on the interactions between brine and rock salt, as well as the most important results from more recent research. Each summary elucidates the information or data most pertinent to situations encountered in siting, constructing, and operating a mined repository in salt for high-level radioactive waste. The research topics covered include the basic geology, depositional environment, mineralogy, and structure of evaporite and domal salts, as well as fluid inclusions, brine chemistry, thermal and gamma-radiation effects, radionuclide migration, and thermodynamic properties of salts and brines. 4 figs., 6 tabs

  16. Radioactive waste isolation in salt: geochemistry of brine in rock salt in temperature gradients and gamma-radiation fields - a selective annotated bibliography

    Energy Technology Data Exchange (ETDEWEB)

    Hull, A.B.; Williams, L.B.

    1985-07-01

    Evaluation of the extensive research concerning brine geochemistry and transport is critically important to successful exploitation of a salt formation for isolating high-level radioactive waste. This annotated bibliography has been compiled from documents considered to provide classic background material on the interactions between brine and rock salt, as well as the most important results from more recent research. Each summary elucidates the information or data most pertinent to situations encountered in siting, constructing, and operating a mined repository in salt for high-level radioactive waste. The research topics covered include the basic geology, depositional environment, mineralogy, and structure of evaporite and domal salts, as well as fluid inclusions, brine chemistry, thermal and gamma-radiation effects, radionuclide migration, and thermodynamic properties of salts and brines. 4 figs., 6 tabs.

  17. An Annotated Bibliography of the Literature Dealing with the Impact of Divorce upon the Academic Performance, Emotional Adjustment, Self-Concept, and Behavioral Changes of Children of Divorce and the Diagnosis of and Strategies for Alleviating Negative Symptoms of Divorce.

    Science.gov (United States)

    Barrington, Diane M.

    Annotated citations in this bibliography are divided into two sections: (1) statistical studies concerning the impact of divorce on students, and (2) diagnostic studies and suggested strategies for dealing with the issue of marital separation and divorce and their effects in the classroom. A glossary of terms, a summary of findings, conclusions,…

  18. Job Sharing for Teachers. Bibliographies in Education. No. 79.

    Science.gov (United States)

    Canadian Teachers' Federation, Ottawa (Ontario).

    This annotated bibliography focusing on job sharing for teachers contains 37 book citations and 94 journal article citations. While the particular focus was on job sharing for teachers, general works which provide useful information on such arrangements have been included. A special effort was made to include all Canadian references related to job…

  19. Municipal solid waste management: A bibliography of U.S. Department of Energy contractor reports through 1995

    International Nuclear Information System (INIS)

    NONE

    1997-01-01

    This bibliography is an updated version of Municipal Solid Waste Management: A Bibliography of US Department of Energy Contractor Reports Through 1994 (NREL/TP-430-7886). The original bibliography, entitled Municipal Waste to Energy: An Annotated Bibliography of US Department of Energy Contractor Reports, by Caroline Brooks, was published in 1987. Like its predecessor, this bibliography provides information about technical reports on energy from municipal waste that were prepared under grants or contracts from the US Department of Energy. The reports listed focus on energy from municipal waste technologies and energy conservation in wastewater treatment. The bibliography contains three indexes-an author index, a subject index, and a title index. The reports are listed alphabetically in the subject areas and may appear under more than one subject. All of the reports cited in the original MSW bibliography are also included in this update

  20. Municipal solid waste management: A bibliography of U.S. Department of Energy contractor reports through 1995

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-09-01

    This bibliography is an updated version of Municipal Solid Waste Management: A Bibliography of US Department of Energy Contractor Reports Through 1994 (NREL/TP-430-7886). The original bibliography, entitled Municipal Waste to Energy: An Annotated Bibliography of US Department of Energy Contractor Reports, by Caroline Brooks, was published in 1987. Like its predecessor, this bibliography provides information about technical reports on energy from municipal waste that were prepared under grants or contracts from the US Department of Energy. The reports listed focus on energy from municipal waste technologies and energy conservation in wastewater treatment. The bibliography contains three indexes--an author index, a subject index, and a title index. The reports are listed alphabetically in the subject areas and may appear under more than one subject. All of the reports cited in the original MSW bibliography are also included in this update.

  1. Selected Bibliography of Egyptian Educational Materials, Vol. 2, No. 2, 1976.

    Science.gov (United States)

    Al-Ahram Center for Scientific Translations, Cairo (Egypt).

    One hundred fourteen entries on 58 topics are contained in the selective annotated bibliography of Egyptian publications on education. Included are journal articles, books, and government documents published during 1976. Content includes the following topics: adult education, Arabic language, audiovisual aids, child upbringing, civics, economics…

  2. Selected Bibliography of Egyptian Educational Materials, Vol. 2, No. 1, 1976.

    Science.gov (United States)

    Al-Ahram Center for Scientific Translations, Cairo (Egypt).

    This selective annotated bibliography of Egyptian publications on education contains 126 entries on 55 topics. Publications include journal articles, books, and government documents published during 1976 or late 1975. Among the 55 topics are the following: adult education, agricultural schools, art education, child upbringing, compulsory…

  3. Selected Bibliography of Egyptian Educational Materials, Vol. 2, No. 4, 1976.

    Science.gov (United States)

    Al-Ahram Center for Scientific Translations, Cairo (Egypt).

    One hundred seventy entries on 69 topics are contained in the selective annotated bibliography of Egyptian publications on education. Included are journal articles, books, and government documents published during 1976. Content includes the following topics: Arabic language, art education, civics, commercial schools, comparative education,…

  4. New Publications for Planning Libraries (List No. 20). Exchange Bibliography 928.

    Science.gov (United States)

    Vance, Mary, Comp.

    This partially annotated bibliography contains current listings on a variety of topics including architecture, economics, energy, environmental education, geography, housing, land use, politics, urban planning, recreation, and transportation. The bulk of the documents are project reports, commercially published books, and studies. Most date from…

  5. A Bibliography for Young Children: Birth Through Eight Years - Affective Domain.

    Science.gov (United States)

    Heinz, Rebecca S., Comp.

    The citations in this annotated bibliography of literature for young children cover many topics including aggression, feelings of ambivalence, anger, anxiety, loneliness, making friends, nightmares, perseverance, sibling rivalry, teasing, trust, values, and attitudes toward work. The books cited focus on aspects of children's emotional experience…

  6. Nuclear criticality experiments from 1943 to 1978. An annotated bibliography: Volume 1, main listing

    International Nuclear Information System (INIS)

    Koponen, B.L.; Wilcox, T.P.; Hampel, V.E.

    1979-05-01

    This report only describes the bibliography which contains 1067 citations from the literature of critical and near-critical nuclear experiments. The bibliography provides an up-to-date index to reports containing useful data for many types of criticality studies. Most of the reports can provide specifications for relatively simple critical configurations necessary for validating nuclear constants and calculational techniques. The reports of more than 1143 experimentors at 38 international facilities since 1943 are cross-referenced. This collection contains the prototypes of many different designs of nuclear reactors and studies performed to ensure the safe use of fissile materials in chemical processing plants, storage facilities, and transportation containers. The bibliography has three volumes. Volume 1 contains the main listing of citations with abstracts. Volume 2 is a set of indexes organized by report number, publication date, experimental facility, and author name. Volume 3 provides a subject index, concorded on the significant keyphrases derived from titles, and an index of key terms extracted from titles and abstracts. The bibliography was printed by computer as a selection from a computerized system at Lawrence Livermore Laboratory containing information and data on criticality experiments

  7. Annotated bibliography on selected areas of coal mining research and development. Report prepared for the Committee on Science and Technology, US House of Representatives, Ninety-Sixth Congress, First Session by the Congressional Research Service, Library of Congress

    Energy Technology Data Exchange (ETDEWEB)

    1979-01-01

    The Congressional Research Service has completed an annotated bibliography on coal mining research and development. Although the completion of the study was delayed in order to permit CRS analysts to search the libraries of Bituminous Coal, Research Inc., and the Bureau of Mines in the Pittsburgh area, current re-emphasis on the use of coal as an energy source indicates a sustained relevance. The bibliography presents key references to coal-mining R and D under six subject headings keyed to issues of central concern in coal production: (1) mine health and safety, (2) methane recovery, (3) 1-hour rescuer, (4) use of diesels underground, (5) coal preparation, and (6) manpower development in coal mining.

  8. Selected Bibliography of Egyptian Educational Materials, Vol. 3, No. 1, 1977.

    Science.gov (United States)

    Al-Ahram Center for Scientific Translations, Cairo (Egypt).

    This annotated bibliography lists 135 selected educational materials from Egypt covering the period 1976-1977. The materials are drawn from a variety of Egyptian newspapers, journals, government publications, and university research reports. The entries are organized into 55 categories, including Adolescence; Adult Education; Art Education; Basic…

  9. Selected Bibliography of Egyptian Educational Materials. Vol. 3, No. 4, 1977.

    Science.gov (United States)

    Al-Ahram Center for Scientific Translations, Cairo (Egypt).

    Over 130 citations of books, journals, government publications, and newspapers dealing with education in Egypt are included in this annotated bibliography. Materials cited were published in 1977. Sixty-two alphabetically arranged categories cover such topics as agricultural schools, Arabic language, basic education, child care, curricula,…

  10. New Publications for Planning Libraries (List No. 19). Exchange Bibliography 927.

    Science.gov (United States)

    Vance, Mary, Comp.

    This partially annotated bibliography contains current sources on a variety of topics including architecture, economics, environmental education, energy, geography, land use, urban planning, politics, recreation, and open space. The sources date from 1973 through 1975. The bulk of the documents are project reports, commercially published books,…

  11. Geopressured geothermal bibliography. Volume I. Citation extracts. Second edition

    Energy Technology Data Exchange (ETDEWEB)

    Sepehrnoori, K.; Carter, F.; Schneider, R.; Street, S.; McGill, K.

    1983-05-01

    This annoted bibliography contains 1131 citations. It represents reports, papers, and articles appearing over the past eighteen years covering topics from the scientific and technical aspects of geopressured geothermal reservoirs to the social, environmental, and legal considerations of exploiting those reservoirs for their energy resources. Six indexes include: author, conference title, descriptor, journal title, report number, and sponsor. (MHR)

  12. The Preparation of an Annotated Bibliographical Guide to Selected Research Studies Related to the Small College, 1965-1971. Final Report.

    Science.gov (United States)

    Askew, Thomas A.

    This document presents an outline of the processes used in compiling and annotating an approximately 560-entry bibliography dealing with the small college. The entries are comprised of books, articles, dissertations, and other studies published on the small college from 1965 through 1971. The actual bibliography is to be published soon by the…

  13. The Journalism Bibliography of the Journalism Education Association's Bookshelf Commission, 1970.

    Science.gov (United States)

    Gaskill, David H.; And Others

    This annotated bibliography in 11 categories is designed to provide instructors with the means of identifying resource books needed for a Journalism Bookshelf in their school libraries. The 11 categories are Advertising and Public Relations, Analysis--Press and Society, Broadcasting, Communications Theory and Mass Media, Graphics--Design,…

  14. Safari Adventures: A Bibliography for Young Readers Preschool through Junior High.

    Science.gov (United States)

    Sumner, Mary Ann, Comp.

    This annotated bibliography contains books for blind or physically handicapped youngsters from preschool through junior high. The books are available in braille, on audiocassette, or recorded discs. The approximately 400 titles listed were produced in Florida or obtained from the National Library Service for the Blind and Physically Handicapped.…

  15. Annotated bibliography of safety-related occurrences in nuclear power plans as reported in 1974

    International Nuclear Information System (INIS)

    Scott, R.L.; Gallaher, R.B.

    1975-05-01

    All abnormal occurrences at nuclear power plants reported in 1974 are reviewed and summarized. This bibliography covers the individual reports on each of the 1421 abnormal occurrences reported to the U. S. Nuclear Regulatory Commission, as well as some 455 other documents pertaining to these and other events of note. The review is intended to provide insight as to where additional effort can be expended to improve operations in nuclear power plants. The individual reports, abstracted by the Nuclear Safety Information Center, concern incidents and failures, design or construction deficiencies, and noncompliance citations for license violations. A bibliography is included which contains 100-word abstracts of each incident. For convenience, the bibliography is organized according to type of facility as follows: boiling-water reactors; pressurized-water reactors; non-water-cooled power reactors; and reactors, general. Key-word and permuted-title indexes are provided for each section. (U.S.)

  16. Operation, Maintenance and Management of Wastewater Treatment Facilities: A Bibliography of Technical Documents.

    Science.gov (United States)

    Himes, Dottie

    This is an annotated bibliography of wastewater treatment manuals. Fourteen manuals are abstracted including: (1) A Planned Maintenance Management System for Municipal Wastewater Treatment Plants; (2) Anaerobic Sludge Digestion, Operations Manual; (3) Emergency Planning for Municipal Wastewater Treatment Facilities; (4) Estimating Laboratory Needs…

  17. Selected bibliography for the extraction of uranium from seawater: chemical process and plant design feasibility study

    Energy Technology Data Exchange (ETDEWEB)

    Binney, S.E.; Polkinghorne, S.T.; Jante, R.R.; Rodman, M.R.; Chen, A.C.T.; Gordon, L.I.

    1979-02-01

    A selected annotated bibliography of 521 references was prepared as a part of a feasibility study of the extraction of uranium from seawater. For the most part, these references are related to the chemical processes whereby the uranium is removed from the seawater. A companion docment contains a similar bibliography of 471 references related to oceanographic and uranium extraction plant siting considerations, although some of the references are in common. The bibliography was prepared by computer retrieval from Chemical Abstracts, Nuclear Science Abstracts, Energy Data Base, NTIS, and Oceanic Abstracts. References are listed by author, country of author, and selected keywords.

  18. Selected bibliography for the extraction of uranium from seawater: chemical process and plant design feasibility study

    International Nuclear Information System (INIS)

    Binney, S.E.; Polkinghorne, S.T.; Jante, R.R.; Rodman, M.R.; Chen, A.C.T.; Gordon, L.I.

    1979-02-01

    A selected annotated bibliography of 521 references was prepared as a part of a feasibility study of the extraction of uranium from seawater. For the most part, these references are related to the chemical processes whereby the uranium is removed from the seawater. A companion docment contains a similar bibliography of 471 references related to oceanographic and uranium extraction plant siting considerations, although some of the references are in common. The bibliography was prepared by computer retrieval from Chemical Abstracts, Nuclear Science Abstracts, Energy Data Base, NTIS, and Oceanic Abstracts. References are listed by author, country of author, and selected keywords

  19. BIBLIOGRAPHY ON LEARNING PROCESS. SUPPLEMENT II.

    Science.gov (United States)

    Harvard Univ., Cambridge, MA. Graduate School of Education.

    THIS SUPPLEMENTARY BIBLIOGRAPHY LISTS MATERIALS ON VARIOUS FACETS OF HUMAN LEARNING. APPROXIMATELY 60 UNANNOTATED REFERENCES ARE PROVIDED FOR DOCUMENTS DATING FROM 1954 TO 1966. JOURNAL ARTICLES, BOOKS, RESEARCH REPORTS, AND CONFERENCE PAPERS ARE LISTED. SOME SUBJECT AREAS INCLUDED ARE (1) LEARNING PARAMETERS AND ABILITY, (2) RETENTION AND…

  20. Geological and geochemical aspects of uranium deposits: a selected, annotated bibliography. [474 references

    Energy Technology Data Exchange (ETDEWEB)

    Thomas, J.M.; Garland, P.A.; White, M.B.; Daniel, E.W.

    1980-09-01

    This bibliography, a compilation of 474 references, is the fourth in a series compiled from the National Uranium Resource Evaluation (NURE) Bibliographic Data Base. This data base was created for the Grand Junction Office of the Department of Energy's National Uranium Resource Evaluation Project by the Ecological Sciences Information Center, Oak Ridge National Laboratory. The references in the bibliography are arranged by subject category: (1) geochemistry, (2) exploration, (3) mineralogy, (4) genesis of deposits, (5) geology of deposits, (6) uranium industry, (7) geology of potential uranium-bearing areas, and (8) reserves and resources. The references are indexed by author, geographic location, quadrangle name, geoformational feature, and keyword.

  1. Arms Control and Disarmament. A Quarterly Bibliography with Abstracts and Annotations.

    Science.gov (United States)

    Arms Control and Disarmament Agency, Washington, DC.

    This bibliography is compiled from a survey of the literature on the subject received by the Library of Congress. Only those likely to be available in larger research and public libraries in the United States are included. Sources surveyed include books, monographs, publications of government agencies and international and national organizations,…

  2. BioAnnote: a software platform for annotating biomedical documents with application in medical learning environments.

    Science.gov (United States)

    López-Fernández, H; Reboiro-Jato, M; Glez-Peña, D; Aparicio, F; Gachet, D; Buenaga, M; Fdez-Riverola, F

    2013-07-01

    Automatic term annotation from biomedical documents and external information linking are becoming a necessary prerequisite in modern computer-aided medical learning systems. In this context, this paper presents BioAnnote, a flexible and extensible open-source platform for automatically annotating biomedical resources. Apart from other valuable features, the software platform includes (i) a rich client enabling users to annotate multiple documents in a user friendly environment, (ii) an extensible and embeddable annotation meta-server allowing for the annotation of documents with local or remote vocabularies and (iii) a simple client/server protocol which facilitates the use of our meta-server from any other third-party application. In addition, BioAnnote implements a powerful scripting engine able to perform advanced batch annotations. Copyright © 2013 Elsevier Ireland Ltd. All rights reserved.

  3. Native American Arts and Crafts of the United States. Bibliography 1.

    Science.gov (United States)

    Indian Arts and Crafts Board, Washington, DC.

    The selected readings listed in this annotated bibliography are suggested as an introduction to the varied arts and crafts created from prehistoric to modern times by Native American peoples of the United States. The publications are organized by culture area to encompass major media practiced by Native American artists and craftsmen of these…

  4. Selected Bibliography of Egyptian Educational Materials. Vol. 5, No. 2, 1979.

    Science.gov (United States)

    Al-Ahram Center for Scientific Translations, Cairo (Egypt).

    One hundred and forty two books, articles, and government publications dealing with education in Egypt are cited in this annotated bibliography. Items cited were published in 1979 and examine education for all age groups and ability levels. The material is presented under 84 headings including adult education, art education, children's books,…

  5. Nutrition Education Materials: Grades Preschool through 6. 1979-March 1987. Quick Bibliography Series.

    Science.gov (United States)

    Irving, Holly Berry

    The citations in this annotated bibliography are of audiovisuals and books focusing on basic nutrition education for children in preschool through the sixth grade. There are 306 citations derived from online searches of the AGRICOLA database. Information is provided on obtaining the materials. (JD)

  6. Nutrition Education Materials: Grades 7 through 12. 1979-March 1987. Quick Bibliography Series.

    Science.gov (United States)

    Irving, Holly Berry

    The citations in this annotated bibliography are of audiovisuals and books focusing on basic nutrition education for children in junior high and secondary schools. There are 233 citations derived from online searches of the AGRICOLA database. Information is provided on obtaining the materials. (JD)

  7. TRI-SERVICE ELF COMMUNICATIONS - VOL. II, BIBLIOGRAPHY.

    Science.gov (United States)

    BIBLIOGRAPHIES, UNDERGROUND ANTENNAS , ELECTRICAL RESISTANCE, UNDERGROUND , COSTS, VERY LOW FREQUENCY, LOW FREQUENCY, PROPAGATION, NOISE(RADIO)....EXTREMELY LOW FREQUENCY), (*COMMAND AND CONTROL SYSTEMS, COMMUNICATION AND RADIO SYSTEMS), (* COMMUNICATION AND RADIO SYSTEMS, MILITARY RESEARCH

  8. Shakespeare Is Alive and Well in Cyberspace: An Annotated Bibliography.

    Science.gov (United States)

    Hett, Dorothy Marie

    2002-01-01

    Suggests that in addition to using books and movies to enhance students' understanding of Shakespeare, teachers can add the World Wide Web to their repertoire to help students connect to Shakespeare. Presents annotations of 12 websites to use for teaching Shakespeare. (SG)

  9. More Materiales Tocante Los Latinos. A Bibliography of Materials on the Spanish-American.

    Science.gov (United States)

    Harrigan, Joan, Comp.

    A bibliography of materials published between 1964 and 1969 on the Spanish American is presented to assist librarians and educators in locating Hispano instructional aids. Over 120 annotated entries list audio-visual aids and reading materials for students of all ages, professional materials for educators including librarians, ERIC materials…

  10. A DDC Bibliography on Computers in Information Sciences. Volume I. Information Sciences Series.

    Science.gov (United States)

    Defense Documentation Center, Alexandria, VA.

    The unclassified and unlimited bibliography compiles references dealing specifically with the role of computers in information sciences. The volume contains 249 annotated references grouped under two major headings: Time Shared, On-Line, and Real Time Systems, and Computer Components. The references are arranged in accesion number (AD-number)…

  11. The Geology of Burma (Myanmar): An Annotated Bibliography of Burma’s Geology, Geography and Earth Science

    Science.gov (United States)

    2008-09-01

    Eichornia-Crassipes; Ephydatia-Fluviatilis; Hydrilla; Imperata ; Inle; Intha; Shan; Utricularia. Abstract: cultural data on the people and a bibliography...characterized by dipterocarpus Bibliography of Burman Earth Science September 2008 71 tuberculatus and associated plants; the other by imperata . The

  12. Resources on Campus Governance and Employment Relations, 1967-1977. With Essay, Annotations, and Indexes.

    Science.gov (United States)

    Tice, Terrence N.

    An annotated bibliography containing 1,110 items from 1967 through early 1977 and other relevant resources covers virtually all the significant material on campus collective bargaining and closely related issues regarding campus governance and employment relations. It complements five publications from 1972-76 and indexes both authors and…

  13. Information on Child Abuse: A Selected Bibliography of Federal Government Publications. Research Guide.

    Science.gov (United States)

    Dodge, Timothy

    The overall topic of this annotated bibliography, directed to users of the Auburn University libraries, is child abuse. It contains 63 federal government publications in 4 major areas: (1) definitions and prevalence of child abuse, including child pornography and pedophilia, family violence, abductions, and emotional abuse; (2) recent legislation,…

  14. Maternal and Infant Nutrition Education Materials. January 1981-October 1988. Quick Bibliography Series.

    Science.gov (United States)

    Irving, Holly Berry

    The materials cited in this annotated bibliography focus on maternal and infant health and the critical importance of good nutrition. Audiovisuals and books are listed in 152 citations derived from online searches of the AGRICOLA database. Materials are available from the National Agricultural Library or through interlibrary loan to a local…

  15. Conservation Reserve Program (CRP) contributions to wildlife habitat, management issues, challenges and policy choices--an annotated bibliography

    Science.gov (United States)

    Allen, Arthur W.; Vandever, Mark W.

    2012-01-01

    The following bibliography presents brief summaries of documents relevant to Conservation Reserve Program relations to wildlife habitat, habitat management in agriculturally dominated landscapes, and conservation policies potentially affecting wildlife habitats in agricultural ecosystems. Because the literature summaries furnished provide only sweeping overviews, users are urged to obtain and evaluate those papers appearing useful to obtain a more complete understanding of study findings and their implications to conservation in agricultural ecosystems. The bibliography contains references to reports that reach beyond topics that directly relate to the Conservation Reserve Program. Sections addressing grassland management and landowner surveys/opinions, for example, furnish information useful for enhancing development and administration of conservation policies affecting lands beyond those enrolled in conservation programs. Some sections of the bibliography (for example, agricultural conservation policy, economics, soils) are far from inclusive of all relevant material written on the subject. Hopefully, these sections will serve as fundamental introductions to related issues. In a few instances, references may be presented in more than one section of the bibliography. For example, individual papers specifically addressing both non-game and game birds are included in respective sections of the bibliography. Duplication of citations and associated notes has, however, been kept to a minimum.

  16. Nuclear criticality experiments from 1943 to 1978: an annotated bibliography. Volume 1. Main listing

    Energy Technology Data Exchange (ETDEWEB)

    Koponen, B.L.; Wilcox, T.P.; Hampel, V.E.

    1979-04-24

    The bibliography contains 1067 citations from the literature of critical and near-critical nuclear experiments. It provides an up-to-date index to reports containing useful data for many types of criticality studies. Most of the reports can provide specifications for relatively simple critical configurations necessary for validating nuclear constants and calculational techniques. The reports of more than 1143 experimentors at 38 international facilities since 1943 are cross-referenced. The collection contains the prototypes of many different designs of nuclear reactors and studies performed to insure the safe use of fissile materials in chemical processing plants, storage facilities, and transportation containers. The bibliography has three volumes. Volume 1 contains the main listing of citations with abstracts. Volume 2 is a set of indexes organized by report number, publication date, experimental facility, and author name. Volume 3 provides a subject index, concorded on the significant keyphrases derived from titles, and an index of keyterms derived from titles, and an index of keyterms extracted from titles and abstracts. The bibliography was printed by computer as a selection from a computerized system at Lawrence Livermore Laboratory contaning information and data on criticality experiments.

  17. An Online Bibliography of Resources for the Study of Woman Suffrage

    Science.gov (United States)

    Sparacino, Elizabeth Kenny

    2004-01-01

    The purpose of this annotated bibliography is twofold. The first purpose is to address the question raised by Phyllis Holman Wiesbard, "Where are women on the 'net?" The second purpose is to explore how teachers can use the documents found on the world wide web to teach woman suffrage in their classrooms. Woman suffrage has proved to be a fruitful…

  18. Systematic Methods in School Planning and Design. A Selected and Annotated Bibliography.

    Science.gov (United States)

    Murtha, D. Michael

    A selection of technical reports, journal articles and books on various aspects of systematic methods for school planning and design, are presented in this bibliography. The subject areas include the design process in terms of--(1) practice, (2) theory, (3) methods, (4) decision systems, and (5) computer applications. Criteria for design with…

  19. India: an annotated bibliography on rural regional development

    Energy Technology Data Exchange (ETDEWEB)

    1978-01-01

    References contained in this bibliography focus on rural regional development in India during the past fifteen years. They include works on administration, administrative law, agriculture, business, community development, decision making, demography, development indicators, development planning, economic development, economic policy, education, employment and labor utilization, energy, family planning, finance and taxation, geography, health, housing, human settlements, income distribution, industry, institutional development, intergovernmental relations, land reform, location and space economy, migration, models, national planning, plan implementation, planning and programming techniques, politics and government, popular participation, population policy, poverty, project and program evaluation, public works, reference works, regional analysis, regional development, regional planning, rural development, science and technology, social communication, social development, social integration and welfare, social policy, socioeconomic diagnosis, subregional planning, systems approach, tourism and recreation, training techniques, and utilities. The information sources are primarilly Indian, but a few significant documents of foreign imprints have also been included. All documents referred to are in English and include reference works, government publications, scholarly works (monographs), conference proceedings, and periodical articles.

  20. Environmental aspects of the transuranics: a selected, annotated bibliography. [Pu-238, Pu-239

    Energy Technology Data Exchange (ETDEWEB)

    Ensminger, J.T.; Martin, F.M.; Fore, C.S. (comps.)

    1977-03-01

    This eighth published bibliography of 427 references is compiled from the Nevada Applied Ecology Information Center's Data Base on the Environmental Aspects of the Transuranics. The data base was built to provide information support to the Nevada Applied Ecology Group (NAEG) of ERDA's Nevada Operations Office. The general scope covers environmental aspects of uranium and the transuranic elements, with emphasis on plutonium. This bibliography highlights literature on plutonium 238 and 239 and americium in the critical organs of man and animals. Supporting information on ecology of the Nevada Test Site and reviews and summarizing literature on other radionuclides have been included at the request of the NAEG. The references are arranged by subject category with leading authors appearing alphabetically in each category. Indexes are provided for author(s), geographic location, keyword(s), taxon, title, and publication description.

  1. Annotated bibliography of Accelerator Technology Division research and development, 1978-1985

    International Nuclear Information System (INIS)

    Jameson, R.A.; Nicol, C.S.; Cochran, M.A.

    1985-09-01

    A bibliography is presented of unclassified published and in-house technical material written by members of the Accelerator Technology Division, Los Alamos National Laboratory, since its inception in January, 1978. The author and subject concordances in this report provide cross-reference to detailed citations kept in a computer database and a microfilm file of the documents. The citations include an abstract and other notes, and can be searched for key words and phrases

  2. Cleanup and treatment of radioactively contaminated land including areas near nuclear facilities. A selected bibliography

    International Nuclear Information System (INIS)

    Fore, C.S.; Faust, R.A.; Brewster, R.H.

    1982-09-01

    This annotated bibliography of 337 references summarizes the literature published on the cleanup and treatment of radioactively contaminated land. Specifically, this bibliography focuses on literature concerned with the methods of cleanup and treatment being applied - chemical, physical, or vegetative stabilization; the types of equipment being used; and the influence of climatic conditions on the method selected for use. The emphasis in such literature is placed on hazardous site cleanup efforts that have been completed as well as those that are in progress and are being planned. Appendix A includes 135 additional references to literature identified but not included in the bibliography because of time and funding constraints. Appendix B consists of a table that identifies the cleanup and treatment research conducted at specific sites. All of the information included in this bibliography is stored in a computerized form that is readily available upon request

  3. The News about High School Journalism: Focused Access to Selected Topics (FAST) Bibliography No. 4.

    Science.gov (United States)

    Cowles, Margaret Haining

    This annotated bibliography contains 33 items from the ERIC database on high school journalism topics of interest to student writers and editors, journalism instructors, publications advisers, and school administrators. The first section contains overviews. Ensuing sections address how journalism benefits students; legal issues in high school…

  4. Selecting Materials on the Iranian Revolution: A Short Bibliography of Materials Now in Print.

    Science.gov (United States)

    Sanchez, James Joseph

    Appropriate for adult reading, 27 books published between 1969 and 1982 are listed in this annotated bibliography for those studying the Iranian Revolution. Works are arranged into two categories: (1) "Background Materials: Islam and Petroleum," which lists basic works that make it easier to place events in Iran within an intelligible…

  5. Community College Faculty Retention: Examining Burnout, Stress, and Job Satisfaction. UCLA Community College Bibliography

    Science.gov (United States)

    McJunkin, Kyle Stewart

    2005-01-01

    Recent literature on faculty departure from community colleges has focused primarily on faculty retirement. Less research has been conducted on turnover related to stress and faculty burnout, particularly at the community college level. In order to shed some light on this subject, the citations in this annotated bibliography focus on the…

  6. Bibliography of the geology of the Columbia Basin and surrounding areas of Washington

    International Nuclear Information System (INIS)

    Tucker, G.B.; Rigby, J.G.

    1979-07-01

    In the fall of 1977, the Washington State Department of Natural Resources, Division of Geology and Earth Resources (WDGER), entered into a contract with the US Department of Energy, administered by Rockwell Hanford Operations (Rockwell) in Richland, Washington, as a principal contributor to a geologic study of feasibility of storing radioactive waste within Columbia River basalt. WDGER's responsibility was the production of this bibliography and a reconnaissance geologic map of the sediments overlying the Columbia River Basalt Group in the State of Washington. This bibliography is a compilation of all known published, unpublished, and open-file references dealing with geology and geophysics of the Columbia Basin of eastern Washington. The citations were obtained primarily from the WDGER and Washington State libraries; the Geo-Ref bibliographic system was also utilized. Because the WDGER portion of the study included preparation of a reconnaissance geologic map of surficial deposits in the Columbia Basin, available references dealing with this subject have been annotated. Many abstracts in the annotated section are quotations and have been copied directly from their respective publications

  7. Bibliography of the geology of the Columbia Basin and surrounding areas of Washington

    Energy Technology Data Exchange (ETDEWEB)

    Tucker, G.B.; Rigby, J.G.

    1979-07-01

    In the fall of 1977, the Washington State Department of Natural Resources, Division of Geology and Earth Resources (WDGER), entered into a contract with the US Department of Energy, administered by Rockwell Hanford Operations (Rockwell) in Richland, Washington, as a principal contributor to a geologic study of feasibility of storing radioactive waste within Columbia River basalt. WDGER's responsibility was the production of this bibliography and a reconnaissance geologic map of the sediments overlying the Columbia River Basalt Group in the State of Washington. This bibliography is a compilation of all known published, unpublished, and open-file references dealing with geology and geophysics of the Columbia Basin of eastern Washington. The citations were obtained primarily from the WDGER and Washington State libraries; the Geo-Ref bibliographic system was also utilized. Because the WDGER portion of the study included preparation of a reconnaissance geologic map of surficial deposits in the Columbia Basin, available references dealing with this subject have been annotated. Many abstracts in the annotated section are quotations and have been copied directly from their respective publications.

  8. 1978 bibliography of atomic and molecular processes

    International Nuclear Information System (INIS)

    1980-03-01

    This annotated bibliography lists 2557 works on atomic and molecular processes reported in publications dated 1978. Sources include scientific journals, conference proceedings, and books. Each entry is designated by one or more of the 114 categories of atomic and molecular processes used by the Controlled Fusion Atomic Data Center to classify data. Also indicated is whether the work was experimental or theoretical, what energy range was covered, what reactants were investigated, and the country of origin of the first author. Following the bibliographical listing are indexes of reactants and authors

  9. 1979 bibliography of atomic and molecular processes

    International Nuclear Information System (INIS)

    1980-08-01

    This annotated bibliography lists 2146 works on atomic and molecular processes reported in publications dated 1979. Sources include scientific journals, conference proceedings, and books. Each entry is designated by one or more of the 114 categories of atomic and molecular processes used by the Controlled Fusion Atomic Data Center, Oak Ridge National Laboratory, to classify data. Also indicated is whether the work was experimental or theoretical, what energy range was covered, what reactants were investigated, and the country of origin of the first author. Following the bibliographical listing are indexes of reactants and authors

  10. 1980 bibliography of atomic and molecular processes

    International Nuclear Information System (INIS)

    1982-02-01

    This annotated bibliography lists 2866 works on atomic and molecular processes reported in publications dated 1980. Sources include scientific journals, conference proceedings, and books. Each entry is designated by one or more of the 114 categories of atomic and molecular processes used by the Controlled Fusion Atomic Data Center, Oak Ridge National Laboratory, to classify data. Also indicated is whether the work was experimental or theoretical, what energy range was covered, what reactants were investigated, and the country of origin of the first author. Following the bibliographical listing are indexes of reactants and authors

  11. Environmental Pollution: Noise Pollution - Sonic Boom. Volume I.

    Science.gov (United States)

    Defense Documentation Center, Alexandria, VA.

    The unclassified, annotated bibliography is Volume I of a two-volume set on Noise Pollution - Sonic Boom in a series of scheduled bibliographies on Environmental Pollution. Volume II is Confidential. Corporate author-monitoring agency, subject, title, contract, and report number indexes are included. (Author/JR)

  12. A Bibliography of English as a Second Language Materials: Grades K-3.

    Science.gov (United States)

    National Clearinghouse for Bilingual Education, Arlington, VA.

    This annotated bibliography of English as a second language (ESL) materials for grades K-3 is divided into four parts. The first part, ESL texts, lists a number of series or single texts that are designed to teach the spoken language and reading to the elementary school child. The second part is a list of readers that, although were mostly…

  13. Annotated bibliography of structural equation modelling: technical work.

    Science.gov (United States)

    Austin, J T; Wolfle, L M

    1991-05-01

    Researchers must be familiar with a variety of source literature to facilitate the informed use of structural equation modelling. Knowledge can be acquired through the study of an expanding literature found in a diverse set of publishing forums. We propose that structural equation modelling publications can be roughly classified into two groups: (a) technical and (b) substantive applications. Technical materials focus on the procedures rather than substantive conclusions derived from applications. The focus of this article is the former category; included are foundational/major contributions, minor contributions, critical and evaluative reviews, integrations, simulations and computer applications, precursor and historical material, and pedagogical textbooks. After a brief introduction, we annotate 294 articles in the technical category dating back to Sewall Wright (1921).

  14. Annotated catalog and bibliography of the cyclocephaline scarab beetles (Coleoptera, Scarabaeidae, Dynastinae, Cyclocephalini).

    Science.gov (United States)

    Moore, Matthew R; Cave, Ronald D; Branham, Marc A

    2018-01-01

    Cyclocephaline scarab beetles represent the second largest tribe of the subfamily Dynastinae, and the group includes the most speciose genus of dynastines, Cyclocephala . The period following publication of Sebő Endrődi's The Dynastinae of the World has seen a huge increase in research interest on cyclocephalines, and much of this research has not been synthesized. The objective of this catalog and bibliography is to compile an exhaustive list of taxa in Cyclocephalini. This paper provides an updated foundation for understanding the taxonomy and classification of 14 genera and over 500 species in the tribe. It discusses the history of cataloging dynastine species, clarifies issues surrounding the neotype designations in Endrődi's revision of Cyclocephalini, synthesizes all published distribution data for cyclocephaline species, and increases accessibility to the voluminous literature on the group by providing an easily searchable bibliography for each species. We propose the nomen novum Cyclocephala rogerpauli , new replacement name , for C. nigra Dechambre.

  15. New Publications for Planning Libraries (List No. 18: Urban and Regional Planning). Exchange Bibliography 905.

    Science.gov (United States)

    Vance, Mary, Comp.

    This general bibliography contains current sources on urban and regional planning. Most citations date from 1973 through 1975, and some are annotated. The bulk of the documents are commercially published books, bulletins, project reports, and studies on urban studies, urban planning, regional planning, and city planning and problems. Citations are…

  16. Goethe-Institut Lehrerhandbibliothek: A Bibliography of Texts and Reference Works for the Teacher of German.

    Science.gov (United States)

    Goethe Inst., Munich (West Germany).

    Teachers of German will find 120 items dating from 1960 entered in this alphabetized and annotated bibliography of texts and references. Language entries include material on: (1) grammar, (2) vocabulary, (3) pronunciation, (4) writing and style, (5) syntax, (6) morphology, (7) etymology, (8) dictation, (9) translation exercises, (10) verbs, (11)…

  17. Coping: Books About Young People Surviving Special Problems. A Bibliography Based on the Acquisitions of EDMARC.

    Science.gov (United States)

    Billings, Mary DeWitt

    This annotated bibliography lists and describes books in the Educational Materials Review Center (EDMARC) collection for children and young adults which deal with some facet of mental health, physical handicaps, or family life. The mental health category includes books about retardation, severe depression, alcohol and drug abuse, suicide, dealing…

  18. Annotated bibliography of scientific research on greater sage-grouse published since January 2015

    Science.gov (United States)

    Carter, Sarah K.; Manier, Daniel J.; Arkle, Robert S.; Johnston, Aaron; Phillips, Susan L.; Hanser, Steven E.; Bowen, Zachary H.

    2018-02-14

    resulted in the inclusion of 169 published products (2 of these products were published corrections to journal articles). The management topics most commonly addressed were GRSG behavior or demographics and GRSG habitat selection or habitat characteristics at broad or site scales. Few products addressed captive breeding, recreation, wild horses and burros, and range management structures (including fences). We include in this annotated bibliography the full citation, product summary, and management topics addressed by each product. The online version of this bibliography (https://apps.usgs.gov/gsgbib/index.php) is searchable by topic and location and includes links to the original publications.A substantial body of literature has been compiled based on research explicitly related to the conservation, management, monitoring, and assessment of GRSG. These studies may inform planning and management actions that seek to balance conservation, economic, and social objectives and manage diverse resource uses and values across the western United States.The review process for this product included requesting input on each summary from one or more authors of the original peer-reviewed article or report and a formal review of the entire document by three independent reviewers and, subsequently, the USGS Bureau Approving Official. This process is consistent with USGS Fundamental Science Practices.

  19. 1982 bibliography of atomic and molecular processes

    International Nuclear Information System (INIS)

    Barnett, C.F.; Crandall, D.H.; Gilbody, H.B.

    1984-05-01

    This annotated bibliography includes papers on atomic and molecular processes published during 1982. Sources include scientific journals, conference proceedings, and books. Each entry is designated by one or more of the 114 categories of atomic and molecular processes used by the Controlled Fusion Atomic Data Center, Oak Ridge National Laboratory to classify data. Also indicated is whether the work was experimental or theoretical, what energy range was covered, what reactants were investigated, and the country of origin of the first author. Following the bibliographical listing, the entries are indexed according to the categories and according to reactants within each subcategory

  20. Bibliography of atomic and molecular processes, 1983

    International Nuclear Information System (INIS)

    Barnett, C.F.; Crandall, D.H.; Gilbody, H.B.

    1984-10-01

    This annotated bibliography includes papers on atomic and molecular processes published during 1983. Sources include scientific journals, conference proceedings, and books. Each entry is designated by one or more of the 114 categories of atomic and molecular processes used by the Controlled Fusion Atomic Data Center, Oak Ridge National Laboratory to classify data. Also indicated is whether the work was experimental or theoretical, what energy range was covered, what reactants were investigated, and the country of origin of the first author. Following the bibliographical listing, the entries are indexed according to the categories and according to reactants within each subcategory

  1. 1985 bibliography of atomic and molecular processes

    Energy Technology Data Exchange (ETDEWEB)

    Barnett, C.F.; Gilbody, H.B.; Gregory, D.C.; Griffin, P.M.; Havener, C.C.; Howald, A.M.; Kirkpatrick, M.I.; McDaniel, E.W.; Meyer, F.W.; Morgan, T.J. (comps.)

    1986-06-01

    This annotated bibliography includes papers on atomic and molecular processes published during 1985. Sources include scientific journals, conference proceedings, and books. Each entry is designated by one or more of the 114 categories of atomic and molecular processes used by the Controlled Fusion Atomic Data Center, Oak Ridge National Laboratory to classify data. Also indicated is whether the work was experimental or theoretical, what energy range was covered, what reactants were investigated, and the country of origin of the first author. Following the bibliographical listing, the entries are indexed according to the categories and according to reactants within each subcategory.

  2. 1985 bibliography of atomic and molecular processes

    International Nuclear Information System (INIS)

    Barnett, C.F.; Gilbody, H.B.; Gregory, D.C.

    1986-06-01

    This annotated bibliography includes papers on atomic and molecular processes published during 1985. Sources include scientific journals, conference proceedings, and books. Each entry is designated by one or more of the 114 categories of atomic and molecular processes used by the Controlled Fusion Atomic Data Center, Oak Ridge National Laboratory to classify data. Also indicated is whether the work was experimental or theoretical, what energy range was covered, what reactants were investigated, and the country of origin of the first author. Following the bibliographical listing, the entries are indexed according to the categories and according to reactants within each subcategory

  3. Bibliography of atomic and molecular processes, 1983

    Energy Technology Data Exchange (ETDEWEB)

    Barnett, C.F.; Crandall, D.H.; Gilbody, H.B.; Gregory, D.C.; Kirkpatrick, M.I.; McDaniel, E.W.; McKnight, R.H.; Meyer, F.W.; Morgan, T.J.; Phaneuf, R.A. (comps.)

    1984-10-01

    This annotated bibliography includes papers on atomic and molecular processes published during 1983. Sources include scientific journals, conference proceedings, and books. Each entry is designated by one or more of the 114 categories of atomic and molecular processes used by the Controlled Fusion Atomic Data Center, Oak Ridge National Laboratory to classify data. Also indicated is whether the work was experimental or theoretical, what energy range was covered, what reactants were investigated, and the country of origin of the first author. Following the bibliographical listing, the entries are indexed according to the categories and according to reactants within each subcategory.

  4. 1984 Bibliography of atomic and molecular processes

    International Nuclear Information System (INIS)

    Barnett, C.F.; Gilbody, H.B.; Gregory, D.C.

    1985-04-01

    This annotated bibliography includes papers on atomic and molecular processes published during 1984. Sources include scientific journals, conference proceedings, and books. Each entry is designated by one or more of the 114 categories of atomic and molecular processes used by the Controlled Fusion Atomic Data Center, Oak Ridge National Laboratory to classify data. Also indicated is whether the work was experimental or theoretical, what energy range was covered, what reactants were investigated, and the country of origin of the first author. Following the bibliographical listing, the entries are indexed according to the categories and according to reactants within each subcategory

  5. 1982 bibliography of atomic and molecular processes

    Energy Technology Data Exchange (ETDEWEB)

    Barnett, C.F.; Crandall, D.H.; Gilbody, H.B.; Gregory, D.C.; Kirkpatrick, M.I.; McDaniel, E.W.; McKnight, R.H.; Meyer, F.W.; Morgan, T.J.; Phaneuf, R.A. (comps.)

    1984-05-01

    This annotated bibliography includes papers on atomic and molecular processes published during 1982. Sources include scientific journals, conference proceedings, and books. Each entry is designated by one or more of the 114 categories of atomic and molecular processes used by the Controlled Fusion Atomic Data Center, Oak Ridge National Laboratory to classify data. Also indicated is whether the work was experimental or theoretical, what energy range was covered, what reactants were investigated, and the country of origin of the first author. Following the bibliographical listing, the entries are indexed according to the categories and according to reactants within each subcategory.

  6. Bibliography for nuclear criticality accident experience, alarm systems, and emergency management

    International Nuclear Information System (INIS)

    Putman, V.L.

    1995-09-01

    The characteristics, detection, and emergency management of nuclear criticality accidents outside reactors has been an important component of criticality safety for as long as the need for this specialized safety discipline has been recognized. The general interest and importance of such topics receives special emphasis because of the potentially lethal, albeit highly localized, effects of criticality accidents and because of heightened public and regulatory concerns for any undesirable event in nuclear and radiological fields. This bibliography lists references which are potentially applicable to or interesting for criticality alarm, detection, and warning systems; criticality accident emergency management; and their associated programs. The lists are annotated to assist bibliography users in identifying applicable: industry and regulatory guidance and requirements, with historical development information and comments; criticality accident characteristics, consequences, experiences, and responses; hazard-, risk-, or safety-analysis criteria; CAS design and qualification criteria; CAS calibration, maintenance, repair, and testing criteria; experiences of CAS designers and maintainers; criticality accident emergency management (planning, preparedness, response, and recovery) requirements and guidance; criticality accident emergency management experience, plans, and techniques; methods and tools for analysis; and additional bibliographies

  7. Alaska Wilderness: A Bibliography for Secondary Students on Marine Vertebrates, Birds, Small or Fur Bearing Mammals and Game Animals of Alaska.

    Science.gov (United States)

    Symons, Ann

    This is an annotated bibliography for secondary school students. It contains fourteen entries on marine vertebrates, nine entries on birds, twenty-nine entries on mammals, and one on amphibians and reptiles. Some of the entries are fiction. (BB)

  8. Bibliography of Unpublished Materials Pertaining to Hispanic Culture in the New Mexico WPA Writers' Files.

    Science.gov (United States)

    Cordova, Benito, Comp.

    The bibliography consists of unpublished manuscripts relating to the Hispano culture from the New Mexico Writer's Project. The nearly 600 different items, written 3 or 4 decades ago as part of a WPA project, present a fresh look at a variety of indigenous New Mexico folklore. Most of the entries are annotated, dated, and sources and contributors…

  9. Beautiful Black: A Bibliography about the Night for Young Readers from Preschool through Junior High.

    Science.gov (United States)

    Sumner, Mary Ann, Comp.

    This bibliography offers a "magical adventure into the dark and dreamy world of the night." It contains annotations for 146 books, available for free to the blind and disabled, that cover various things associated with the night: dreams, monsters and ghosts, overcoming fear of the dark, nights in other countries that are six months long,…

  10. Annotated bibliography of literature relating to wind transport of plutonium-contaminated soils at the Nevada Test Site

    International Nuclear Information System (INIS)

    Lancaster, N.; Bamford, R.

    1993-12-01

    During the period from 1954 through 1963, a number of tests were conducted on the Nevada Test Site (NTS) and Tonopah Test Range (TTR) to determine the safety of nuclear devices with respect to storage, handling, transport, and accidents. These tests were referred to as ''safety shots.'' ''Safety'' in this context meant ''safety against fission reaction.'' The safety tests were comprised of chemical high explosive detonations with components of nuclear devices. The conduct of these tests resulted in the dispersion of plutonium, and some americium over areas ranging from several tens to several hundreds of hectares. Of the various locations used for safety tests, the site referred to as ''Plutonium Valley'' was subject to a significant amount of plutonium contamination. Plutonium Valley is located in Area 11 on the eastern boundary of the NTS at an elevation of about 1036 m (3400 ft). Plutonium Valley was the location of four safety tests (A,B,C, and D) conducted during 1956. A major environmental, health, and safety concern is the potential for inhalation of Pu 239,240 by humans as a result of airborne dust containing Pu particles. Thus, the wind transport of Pu 239,240 particles has been the subject of considerable research. This annotated bibliography was created as a reference guide to assist in the better understanding of the environmental characteristics of Plutonium Valley, the safety tests performed there, the processes and variables involved with the wind transport of dust, and as an overview of proposed clean-up procedures

  11. Gulf Coast geopressured-geothermal program summary report compilation. Volume 4: Bibliography (annotated only for all major reports)

    Energy Technology Data Exchange (ETDEWEB)

    John, C.J.; Maciasz, G.; Harder, B.J.

    1998-06-01

    This bibliography contains US Department of Energy sponsored Geopressured-Geothermal reports published after 1984. Reports published prior to 1984 are documented in the Geopressured Geothermal bibliography Volumes 1, 2, and 3 that the Center for Energy Studies at the University of Texas at Austin compiled in May 1985. It represents reports, papers and articles covering topics from the scientific and technical aspects of geopressured geothermal reservoirs to the social, environmental, and legal considerations of exploiting those reservoirs for their energy resources.

  12. The Geology of Burma (Myanmar): An Annotated Bibliography of Burma's Geology, Geography and Earth Science

    National Research Council Canada - National Science Library

    Hadden, Robert L

    2008-01-01

    A bibliography on Burma prepared by the Topographic Engineering Center (TEC) to assist with humanitarian efforts offered by the US Government after the devastating Cyclone Nargis hit Burma on May 2, 2008...

  13. Physical Modeling in the Geological Sciences: An Annotated Bibliography. CEGS Programs Publication No. 16.

    Science.gov (United States)

    Charlesworth, L. J., Jr.; Passero, Richard Nicholas

    The bibliography identifies, describes, and evaluates devices and techniques discussed in the world's literature to demonstrate or stimulate natural physical geologic phenomena in classroom or laboratory teaching or research situations. The aparatus involved ranges from the very simple and elementary to the highly complex, sophisticated, and…

  14. Biomedical and environmental aspects of the thorium fuel cycle: a selected, annotated bibliography

    International Nuclear Information System (INIS)

    Faust, R.A.; Fore, C.S.; Cone, M.V.; Meyer, H.R.; Till, J.E.

    1979-07-01

    This bibliography was compiled to assist in the evaluation of the health and environmental consequences of high specific activity thorium and related nuclides which could be released to the environment by activities related to the Thorium Fuel Cycle. The general scope covers studies regarding potential releases, environmental transport, metabolism, dosimetry, dose assessment, and overall risk assessment for radionuclides specific to the NASAP project. This publication of 740 abstracted references highlights the biological and medical aspects of thorium 228 and thorium 232 in man and animals. Similar studies on related nuclides such as radium 224, radium 226, radium 228, and thorium 230 are also emphasized. Additional categories relevant to these radionuclides are included as follows: chemical analysis; ecological aspects; energy; geological aspects; instrumentation; legal and political aspects; monitoring, measurement and analysis; physical aspects; production; radiation safety and control; and waste disposal and management. Environmental assessment and sources categories were used for entries which contain a multiple use of categories. Leading authors appear alphabetically within each category. Indexes are provided for : author(s), geographic location, keywords, title, and publication description. The bibliography contains literature dating from December 1925 to February 1978

  15. Biomedical and environmental aspects of the thorium fuel cycle: a selected, annotated bibliography

    Energy Technology Data Exchange (ETDEWEB)

    Faust, R.A.; Fore, C.S.; Cone, M.V.; Meyer, H.R.; Till, J.E.

    1979-07-01

    This bibliography was compiled to assist in the evaluation of the health and environmental consequences of high specific activity thorium and related nuclides which could be released to the environment by activities related to the Thorium Fuel Cycle. The general scope covers studies regarding potential releases, environmental transport, metabolism, dosimetry, dose assessment, and overall risk assessment for radionuclides specific to the NASAP project. This publication of 740 abstracted references highlights the biological and medical aspects of thorium 228 and thorium 232 in man and animals. Similar studies on related nuclides such as radium 224, radium 226, radium 228, and thorium 230 are also emphasized. Additional categories relevant to these radionuclides are included as follows: chemical analysis; ecological aspects; energy; geological aspects; instrumentation; legal and political aspects; monitoring, measurement and analysis; physical aspects; production; radiation safety and control; and waste disposal and management. Environmental assessment and sources categories were used for entries which contain a multiple use of categories. Leading authors appear alphabetically within each category. Indexes are provided for : author(s), geographic location, keywords, title, and publication description. The bibliography contains literature dating from December 1925 to February 1978.

  16. Public regulation of site selection for nuclear power plants. Present procedures and reform proposals: an annotated bibliography

    International Nuclear Information System (INIS)

    Klema, E.D.; West, R.L.

    1977-01-01

    Part I of this bibliography contains literature which describes the process of power-plant siting as conducted by the utilities, siting procedures at the point of initiative, analytical tools employed or proposed for site assessment by enterprises in the industry, and the wide range of considerations which the utilities take into account in making site assessments. Part II contains studies and reports on the structure and process of public regulation of power plant siting: the licensing of nuclear facilities by the NRC under terms of the special Government powers in the field of nuclear energy that have evolved since World War II; the steady expansion of regulatory objectives bearing on site approval for nuclear power plants; local government, State, and other Federal agency regulation of siting; survey siting procedures in other countries; the role of regulatory delay in the long lead-time required for construction and operation of nuclear plants. Part III incudes citations on regulatory structure and practice that are unresponsive to the public interest; regulatory decision making's insufficient accessible to public scrutiny and participation; and regulatory procedures that encourage and protect inefficient practices of the regulated industries. Some legal decisions and case studies are included. Part IV, Reform Proposals, includes citations on regulatory reform and reform of siting regulations. Abstracts are provided with 157 of the citations with many more papers cited by title, author, and accession data

  17. Information pertinent to the migration of radionuclides in ground water at the Nevada Test Site. Part 2: annotated bibliography

    International Nuclear Information System (INIS)

    Borg, I.Y.; Stone, R.; Levy, H.B.; Ramspott, L.D.

    1976-01-01

    Part 2 of UCRL-52078 consists of the bibliography and abstracts that were compiled in the course of searching the literature for information on the migration of radionuclides in groundwater at the Nevada Test Site. The bibliography also includes numerous references to work done at foreign nuclear centers or contracted to outside agencies by these same centers

  18. Alignment-Annotator web server: rendering and annotating sequence alignments.

    Science.gov (United States)

    Gille, Christoph; Fähling, Michael; Weyand, Birgit; Wieland, Thomas; Gille, Andreas

    2014-07-01

    Alignment-Annotator is a novel web service designed to generate interactive views of annotated nucleotide and amino acid sequence alignments (i) de novo and (ii) embedded in other software. All computations are performed at server side. Interactivity is implemented in HTML5, a language native to web browsers. The alignment is initially displayed using default settings and can be modified with the graphical user interfaces. For example, individual sequences can be reordered or deleted using drag and drop, amino acid color code schemes can be applied and annotations can be added. Annotations can be made manually or imported (BioDAS servers, the UniProt, the Catalytic Site Atlas and the PDB). Some edits take immediate effect while others require server interaction and may take a few seconds to execute. The final alignment document can be downloaded as a zip-archive containing the HTML files. Because of the use of HTML the resulting interactive alignment can be viewed on any platform including Windows, Mac OS X, Linux, Android and iOS in any standard web browser. Importantly, no plugins nor Java are required and therefore Alignment-Anotator represents the first interactive browser-based alignment visualization. http://www.bioinformatics.org/strap/aa/ and http://strap.charite.de/aa/. © The Author(s) 2014. Published by Oxford University Press on behalf of Nucleic Acids Research.

  19. Nuclear energy and public safety (Part II): a bibliography of technical resources

    International Nuclear Information System (INIS)

    Gabriel, M.R.

    1982-01-01

    Part 2 of the bibliography focuses on technical information of interest to those concerned with the operation of nuclear power plants and the subjects of safety and accidents. A subject index included after the bibliography provides a breakdown of the references into seven categories. There is also an author index. The material cited is available through the National Technical Information Service (NTIS) in Springfield, Virginia

  20. Annotated Bibliography for Lake Erie. Volume II. Chemical,

    Science.gov (United States)

    1974-10-01

    ural forces tending to restore equilibrium. Bieber , Glen F. - See: Frank J. Little, Jr., et al, No. 212. 37. Bird, John. 1966. Our dying waters...research should indicate more definite trends. 207. Leonard, Justin W. 1962. Environmental requirements of Ephemeroptera. In: Clarence M. Tarzwell (Ed... Bieber , Thomas J. Horst and Danley F. Brown. 1973. Possible accelerated eutrophication thresholds in the Great Lakes rela- tive to human population

  1. Understanding the links between ecosystem health and social system well-being: an annotated bibliography.

    Science.gov (United States)

    Dawn M. Elmer; Harriet H. Christensen; Ellen M. Donoghue; [Compilers].

    2002-01-01

    This bibliography focuses on the links between social system well-being and ecosystem health. It is intended for public land managers and scientists and students of social and natural sciences. Multidisciplinary science that addresses the interconnections between the social system and the ecosystem is presented. Some of the themes and strategies presented are policy...

  2. Energy efficiency and using less – a social sciences and humanities annotated bibliography

    OpenAIRE

    Mourik, Ruth; Jeuken, Yvette; de Zeeuw, Mariska; Uitdenbogerd, Diana; van Summeren, Luc; Wilhite, Harold; Robison, Rosalyn A. V.; Heidenreich, Sara; Blahová, Michaela; Pidoux, Blandine; Kern-Gillard, Thomas; Arrobbio, Osman; Sonetti, Giulia; Throndsen, William; Fox, Emmet

    2017-01-01

    The challenge: \\ud * Technological progress and changes in energy supply are not sufficient for a transition to a low-carbon energy system; demand also needs to be considered. Energy efficiency and reducing total consumption - the topics of this bibliography - are typical elements of a demand side approach. \\ud * The uptake of energy efficient technologies, and understanding how we might use less energy, represent big challenges for researchers, policymakers, practitioners and end-users thems...

  3. Radionuclide movement in soils and uptake by plants. A selected, annotated bibliography

    International Nuclear Information System (INIS)

    Francis, C.W.; Talmage, S.S.; McMullin, B.B.

    1975-08-01

    This bibliography covers the world literature from 1948 to 1975 and contains 1397 references to information on how various chemical, physical, and biological factors influence the movement of radionuclides in soil and uptake by plants. Much of the data is related to the major fission products in radioactive fallout, with emphasis on 137 Cs and 90 Sr. References are included to data on nearly all fission products, a large number of biologically important activation products, and various naturally occurring radioactive nuclides such as uranium and thorium. Subject, author, geographic location, taxon, and permuted title indexes are included. (U.S.)

  4. Annotated bibliography of safety-related occurrences in pressurized-water nuclear power plants as reported in 1976

    International Nuclear Information System (INIS)

    Scott, R.L.; Gallaher, R.B.

    1977-01-01

    The bibliography contains 100-word abstracts of reports to the U.S. Nuclear Regulatory Commission concerning operational events that occurred at pressurized-water reactor nuclear power plants in 1976. Included are 1264 abstracts that describe incidents, failures, and design construction deficiencies experienced at the facilities. They are arranged alphabetically by reactor name and then chronologically for each reactor. Key-word and permuted-title indexes are provided to facilitate location of the subjects of interest, and tables summarizing the information contained in the bibliography are presented. The information listed in the tables includes instrument failures, equipment failures, system failures, causes of failures, deficiencies noted, and the time of occurrence (i.e., during refueling, operation, testing, or construction). A few of the unique events that occurred during the year are reviewed in detail

  5. Annotated bibliography of safety-related occurrences in pressurized-water nuclear power plants as reported in 1975

    International Nuclear Information System (INIS)

    Scott, R.L.; Gallaher, R.B.

    1976-07-01

    The bibliography presented contains 100-word abstracts of reports to the U.S. Nuclear Regulatory Commission concerning operational events that occurred at pressurized-water reactor nuclear power plants in 1975. The report includes 1097 abstracts, arranged alphabetically by reactor name and then chronologically for each reactor, that describe incidents, failures, and design or construction deficiencies experienced at the facilities. Key-word and permuted-title indexes are provided to facilitate location of the subjects of interest, and tables summarizing the information contained in the bibliography are presented. The information listed in the tables includes instrument failures, equipment failures, system failures, causes of failures, deficiencies noted, and the time of occurrence (i.e., during refueling, operation, testing, or construction). A few of the unique events that occurred during the year are reviewed in detail

  6. Annotated bibliography of safety-related occurrences in pressurized-water nuclear power plants as reported in 1976

    Energy Technology Data Exchange (ETDEWEB)

    Scott, R.L.; Gallaher, R.B.

    1977-08-01

    The bibliography contains 100-word abstracts of reports to the U.S. Nuclear Regulatory Commission concerning operational events that occurred at pressurized-water reactor nuclear power plants in 1976. Included are 1264 abstracts that describe incidents, failures, and design construction deficiencies experienced at the facilities. They are arranged alphabetically by reactor name and then chronologically for each reactor. Key-word and permuted-title indexes are provided to facilitate location of the subjects of interest, and tables summarizing the information contained in the bibliography are presented. The information listed in the tables includes instrument failures, equipment failures, system failures, causes of failures, deficiencies noted, and the time of occurrence (i.e., during refueling, operation, testing, or construction). A few of the unique events that occurred during the year are reviewed in detail.

  7. Annotated bibliography of safety-related occurrences in boiling-water nuclear power plants as reported in 1975

    Energy Technology Data Exchange (ETDEWEB)

    Scott, R.L.; Gallaher, R.B.

    1976-07-01

    The bibliography presented contains 100-word abstracts of reports to the U.S. Nuclear Regulatory Commission concerning operational events that occurred at boiling-water reactor nuclear power plants in 1975. The report includes 1169 abstracts, arranged alphabetically by reactor name and then chronologically for each reactor, that describe incidents, failures, and design or construction deficiencies that were experienced at the facilities. Key-word and permuted-title indexes are provided to facilitate location of the subjects of interest, and tables that summarize the information contained in the bibliography are provided. The information listed in the tables includes instrument failures, equipment failures, system failures, causes of failures, deficiencies noted, and the time of occurrence (i.e., during refueling, operation, testing, or construction). Seven of the unique events that occurred during the year are reviewed in detail.

  8. Annotated bibliography of safety-related occurrences in pressurized-water nuclear power plants as reported in 1975

    Energy Technology Data Exchange (ETDEWEB)

    Scott, R.L.; Gallaher, R.B.

    1976-07-01

    The bibliography presented contains 100-word abstracts of reports to the U.S. Nuclear Regulatory Commission concerning operational events that occurred at pressurized-water reactor nuclear power plants in 1975. The report includes 1097 abstracts, arranged alphabetically by reactor name and then chronologically for each reactor, that describe incidents, failures, and design or construction deficiencies experienced at the facilities. Key-word and permuted-title indexes are provided to facilitate location of the subjects of interest, and tables summarizing the information contained in the bibliography are presented. The information listed in the tables includes instrument failures, equipment failures, system failures, causes of failures, deficiencies noted, and the time of occurrence (i.e., during refueling, operation, testing, or construction). A few of the unique events that occurred during the year are reviewed in detail.

  9. Annotated bibliography of safety-related occurrences in boiling-water nuclear power plants as reported in 1975

    International Nuclear Information System (INIS)

    Scott, R.L.; Gallaher, R.B.

    1976-07-01

    The bibliography presented contains 100-word abstracts of reports to the U.S. Nuclear Regulatory Commission concerning operational events that occurred at boiling-water reactor nuclear power plants in 1975. The report includes 1169 abstracts, arranged alphabetically by reactor name and then chronologically for each reactor, that describe incidents, failures, and design or construction deficiencies that were experienced at the facilities. Key-word and permuted-title indexes are provided to facilitate location of the subjects of interest, and tables that summarize the information contained in the bibliography are provided. The information listed in the tables includes instrument failures, equipment failures, system failures, causes of failures, deficiencies noted, and the time of occurrence (i.e., during refueling, operation, testing, or construction). Seven of the unique events that occurred during the year are reviewed in detail

  10. Bibliography of published material related to the Soviet PNE Program

    International Nuclear Information System (INIS)

    Ledbetter, G.P.; Nordyke, M.D.

    1977-01-01

    Scientists in the Soviet Union have published many papers that provide details about the Soviet program for the peaceful use of nuclear explosions. Over the years much of this material has been gathered at the Lawrence Livermore Laboratory into what has become a sizeable collection. The bibliography of 334 references provides a useful record of the material available in that collection. The bibliography is divided into three main parts. Part I lists articles alphabetically. In Part II, the same articles are arranged by subject; many of them are included under more than one subject category. Part III is a list of important collections of papers. These collections provide many of the articles listed in Parts I and II

  11. The Africa Collection: An Annotated Historical Resource Bibliography for the Student of Africa.

    Science.gov (United States)

    Lynn, Karen

    This annotated bibliographic collection of resources on Africa including non-fiction, fiction, texts, poetry, draft papers, addresses, periodicals, film, records, and travel agencies is designed to aid secondary students and their teachers interested in research on Africa. An instructional approach is taken, drawing upon examples to demonstrate…

  12. Annotated bibliography of safety-related occurrences in boiling-water nuclear power plants as reported in 1976

    International Nuclear Information System (INIS)

    Scott, R.L.; Gallaher, R.B.

    1977-01-01

    This bibliography contains 100-word abstracts of reports to the U.S. Nuclear Regulatory Commission concerning operational events that occurred at boiling-water reactor nuclear power plants in 1976. The report includes 1,253 abstracts that describe incidents, failures, and design or construction deficiencies that were experienced at the facilities. They are arranged alphabetically by reactor name and then chronologically for each reactor. Key-word and permuted-title indexes are provided to facilitate location of the subjects of interest, and tables that summarize the information contained in the bibliography are provided. The information listed in the tables includes instrument failures, equipment failures, system failures, causes of failures, deficiencies noted, and the time of occurrence (i.e., during refueling, operation, testing, or construction). Three of the unique events that occurred during the year are reviewed in detail

  13. Annotated bibliography of safety-related occurrences in boiling-water nuclear power plants as reported in 1976

    Energy Technology Data Exchange (ETDEWEB)

    Scott, R.L.; Gallaher, R.B.

    1977-08-02

    This bibliography contains 100-word abstracts of reports to the U.S. Nuclear Regulatory Commission concerning operational events that occurred at boiling-water reactor nuclear power plants in 1976. The report includes 1,253 abstracts that describe incidents, failures, and design or construction deficiencies that were experienced at the facilities. They are arranged alphabetically by reactor name and then chronologically for each reactor. Key-word and permuted-title indexes are provided to facilitate location of the subjects of interest, and tables that summarize the information contained in the bibliography are provided. The information listed in the tables includes instrument failures, equipment failures, system failures, causes of failures, deficiencies noted, and the time of occurrence (i.e., during refueling, operation, testing, or construction). Three of the unique events that occurred during the year are reviewed in detail.

  14. Indice Bibliografico Ciencias de la Educacion. Ano 1988. Volume II No. 1. (Bibliographic Index of the Education Sciences. 1988. Volume II No.1).

    Science.gov (United States)

    Centro de Investigacion, Madrid (Spain). Servicio de Documentacion.

    Published quarterly, this annotated bibliography indexes articles from scholarly Spanish journals, as well as significant foreign journals, considered important in the field of education. References are organized alphabetically according to subject and within each subject by number, author, and content. A users' information description is provided…

  15. IIS--Integrated Interactome System: a web-based platform for the annotation, analysis and visualization of protein-metabolite-gene-drug interactions by integrating a variety of data sources and tools.

    Science.gov (United States)

    Carazzolle, Marcelo Falsarella; de Carvalho, Lucas Miguel; Slepicka, Hugo Henrique; Vidal, Ramon Oliveira; Pereira, Gonçalo Amarante Guimarães; Kobarg, Jörg; Meirelles, Gabriela Vaz

    2014-01-01

    High-throughput screening of physical, genetic and chemical-genetic interactions brings important perspectives in the Systems Biology field, as the analysis of these interactions provides new insights into protein/gene function, cellular metabolic variations and the validation of therapeutic targets and drug design. However, such analysis depends on a pipeline connecting different tools that can automatically integrate data from diverse sources and result in a more comprehensive dataset that can be properly interpreted. We describe here the Integrated Interactome System (IIS), an integrative platform with a web-based interface for the annotation, analysis and visualization of the interaction profiles of proteins/genes, metabolites and drugs of interest. IIS works in four connected modules: (i) Submission module, which receives raw data derived from Sanger sequencing (e.g. two-hybrid system); (ii) Search module, which enables the user to search for the processed reads to be assembled into contigs/singlets, or for lists of proteins/genes, metabolites and drugs of interest, and add them to the project; (iii) Annotation module, which assigns annotations from several databases for the contigs/singlets or lists of proteins/genes, generating tables with automatic annotation that can be manually curated; and (iv) Interactome module, which maps the contigs/singlets or the uploaded lists to entries in our integrated database, building networks that gather novel identified interactions, protein and metabolite expression/concentration levels, subcellular localization and computed topological metrics, GO biological processes and KEGG pathways enrichment. This module generates a XGMML file that can be imported into Cytoscape or be visualized directly on the web. We have developed IIS by the integration of diverse databases following the need of appropriate tools for a systematic analysis of physical, genetic and chemical-genetic interactions. IIS was validated with yeast two

  16. Wilbur and Orville Wright: A Bibliography Commemorating the One-Hundredth Anniversary of the First Powered Flight, December 17, 1903. Revised

    Science.gov (United States)

    Renstrom, Arthur G. (Compiler); Goldblatt, Roberta W.; Minkus, Carl; Berube, Karen L.; Launius, Roger (Technical Monitor)

    2002-01-01

    This annotated bibliography of material about Wilbur and Orville Wright and the first powered flight, commemorates the one hundredth anniversary of the event. This publication represents an updated version of the classic, "Wilbur and Orville Wright: A Bibliography Commemorating the Hundredth Anniversary of the Birth of Wilbur Wright, April 16, 1867" which was originally published in 1968. Aspects of the Wright brothers' lives covered include: their published writings, biographical references, airplanes used and flight records, airplane components, patents, court records, Wright companies and schools, the Wright-Smithsonian controversy, monuments and museums, memorials, medals and honors, memorabilia, art, poetry, music, motion pictures and juvenile publications. An index is included.

  17. Municipal solid waste management: A bibliography of US Department of Energy contractor reports through 1993

    Energy Technology Data Exchange (ETDEWEB)

    Shepherd, P

    1994-07-01

    US Department of Energy contractors continue to conduct research targeting the productive and responsible use of the more than 536,000 tons of municipal solid waste (MSW) that is generated each day in the United States. It is becoming more and more prudent to improve current methods of MSW management and to continue to search for additional cost-effective, energy-efficient means to manage our MSW resource. This bibliography is an updated version of Municipal Waste to Energy: An Annotated Bibliography of US Department of Energy Contractor Reports, by Caroline Brooks, published in 1987. Like its predecessor, this bibliography provides information about technical reports on energy from municipal waste that were prepared under grants or contracts from the US Department of Energy. The reports listed focus on energy from municipal waste technologies and energy conservation in wastewater treatment. The bibliography contains three indexes -- an author index, a subject index, and a title index. The reports are listed alphabetically in the subject areas and may appear under more than one subject. All of the reports cited in the original MSW bibliography are also included in this update. The number of copies of each report originally published varied according to anticipated public demand. However, all reports are available in either microfiche or hard copy form and may be ordered from the National Technical Information Service (NTIS), US Department of Commerce, Springfield, VA 22161. Explicit information on ordering reports is included in Appendix A.

  18. Annotated bibliography of radioactive waste management publications at Pacific Northwest Laboratory, January 1978 through July 1982

    International Nuclear Information System (INIS)

    1982-09-01

    This bibliography lists publications (831 abstracts) from the Pacific Northwest Laboratory's Department of Energy sponsored research and development programs from January 1978 through July of 1982. The abstracts are grouped in subject categories, as shown in the table of contents. Entries in the subject index also facilitate access by subject, e.g., High-Level Radioactive Wastes. Three indexes, each preceded by a brief description, are provided: personal author, subject, and report number. Cited are research reports, journal articles, books, patents, theses, and conference papers. Excluded are technical progress reports. Since 1978 the Nuclear Waste Management Quarterly Progress Report has been published under the series number PNL-3000. Beginning in 1982, this publication has been issued semiannually, under the series number PNL-4250. This bibliography is the successor to two others, BNWL-2201 (covering the years 1965-1976) and PNL-4050 (1975-1978). It is intended to provide a useful reference to literature in waste management written or compiled by PNL staff

  19. Urban Property Taxation: II. Land and Location. Exchange Bibliography 480.

    Science.gov (United States)

    White, Anthony G.

    This is one of three related bibliographies listing publications dealing with the broad topic of property taxation. This particular volume concerns some specialized fields of study, including locational theory, land use and taxation, property markets and valuation, housing, and urban renewal and redevelopment. Citations are listed alphabetically…

  20. Particle physics, one hundred years of dicoveries an annotated chronological bibliography

    CERN Document Server

    Ezhela, Vladimir V; Lugovsky, S B; Polishchuk, B V; Striganov, S I; Stroganov, Y G; Armstrong, Betty; Barnett, Richard Michael; Groom, D E; Gee, P S; Trippe, Thomas G; Wohl, Charles G; Jackson, John David

    1996-01-01

    Several years before the official start of the 20th century, a series of milestone physics experiments pioneered the science which eventually became to be known as particle physics. A new book by several authors from the COMPAS group at the Institute for High Energy Physics, Protvino, near Moscow, and from the Particle Data Group effort at the Lawrence Berkeley Laboratory, reinforced by J.D. Jackson, has compiled a useful summary and bibliography of more than 500 key papers marking the development of particle physics from 1895 to the discovery of the top quark in 1995. Some 70 percent of the listed papers are post World War 2. The book is comprehensively indexed, including members of large collaborations and providing a useful benchmark. However actual entries confusingly use the first listed member of the collaboborations, even if a Nobel Prize was subsequently awarded to another member of the team.

  1. The Slovenian bibliography

    Directory of Open Access Journals (Sweden)

    Lidija Wagner

    2000-01-01

    Full Text Available The Slovenian bibliography is our national bibliography. We want to show the criteria of the selection of the particular materials, which are included in the Slovenian bibliography. We described the bibliographic description and classification of the records with UDC and the descriptors. The printing and the CD-ROM issues of the Slovenian bibli¬ography are described. We compared UNESCO guidelines for the national bibliography on the field of the selection, bibliographic description and classification, arrangement of the records and the useful of the national bibliography.

  2. Bibliography on peace, security, and international conflict management

    International Nuclear Information System (INIS)

    Anon.

    1993-01-01

    This bibliography presents an annotated list of approximately one hundred titles for public libraries seeking to serve the college-educated nonspecialist in the fields of peace, security, and international conflict management. representative titles have been selected in eight subject areas: (1) arms control, disarmament, and proliferation; (2) causes and nature of international conflict; (3) conflict management, diplomacy, and negotiation; (4) human rights and ethnic and religious conflicts; (5) international law and international order; (6) international organizations and transnationalism; (7) other approaches to, and overviews of, security and peace; and (8) religion and ethics. Three criteria determined selection of titles: the book is in print and is expected to remain in print for the foreseeable future; the book is of interest to the college-educated lay reader with a serious interest in the subject; and the list, as a whole, illustrates the full spectrum of debate, both in selection of topics and selection of titles. As an aid to the identification and acquisition of any of these materials, the editors have provided a bibliographic citation with an annotation that includes the following: author, title, statement of responsibility, publisher, publication information, pagination, and ISBN or ISSN

  3. Articles on Mass Communication in U.S. and Foreign Journals: A Selected Annotated Bibliography

    Science.gov (United States)

    McKerns, Joseph P.; Delahaye, Alfred N.

    1978-01-01

    Lists and annotates 212 journal articles on mass communication, grouped according to topic. Topics include audience and communicator analysis, broadcasting, communication theory, courts and law, criticism and defense of media, journalism education, government and media, history and biography, international topics, and public relations. (GW)

  4. Bibliography of atomic and molecular processes. Volume 1, 1978-1981

    International Nuclear Information System (INIS)

    Barnett, C.F.; Crandall, D.H.; Farmer, B.J.

    1982-10-01

    This annotated bibliography lists 10,676 works on atomic and molecular processes reported in publications dated 1978-1981. Sources include scientific journals, conference proceedings, and books. Each entry is designated by one or more of the 114 categories of atomic and molecular processes used by the Controlled Fusion Atomic Data Center, Oak Ridge National Laboratory to classify data. Also indicated is whether the work was experimental or theoretical, what energy range was covered, what reactants were investigated, and the county of origin of the first author. Following the bibliographical listing, the entries are indexed according to the categories and according to reactants within each subcategory

  5. Bibliography of atomic and molecular processes. Volume 1, 1978-1981

    Energy Technology Data Exchange (ETDEWEB)

    Barnett, C.F.; Crandall, D.H.; Farmer, B.J. (comps.)

    1982-10-01

    This annotated bibliography lists 10,676 works on atomic and molecular processes reported in publications dated 1978-1981. Sources include scientific journals, conference proceedings, and books. Each entry is designated by one or more of the 114 categories of atomic and molecular processes used by the Controlled Fusion Atomic Data Center, Oak Ridge National Laboratory to classify data. Also indicated is whether the work was experimental or theoretical, what energy range was covered, what reactants were investigated, and the county of origin of the first author. Following the bibliographical listing, the entries are indexed according to the categories and according to reactants within each subcategory.

  6. Occupational dose reduction at nuclear power plants: Annotated bibliography of selected readings in radiation protection and ALARA

    International Nuclear Information System (INIS)

    Baum, J.W.; Khan, T.A.

    1986-10-01

    This report is the third in a series of bibliographies supporting the efforts at Brookhaven National Laboratory on dose reduction at nuclear power plants. Abstracts for this report were selected from papers presented at recent technical meetings, journals and research reports reviewed at the BNL ALARA Center, and searches of the DOE/RECON data base on energy-related publications. The references selected for inclusion in the bibliography relate not only to operational health physics topics but also to plant chemistry, stress corrosion cracking, and other aspects of plant operation which have important impacts on occupational exposure. Also included are references to improved design, planning, materials selection and other topics related to what might be called ALARA engineering. Thus, an attempt has been made to cover a broad spectrum of topics related directly or indirectly to occupational exposure reduction. The report contains 252 abstracts and both author and subject indices

  7. Adaptation to prolonged bedrest in man: A compendium of research. [bibliographies on clinical medicine and human pathology

    Science.gov (United States)

    Greenleaf, J. E.; Greenleaf, C. J.; Vanderveer, D.; Dorchak, K. J.

    1976-01-01

    A compilation of major studies that describe the clinical observations and elucidate the physiological mechanisms of the adaptive process of man undergoing prolonged bed rest is presented. Additional studies are included that provide background information in the form of reviews or summaries of the process. Wherever possible a detailed annotation is provided under the subheadings: (1) purpose, (2) procedure and methods, (3) results, and (4) conclusions. Additional references are provided in a selected bibliography.

  8. Methodology to assess the value of Florida wetlands to fish and wildlife: an annotated bibliography

    OpenAIRE

    Leadon, Monica A.

    1981-01-01

    The following bibliography was compiled for use by the Cooperative Fish and Wildlife Unit and their cooperators as an aid in determining research priorities in Florida wetlands. Emphasis was placed on studies done on the economic value of wetlands, values to fish and wildlife, methods of sampling in a wetland area, and restoration practices. Material was generally gathered from studies done in the southeast, however, some relevant national papers were also included. (35 page...

  9. Supporting Keyword Search for Image Retrieval with Integration of Probabilistic Annotation

    Directory of Open Access Journals (Sweden)

    Tie Hua Zhou

    2015-05-01

    Full Text Available The ever-increasing quantities of digital photo resources are annotated with enriching vocabularies to form semantic annotations. Photo-sharing social networks have boosted the need for efficient and intuitive querying to respond to user requirements in large-scale image collections. In order to help users formulate efficient and effective image retrieval, we present a novel integration of a probabilistic model based on keyword query architecture that models the probability distribution of image annotations: allowing users to obtain satisfactory results from image retrieval via the integration of multiple annotations. We focus on the annotation integration step in order to specify the meaning of each image annotation, thus leading to the most representative annotations of the intent of a keyword search. For this demonstration, we show how a probabilistic model has been integrated to semantic annotations to allow users to intuitively define explicit and precise keyword queries in order to retrieve satisfactory image results distributed in heterogeneous large data sources. Our experiments on SBU (collected by Stony Brook University database show that (i our integrated annotation contains higher quality representatives and semantic matches; and (ii the results indicating annotation integration can indeed improve image search result quality.

  10. Gifted Gay, Lesbian, Bisexual, and Transgender Annotated Bibliography: A Resource for Educators of Gifted Secondary GLBT Students

    Science.gov (United States)

    Treat, Alena R.; Whittenburg, Becky

    2006-01-01

    This bibliography makes available to educators and others a comprehensive resource for information regarding gifted youth who are gay, lesbian, bisexual, transgender or questioning their sexual orientation and/or gender identity (G/GLBTQ). It includes articles, brochures, books, lesson plans, staff development, video media, and Web resources. As…

  11. MIPS: analysis and annotation of genome information in 2007.

    Science.gov (United States)

    Mewes, H W; Dietmann, S; Frishman, D; Gregory, R; Mannhaupt, G; Mayer, K F X; Münsterkötter, M; Ruepp, A; Spannagl, M; Stümpflen, V; Rattei, T

    2008-01-01

    The Munich Information Center for Protein Sequences (MIPS-GSF, Neuherberg, Germany) combines automatic processing of large amounts of sequences with manual annotation of selected model genomes. Due to the massive growth of the available data, the depth of annotation varies widely between independent databases. Also, the criteria for the transfer of information from known to orthologous sequences are diverse. To cope with the task of global in-depth genome annotation has become unfeasible. Therefore, our efforts are dedicated to three levels of annotation: (i) the curation of selected genomes, in particular from fungal and plant taxa (e.g. CYGD, MNCDB, MatDB), (ii) the comprehensive, consistent, automatic annotation employing exhaustive methods for the computation of sequence similarities and sequence-related attributes as well as the classification of individual sequences (SIMAP, PEDANT and FunCat) and (iii) the compilation of manually curated databases for protein interactions based on scrutinized information from the literature to serve as an accepted set of reliable annotated interaction data (MPACT, MPPI, CORUM). All databases and tools described as well as the detailed descriptions of our projects can be accessed through the MIPS web server (http://mips.gsf.de).

  12. Annotated bibliography of the geology of the Columbia Plateau (Columbia River Basalt) and adjacent areas of Oregon

    International Nuclear Information System (INIS)

    Bela, J.

    1979-01-01

    This bibliography containing approximately 2000 entries was prepared by the Oregon Department of Geology and Mineral Industries under Subcontract SA-913 with Rockwell Hanford Operations' Basalt Waste Isolation Program. The objective of the Basalt Waste Isolation Program is to determine the feasibility of storing nuclear waste within the Columbia River Basalt Group. Under the geologic portion of this program, the stratigraphic, structural, tectonic, seismic, and hydrologic aspects of the Columbia Plateau are being examined. Other aspects of the Basalt Waste Isolation Program are concerned with systems integration, engineered barriers, engineering testing, and construction of a near-surface test facility. The area covered in this bibliography comprises that area north of 43 0 30' latitude and east of the Willamette Meridian, which is located just west of Portland. The bibliographic entries are presented in two forms. The first is an alphabetized listing of all articles dealing with the geology of the Columbia Plateau (Columbia River Basalt) and adjacent areas of Oregon. The second form consists of an alphabetized listing of the entries subdivided under fourteen categories

  13. Occupational dose reduction at nuclear power plants: Annotated bibliography of selected readings in radiation protection and ALARA

    International Nuclear Information System (INIS)

    Kaurin, D.G.; Khan, T.A.; Sullivan, S.G.; Baum, J.W.

    1993-07-01

    The ALARA Center at Brookhaven National Laboratory publishes a series of bibliographies of selected readings in radiation protection and ALARA in the continuing effort to collect and disseminate information on radiation dose reduction at nuclear power plants. This is volume 7 of the series. The abstracts in this bibliography were selected from proceedings of technical meetings and conferences, journals, research reports, and searches of the Energy Science and Technology database of the US Department of Energy. The subject material of these abstracts relates to radiation protection and dose reduction, and ranges from use of robotics to operational health physics, to water chemistry. Material on the design, planning, and management of nuclear power stations is included, as well as information on decommissioning and safe storage efforts. Volume 7 contains 293 abstract, an author index, and a subject index. The author index is specific for this volume. The subject index is cumulative and lists all abstract numbers from volumes 1 to 7. The numbers in boldface indicate the abstracts in this volume; the numbers not in boldface represent abstracts in previous volumes

  14. Annotated bibliography of the geology of the Columbia Plateau (Columbia River Basalt) and adjacent areas of Oregon

    Energy Technology Data Exchange (ETDEWEB)

    Bela, J.

    1979-01-01

    This bibliography containing approximately 2000 entries was prepared by the Oregon Department of Geology and Mineral Industries under Subcontract SA-913 with Rockwell Hanford Operations' Basalt Waste Isolation Program. The objective of the Basalt Waste Isolation Program is to determine the feasibility of storing nuclear waste within the Columbia River Basalt Group. Under the geologic portion of this program, the stratigraphic, structural, tectonic, seismic, and hydrologic aspects of the Columbia Plateau are being examined. Other aspects of the Basalt Waste Isolation Program are concerned with systems integration, engineered barriers, engineering testing, and construction of a near-surface test facility. The area covered in this bibliography comprises that area north of 43/sup 0/30' latitude and east of the Willamette Meridian, which is located just west of Portland. The bibliographic entries are presented in two forms. The first is an alphabetized listing of all articles dealing with the geology of the Columbia Plateau (Columbia River Basalt) and adjacent areas of Oregon. The second form consists of an alphabetized listing of the entries subdivided under fourteen categories. (RWR)

  15. Annotated Bibliographies.

    Science.gov (United States)

    Totten, Sam; Alexander, Susan

    1985-01-01

    Intended for elementary, secondary, and college teachers, this listing cites print materials dealing with nuclear warfare. Included are nonfiction, fiction, journals, newsletters, curriculum materials, and organizations. (RM)

  16. Geological and geochemical aspects of uranium deposits. A selected, annotated bibliography. Vol. 1

    International Nuclear Information System (INIS)

    White, M.B.; Garland, P.A.

    1977-10-01

    This bibliography was compiled by selecting 580 references from the Bibliographic Information Data Base of the Department of Energy's (DOE) National Uranium Resource Evaluation (NURE) Program. This data base and five others have been created by the Ecological Sciences Information Center to provide technical computer-retrievable data on various aspects of the nation's uranium resources. All fields of uranium geology are within the defined scope of the project, as are aerial surveying procedures, uranium reserves and resources, and universally applied uranium research. References used by DOE-NURE contractors in completing their aerial reconnaissance survey reports have been included at the request of the Grand Junction Office, DOE. The following indexes are provided to aid the user in locating reference of interest: author, keyword, geographic location, quadrangle name, geoformational index, and taxonomic name

  17. Annotated bibliography for the design of waste packages for geologic disposal of spent fuel and high-level waste

    International Nuclear Information System (INIS)

    Wurm, K.J.; Miller, N.E.

    1982-11-01

    This bibliography identifies documents that are pertinent to the design of waste packages for geologic disposal of nuclear waste. The bibliography is divided into fourteen subject categories so that anyone wishing to review the subject of leaching, for example, can turn to the leaching section and review the abstracts of reports which are concerned primarily with leaching. Abstracts are also cross referenced according to secondary subject matter so that one can get a complete list of abstracts for any of the fourteen subject categories. All documents which by their title alone appear to deal with the design of waste packages for the geologic disposal of spent fuel or high-level waste were obtained and reviewed. Only those documents which truly appear to be of interest to a waste package designer were abstracted. The documents not abstracted are listed in a separate section. There was no beginning date for consideration of a document for review. About 1100 documents were reviewed and about 450 documents were abstracted

  18. Annotated bibliography of radioactive waste management publications at Pacific Northwest Laboratory, January 1978 through July 1982. [831 abstracts

    Energy Technology Data Exchange (ETDEWEB)

    1982-09-01

    This bibliography lists publications (831 abstracts) from the Pacific Northwest Laboratory's Department of Energy sponsored research and development programs from January 1978 through July of 1982. The abstracts are grouped in subject categories, as shown in the table of contents. Entries in the subject index also facilitate access by subject, e.g., High-Level Radioactive Wastes. Three indexes, each preceded by a brief description, are provided: personal author, subject, and report number. Cited are research reports, journal articles, books, patents, theses, and conference papers. Excluded are technical progress reports. Since 1978 the Nuclear Waste Management Quarterly Progress Report has been published under the series number PNL-3000. Beginning in 1982, this publication has been issued semiannually, under the series number PNL-4250. This bibliography is the successor to two others, BNWL-2201 (covering the years 1965-1976) and PNL-4050 (1975-1978). It is intended to provide a useful reference to literature in waste management written or compiled by PNL staff.

  19. Bibliography of Intelligence Literature. A Critical and Annotated Bibliography of Open-Source Literature.

    Science.gov (United States)

    1985-01-01

    latter revealing the famous " pumpkin papers" - copies of confidential State Department material which Hiss, as an agent, had given Chambers for their...34Portland Naval Secrets" case. This book is unreliable, for the author’s text is written purely for Soviet propaganda and disinformation purposes, but it...diplomatic relations at the time world- wide respectively. Vols. II-IV are purely textual, based on the material described above, and appropriately

  20. Estimating the annotation error rate of curated GO database sequence annotations

    Directory of Open Access Journals (Sweden)

    Brown Alfred L

    2007-05-01

    Full Text Available Abstract Background Annotations that describe the function of sequences are enormously important to researchers during laboratory investigations and when making computational inferences. However, there has been little investigation into the data quality of sequence function annotations. Here we have developed a new method of estimating the error rate of curated sequence annotations, and applied this to the Gene Ontology (GO sequence database (GOSeqLite. This method involved artificially adding errors to sequence annotations at known rates, and used regression to model the impact on the precision of annotations based on BLAST matched sequences. Results We estimated the error rate of curated GO sequence annotations in the GOSeqLite database (March 2006 at between 28% and 30%. Annotations made without use of sequence similarity based methods (non-ISS had an estimated error rate of between 13% and 18%. Annotations made with the use of sequence similarity methodology (ISS had an estimated error rate of 49%. Conclusion While the overall error rate is reasonably low, it would be prudent to treat all ISS annotations with caution. Electronic annotators that use ISS annotations as the basis of predictions are likely to have higher false prediction rates, and for this reason designers of these systems should consider avoiding ISS annotations where possible. Electronic annotators that use ISS annotations to make predictions should be viewed sceptically. We recommend that curators thoroughly review ISS annotations before accepting them as valid. Overall, users of curated sequence annotations from the GO database should feel assured that they are using a comparatively high quality source of information.

  1. Indoor air: Reference bibliography

    International Nuclear Information System (INIS)

    Campbell, D.; Staves, D.; McDonald, S.

    1989-07-01

    The U. S. Environmental Protection Agency initially established the indoor air Reference Bibliography in 1987 as an appendix to the Indoor Air Quality Implementation Plan. The document was submitted to Congress as required under Title IV--Radon Gas and Indoor Air Quality Research of the Superfund Amendments and Reauthorization Act of 1986. The Reference Bibliography is an extensive bibliography of reference materials on indoor air pollution. The Bibliography contains over 4500 citations and continues to increase as new articles appear

  2. Discovering gene annotations in biomedical text databases

    Directory of Open Access Journals (Sweden)

    Ozsoyoglu Gultekin

    2008-03-01

    Full Text Available Abstract Background Genes and gene products are frequently annotated with Gene Ontology concepts based on the evidence provided in genomics articles. Manually locating and curating information about a genomic entity from the biomedical literature requires vast amounts of human effort. Hence, there is clearly a need forautomated computational tools to annotate the genes and gene products with Gene Ontology concepts by computationally capturing the related knowledge embedded in textual data. Results In this article, we present an automated genomic entity annotation system, GEANN, which extracts information about the characteristics of genes and gene products in article abstracts from PubMed, and translates the discoveredknowledge into Gene Ontology (GO concepts, a widely-used standardized vocabulary of genomic traits. GEANN utilizes textual "extraction patterns", and a semantic matching framework to locate phrases matching to a pattern and produce Gene Ontology annotations for genes and gene products. In our experiments, GEANN has reached to the precision level of 78% at therecall level of 61%. On a select set of Gene Ontology concepts, GEANN either outperforms or is comparable to two other automated annotation studies. Use of WordNet for semantic pattern matching improves the precision and recall by 24% and 15%, respectively, and the improvement due to semantic pattern matching becomes more apparent as the Gene Ontology terms become more general. Conclusion GEANN is useful for two distinct purposes: (i automating the annotation of genomic entities with Gene Ontology concepts, and (ii providing existing annotations with additional "evidence articles" from the literature. The use of textual extraction patterns that are constructed based on the existing annotations achieve high precision. The semantic pattern matching framework provides a more flexible pattern matching scheme with respect to "exactmatching" with the advantage of locating approximate

  3. Geological and geochemical aspects of uranium deposits. A selected, annotated bibliography. Vol. 1

    Energy Technology Data Exchange (ETDEWEB)

    White, M.B.; Garland, P.A. (comps.)

    1977-10-01

    This bibliography was compiled by selecting 580 references from the Bibliographic Information Data Base of the Department of Energy's (DOE) National Uranium Resource Evaluation (NURE) Program. This data base and five others have been created by the Ecological Sciences Information Center to provide technical computer-retrievable data on various aspects of the nation's uranium resources. All fields of uranium geology are within the defined scope of the project, as are aerial surveying procedures, uranium reserves and resources, and universally applied uranium research. References used by DOE-NURE contractors in completing their aerial reconnaissance survey reports have been included at the request of the Grand Junction Office, DOE. The following indexes are provided to aid the user in locating reference of interest: author, keyword, geographic location, quadrangle name, geoformational index, and taxonomic name.

  4. Virtual Ribosome - a comprehensive DNA translation tool with support for integration of sequence feature annotation

    DEFF Research Database (Denmark)

    Wernersson, Rasmus

    2006-01-01

    of alternative start codons. ( ii) Integration of sequences feature annotation - in particular, native support for working with files containing intron/ exon structure annotation. The software is available for both download and online use at http://www.cbs.dtu.dk/services/VirtualRibosome/....

  5. Annotated Bibliography of Publications on Watershed Management and Ecological Studies at Coweeta Hydrologic Laboratory, 1934,1984

    Science.gov (United States)

    Julia W. Gaskin; James E. Douglass; Wayne T. Swank; [Compilers

    1984-01-01

    A collection of 470 citations and annotations for papers published by scientists associated with theCoweeta Hydrologic Laboratory. Major categories in a subject index include watershed management, hydrometeorology, plant-water relationships, soil relationships, stream-flow relationships, ground water, stream ecology, and terrestrial ecology.

  6. Bibliography on transuranium elements

    International Nuclear Information System (INIS)

    Sood, D.D.

    1991-01-01

    A selective bibliography of prominent publications on transuranium elements is compiled. Heading papers, symposia proceedings and the textbooks are included in the bibliography. The bibliography is arranged under the headings: (1)Books, Symposia Proceedings, Reviews etc., (2)Discovery, (3)Weighable Isolation, (4)Metal Preparation, (5)Nuclear Properties, (6)Plutonium as Reactor Fuel, (7)Fuel Reprocessing, (8)Solid State Chemistry, Thermochemistry and Spectroscopy, (9)Radiation Safety, (10)Applications, and (11)Some Typical Indian Papers. Total number of references cited are 298. The bibliography, though selective, will serve as a starting point for comprehensive literature search on transuranium elements. (author)

  7. dbCAN2: a meta server for automated carbohydrate-active enzyme annotation

    DEFF Research Database (Denmark)

    Zhang, Han; Yohe, Tanner; Huang, Le

    2018-01-01

    of plant and plant-associated microbial genomes and metagenomes being sequenced, there is an urgent need of automatic tools for genomic data mining of CAZymes. We developed the dbCAN web server in 2012 to provide a public service for automated CAZyme annotation for newly sequenced genomes. Here, dbCAN2...... (http://cys.bios.niu.edu/dbCAN2) is presented as an updated meta server, which integrates three state-of-the-art tools for CAZome (all CAZymes of a genome) annotation: (i) HMMER search against the dbCAN HMM (hidden Markov model) database; (ii) DIAMOND search against the CAZy pre-annotated CAZyme...

  8. Geological and geochemical aspects of uranium deposits: a selected, annotated bibliography. Vol. 2, Rev. 1

    International Nuclear Information System (INIS)

    Thomas, J.M.; Brock, M.L.; Garland, P.A.; White, M.B.; Daniel, E.W.

    1979-07-01

    This bibliography, a compilation of 490 references, is the second in a series compiled from the National Uranium Resource Evaluation (NURE) Bibliographic Data Base. This data base is one of six data bases created by the Ecological Sciences Information Center, Oak Ridge National Laboratory, for the Grand Junction Office of the Department of Energy. Major emphasis for this volume has been placed on uranium geology, encompassing deposition, genesis of ore deposits, and ore controls; and prospecting techniques, including geochemistry and aerial reconnaissance. The following indexes are provided to aid the user in locating references of interest: author, geographic location, quadrangle name, geoformational feature, taxonomic name, and keyword

  9. annot8r: GO, EC and KEGG annotation of EST datasets

    Directory of Open Access Journals (Sweden)

    Schmid Ralf

    2008-04-01

    Full Text Available Abstract Background The expressed sequence tag (EST methodology is an attractive option for the generation of sequence data for species for which no completely sequenced genome is available. The annotation and comparative analysis of such datasets poses a formidable challenge for research groups that do not have the bioinformatics infrastructure of major genome sequencing centres. Therefore, there is a need for user-friendly tools to facilitate the annotation of non-model species EST datasets with well-defined ontologies that enable meaningful cross-species comparisons. To address this, we have developed annot8r, a platform for the rapid annotation of EST datasets with GO-terms, EC-numbers and KEGG-pathways. Results annot8r automatically downloads all files relevant for the annotation process and generates a reference database that stores UniProt entries, their associated Gene Ontology (GO, Enzyme Commission (EC and Kyoto Encyclopaedia of Genes and Genomes (KEGG annotation and additional relevant data. For each of GO, EC and KEGG, annot8r extracts a specific sequence subset from the UniProt dataset based on the information stored in the reference database. These three subsets are then formatted for BLAST searches. The user provides the protein or nucleotide sequences to be annotated and annot8r runs BLAST searches against these three subsets. The BLAST results are parsed and the corresponding annotations retrieved from the reference database. The annotations are saved both as flat files and also in a relational postgreSQL results database to facilitate more advanced searches within the results. annot8r is integrated with the PartiGene suite of EST analysis tools. Conclusion annot8r is a tool that assigns GO, EC and KEGG annotations for data sets resulting from EST sequencing projects both rapidly and efficiently. The benefits of an underlying relational database, flexibility and the ease of use of the program make it ideally suited for non

  10. Publishing a Quality Context-aware Annotated Corpus and Lexicon for Harassment Research

    OpenAIRE

    Rezvan, Mohammadreza; Shekarpour, Saeedeh; Balasuriya, Lakshika; Thirunarayan, Krishnaprasad; Shalin, Valerie; Sheth, Amit

    2018-01-01

    Having a quality annotated corpus is essential especially for applied research. Despite the recent focus of Web science community on researching about cyberbullying, the community dose not still have standard benchmarks. In this paper, we publish first, a quality annotated corpus and second, an offensive words lexicon capturing different types type of harassment as (i) sexual harassment, (ii) racial harassment, (iii) appearance-related harassment, (iv) intellectual harassment, and (v) politic...

  11. Annotated bibliography of economic literature on wetlands

    Science.gov (United States)

    Douglas, Aaron J.

    1989-01-01

    This bibliography is intended for the use of wetlands scientists, policy analysts, and natural resource professionals who have little acquaintance with natural resource economics, and natural resource professionals who have some background in economic analysis and wish to sharpen their appreciation of the specialized methods used to value the nonmarket uses of wetland resources. It is not intended to serve as a first primer of natural resource economics. The purpose of including this discussion is to introduce the reader to the fact that specialized language and analytic techniques are used in this field, and that summary discussion of these techniques are not available in introductory or intermediate level economics textbooks. A key difficulty in economic analysis lies in the need that economists have to express common-sense terms such as "demand" or "supply" in a precise way; this facilitates the interpretation of data and is a powerful aid in making internally consistent, policy analysis. Natural resource economists would like to find a consistent, intuitively plausible measure of the social benefits conferred by some good or service. The most common fallacy noneconomists make in this field is to use expenditures as a measure of well-being or benefits. This measure is defective; expenditures may rise, while benefits fall. The following simple example should clarify the issue. Suppose that a certain population center, in the 1940's, is located 5 miles from a riverine recreation site. Suppose that a factory opens up 15 miles away from the site during the 1950's, and closes at the end of the 1960's; and that during this 20-year period, the bulk of this region's populace resides 15 miles from the site, close to the factory. In the 1970's, the populace of the region returns to the old population center, 5 miles from the recreation site. The benefits conferred by the site diminished during the 1950's and 1960's, even though travel (and even total) expenditures

  12. Ada (Trade Name) Bibliography. Volume 1.

    Science.gov (United States)

    1983-05-01

    GLENN DOCUMENT NUMBER: 3268 TYPE: JOURNAL ARTICLE .5-., SCIENCE VOL 215 ISSUE 34 PP. 775-779S In this article, two principal themes are observed in...AINST LANAN RD NAY 83 ND9S-8-C-936 UNCLASSIFIED F/6 12/5 ML -4.4 ’-4-4----" ’°p..l i . d N N L. 131 t ’ll /II~ Ada Bibliography Volume I 95 𔃾- This...BUDAPEST,HUNGARY 4102 -01 ON THE TYPE CONCEPT OF ADA 6224 -03 UNORTHOGONALITIES IN THE IDENTIFICATION RULES IN ADA BACON, GLENN , IBM SANTA TERESA LABS

  13. Bibliography of Finnish forestry literature

    International Nuclear Information System (INIS)

    1996-01-01

    The bibliography consists primarily of material from Finnish publications. Although, relevant articles published outside Finland are also included in the bibliography. The references listed in the bibliography include articles on forestry sciences taken from 200 different Finnish journals as well as all the material in the journals published by the various departments of forestry of the University of Helsinki, the Society of Forestry in Finland and the Finnish Forest Research Institute. The bibliography is published four times per year, and is compiled annually in a single volume. The bibliography consists of about 2000 references per year. The material is categorized according to the FDC (Forest Decimal Classification, formerly Oxford Decimal Classification). The bibliography contains material of following subject categories: (0) Forests, forestry and the utilization of forest products (general). Dictionaries. Bibliographies. (1) Factors of the environment. Biology. (2) Silviculture. (3) Work science (Work studies). Harvesting of wood: Logging and transport. Forest engineering. (4) Forest injuries and protection. (5) Forest mensuration. Increment; development and structure of stands. Surveying and mapping. (6) Forest management. Business economics of forestry. Administration and organization of forest enterprises. (7) Marketing of forest products: Economics of forest transport and the wood industries. (8) forest products and their utilization. (9) Forests and forestry from the national point of view. Social economics of forestry. The bibliography includes author and subject indexes

  14. Bibliography of Finnish forestry literature

    International Nuclear Information System (INIS)

    1997-01-01

    The bibliography consists primarily of material from Finnish publications. Although, relevant articles published outside Finland are also included in the bibliography. The references listed in the bibliography include articles on forestry sciences taken from 200 different Finnish journals as well as all the material in the journals published by the various departments of forestry of the University of Helsinki, the Society of Forestry in Finland and the Finnish Forest Research Institute. The bibliography is published four times per year, and is compiled annually in a single volume. The bibliography consists of about 2000 references per year. The material is categorised according to the FDC (Forest Decimal Classification, formerly Oxford Decimal Classification). The bibliography contains material of following subject categories: (0) Forests, forestry and the utilisation of forest products (general). Dictionaries. Bibliographies. (1) Factors of the environment. Biology. (2) Silviculture. (3) Work science (Work studies). Harvesting of wood: Logging and transport. Forest engineering. (4) Forest injuries and protection. (5) Forest mensuration. Increment; development and structure of stands. Surveying and mapping. (6) Forest management. Business economics of forestry. Administration and organisation of forest enterprises. (7) Marketing of forest products: Economics of forest transport and the wood industries. (8) forest products and their utilisation. (9) Forests and forestry from the national point of view. Social economics of forestry. The bibliography includes author and subject indexes

  15. Accelerator produced nuclides for use in biology and medicine. A bibliography: January 1974--June 1976

    International Nuclear Information System (INIS)

    Karlstrom, K.I.; Christman, D.R.

    1978-01-01

    This bibliography (Volume II) follows the format of the first bibliography. Nuclides used therapeutically have not been included. References to medical application of the various nuclides of iodine, gallium, and indium have been excluded as being beyond the scope of this bibliography (and to keep its size to manageable proportions). For nuclides having fifteen or fewer references there is no breakdown into subcategories. For the others they have been subdivided as follows: (1) Production methods, (2) Compound syntheses, and (3) Medical uses. The first part of the bibliography contains references of general interest of various types. Where specific nuclides are involved, these references are also cross-indexed to each nuclide. The original reference number is always used for cross-indexing. The nuclide section is arranged in alphabetical order, and within each section alphabetically by first author. The author index lists each reference once for each author, with no indication of cross-referencing given

  16. National bibliographies on radioanalytical chemistry (1936-1977) Pt. 2

    International Nuclear Information System (INIS)

    Braun, T.; Burger, M.; Bujdoso, E.

    1981-01-01

    This second part of Vol. 1 contains 5 national radioanalytical bibliographies, namely those of Poland, Denmark, Austria, New Zealand and Finland. It is divided into two parts: (i) Activation Analysis, and (ii) Other Radioanalytical Methods. The latter includes isotope dilution methods, radiochemical separations, radiometric analyses and allied topics. Applications of radioactive isotope tracers are not covered. It also contains Subject and Author Index. (Sz.J.)

  17. The Pajarito Plateau: A bibliography

    Science.gov (United States)

    Mathien, Frances Joan; Steen, Charlie R.; Allen, Craig D.

    1993-01-01

    This bibliography is the result of two initially independent projects. As the consulting archaeologist at Los Alamos National Laboratory (LANL), Charlie R. Steen collected entries at the suggestion of the staff of the Environmental Surveillance Group of the Health, Safety, and Environmental Division, HSE-8. The primary purpose was to aid the staff in evaluating cultural resources on LANL lands. In addition to works that related to the archaeology and history of the area, Steen included notations of a few books and articles in other fields such as geology and natural history. It was hoped that they also would be of value to other organizations and to students of past human activities on the Pajarito Plateau.At the same time, the National Park Service (NPS) was planning a major survey of Bandelier National Monument (BNM). As part of this plan, the author was asked to prepare a background document that described research previously carried out in the area, including an annotated bibliography. Although the survey would be limited to the park boundaries, the larger Pajarito Plateau is a more logical study area from physiographic, environmental, and cultural perspectives; hence the focus was on this larger region. Mathien (1986) also included some references to natural resources studies, particularly those initiated by NPS within Bandelier National Monument.Both bibliographies were made available to Colleen Olinger and Beverly Larson of the Health and Environmental Services Group at Los Alamos. They realized that while neither was complete, each included entries missing from the other. Larson suggested the two bibliographies be combined. (At this time, Craig Allen was studying the landscape of the Jemez Mountains [Allen 1984c, 1989]. His investigations included much detailed information on natural resource studies and were added in 1991 and 1992.)To limit the scope of their work, Steen and Mathien had chosen their parameter: the Pajarito Plateau. Geographically, the

  18. ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.7258 >orf19.7258; Contig19-2507; 88880..89851; DDI1*; response to DNA alkyl...ation; MQLTISLDHSGDIISVDVPDSLCLEDFKAYLSAETGLEASVQVLKFNGRELVGNATLSELQIHDNDLLQLSKKQVA

  19. ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.1278 >orf19.1278; Contig19-10104; complement(13162...4..>132028); ; conserved hypothetical protein; truncated protein IQNNKCSGCNLKLDFPVIHFKCKHSFHQKCLSTNLIATSTESS

  20. ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.4711 >orf19.4711; Contig19-10212; complement(29836...7..>300616); ; acidic repetitive protein; truncated protein DRSDYNEEDNNDFTRKLNEIQSKESNHEDLAQSEVQEGQKDEPDSVNQ

  1. ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ruitment factor; MAKTRSKSAATAAATSPKASPTAAKVTKNKVTKPSTASPSKTTKTKAVKKTTTKKATPKKEEEEKK... Ca19AnnotatedDec2004aaSeq orf19.124 >orf19.124; Contig19-10035; 67601..68698; CIC1*; protease substrate rec

  2. Bibliography of publications on Experimental Breeder Reactor No. II (ERB-II). 1955-July 1979

    Energy Technology Data Exchange (ETDEWEB)

    Berg, D B [comp.

    1979-08-01

    This bibliography is divided into 15 broad areas, or categories, of interest. The same publication is listed in more than one category if its content applies to several areas of interest. Under each category, the publications are listed (1) by calendar year of publication and (2) then alphabetically by last name of the first author given. Publications that have no evident author (or compiler or editor) are listed alphabetically by title at the end of the listing for the calendar year in which they were published. Only open literature (that which can be obtained through libraries and other sources available to the public) are listed.

  3. Bibliography of publications on Experimental Breeder Reactor No. II (ERB-II). 1955-July 1979

    International Nuclear Information System (INIS)

    Berg, D.B.

    1979-08-01

    This bibliography is divided into 15 broad areas, or categories, of interest. The same publication is listed in more than one category if its content applies to several areas of interest. Under each category, the publications are listed (1) by calendar year of publication and (2) then alphabetically by last name of the first author given. Publications that have no evident author (or compiler or editor) are listed alphabetically by title at the end of the listing for the calendar year in which they were published. Only open literature (that which can be obtained through libraries and other sources available to the public) are listed

  4. Occupational dose reduction at nuclear power plants: Annotated bibliography of selected readings in radiation protection and ALARA. Volume 7

    Energy Technology Data Exchange (ETDEWEB)

    Kaurin, D.G.; Khan, T.A.; Sullivan, S.G.; Baum, J.W. [Brookhaven National Lab., Upton, NY (United States)

    1993-07-01

    The ALARA Center at Brookhaven National Laboratory publishes a series of bibliographies of selected readings in radiation protection and ALARA in the continuing effort to collect and disseminate information on radiation dose reduction at nuclear power plants. This is volume 7 of the series. The abstracts in this bibliography were selected from proceedings of technical meetings and conferences, journals, research reports, and searches of the Energy Science and Technology database of the US Department of Energy. The subject material of these abstracts relates to radiation protection and dose reduction, and ranges from use of robotics to operational health physics, to water chemistry. Material on the design, planning, and management of nuclear power stations is included, as well as information on decommissioning and safe storage efforts. Volume 7 contains 293 abstract, an author index, and a subject index. The author index is specific for this volume. The subject index is cumulative and lists all abstract numbers from volumes 1 to 7. The numbers in boldface indicate the abstracts in this volume; the numbers not in boldface represent abstracts in previous volumes.

  5. Occupational dose reduction at nuclear power plants: Annotated bibliography of selected readings in radiation protection and ALARA. Volume 8

    Energy Technology Data Exchange (ETDEWEB)

    Sullivan, S.G.; Khan, T.A.; Xie, J.W. [Brookhaven National Lab., Upton, NY (United States)

    1995-05-01

    The ALARA Center at Brookhaven National Laboratory publishes a series of bibliographies of selected readings in radiation protection and ALARA in a continuing effort to collect and disseminate information on radiation dose reduction at nuclear power plants. This volume 8 of the series. The abstracts in this bibliography were selected form proceedings of technical meetings and conference journals, research reports, and searches of the Energy Science and Technology database of the US Department of Energy. The subject material of these abstracts relates to the many aspects of radiation protection and dose reduction, and ranges form use of robotics, to operational health physics, to water chemistry. Material on the design, planning, and management of nuclear power stations is included, as well as information on decommissioning and safe storage efforts. Volume 8 contains 232 abstracts, an author index, and a subject index. The author index is specific for this volume. The subject index is cumulative and lists all abstract numbers from volumes 1 to 8. The numbers in boldface indicate the abstracts in this volume; the numbers not in boldface represent abstracts in previous volumes.

  6. Occupational dose reduction at nuclear power plants: Annotated bibliography of selected readings in radiation protection and ALARA. Volume 8

    International Nuclear Information System (INIS)

    Sullivan, S.G.; Khan, T.A.; Xie, J.W.

    1995-05-01

    The ALARA Center at Brookhaven National Laboratory publishes a series of bibliographies of selected readings in radiation protection and ALARA in a continuing effort to collect and disseminate information on radiation dose reduction at nuclear power plants. This volume 8 of the series. The abstracts in this bibliography were selected form proceedings of technical meetings and conference journals, research reports, and searches of the Energy Science and Technology database of the US Department of Energy. The subject material of these abstracts relates to the many aspects of radiation protection and dose reduction, and ranges form use of robotics, to operational health physics, to water chemistry. Material on the design, planning, and management of nuclear power stations is included, as well as information on decommissioning and safe storage efforts. Volume 8 contains 232 abstracts, an author index, and a subject index. The author index is specific for this volume. The subject index is cumulative and lists all abstract numbers from volumes 1 to 8. The numbers in boldface indicate the abstracts in this volume; the numbers not in boldface represent abstracts in previous volumes

  7. ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.3361 >orf19.3361; Contig19-10173; 157397..>158185;... YAT2*; carnitine acetyltransferase; gene family | truncated protein MSTYRFQETLEKLPIPDLVQTCNAYLEALKPLQTEQEHE

  8. Articles on Mass Communication in U.S. and Foreign Journals: A Selected Annotated Bibliography--October, November, December 1978.

    Science.gov (United States)

    McKerns, Joseph P.; Delahaye, Alfred N.

    1979-01-01

    Lists and annotates more than 200 articles on mass communication, grouped according to topic. Topics include advertising, broadcasting, courts and law, education for journalism, international, management, public relations, and visual communications. (GT)

  9. Extending eScience Provenance with User-Submitted Semantic Annotations

    Science.gov (United States)

    Michaelis, J.; Zednik, S.; West, P.; Fox, P. A.; McGuinness, D. L.

    2010-12-01

    eScience based systems generate provenance of their data products, related to such things as: data processing, data collection conditions, expert evaluation, and data product quality. Recent advances in web-based technology offer users the possibility of making annotations to both data products and steps in accompanying provenance traces, thereby expanding the utility of such provenance for others. These contributing users may have varying backgrounds, ranging from system experts to outside domain experts to citizen scientists. Furthermore, such users may wish to make varying types of annotations - ranging from documenting the purpose of a provenance step to raising concerns about the quality of data dependencies. Semantic Web technologies allow for such kinds of rich annotations to be made to provenance through the use of ontology vocabularies for (i) organizing provenance, and (ii) organizing user/annotation classifications. Furthermore, through Linked Data practices, Semantic linkages may be made from provenance steps to external data of interest. A desire for Semantically-annotated provenance has been motivated by data management issues in the Mauna Loa Solar Observatory’s (MLSO) Advanced Coronal Observing System (ACOS). In ACOS, photomoeter-based readings are taken of solar activity and subsequently processed into final data products consumable by end users. At intermediate stages of ACOS processing, factors such as evaluations by human experts and weather conditions are logged, which could impact data product quality. If such factors are linked via user-submitted annotations to provenance, it could be significantly beneficial for other users. Likewise, the background of a user could impact the credibility of their annotations. For example, an annotation made by a citizen scientist describing the purpose of a provenance step may not be as reliable as a similar annotation made by an ACOS project member. For this work, we have developed a software package that

  10. ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.4748 >orf19.4748; Contig19-10215; complement(47336.....47731); MSL1*; U2 snRNA-associated protein; MPSTKRSSSTEYSHKDSKKKVKLDYVNLKPSQTLYVKNLNTKINKKILLHNLYLLFSAFGDIISINLQNGFAFIIFSNLNSATLALRNLKNQDFFDKPLVLNYAVKESKAISQEKQKLQDENDEEVMPSYE*

  11. ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.2370 >orf19.2370; Contig19-10147; complement(50671..52716); DSL1*; retrogra...de ER-to-golgi transport; MPSIEQQLEDQELYLKDIEQNINKTLSKINKTTLENDNDFRKQFEEIPQDSNTTESN

  12. Ubiquitous Annotation Systems

    DEFF Research Database (Denmark)

    Hansen, Frank Allan

    2006-01-01

    Ubiquitous annotation systems allow users to annotate physical places, objects, and persons with digital information. Especially in the field of location based information systems much work has been done to implement adaptive and context-aware systems, but few efforts have focused on the general...... requirements for linking information to objects in both physical and digital space. This paper surveys annotation techniques from open hypermedia systems, Web based annotation systems, and mobile and augmented reality systems to illustrate different approaches to four central challenges ubiquitous annotation...... systems have to deal with: anchoring, structuring, presentation, and authoring. Through a number of examples each challenge is discussed and HyCon, a context-aware hypermedia framework developed at the University of Aarhus, Denmark, is used to illustrate an integrated approach to ubiquitous annotations...

  13. Towards the bibliography of life

    Directory of Open Access Journals (Sweden)

    David King

    2011-11-01

    Full Text Available This paper discusses how we intend to take forward the vision of a Bibliography of Life in the ViBRANT project. The underlying principle of the Bibliography is to provide taxonomists and others with a freely accessible bibliography covering the whole of life. Such a bibliography has been achieved for specific study areas within taxonomy, but not for “life” as a whole.The creation of such a comprehensive tool has been hindered by various social and technical issues. The social concerns focus on the willingness of users to contribute to the Bibliography. The technical concerns relate to the architecture required to deliver the Bibliography. These issues are discussed in the paper and approaches to addressing them within the ViBRANT project are described, to demonstrate how we can now seriously consider building a Bibliography of Life. We are particularly interested in the potential of the resulting tool to improve the quality of bibliographic references. Through analysing the large number of references in the Bibliography we will be able to add metadata by resolving known issues such as geographical name variations. This should result in a tool that will assist taxonomists in two ways. Firstly, it will be easier for them to discover relevant literature, especially pre-digital literature; and secondly, it will be easier for them to identify the canonical form for a citation.The paper also covers related issues relevant to building the tool in ViBRANT, including implementation and copyright, with suggestions as to how we could address them.

  14. Articles on Mass Communication in U.S. and Foreign Journals: A Selected Annotated Bibliography--January, February, March 1979.

    Science.gov (United States)

    McKerns, Joseph P.; Delahaye, Alfred N.

    1979-01-01

    Lists and annotates more than 200 articles on mass communication, grouped according to topic. Topics include advertising, broadcasting, courts and law, government and media, history and biography, international, management, public relations, and visual communication. (GT)

  15. Sand lance: A review of biology and predator relations and annotated bibliography

    Science.gov (United States)

    Robards, Martin D.; Willson, Mary F.; Armstrong, Robert H.; Piatt, John F.

    1999-01-01

    Six species of sand lance (Ammodytes) in temperate and boreal regions are currently recognized. Sand lance can occupy a wide range of environmental conditions, but all appear to be dormant predominantly in winter, and one species is in summer also. They lack a swim bladder and spend much of their time buried in specific substrates. Copepods are the primary food. Spawning usually occurs in fall or winter (although some species also spawn in spring), eggs are demersal, and larvae may hatch at times of low food abundance. Sand lance usually occur in schools and are regarded as a relatively high-quality forage fish.Sand lance constitute a major prey for at least some populations of over 100 species of consumer, including 40 species of birds, 12 species of marine mammals, 45 species of fishes, and some invertebrates. Variation in the availability of sand lance (and other forage fishes) can have major effects on the breeding success and survival of their predators. Commercial fishing and other pressures on sand lance populations potentially have ramifying effects on many species of wildlife.The bibliography contains over 1,700 references on the family Ammodytidae, with an emphasis on the genus Ammodytes. Keywords are provided for each reference and have been further organized into taxonomic, geographic, subject, and predator indexes.

  16. Systematic reviews of complementary therapies – an annotated bibliography. Part 3: Homeopathy

    Science.gov (United States)

    Linde, Klaus; Hondras, Maria; Vickers, Andrew; Riet, Gerben ter; Melchart, Dieter

    2001-01-01

    Background Complementary therapies are widespread but controversial. We aim to provide a comprehensive collection and a summary of systematic reviews of clinical trials in three major complementary therapies (acupuncture, herbal medicine, homeopathy). This article is dealing with homeopathy. Potentially relevant reviews were searched through the register of the Cochrane Complementary Medicine Field, the Cochrane Library, Medline, and bibliographies of articles and books. To be included articles had to review prospective clinical trials of homeopathy; had to describe review methods explicitly; had to be published; and had to focus on treatment effects. Information on conditions, interventions, methods, results and conclusions was extracted using a pretested form and summarized descriptively. Results Eighteen out of 22 potentially relevant reviews preselected in the screening process met the inclusion criteria. Six reviews addressed the question whether homeopathy is effective across conditions and interventions. The majority of available trials seem to report positive results but the evidence is not convincing. For isopathic nosodes for allergic conditions, oscillococcinum for influenza-like syndromes and galphimia for pollinosis the evidence is promising while in other areas reviewed the results are equivocal. Interpretation Reviews on homeopathy often address general questions. While the evidence is promising for some topics the findings of the available reviews are unlikely to end the controversy on this therapy. PMID:11527508

  17. ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.710 >orf19.710; Contig19-10065; complement(47186.....>47710); LSC2*; succinate-CoA ligase beta subunit; truncated protein | overlap LGFDDNASFRQEEVFSWRDPTQEDPQEAE

  18. Articles on Mass Communication in U.S. and Foreign Journals: A Selected Annotated Bibliography--July, August, September 1979.

    Science.gov (United States)

    Delahaye, Alfred N.; McKerns, Joseph P.

    1979-01-01

    Lists and annotates more than 200 articles on mass communication, grouped according to topic. Topics include advertising, broadcasting, courts and law, journalism education, history and biography, international, public relations, visual communication, and women and media. (GT)

  19. Articles on Mass Communication in U.S. and Foreign Journals: A Selected Annotated Bibliography--April, May, June 1979.

    Science.gov (United States)

    McKerns, Joseph P.; Delahaye, Alfred N.

    1979-01-01

    Lists and annotates 200 articles on mass communication, grouped according to topic. Topics include advertising, audience and communicator analysis, broadcasting, courts and law, education for journalism, government and media, international, management, public relations, and visual communication. (GT)

  20. Articles on Mass Communication in U.S. and Foreign Journals: A Selected Annotated Bibliography--October, November, December 1979.

    Science.gov (United States)

    McKerns, Joseph P.; Delahaye, Alfred N.

    1980-01-01

    Lists and annotates more than 200 articles on mass communication, grouped according to topic. Topics include advertising, broadcasting, courts and law, criticism and defense of media, history and biography, international, public relations, visual communication, and women and media. (GT)

  1. Occupational dose reduction at nuclear power plants: Annotated bibliography of selected readings in radiation protection and ALARA: Volume 4

    International Nuclear Information System (INIS)

    Khan, T.A.; Baum, J.W.

    1989-06-01

    This report is the fourth in the series of bibliographies supporting the efforts at the Brookhaven National Laboratory on dose reduction at nuclear power plants. Abstracts for this bibliography were selected from proceedings of technical meetings, journals, research reports and searches of the DOE's Energy Data Base. The abstracts included in this report to operational health physics as well as other subjects which have a bearing on dose reduction at nuclear power plants, such as stress corrosion, cracking, plant chemistry, use of robotics and remote devices, etc. Material on improved design, materials selection, planning and other topics which are related to dose reduction efforts are also included. The report contains 327 abstracts as well as subject and author indices. All information in the current volume is also available from the ALARA Center's bulletin board service which is accessible by personal computers with the help of a modem. The last section of the report explains the features of the bulletin board. The bulletin board will be kept up-to-date with new information and should be of help in keeping people current in the area of dose reduction

  2. Articles on Mass Communication in U.S. and Foreign Journals: A Selected Annotated Bibliography--January, February, March 1980.

    Science.gov (United States)

    McKerns, Joseph P.; Delahaye, Alfred N.

    1980-01-01

    Lists and annotates more than 250 articles on mass communication, grouped according to topic. Topics include advertising, audience and communicator analysis, broadcasting, community journalism, courts and law, criticism and defense of media, education for journalism, history and biography, international, management, public relations, visual…

  3. Women: A Select Bibliography.

    Science.gov (United States)

    Kusnerz, Peggy A., Comp.; Pollack, Ann M., Comp.

    This select bibliography lists books, monographs, journals and newsletters which relate to feminism, women's studies, and other perspectives on women. Selections are organized by topic: general, bibliographies, art and literature, biography/autobiography, economics, education, family and marriage, history, politics and sex roles. Also included is…

  4. Modeling multiple time series annotations as noisy distortions of the ground truth: An Expectation-Maximization approach.

    Science.gov (United States)

    Gupta, Rahul; Audhkhasi, Kartik; Jacokes, Zach; Rozga, Agata; Narayanan, Shrikanth

    2018-01-01

    Studies of time-continuous human behavioral phenomena often rely on ratings from multiple annotators. Since the ground truth of the target construct is often latent, the standard practice is to use ad-hoc metrics (such as averaging annotator ratings). Despite being easy to compute, such metrics may not provide accurate representations of the underlying construct. In this paper, we present a novel method for modeling multiple time series annotations over a continuous variable that computes the ground truth by modeling annotator specific distortions. We condition the ground truth on a set of features extracted from the data and further assume that the annotators provide their ratings as modification of the ground truth, with each annotator having specific distortion tendencies. We train the model using an Expectation-Maximization based algorithm and evaluate it on a study involving natural interaction between a child and a psychologist, to predict confidence ratings of the children's smiles. We compare and analyze the model against two baselines where: (i) the ground truth in considered to be framewise mean of ratings from various annotators and, (ii) each annotator is assumed to bear a distinct time delay in annotation and their annotations are aligned before computing the framewise mean.

  5. Bibliography on augmentation of convective heat and mass transfer-II

    Energy Technology Data Exchange (ETDEWEB)

    Bergles, A.E.; Nirmalan, V.; Junkhan, G.H.; Webb, R.L.

    1983-12-01

    Heat transfer augmentation has developed into a major specialty area in heat transfer research and development. This report presents and updated bibliography of world literature on augmentation. The literature is classified into passive augmentation techniques, which require no external power, and active techniques, which do require external power. The fifteen techniques are grouped in terms of their applications to the various modes of heat transfer. Mass transfer is included for completeness. Key words are included with each citation for technique/mode identification. The total number of publications cited is 3045, including 135 surveys of various techniques and 86 papers on performance evaluation of passive techniques. Patents are not included, as they are the subject of a separate bibliographic report.

  6. Towards Viral Genome Annotation Standards, Report from the 2010 NCBI Annotation Workshop.

    Science.gov (United States)

    Brister, James Rodney; Bao, Yiming; Kuiken, Carla; Lefkowitz, Elliot J; Le Mercier, Philippe; Leplae, Raphael; Madupu, Ramana; Scheuermann, Richard H; Schobel, Seth; Seto, Donald; Shrivastava, Susmita; Sterk, Peter; Zeng, Qiandong; Klimke, William; Tatusova, Tatiana

    2010-10-01

    Improvements in DNA sequencing technologies portend a new era in virology and could possibly lead to a giant leap in our understanding of viral evolution and ecology. Yet, as viral genome sequences begin to fill the world's biological databases, it is critically important to recognize that the scientific promise of this era is dependent on consistent and comprehensive genome annotation. With this in mind, the NCBI Genome Annotation Workshop recently hosted a study group tasked with developing sequence, function, and metadata annotation standards for viral genomes. This report describes the issues involved in viral genome annotation and reviews policy recommendations presented at the NCBI Annotation Workshop.

  7. Towards Viral Genome Annotation Standards, Report from the 2010 NCBI Annotation Workshop

    Directory of Open Access Journals (Sweden)

    Qiandong Zeng

    2010-10-01

    Full Text Available Improvements in DNA sequencing technologies portend a new era in virology and could possibly lead to a giant leap in our understanding of viral evolution and ecology. Yet, as viral genome sequences begin to fill the world’s biological databases, it is critically important to recognize that the scientific promise of this era is dependent on consistent and comprehensive genome annotation. With this in mind, the NCBI Genome Annotation Workshop recently hosted a study group tasked with developing sequence, function, and metadata annotation standards for viral genomes. This report describes the issues involved in viral genome annotation and reviews policy recommendations presented at the NCBI Annotation Workshop.

  8. Intracultural Communication: Selected Bibliography.

    Science.gov (United States)

    Byrd, Marquita L.

    The 63 books and journal articles listed in this bibliography address the problem of intracultural communication. A short introduction to the bibliography defines intracultural communication as the creation and sharing of meaning among citizens of the same geo-political system who come from various tributary cultures (groups distinguishable from…

  9. Gas centrifuge bibliography 1970 - 1974

    International Nuclear Information System (INIS)

    Lowe, G.E.; Edwards, K.J.

    1978-05-01

    A bibliography, with abstract, is presented of the gas centrifuge literature published during 1970 to 1974. It supplements PG Information Series 25 (CA) which covered the period 1895 to 1970. Following reference to bibliographies, books and pamphlets, and a few items omitted from the previous bibliography, main items are grouped under the headings Reports, Journal articles and Conference papers and are listed chronologically. There are indexes to subject, author, and document number, the latter including the issuing body. (UK)

  10. A bibliography of all known publications & reports on the Gulf sturgeon, Acipenser oxyrinchus desotoi

    Science.gov (United States)

    Price, Melissa; Adler, Jennifer; Littles, Chanda; Randolph, April Norem; Nash, Ursula A.; Gillett, Bethan; Randall, Michael T.; Sulak, Kenneth J.; Walsh, Stephen J.; Brownell, Prescott

    2013-01-01

    This functional bibliography is meant to be a complete and comprehensive bibliography of all discoverable reports containing information on the Gulf Sturgeon (GS). This bibliography contains all known reports presenting, documenting, summarizing, listing, or interpreting information on the GS through 31 December 2013. Report citations are organized into four sections. Section I includes published scientific journal articles, books, dissertations and theses, published and unpublished technical reports, published harvest prohibitions, and online articles reporting substantive scientific information. Section II includes newspaper, newsletter, magazine, book, agency news releases, and online articles reporting on GS occurrences, mortalities, captures, jumping, boat collisions, aquaculture, historical photographs, and other largely non-scientific or anecdotal issues. Section III consists of books, theses, ecotour-guides, media articles, editorials, and blogs reporting a mix of anecdotal information, historical information, and opinion on GS conservation, habitat issues, exploitation, aquaculture, and human interaction - but presenting very limited or no substantive scientific information. Section IV includes videos, films and audio recordings documenting GS life history and behavior.

  11. Art Therapy: A Bibliography.

    Science.gov (United States)

    Gantt, Linda, Comp.; Schmal, Marilyn Strauss, Comp.

    The bibliography on art therapy presents 1175 citations (1940-1973) drawn from searches of the medical indexes, computer systems of the National Library of Medicine and the National Institute of Mental Health, other bibliographies, Centre International de Documentation Concernant les Expressions Plastiques, and the American Journal of Art Therapy.…

  12. TWRS privatization bibliography

    International Nuclear Information System (INIS)

    1996-03-01

    The purpose of this bibliography is to present a select set of documents that may be of interest to the Offeror, covering a variety of subject areas related to the TWRS Privatization Project. This bibliography is not, nor is intended to be, exhaustive or complete. It was prepared with the intent of providing a sampling of representative documents potentially helpful to Offerors. The documents referenced herein have been identified as representative of those potentially helpful to Offerors. This list of documents does not represent the full extent of available and potentially helpful information, nor should it be taken as a representation of documents determined to be of greater importance than other documents not referenced herein. There are numerous documents available to the public that are NOT cited in this bibliography; the Offeror is encouraged to perform searches for alternate sources of information

  13. ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.6649; Contig19-10251; complement(36800..38461); BR...87398.1| ... TFIIB related subunit of TFIIIB (BRF1) [Candida ... albicans] pir||B55483 transcr...L Transcription factor IIIB 70 kDa ... subunit (TFIIIB) (B-related factor)

  14. ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Ca19AnnotatedDec2004aaSeq orf19.2029; Contig19-10139; 79190..80278; RFC5*; DNA replicationn factor C | lead...ing strand elongation mismatch repair ... (ATPase); >1a5t0 2 329 7 339 1e-22 ... gb|EAL00

  15. Literatura Chicana. A Comprehensive Bibliography (1980-June, 1984). Working Bibliography Series No. 1.

    Science.gov (United States)

    Trujillo, Roberto G.; And Others

    The 197-item bibliography on Chicano literature published from 1980 through June 1984 is presented in 10 sections: poetry (77 entries), novel (25 entries), short fiction (13 entries), theatre (7 entries), literary criticism (16 entries), anthology (24 entries), unpublished dissertations (13 entries), bibliographies and encyclopedia (6 entries),…

  16. Annotating breast cancer microarray samples using ontologies

    Science.gov (United States)

    Liu, Hongfang; Li, Xin; Yoon, Victoria; Clarke, Robert

    2008-01-01

    As the most common cancer among women, breast cancer results from the accumulation of mutations in essential genes. Recent advance in high-throughput gene expression microarray technology has inspired researchers to use the technology to assist breast cancer diagnosis, prognosis, and treatment prediction. However, the high dimensionality of microarray experiments and public access of data from many experiments have caused inconsistencies which initiated the development of controlled terminologies and ontologies for annotating microarray experiments, such as the standard microarray Gene Expression Data (MGED) ontology (MO). In this paper, we developed BCM-CO, an ontology tailored specifically for indexing clinical annotations of breast cancer microarray samples from the NCI Thesaurus. Our research showed that the coverage of NCI Thesaurus is very limited with respect to i) terms used by researchers to describe breast cancer histology (covering 22 out of 48 histology terms); ii) breast cancer cell lines (covering one out of 12 cell lines); and iii) classes corresponding to the breast cancer grading and staging. By incorporating a wider range of those terms into BCM-CO, we were able to indexed breast cancer microarray samples from GEO using BCM-CO and MGED ontology and developed a prototype system with web interface that allows the retrieval of microarray data based on the ontology annotations. PMID:18999108

  17. Use of Annotations for Component and Framework Interoperability

    Science.gov (United States)

    David, O.; Lloyd, W.; Carlson, J.; Leavesley, G. H.; Geter, F.

    2009-12-01

    western United States at the USDA NRCS National Water and Climate Center. PRMS is a component based modular precipitation-runoff model developed to evaluate the impacts of various combinations of precipitation, climate, and land use on streamflow and general basin hydrology. The new OMS 3.0 PRMS model source code is more concise and flexible as a result of using the new framework’s annotation based approach. The fully annotated components are now providing information directly for (i) model assembly and building, (ii) dataflow analysis for implicit multithreading, (iii) automated and comprehensive model documentation of component dependencies, physical data properties, (iv) automated model and component testing, and (v) automated audit-traceability to account for all model resources leading to a particular simulation result. Experience to date has demonstrated the multi-purpose value of using annotations. Annotations are also a feasible and practical method to enable interoperability among models and modeling frameworks. As a prototype example, model code annotations were used to generate binding and mediation code to allow the use of OMS 3.0 model components within the OpenMI context.

  18. Semi-Semantic Annotation: A guideline for the URDU.KON-TB treebank POS annotation

    Directory of Open Access Journals (Sweden)

    Qaiser ABBAS

    2016-12-01

    Full Text Available This work elaborates the semi-semantic part of speech annotation guidelines for the URDU.KON-TB treebank: an annotated corpus. A hierarchical annotation scheme was designed to label the part of speech and then applied on the corpus. This raw corpus was collected from the Urdu Wikipedia and the Jang newspaper and then annotated with the proposed semi-semantic part of speech labels. The corpus contains text of local & international news, social stories, sports, culture, finance, religion, traveling, etc. This exercise finally contributed a part of speech annotation to the URDU.KON-TB treebank. Twenty-two main part of speech categories are divided into subcategories, which conclude the morphological, and semantical information encoded in it. This article reports the annotation guidelines in major; however, it also briefs the development of the URDU.KON-TB treebank, which includes the raw corpus collection, designing & employment of annotation scheme and finally, its statistical evaluation and results. The guidelines presented as follows, will be useful for linguistic community to annotate the sentences not only for the national language Urdu but for the other indigenous languages like Punjab, Sindhi, Pashto, etc., as well.

  19. Model and Interoperability using Meta Data Annotations

    Science.gov (United States)

    David, O.

    2011-12-01

    Software frameworks and architectures are in need for meta data to efficiently support model integration. Modelers have to know the context of a model, often stepping into modeling semantics and auxiliary information usually not provided in a concise structure and universal format, consumable by a range of (modeling) tools. XML often seems the obvious solution for capturing meta data, but its wide adoption to facilitate model interoperability is limited by XML schema fragmentation, complexity, and verbosity outside of a data-automation process. Ontologies seem to overcome those shortcomings, however the practical significance of their use remains to be demonstrated. OMS version 3 took a different approach for meta data representation. The fundamental building block of a modular model in OMS is a software component representing a single physical process, calibration method, or data access approach. Here, programing language features known as Annotations or Attributes were adopted. Within other (non-modeling) frameworks it has been observed that annotations lead to cleaner and leaner application code. Framework-supported model integration, traditionally accomplished using Application Programming Interfaces (API) calls is now achieved using descriptive code annotations. Fully annotated components for various hydrological and Ag-system models now provide information directly for (i) model assembly and building, (ii) data flow analysis for implicit multi-threading or visualization, (iii) automated and comprehensive model documentation of component dependencies, physical data properties, (iv) automated model and component testing, calibration, and optimization, and (v) automated audit-traceability to account for all model resources leading to a particular simulation result. Such a non-invasive methodology leads to models and modeling components with only minimal dependencies on the modeling framework but a strong reference to its originating code. Since models and

  20. Geological and geochemical aspects of uranium deposits: a selected, annotated bibliography. Vol. 2, Rev. 1. [490 references

    Energy Technology Data Exchange (ETDEWEB)

    Thomas, J.M.; Brock, M.L.; Garland, P.A.; White, M.B.; Daniel, E.W. (comps.)

    1979-07-01

    This bibliography, a compilation of 490 references, is the second in a series compiled from the National Uranium Resource Evaluation (NURE) Bibliographic Data Base. This data base is one of six data bases created by the Ecological Sciences Information Center, Oak Ridge National Laboratory, for the Grand Junction Office of the Department of Energy. Major emphasis for this volume has been placed on uranium geology, encompassing deposition, genesis of ore deposits, and ore controls; and prospecting techniques, including geochemistry and aerial reconnaissance. The following indexes are provided to aid the user in locating references of interest: author, geographic location, quadrangle name, geoformational feature, taxonomic name, and keyword.

  1. Relationship Factors Contributing to the Progression of Combat Related PTSD and Suicidality over Time

    Science.gov (United States)

    2014-04-01

    our participants.  Have created an annotated bibliography of Internet Research (e-Research) best methods to ensure best practices with this form...case evaluation of applicants. We have also created an annotated bibliography of Internet Research (e- Research) studies and methods to ensure best

  2. Chado controller: advanced annotation management with a community annotation system.

    Science.gov (United States)

    Guignon, Valentin; Droc, Gaëtan; Alaux, Michael; Baurens, Franc-Christophe; Garsmeur, Olivier; Poiron, Claire; Carver, Tim; Rouard, Mathieu; Bocs, Stéphanie

    2012-04-01

    We developed a controller that is compliant with the Chado database schema, GBrowse and genome annotation-editing tools such as Artemis and Apollo. It enables the management of public and private data, monitors manual annotation (with controlled vocabularies, structural and functional annotation controls) and stores versions of annotation for all modified features. The Chado controller uses PostgreSQL and Perl. The Chado Controller package is available for download at http://www.gnpannot.org/content/chado-controller and runs on any Unix-like operating system, and documentation is available at http://www.gnpannot.org/content/chado-controller-doc The system can be tested using the GNPAnnot Sandbox at http://www.gnpannot.org/content/gnpannot-sandbox-form valentin.guignon@cirad.fr; stephanie.sidibe-bocs@cirad.fr Supplementary data are available at Bioinformatics online.

  3. Bibliography of studies for the Salt Repository Project Office of the Civilian Radioactive Waste Management Program, April 1978-May 1986

    International Nuclear Information System (INIS)

    1986-10-01

    DOE/CH/10140-05 is an annotated bibliography of approved reports that have been produced for the US Department of Energy Salt Repository Project Office of the Civilian Radioactive Waste Management Program since April 1978. This document is intended for use by the US Department of Energy, State and local officials, the US Nuclear Regulatory Commission, contractors to the Office of Nuclear Waste Isolation, concerned citizens, and others who need a comprehensive listing of reports related to a nuclear waste repository in salt. This document consists of a main report listing, appendixes with Work Breakdown Structure lists, and a topical index

  4. Bibliography of studies for the Salt Repository Project Office of the Civilian Radioactive Waste Management Program, April 1978-December 1986

    International Nuclear Information System (INIS)

    1987-06-01

    This document is an annotated bibliography of approved reports that have been produced for the US Department of Energy Salt Repository Project Office of the Civilian Radioactive Waste Management Program since April 1978. This document is intended for use by the US Department of Energy, State and local officials, the US Nuclear Regulatory Commission, contractors to the Office of Nuclear Waste Isolation, concerned citizens, and others who need a comprehensive listing of reports related to a nuclear waste repository in salt. This document consists of a main report listing, appendixes with Work Breakdown Structure lists, and a topical index

  5. Assurance program for remedial action (APRA) microcomputer-operated bibliography management system

    International Nuclear Information System (INIS)

    Stenner, R.D.; Washburn, D.K.; Denham, D.H.

    1985-10-01

    Pacific Northwest Laboratory (PNL) provided technical assistance to the Office of Operational Safety (OOS) in developing their Assurance Program for Remedial Action (APRA). The APRA Bibliography Management System (BMS), a microcomputer-operated system designed to file, locate and retrieve project-specific bibliographic data, was developed to manage the documentation associated with APRA. The BMS uses APRABASE, a PNL-developed computer program written in dBASE II language, which is designed to operate using the commercially available dBASE II database software. The paper describes the APRABASE computer program, its associated subprograms, and the dBASE II APRA file. Although the BMS was designed to manage APRA-associated documents, it could be easily adapted for use in handling bibliographic data associated with any project

  6. Assurance Program for Remedial Action (APRA) microcomputer-operated bibliography management system

    International Nuclear Information System (INIS)

    Stenner, R.D.; Washburn, D.K.; Denham, D.H.

    1986-01-01

    Pacific Northwest Laboratory (PNL) provided technical assistance to the Office of Operational Safety (OOS) in developing their Assurance Program for Remedial Action (APRA). The APRA Bibliography Management System (BMS), a microcomputer-operated system designed to file, locate and retrieve project-specific bibliographic data, was developed to manage the documentation associated with APRA. The BMS uses APRABASE, a PNL-developed computer program written in dBASE II/sup (b)/ language, which is designed to operate using the commercially available dBASE II database software. This paper describes the APRABASE computer program, its associated subprograms, and the dBASE II APRA file. Although the BMS was designed to manage APRA-associated documents, it could be easily adapted for use in handling bibliographic data associated with any project

  7. A Multimedia Bibliography of Weather Materials for Schools. Climatological Publications, Bibliography Series No. 2.

    Science.gov (United States)

    Roseman, Steven, Ed.; Ray, Henry, Ed.

    This bibliography identifies multimedia weather resources for elementary and secondary schools in Arizona. Content of the materials includes weather forecasting techniques, storms, clouds, the atmosphere, wind, radar, humidity, precipitation, and world climate regions. The first section of the bibliography lists 47 books, most of which were…

  8. Automatic differentiation bibliography

    Energy Technology Data Exchange (ETDEWEB)

    Corliss, G.F. [comp.

    1992-07-01

    This is a bibliography of work related to automatic differentiation. Automatic differentiation is a technique for the fast, accurate propagation of derivative values using the chain rule. It is neither symbolic nor numeric. Automatic differentiation is a fundamental tool for scientific computation, with applications in optimization, nonlinear equations, nonlinear least squares approximation, stiff ordinary differential equation, partial differential equations, continuation methods, and sensitivity analysis. This report is an updated version of the bibliography which originally appeared in Automatic Differentiation of Algorithms: Theory, Implementation, and Application.

  9. Gas centrifuge bibliography 1980-1982

    International Nuclear Information System (INIS)

    Lowe, G.E.; Morrison, M.

    1983-06-01

    A bibliography, with abstract, is presented of the gas centrifuge literature published from 1980 to 1982 inclusive. It supplements PG Information Series 25 (CA), BNFL Information Series 15 (CA) and BNFL Information Series 23 (CA), which covered the periods 1895 to 1970, 1970 to 1974, and 1975 to 1979 respectively. After bibliographies and books and pamphlets, the main list is arranged chronologically under the headings, Reports, Journal articles, and Conference papers. Items omitted from the earlier bibliographies or received too late for inclusion in this, have been listed separately. There are author, report number and subject indexes. (U.K.)

  10. TWRS privatization bibliography. Revision 2

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-04-01

    The purpose of this bibliography is to present a select set of documents that may be of interest to the Offeror, covering a variety of subject areas related to the TWRS Privatization Project. This bibliography is not, nor is it intended to be, exhaustive or complete. It was prepared with the intent of providing a sampling of representative documents potentially helpful to Offerors. This bibliography is organized by subject area. The subjects covered are: waste characterization; pre-treatment; high-level waste immobilization; low-level waste immobilization; low-level waste melter test program; performance assessment; general; and safety.

  11. A select bibliography with abstracts of reports related to Waste Isolation Pilot Plant geotechnical studies (1972--1990)

    Energy Technology Data Exchange (ETDEWEB)

    Powers, D.W. [Powers (Dennis W.), Anthony, TX (United States); Martin, M.L. [International Technology, Inc., Las Vegas, NV (United States)

    1993-08-01

    This select bibliography contains 941 entries. Each bibliographic entry contains the citation of a report, conference paper, or journal article containing geotechnical information about the Waste Isolation Pilot Plant (WIPP). The entries cover the period from 1972, when investigation began for a WIPP Site in southeastern New Mexico, through December 1990. Each entry is followed by an abstract. If an abstract or suitable summary existed, it has been included; 316 abstracts were written for other documents. For some entries, an annotation has been provided to clarify the abstract, comment on the setting and significance of the document, or guide the reader to related reports. An index of key words/phrases is included for all entries.

  12. A select bibliography with abstracts of reports related to Waste Isolation Pilot Plant geotechnical studies (1972--1990)

    International Nuclear Information System (INIS)

    Powers, D.W.; Martin, M.L.

    1993-08-01

    This select bibliography contains 941 entries. Each bibliographic entry contains the citation of a report, conference paper, or journal article containing geotechnical information about the Waste Isolation Pilot Plant (WIPP). The entries cover the period from 1972, when investigation began for a WIPP Site in southeastern New Mexico, through December 1990. Each entry is followed by an abstract. If an abstract or suitable summary existed, it has been included; 316 abstracts were written for other documents. For some entries, an annotation has been provided to clarify the abstract, comment on the setting and significance of the document, or guide the reader to related reports. An index of key words/phrases is included for all entries

  13. Environmental Pollution, A Selective Bibliography.

    Science.gov (United States)

    Clearinghouse for Federal Scientific and Technical Information, Springfield, VA.

    This bibliography on environmental pollution is comprised primarily of reports of federally sponsored research by such departments and agencies as HEW, Interior, AEC, NASA, Defense, Transportation, and others. The reports were selected from Clearinghouse announcement journals during the period 1968 through April 1970. The bibliography contains…

  14. Community emergency response to nuclear power plant accidents: A selected and partially annotated bibliography

    International Nuclear Information System (INIS)

    Youngen, G.

    1988-10-01

    The role of responding to emergencies at nuclear power plants is often considered the responsibility of the personnel onsite. This is true for most, if not all, of the incidents that may happen during the course of the plant's operating lifetime. There is however, the possibility of a major accident occurring at anytime. Major nuclear accidents at Chernobyl and Three Mile Island have taught their respective countries and communities a significant lesson in local emergency preparedness and response. Through these accidents, the rest of the world can also learn a great deal about planning, preparing and responding to the emergencies unique to nuclear power. This bibliography contains books, journal articles, conference papers and government reports on emergency response to nuclear power plant accidents. It does not contain citations for ''onsite'' response or planning, nor does it cover the areas of radiation releases from transportation accidents. The compiler has attempted to bring together a sampling of the world's collective written experience on dealing with nuclear reactor accidents on the sate, local and community levels. Since the accidents at Three Mile Island and Chernobyl, that written experience has grown enormously

  15. Community emergency response to nuclear power plant accidents: A selected and partially annotated bibliography

    Energy Technology Data Exchange (ETDEWEB)

    Youngen, G.

    1988-10-01

    The role of responding to emergencies at nuclear power plants is often considered the responsibility of the personnel onsite. This is true for most, if not all, of the incidents that may happen during the course of the plant`s operating lifetime. There is however, the possibility of a major accident occurring at anytime. Major nuclear accidents at Chernobyl and Three Mile Island have taught their respective countries and communities a significant lesson in local emergency preparedness and response. Through these accidents, the rest of the world can also learn a great deal about planning, preparing and responding to the emergencies unique to nuclear power. This bibliography contains books, journal articles, conference papers and government reports on emergency response to nuclear power plant accidents. It does not contain citations for ``onsite`` response or planning, nor does it cover the areas of radiation releases from transportation accidents. The compiler has attempted to bring together a sampling of the world`s collective written experience on dealing with nuclear reactor accidents on the sate, local and community levels. Since the accidents at Three Mile Island and Chernobyl, that written experience has grown enormously.

  16. Vitrification publication bibliography

    Energy Technology Data Exchange (ETDEWEB)

    Schmieman, E.; Johns, W.E.

    1996-02-01

    This document was compiled by a group of about 12 graduate students in the Department of Mechanical Engineering and Material Science at Washington State University and was funded by the U.S. Department of Energy. The literature search resulting in the compilation of this bibliography was designed to be an exhaustive search for research and development work involving the vitrification of mixed wastes, published by domestic and foreign researchers, primarily during 1989-1994. The search techniques were dominated by electronic methods and this bibliography is also available in electronic format, Windows Reference Manager.

  17. Vitrification publication bibliography

    International Nuclear Information System (INIS)

    Schmieman, E.; Johns, W.E.

    1996-02-01

    This document was compiled by a group of about 12 graduate students in the Department of Mechanical Engineering and Material Science at Washington State University and was funded by the U.S. Department of Energy. The literature search resulting in the compilation of this bibliography was designed to be an exhaustive search for research and development work involving the vitrification of mixed wastes, published by domestic and foreign researchers, primarily during 1989-1994. The search techniques were dominated by electronic methods and this bibliography is also available in electronic format, Windows Reference Manager

  18. Diversified Cooperative Training. A Bibliography.

    Science.gov (United States)

    Florida State Univ., Tallahassee. Center for Instructional Development and Services.

    This bibliography describes 52 materials available for use in cooperative education classes and career and guidance counseling. The materials include books, pamphlets, and brochures, films, curriculum guides, study guides, and workbooks. A few are suited for use with special needs students. Materials for inclusion in the bibliography were located…

  19. The Hospice: An Integrated Bibliography.

    Science.gov (United States)

    Bodine, George E.; Sobotor, William

    This extensive bibliography of books and articles provides an interdisciplinary overview of present day terminal care and the hospice alternative. Designed to aid in the development and implementation of terminal care programs stressing palliative and supportive services for both patients and their families, the bibliography includes abstracts of…

  20. Decontamination of metals by melt refining/slagging. An annotated bibliography: Update on stainless steel and steel

    Energy Technology Data Exchange (ETDEWEB)

    Worchester, S.A.; Twidwell, L.G.; Paolini, D.J.; Weldon, T.A. [Montana Tech of the Univ., of Montana (United States); Mizia, R.E. [Lockheed Idaho Technologies Co., Idaho Falls, ID (United States)

    1995-01-01

    The following presentation is an update to a previous annotation, i.e., WINCO-1138. The literature search and annotated review covers all metals used in the nuclear industries but the emphasis of this update is directed toward work performed on mild steels. As the number of nuclear installations undergoing decontamination and decommissioning (D&D) increases, current radioactive waste storage space is consumed and establishment of new waste storage areas becomes increasingly difficult, the problem of handling and storing radioactive scrap metal (RSM) gains increasing importance in the DOE Environmental Restoration and Waste Management Program. To alleviate present and future waste problems, Lockheed Idaho Technologies Co (LITCO) is managing a program for the recycling of RSM for beneficial use within the DOE complex. As part of that effort, Montana Tech has been awarded a contract to help optimize melting and refining technology for the recycling of stainless steel RSM. The scope of the Montana Tech program includes a literature survey, a decontaminating slag design study, small wide melting studies to determine optimum slag compositions for removal of radioactive contaminant surrogates, analysis of preferred melting techniques, and coordination of large scale melting demonstrations (100--2,000 lbs) to be conducted at selected facilities. The program will support recycling and decontaminating stainless steel RSM for use in waste canisters for Idaho Waste Immobilization Facility densified high level waste and Pit 9/RWMC boxes. This report is the result of the literature search conducted to establish a basis for experimental melt/slag program development. The program plan will be jointly developed by Montana Tech and LITCO.

  1. Instructional Media: Comunication Skills. Advisory List.

    Science.gov (United States)

    North Carolina State Dept. of Public Instruction, Raleigh. Media and Technology Services.

    This annotated bibliography of instructional media in communication skills presents annotations of 112 books and videotapes for students in grades from pre-kindergarten through grade 12, and of 38 books and videos for teachers. The material in the bibliography for students consists mostly of poetry collections published in 1990 and 1991. The…

  2. Significant U.S. 20th Century Education Books: Biblio-Historical Essay.

    Science.gov (United States)

    Parker, Franklin

    Presented in historical context, the books listed in this annotated bibliography offer insights into professional education concerns and can help teachers know about the great ideas and themes of their field, and what the best and most provocative books are today. The bibliography begins with books that list and annotate topically selected best…

  3. MixtureTree annotator: a program for automatic colorization and visual annotation of MixtureTree.

    Directory of Open Access Journals (Sweden)

    Shu-Chuan Chen

    Full Text Available The MixtureTree Annotator, written in JAVA, allows the user to automatically color any phylogenetic tree in Newick format generated from any phylogeny reconstruction program and output the Nexus file. By providing the ability to automatically color the tree by sequence name, the MixtureTree Annotator provides a unique advantage over any other programs which perform a similar function. In addition, the MixtureTree Annotator is the only package that can efficiently annotate the output produced by MixtureTree with mutation information and coalescent time information. In order to visualize the resulting output file, a modified version of FigTree is used. Certain popular methods, which lack good built-in visualization tools, for example, MEGA, Mesquite, PHY-FI, TreeView, treeGraph and Geneious, may give results with human errors due to either manually adding colors to each node or with other limitations, for example only using color based on a number, such as branch length, or by taxonomy. In addition to allowing the user to automatically color any given Newick tree by sequence name, the MixtureTree Annotator is the only method that allows the user to automatically annotate the resulting tree created by the MixtureTree program. The MixtureTree Annotator is fast and easy-to-use, while still allowing the user full control over the coloring and annotating process.

  4. Pulsed Power Bibliography. Volume 2. Annotated Bibliography.

    Science.gov (United States)

    1983-08-01

    5-ten In doscrIed for erodocino recaglrple pt I La. dleniainna Late. In MMns s I g’,k Atit~ betl eon. I ai I0 ncCaimlce Iuse changed5 o C1-F.T:11!T...Pulsod Poiir Conference Proceedings. Piper o11-1 (1119761. Prialry ilt IEEE.: EPrFESI PEBanks o e n This reoor describes e procedure for designing

  5. Retrieval-based Face Annotation by Weak Label Regularized Local Coordinate Coding.

    Science.gov (United States)

    Wang, Dayong; Hoi, Steven C H; He, Ying; Zhu, Jianke; Mei, Tao; Luo, Jiebo

    2013-08-02

    Retrieval-based face annotation is a promising paradigm of mining massive web facial images for automated face annotation. This paper addresses a critical problem of such paradigm, i.e., how to effectively perform annotation by exploiting the similar facial images and their weak labels which are often noisy and incomplete. In particular, we propose an effective Weak Label Regularized Local Coordinate Coding (WLRLCC) technique, which exploits the principle of local coordinate coding in learning sparse features, and employs the idea of graph-based weak label regularization to enhance the weak labels of the similar facial images. We present an efficient optimization algorithm to solve the WLRLCC task. We conduct extensive empirical studies on two large-scale web facial image databases: (i) a Western celebrity database with a total of $6,025$ persons and $714,454$ web facial images, and (ii)an Asian celebrity database with $1,200$ persons and $126,070$ web facial images. The encouraging results validate the efficacy of the proposed WLRLCC algorithm. To further improve the efficiency and scalability, we also propose a PCA-based approximation scheme and an offline approximation scheme (AWLRLCC), which generally maintains comparable results but significantly saves much time cost. Finally, we show that WLRLCC can also tackle two existing face annotation tasks with promising performance.

  6. Evaluating Hierarchical Structure in Music Annotations.

    Science.gov (United States)

    McFee, Brian; Nieto, Oriol; Farbood, Morwaread M; Bello, Juan Pablo

    2017-01-01

    Music exhibits structure at multiple scales, ranging from motifs to large-scale functional components. When inferring the structure of a piece, different listeners may attend to different temporal scales, which can result in disagreements when they describe the same piece. In the field of music informatics research (MIR), it is common to use corpora annotated with structural boundaries at different levels. By quantifying disagreements between multiple annotators, previous research has yielded several insights relevant to the study of music cognition. First, annotators tend to agree when structural boundaries are ambiguous. Second, this ambiguity seems to depend on musical features, time scale, and genre. Furthermore, it is possible to tune current annotation evaluation metrics to better align with these perceptual differences. However, previous work has not directly analyzed the effects of hierarchical structure because the existing methods for comparing structural annotations are designed for "flat" descriptions, and do not readily generalize to hierarchical annotations. In this paper, we extend and generalize previous work on the evaluation of hierarchical descriptions of musical structure. We derive an evaluation metric which can compare hierarchical annotations holistically across multiple levels. sing this metric, we investigate inter-annotator agreement on the multilevel annotations of two different music corpora, investigate the influence of acoustic properties on hierarchical annotations, and evaluate existing hierarchical segmentation algorithms against the distribution of inter-annotator agreement.

  7. Evaluating Hierarchical Structure in Music Annotations

    Directory of Open Access Journals (Sweden)

    Brian McFee

    2017-08-01

    Full Text Available Music exhibits structure at multiple scales, ranging from motifs to large-scale functional components. When inferring the structure of a piece, different listeners may attend to different temporal scales, which can result in disagreements when they describe the same piece. In the field of music informatics research (MIR, it is common to use corpora annotated with structural boundaries at different levels. By quantifying disagreements between multiple annotators, previous research has yielded several insights relevant to the study of music cognition. First, annotators tend to agree when structural boundaries are ambiguous. Second, this ambiguity seems to depend on musical features, time scale, and genre. Furthermore, it is possible to tune current annotation evaluation metrics to better align with these perceptual differences. However, previous work has not directly analyzed the effects of hierarchical structure because the existing methods for comparing structural annotations are designed for “flat” descriptions, and do not readily generalize to hierarchical annotations. In this paper, we extend and generalize previous work on the evaluation of hierarchical descriptions of musical structure. We derive an evaluation metric which can compare hierarchical annotations holistically across multiple levels. sing this metric, we investigate inter-annotator agreement on the multilevel annotations of two different music corpora, investigate the influence of acoustic properties on hierarchical annotations, and evaluate existing hierarchical segmentation algorithms against the distribution of inter-annotator agreement.

  8. Soil-characterization and soil-amendment use on coal surface mine lands: An annotated bibliography. Information Circular/1991

    International Nuclear Information System (INIS)

    Norland, M.R.; Veith, D.L.

    1991-01-01

    The U.S. Bureau of Mines Report on United States and Canadian Literature pertaining to soil characterization and the use of soil amendments as a part of the reclamation process of coal surface-mined lands contains 1,280 references. The references were published during the 1977 to 1988 period. Each reference is evaluated by keywords, providing the reader with a means of rapidly sorting through the references to locate those articles with the coal mining regions and subjects of interest. All references are annotated

  9. Bibliography for thermal neutron scattering

    International Nuclear Information System (INIS)

    Sakamoto, Masanobu; Chihara, Junzo; Gotoh, Yorio; Kadotani, Hiroyuki; Sekiya, Tamotsu.

    1979-09-01

    Bibliographic references are given for measurements, calculations, reviews and basic studies of thermal neutron scattering and dynamical properties of condensed matter. This is the sixth edition covering 3,326 articles collected up to 1978. The edition being the final issue of the present bibliography series, a forthcoming edition will be published in a new form of bibliography. (author)

  10. Pipeline to upgrade the genome annotations

    Directory of Open Access Journals (Sweden)

    Lijin K. Gopi

    2017-12-01

    Full Text Available Current era of functional genomics is enriched with good quality draft genomes and annotations for many thousands of species and varieties with the support of the advancements in the next generation sequencing technologies (NGS. Around 25,250 genomes, of the organisms from various kingdoms, are submitted in the NCBI genome resource till date. Each of these genomes was annotated using various tools and knowledge-bases that were available during the period of the annotation. It is obvious that these annotations will be improved if the same genome is annotated using improved tools and knowledge-bases. Here we present a new genome annotation pipeline, strengthened with various tools and knowledge-bases that are capable of producing better quality annotations from the consensus of the predictions from different tools. This resource also perform various additional annotations, apart from the usual gene predictions and functional annotations, which involve SSRs, novel repeats, paralogs, proteins with transmembrane helices, signal peptides etc. This new annotation resource is trained to evaluate and integrate all the predictions together to resolve the overlaps and ambiguities of the boundaries. One of the important highlights of this resource is the capability of predicting the phylogenetic relations of the repeats using the evolutionary trace analysis and orthologous gene clusters. We also present a case study, of the pipeline, in which we upgrade the genome annotation of Nelumbo nucifera (sacred lotus. It is demonstrated that this resource is capable of producing an improved annotation for a better understanding of the biology of various organisms.

  11. Community annotation and bioinformatics workforce development in concert--Little Skate Genome Annotation Workshops and Jamborees.

    Science.gov (United States)

    Wang, Qinghua; Arighi, Cecilia N; King, Benjamin L; Polson, Shawn W; Vincent, James; Chen, Chuming; Huang, Hongzhan; Kingham, Brewster F; Page, Shallee T; Rendino, Marc Farnum; Thomas, William Kelley; Udwary, Daniel W; Wu, Cathy H

    2012-01-01

    Recent advances in high-throughput DNA sequencing technologies have equipped biologists with a powerful new set of tools for advancing research goals. The resulting flood of sequence data has made it critically important to train the next generation of scientists to handle the inherent bioinformatic challenges. The North East Bioinformatics Collaborative (NEBC) is undertaking the genome sequencing and annotation of the little skate (Leucoraja erinacea) to promote advancement of bioinformatics infrastructure in our region, with an emphasis on practical education to create a critical mass of informatically savvy life scientists. In support of the Little Skate Genome Project, the NEBC members have developed several annotation workshops and jamborees to provide training in genome sequencing, annotation and analysis. Acting as a nexus for both curation activities and dissemination of project data, a project web portal, SkateBase (http://skatebase.org) has been developed. As a case study to illustrate effective coupling of community annotation with workforce development, we report the results of the Mitochondrial Genome Annotation Jamborees organized to annotate the first completely assembled element of the Little Skate Genome Project, as a culminating experience for participants from our three prior annotation workshops. We are applying the physical/virtual infrastructure and lessons learned from these activities to enhance and streamline the genome annotation workflow, as we look toward our continuing efforts for larger-scale functional and structural community annotation of the L. erinacea genome.

  12. Community annotation and bioinformatics workforce development in concert—Little Skate Genome Annotation Workshops and Jamborees

    Science.gov (United States)

    Wang, Qinghua; Arighi, Cecilia N.; King, Benjamin L.; Polson, Shawn W.; Vincent, James; Chen, Chuming; Huang, Hongzhan; Kingham, Brewster F.; Page, Shallee T.; Farnum Rendino, Marc; Thomas, William Kelley; Udwary, Daniel W.; Wu, Cathy H.

    2012-01-01

    Recent advances in high-throughput DNA sequencing technologies have equipped biologists with a powerful new set of tools for advancing research goals. The resulting flood of sequence data has made it critically important to train the next generation of scientists to handle the inherent bioinformatic challenges. The North East Bioinformatics Collaborative (NEBC) is undertaking the genome sequencing and annotation of the little skate (Leucoraja erinacea) to promote advancement of bioinformatics infrastructure in our region, with an emphasis on practical education to create a critical mass of informatically savvy life scientists. In support of the Little Skate Genome Project, the NEBC members have developed several annotation workshops and jamborees to provide training in genome sequencing, annotation and analysis. Acting as a nexus for both curation activities and dissemination of project data, a project web portal, SkateBase (http://skatebase.org) has been developed. As a case study to illustrate effective coupling of community annotation with workforce development, we report the results of the Mitochondrial Genome Annotation Jamborees organized to annotate the first completely assembled element of the Little Skate Genome Project, as a culminating experience for participants from our three prior annotation workshops. We are applying the physical/virtual infrastructure and lessons learned from these activities to enhance and streamline the genome annotation workflow, as we look toward our continuing efforts for larger-scale functional and structural community annotation of the L. erinacea genome. PMID:22434832

  13. Energy transition. Selective bibliography

    International Nuclear Information System (INIS)

    2015-10-01

    At the occasion of the promulgation on August 17, 2015 of law no. 2015-992 relative to energy transition, this bibliography reviews the legal, economical and political aspects of the recent evolutions in the energy domain. Basic and synthetic documents are listed first. Then follow documents dealing with: general data, energy models, sustainable agriculture, green technologies, energy conservation, waste processing, renewable energy sources, sustainable cities and buildings. The bibliography ends with a selection of relevant web sites

  14. Reasoning with Annotations of Texts

    OpenAIRE

    Ma , Yue; Lévy , François; Ghimire , Sudeep

    2011-01-01

    International audience; Linguistic and semantic annotations are important features for text-based applications. However, achieving and maintaining a good quality of a set of annotations is known to be a complex task. Many ad hoc approaches have been developed to produce various types of annotations, while comparing those annotations to improve their quality is still rare. In this paper, we propose a framework in which both linguistic and domain information can cooperate to reason with annotat...

  15. ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available chizosaccharomyces pombe] ref|NP_594201.1| spindle poison ... sensitivity related protein. [Schizosac...charomyces pombe] ... pir||T11624 spindle poison sensitivity protein - fis...inger protein | spindle poison sensitivity related protein; >1rgoA 8 70 40 92 2e-04 ... emb|CAB16391.1| scp3 [S... Ca19AnnotatedDec2004aaSeq orf19.7385; Contig19-2513; 105328..106833; LEE1*; zinc f

  16. Geopressured geothermal bibliography. Volume 1 (citation extracts)

    Energy Technology Data Exchange (ETDEWEB)

    Hill, T.R.; Sepehrnoori, K.

    1981-08-01

    This bibliography was compiled by the Center for Energy Studies at The University of Texas at Austin to serve as a tool for researchers in the field of geopressured geothermal energy resources. The bibliography represents citations of papers on geopressured geothermal energy resources over the past eighteen years. Topics covered in the bibliography range from the technical aspects of geopressured geothermal reservoirs to social, environmental, and legal aspects of tapping those reservoirs for their energy resources. The bibliography currently contains more than 750 entries. For quick reference to a given topic, the citations are indexed into five divisions: author, category, conference title, descriptor, and sponsor. These indexes are arranged alphabetically and cross-referenced by page number.

  17. Asbestos bibliography

    Energy Technology Data Exchange (ETDEWEB)

    Jentschke, M

    1982-01-01

    The publication of this special bibliography meets the desire for information on the problem of asbestos from the viewpoint of safety at work. It was compiled from the information stored at the Central Institute for Safety at work in Dresden, the Central Institute of Occupational Medicine in Berlin, the Authority for Safety at Work with the Ministry of Building in Berlin and the Medical Service of the Transport Business in Berlin, as well as with specialists from the institutions mentioned and of the authority for Safety at work, occupational hygiene and toxicology in the chemical industry of Halle and the inspector of occupational hygiene of the council of the district of Schwerin. The bibliography is a selection of the information sources available at the above-mentioned institutions. It makes no claim to completeness.

  18. Semantic annotation of consumer health questions.

    Science.gov (United States)

    Kilicoglu, Halil; Ben Abacha, Asma; Mrabet, Yassine; Shooshan, Sonya E; Rodriguez, Laritza; Masterton, Kate; Demner-Fushman, Dina

    2018-02-06

    Consumers increasingly use online resources for their health information needs. While current search engines can address these needs to some extent, they generally do not take into account that most health information needs are complex and can only fully be expressed in natural language. Consumer health question answering (QA) systems aim to fill this gap. A major challenge in developing consumer health QA systems is extracting relevant semantic content from the natural language questions (question understanding). To develop effective question understanding tools, question corpora semantically annotated for relevant question elements are needed. In this paper, we present a two-part consumer health question corpus annotated with several semantic categories: named entities, question triggers/types, question frames, and question topic. The first part (CHQA-email) consists of relatively long email requests received by the U.S. National Library of Medicine (NLM) customer service, while the second part (CHQA-web) consists of shorter questions posed to MedlinePlus search engine as queries. Each question has been annotated by two annotators. The annotation methodology is largely the same between the two parts of the corpus; however, we also explain and justify the differences between them. Additionally, we provide information about corpus characteristics, inter-annotator agreement, and our attempts to measure annotation confidence in the absence of adjudication of annotations. The resulting corpus consists of 2614 questions (CHQA-email: 1740, CHQA-web: 874). Problems are the most frequent named entities, while treatment and general information questions are the most common question types. Inter-annotator agreement was generally modest: question types and topics yielded highest agreement, while the agreement for more complex frame annotations was lower. Agreement in CHQA-web was consistently higher than that in CHQA-email. Pairwise inter-annotator agreement proved most

  19. Predicting word sense annotation agreement

    DEFF Research Database (Denmark)

    Martinez Alonso, Hector; Johannsen, Anders Trærup; Lopez de Lacalle, Oier

    2015-01-01

    High agreement is a common objective when annotating data for word senses. However, a number of factors make perfect agreement impossible, e.g. the limitations of the sense inventories, the difficulty of the examples or the interpretation preferences of the annotations. Estimating potential...... agreement is thus a relevant task to supplement the evaluation of sense annotations. In this article we propose two methods to predict agreement on word-annotation instances. We experiment with a continuous representation and a three-way discretization of observed agreement. In spite of the difficulty...

  20. Home and Family Management. A Bibliography.

    Science.gov (United States)

    Florida State Univ., Tallahassee. Center for Instructional Development and Services.

    This bibliography describes 133 materials available for use in home economics classes. The materials include books, pamphlets and brochures, films curriculum guides, study guides, and workbooks. A few are suited for use with special needs students. Materials for inclusion in the bibliography were located through the Florida Educational Information…