14 CFR 250.6 - Exceptions to eligibility for denied boarding compensation.
2010-01-01
... boarding compensation. 250.6 Section 250.6 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF... boarding compensation. A passenger denied boarding involuntarily from an oversold flight shall not be eligible for denied boarding compensation if: (a) The passenger does not comply fully with the carrier's...
1985-09-01
Bermuda's population characteristics, history, government, political situation, economy, and foreign relations were briefly described. Bermuda, a parliamentary British colony, is situated on a group of island in the Atlantic Ocean, about 650 miles east of North Carolina. Bermuda was discovered by the Spaniards in 1503; however, it was the British who founded the 1st settlement on the islands in 1612. The current population size is 56,652, and the annual rate of growth is 0.3%. About 2/3 of the population is of African descent, and the remaining inhabitants are of British, American, Portuguese, or Caribbean descent. The literacy rate is 98%, and school enrollment is universal and compulsory for 12 years. The infant mortality rate is 7.1/1000 live births and life expectancy is 69 years for men and 76 years for women. Although Bermuda is a British colony, it was granted considerable internal autonomy in 1968. A governor, appointed by the British Crown, is in charge of external affairs, defense, and the country's internal security. Under the constitution, adopted in 1968, the internal affairs of the country are conducted by an elected bicameral legislative body and a premier who represents the majority party in the lower legislative house. The current premier is John W. D. Swan of the United Bermuda Party (UBP). The UBP is supported mainly by the white minority and by a few blacks. The Progressive Labor Party (PLP) is supported primarily by the black majority. The UBP has retained power since it was established in 1965, but at each election, its winning margin decreased. Although there is universal suffrage, only a small proportion of the public participates in elections. Despite the fact that the governor was assassinated in 1972 and there was civil unrest in 1977, the country is politically stable. This political stability is due in part to the government's efforts since the 1950s to promote racial equality, to the government's willingness to recognize labors' right
45 CFR 2506.11 - Will the Corporation refer debts to the Department of Justice?
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Will the Corporation refer debts to the Department of Justice? 2506.11 Section 2506.11 Public Welfare Regulations Relating to Public Welfare (Continued... Corporation refer debts to the Department of Justice? The Corporation will refer to DOJ for litigation debts...
Bermuda 3 arc-second Coastal Digital Elevation Model
National Oceanic and Atmospheric Administration, Department of Commerce — The 3 arc-second Bermuda DEM will be used to support NOAA's tsunami forecast system and for tsunami inundation modeling. This DEM encompasses the islands of Bermuda...
Bermuda 1 arc-second Coastal Digital Elevation Model
National Oceanic and Atmospheric Administration, Department of Commerce — The 1 arc-second Bermuda DEM will be used to support NOAA's tsunami forecast system and for tsunami inundation modeling. This DEM encompasses the islands of Bermuda...
45 CFR 2506.32 - What are the Corporation's procedures for salary offset?
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false What are the Corporation's procedures for salary...) CORPORATION FOR NATIONAL AND COMMUNITY SERVICE COLLECTION OF DEBTS Salary Offset § 2506.32 What are the Corporation's procedures for salary offset? (a) The Corporation will coordinate salary deductions under this...
Vernon Bermuda Workshop: A Course in Sub-tropical Island Ecology
Werdell, P. Jeremy
2012-01-01
More than 30 years ago, educators in central Connecticut developed the Vernon Bermuda Workshop as a means of introducing middle- and high-school students to subtropical island ecology. Each year, after months of classroom preparation, approximately 20 top students spend one week at the Bermuda Institute of Ocean Sciences (St. George's, Bermuda) studying the local flora and fauna in both the field and laboratory. The curriculum includes an additional array of activities, ranging from historical and ecological tours to spelunking, and culminates in a series of field-observation-related presentations. I am responsible for the meteorological and oceanographic components of the curriculum. In the field, my students collect time-series of biophysical variables over the course of a day, which they use to interpret diurnal patterns and interactions amongst the variables. I also add remote-sensing and phytoplankton biology components to the curriculum - in previous years, my students have studied time-series of Sea WIFS imagery collected at Bermuda during our trip. I have been an Instructor for this Workshop since 2003. The Workshop provides an outreach activity for GSFC Code 616.
45 CFR 2506.33 - How will the Corporation coordinate salary offsets with other agencies?
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false How will the Corporation coordinate salary offsets... (Continued) CORPORATION FOR NATIONAL AND COMMUNITY SERVICE COLLECTION OF DEBTS Salary Offset § 2506.33 How will the Corporation coordinate salary offsets with other agencies? (a) Responsibilities of the...
Bermuda Tsunami Forecast Grids for MOST Model
National Oceanic and Atmospheric Administration, Department of Commerce — The Bermuda Forecast Model Grids provides bathymetric data strictly for tsunami inundation modeling with the Method of Splitting Tsunami (MOST) model. MOST is a...
Ocean time-series near Bermuda: Hydrostation S and the US JGOFS Bermuda Atlantic time-series study
Michaels, Anthony F.; Knap, Anthony H.
1992-01-01
Bermuda is the site of two ocean time-series programs. At Hydrostation S, the ongoing biweekly profiles of temperature, salinity and oxygen now span 37 years. This is one of the longest open-ocean time-series data sets and provides a view of decadal scale variability in ocean processes. In 1988, the U.S. JGOFS Bermuda Atlantic Time-series Study began a wide range of measurements at a frequency of 14-18 cruises each year to understand temporal variability in ocean biogeochemistry. On each cruise, the data range from chemical analyses of discrete water samples to data from electronic packages of hydrographic and optics sensors. In addition, a range of biological and geochemical rate measurements are conducted that integrate over time-periods of minutes to days. This sampling strategy yields a reasonable resolution of the major seasonal patterns and of decadal scale variability. The Sargasso Sea also has a variety of episodic production events on scales of days to weeks and these are only poorly resolved. In addition, there is a substantial amount of mesoscale variability in this region and some of the perceived temporal patterns are caused by the intersection of the biweekly sampling with the natural spatial variability. In the Bermuda time-series programs, we have added a series of additional cruises to begin to assess these other sources of variation and their impacts on the interpretation of the main time-series record. However, the adequate resolution of higher frequency temporal patterns will probably require the introduction of new sampling strategies and some emerging technologies such as biogeochemical moorings and autonomous underwater vehicles.
Bermuda as an evolutionary life raft for an ancient lineage of endangered lizards.
Directory of Open Access Journals (Sweden)
Matthew C Brandley
Full Text Available Oceanic islands are well known for harboring diverse species assemblages and are frequently the basis of research on adaptive radiation and neoendemism. However, a commonly overlooked role of some islands is their function in preserving ancient lineages that have become extinct everywhere else (paleoendemism. The island archipelago of Bermuda is home to a single species of extant terrestrial vertebrate, the endemic skink Plestiodon (formerly Eumeces longirostris. The presence of this species is surprising because Bermuda is an isolated, relatively young oceanic island approximately 1000 km from the eastern United States. Here, we apply Bayesian phylogenetic analyses using a relaxed molecular clock to demonstrate that the island of Bermuda, although no older than two million years, is home to the only extant representative of one of the earliest mainland North American Plestiodon lineages, which diverged from its closest living relatives 11.5 to 19.8 million years ago. This implies that, within a short geological time frame, mainland North American ancestors of P. longirostris colonized the recently emergent Bermuda and the entire lineage subsequently vanished from the mainland. Thus, our analyses reveal that Bermuda is an example of a "life raft" preserving millions of years of unique evolutionary history, now at the brink of extinction. Threats such as habitat destruction, littering, and non-native species have severely reduced the population size of this highly endangered lizard.
Naise võim Bermudas : kubjas kukutati / Allan Espenberg
Espenberg, Allan
2003-01-01
Suurbritanniale kuuluva Bermuda saare parlamendivalimised vallandasid sündmuste ahela, mis võivad muuta asumaa poliitikat. Ametist tagandati peaminister Jennifer Meredith Smith ja uueks peaministriks sai senine tööminister William Alexander Scott
Molecular characterization of vancomycin-resistant Enterococcus faecium isolates from Bermuda.
Directory of Open Access Journals (Sweden)
Patrick Eberechi Akpaka
Full Text Available Molecular characteristics of vancomycin resistant enterococci isolates from Bermuda Island is currently unknown. This study was conducted to investigate phenotypic and genotypic characteristics of VRE isolates from Bermuda Island using the chromogenic agar, E-tests, polymerase chain reaction (PCR, pulsed-field gel electrophoresis (PFGE and multilocus sequence typing (MLST. Eighteen E. faecium isolates were completely analyzed and were all resistant to vancomycin, susceptible to linezolid and quinupristin/dalfopristin, positive for vanA and esp genes. The MLST analysis confirmed most isolates were of the sequence types linked to clonal complex 17 (CC17 that is widely associated with outbreaks in hospitals. Infection control measures, antibiotic stewardship, and surveillance activities will continue to be a priority in hospital on the Island.
Evaluation of molecular basis of cross reactivity between rye and Bermuda grass pollen allergens.
Tiwari, Ruby; Bhalla, Prem L; Singh, Mohan B
2009-12-01
Allergenic cross reactivity between the members of the Pooids (Lolium perenne, Phleum pratense, and Poa pratensis) and Chloridoids (Cynodon dactylon and Paspalum notatum) is well established. Studies using crude extracts in the past have demonstrated limited cross reactivity between the Pooids and the Chloridoids suggesting separate diagnosis and therapy. However, little is known regarding the molecular basis for the limited cross reactivity observed between the 2 groups of grasses. The present study was undertaken to gain insights into the molecular basis of cross allergenicity between the major allergens from rye and Bermuda grass pollens. Immunoblot inhibition tests were carried out to determine the specificity of the proteins involved in cross reactivity. Crude pollen extract and bacterially expressed and purified recombinant Lol p 1and Lol p 5 from rye grass were subjected to cross inhibition experiments with crude and purified recombinant Cyn d 1 from Bermuda grass using sera from patients allergic to rye grass pollen. The immunoblot inhibition studies revealed a high degree of cross inhibition between the group 1 allergens. In contrast, a complete lack of inhibition was observed between Bermuda grass group 1 allergen rCyn d 1, and rye grass group 5 allergen rLol p 5. Crude rye grass extract strongly inhibited IgE reactivity to Bermuda grass, whereas crude Bermuda grass pollen extract showed a weaker inhibition. Our data suggests that a possible explanation for the limited cross reactivity between the Pooids and Chloridoids may, in part, be due to the absence of group 5 allergen from Chloridoid grasses. This approach of using purified proteins may be applied to better characterize the cross allergenicity patterns between different grass pollen allergens.
Genetic ancestry and indigenous heritage in a Native American descendant community in Bermuda.
Gaieski, Jill B; Owings, Amanda C; Vilar, Miguel G; Dulik, Matthew C; Gaieski, David F; Gittelman, Rachel M; Lindo, John; Gau, Lydia; Schurr, Theodore G
2011-11-01
Discovered in the early 16th century by European colonists, Bermuda is an isolated set of islands located in the mid-Atlantic. Shortly after its discovery, Bermuda became the first English colony to forcibly import its labor by trafficking in enslaved Africans, white ethnic minorities, and indigenous Americans. Oral traditions circulating today among contemporary tribes from the northeastern United States recount these same events, while, in Bermuda, St. David's Islanders consider their histories to be linked to a complex Native American, European, and African past. To investigate the influence of historical events on biological ancestry and native cultural identity, we analyzed genetic variation in 111 members of Bermuda's self-proclaimed St. David's Island Native Community. Our results reveal that the majority of mitochondrial DNA (mtDNA) and Y-chromosome haplotypes are of African and West Eurasian origin. However, unlike other English-speaking New World colonies, most African mtDNA haplotypes appear to derive from central and southeast Africa, reflecting the extent of maritime activities in the region. In light of genealogical and oral historical data from the St. David's community, the low frequency of Native American mtDNA and NRY lineages may reflect the influence of genetic drift, the demographic impact of European colonization, and historical admixture with persons of non-native backgrounds, which began with the settlement of the islands. By comparing the genetic data with genealogical and historical information, we are able to reconstruct the complex history of this Bermudian community, which is unique among New World populations. Copyright © 2011 Wiley-Liss, Inc.
Origin of Bermuda's clay-rich Quaternary paleosols and their paleoclimatic significance
Herwitz, S.R.; Muhs, D.R.; Prospero, J.M.; Mahan, S.; Vaughn, B.
1996-01-01
Red clayey paleosols that are chiefly the product of aerosolic dust deposition are interbedded in the Quaternary carbonate formations of the Bermuda oceanic island system. These paleosols provide a basis for reconstructing Quaternary atmospheric circulation patterns in the northwestern Atlantic. Geochemical analyses were performed on representative paleosol samples to identify their parent dust source. Fine-grained fractions were analyzed by energy-dispersive X ray fluorescence to determine trace element (Zr, Y, La, Ti, and Nb) concentrations and to derive geochemical signatures based on immobile element ratios. These ratios were compared with geochemical signatures determined for three possible sources of airborne dust: (1) Great Plains loess, (2) Mississippi River Valley loess, and (3) Saharan dust. The Zr/Y and Zr/La ratios provided the clearest distinction between the hypothesized dust sources. The low ratios in the paleosol B horizons most closely resemble Saharan dust in the the two North American loessial source areas could not be clearly detected. Thus Bermuda paleosols have a predominantly Saharan aerosolic dust signature. Saharan dust deposition on Bermuda during successive Quaternary glacial periods is consistent with patterns of general circulation models, which indicate that during glacial maxima the northeast summer trade winds were stronger than at present and reached latitudes higher than 30 ?? N despite lower-than-present sea surface temperatures in the North Atlantic.
How to Submit a Risk Management Plan (RMP) to EPA
RMP*eSubmit software is the only way to submit RMPs. After you have prepared your plan using RMP*eSubmit, you may also re-submit, correct, or withdraw an RMP. Another electronic tool, RMP*Comp, performs the required off-site consequence analysis.
Bermuda Deep Water Caves 2011: Dives of Discovery between 20110607 and 20110627
National Oceanic and Atmospheric Administration, Department of Commerce — During the three week NOAA Ocean Exploration project, Bermuda Deep Water Caves 2011: Dives of Discovery, our four member deep team, aided by numerous assistants,...
Elevated temperatures and bleaching on a high latitude coral reef: the 1988 Bermuda event
Cook, Clayton B.; Logan, Alan; Ward, Jack; Luckhurst, Brian; Berg, Carl J.
1990-03-01
Sea temperatures were normal in Bermuda during 1987, when Bermuda escaped the episodes of coral bleaching which were prevalent throughout the Caribbean region. Survey transecs in 1988 on 4 6 m reefs located on the rim margin and on a lagoonal patch reef revealed bleaching only of zoanthids between May and July. Transect and tow surveys in August and September revealed bleaching of several coral species; Millepora alcicornis on rim reefs was the most extensively affected. The frequency of bleaching in this species, Montastrea annularis and perhaps Diploria labyrinthiformis was significantly higher on outer reefs than on inshore reefs. This bleaching period coincided with the longest period of elevated sea temperatures in Bermuda in 38 years (28.9 30.9°C inshore, >28° offshore). By December, when temperatures had returned to normal, bleaching of seleractinians continued, but bleaching of M. alcicornis on the outer reefs was greatly reduced. Our observations suggest that corals which normally experience wide temperature ranges are less sensitive to thermal stress, and that high-latitude reef corals are sensitive to elevated temperatures which are within the normal thermal range of corals at lower latitudes.
BERMUDA-1DG: a one-dimensional photon transport code
International Nuclear Information System (INIS)
Suzuki, Tomoo; Hasegawa, Akira; Nakashima, Hiroshi; Kaneko, Kunio.
1984-10-01
A one-dimensional photon transport code BERMUDA-1DG has been developed for spherical and infinite slab geometries. The purpose of development is to equip the function of gamma rays calculation for the BERMUDA code system, which was developed by 1983 only for neutron transport calculation as a preliminary version. A group constants library has been prepared for 30 nuclides, and it now consists of the 36-group total cross sections and secondary gamma ray yields by the 120-group neutron flux. For the Compton scattering, group-angle transfer matrices are accurately obtained by integrating the Klein-Nishina formula taking into account the energy and scattering angle correlation. The pair production cross sections are now calculated in the code from atomic number and midenergy of each group. To obtain angular flux distribution, the transport equation is solved in the same way as in case of neutron, using the direct integration method in a multigroup model. Both of an independent gamma ray source problem and a neutron-gamma source problem are possible to be solved. This report is written as a user's manual with a brief description of the calculational method. (author)
Popolizio, Thea R; Schneider, Craig W; Lane, Christopher E
2015-08-01
We have undertaken a comprehensive, molecular-assisted alpha-taxonomic examination of the rhodophyte family Liagoraceae sensu lato, a group that has not previously been targeted for molecular studies in the western Atlantic. Sequence data from three molecular markers indicate that in Bermuda alone there are 10 species in nine different genera. These include the addition of three genera to the flora - Hommersandiophycus, Trichogloeopsis, and Yamadaella. Liagora pectinata, a species with a type locality in Bermuda, is phylogenetically allied with Indo-Pacific species of Hommersandiophycus, and the species historically reported as L. ceranoides for the islands is morphologically and genetically distinct from that taxon, and is herein described as L. nesophila sp. nov. Molecular sequence data have also uncovered the Indo-Pacific L. mannarensis in Bermuda, a long-distance new western Atlantic record. DNA sequences of Trichogloeopsis pedicellata from the type locality (Bahamas) match with local specimens demonstrating its presence in Bermuda. We described Yamadaella grassyi sp. nov. from Bermuda, a species phylogenetically and morphologically distinct from the generitype, Y. caenomyce of the Indo-Pacific. Our data also indicated a single species each of Ganonema, Gloiocallis, Helminthocladia, Titanophycus, and Trichogloea in the flora. © 2015 Phycological Society of America.
Uhlig, Silvio; Botha, Christo J; Vrålstad, Trude; Rolén, Elin; Miles, Christopher O
2009-12-09
Tremorgenic syndromes in mammals are commonly associated with indole-diterpenoid alkaloids of fungal origin. Cattle are sometimes affected by tremors (also called "staggers") when they graze on toxic grass pastures, and Bermuda grass ( Cynodon dactylon , kweek) has been known to be associated with tremors for several decades. This study reports the identification of paspalitrems and paspaline-like indole-diterpenes in the seedheads of Claviceps cynodontis -infected Bermuda grass collected from a pasture that had caused a staggers syndrome in cattle in South Africa and thereby links the condition to specific mycotoxins. The highest concentration (about 150 mg/kg) was found for paspalitrem B. Ergonovine and ergine (lysergic acid amide), together with their C-8 epimers, were found to co-occur with the indole-diterpenes at concentrations of about 10 microg/kg. The indole-diterpene profile of the extract from the ergotized Bermuda grass was similar to that of Claviceps paspali sclerotia. However, the C. paspali sclerotia contained in addition agroclavine and elymoclavine. This is the first study linking tremors associated with grazing of Bermuda grass to specific tremorgenic indole-diterpenoid mycotoxins.
Ergot fungus Claviceps cynodontis found on Bermuda grass (Cynodon dactylon) in the Americas
Czech Academy of Sciences Publication Activity Database
Pažoutová, Sylvie; Odvody, G.; Frederickson, D.E.
2005-01-01
Roč. 27, - (2005), s. 1-6 ISSN 0706-0661 Institutional research plan: CEZ:AV0Z5020903 Keywords : claviceps cynodon tis * ergot * bermuda grass Subject RIV: EE - Microbiology, Virology Impact factor: 1.066, year: 2005
Directory of Open Access Journals (Sweden)
Jiele Xu
2011-06-01
Full Text Available To investigate the effects of biomass feedstock and pretreatment method on the enzyme requirement during hydrolysis, swichgrass and coastal Bermuda grass pretreated using H2SO4, NaOH, and Ca(OH2 at the optimal conditions were subjected to enzymatic hydrolysis using two enzyme combinations: NS 50013 + NS 50010 and Cellic CTec + Cellic HTec. The enzyme loadings were optimized, and correlations between feedstock property, pretreatment strategy, and enzyme usage were evaluated. The results show that pretreatment methods resulting in greater lignin contents in the pretreated biomass were generally associated with higher enzyme requirements. More sugars could be recovered from alkaline-pretreated biomass during enzymatic hydrolysis due to the better carbohydrate preservation achieved at mild pretreatment temperatures. The cellulase enzyme, Cellic CTec, was more efficient in catalyzing the hydrolysis of coastal Bermuda grass, a feedstock more digestible than the pretreated swichgrass, following pretreatment with NaOH or Ca(OH2.
Population Structure of Montastraea cavernosa on Shallow versus Mesophotic Reefs in Bermuda
Goodbody-Gringley, Gretchen; Marchini, Chiara; Chequer, Alex D.; Goffredo, Stefano
2015-01-01
Mesophotic coral reef ecosystems remain largely unexplored with only limited information available on taxonomic composition, abundance and distribution. Yet, mesophotic reefs may serve as potential refugia for shallow-water species and thus understanding biodiversity, ecology and connectivity of deep reef communities is integral for resource management and conservation. The Caribbean coral, Montastraea cavernosa, is considered a depth generalist and is commonly found at mesophotic depths. We surveyed abundance and size-frequency of M. cavernosa populations at six shallow (10m) and six upper mesophotic (45m) sites in Bermuda and found population structure was depth dependent. The mean surface area of colonies at mesophotic sites was significantly smaller than at shallow sites, suggesting that growth rates and maximum colony surface area are limited on mesophotic reefs. Colony density was significantly higher at mesophotic sites, however, resulting in equal contributions to overall percent cover. Size-frequency distributions between shallow and mesophotic sites were also significantly different with populations at mesophotic reefs skewed towards smaller individuals. Overall, the results of this study provide valuable baseline data on population structure, which indicate that the mesophotic reefs of Bermuda support an established population of M. cavernosa. PMID:26544963
Integrative, Interdisciplinary Learning in Bermuda Through Video Projects
Fox, R. J.; Connaughton, M.
2017-12-01
Understanding an ecosystem and how humans impact it requires a multidisciplinary perspective and immersive, experiential learning is an exceptional way to achieve understanding. In summer 2017 we took 18 students to the Bermuda Institute of Ocean Sciences (BIOS) as part of a Washington College two-week, four-credit summer field course. We took a multi-disciplinary approach in choosing the curriculum. We focused on the ecology of the islands and surrounding coral reefs as well as the environmental impacts humans are having on the islands. Additionally, we included geology and both local and natural history. Our teaching was supplemented by the BIOS staff and local tour guides. The student learning was integrated and reinforced through student-led video projects. Groups of three students were tasked with creating a 5-7 minute video appropriate for a public audience. We selected video topics based upon locations we would visit in the first week and topics were randomly assigned. The project intention was for the students to critically analyze and evaluate an area of Bermuda that is a worthwhile tourist destination. Students presented why a tourist should visit a locale, the area's ecological distinctiveness and complexity, the impact humans are having, and ways tourists can foster stewardship of that locale. These projects required students to learn how to make and edit videos, collaborate with peers, communicate a narrative to the public, integrate multi-disciplinary topics for a clear, whole-system perspective, observe the environment from a critical viewpoint, and interview local experts. The students produced the videos within the two-week period, and we viewed the videos as a group on the last day. The students worked hard, were proud of their final products, and produced excellent videos. They enjoyed the process, which provided them opportunities to collaborate, show individual strengths, be creative, and work independently of the instructors.
Energy Technology Data Exchange (ETDEWEB)
Ebelhar, M W; Barnhisel, R I; Akin, G W; Powell, J L
1982-12-01
Common Bermuda grass (Cynodon dactylon, L. Pers.) was used as an alternative to cool-season grasses such as tall fescue (Festuca arundinacea Schreb.) on acid sandstone surface-mine spoils in western Kentucky. Lime, N, P, and K fertilizer amendments were evaluated as to their effects in promoting Bermuda grass growth and development. The applied lime was effective in raising the pH from 3.4 to 4.6, 5.7, and 6.3 for the 18, 36 and 72 metric ton/ha treatments, respectively, over a 17-month period. Nitrogen was found to affect Bermuda grass production significantly and severe deficiency symptoms were observed where N was not applied. Dry matter yields increased significantly with each additional increment of N applied. Although the application of P and K increased the concentration of these ions in the plant tissues, the main influence of P and K was to increase the plants' resistance to winter killing; little effect on total dry matter production was observed. 19 references.
Bermuda's balancing act: The economic dependence of cruise and air tourism on healthy coral reefs
van Beukering, P.J.H.; Sarkis, S.; van der Putten, L.; Papyrakis, E.
2015-01-01
Although Bermuda has to date managed to achieve equilibrium between tourism and coral reef conservation, this delicate balance may be threatened by the growth and changing face of the tourism industry. This may result in negative impacts on the coral reefs and services provided by this valuable
Bermuda Triangle: a subsystem of the 168/E interfacing scheme used by Group B at SLAC
International Nuclear Information System (INIS)
Oxoby, G.J.; Levinson, L.J.; Trang, Q.H.
1979-12-01
The Bermuda Triangle system is a method of interfacing several 168/E microprocessors to a central system for control of the processors and overlaying their memories. The system is a three-way interface with I/O ports to a large buffer memory, a PDP11 Unibus and a bus to the 168/E processors. Data may be transferred bidirectionally between any two ports. Two Bermuda Triangles are used, one for the program memory and one for the data memory. The program buffer memory stores the overlay programs for the 168/E, and the data buffer memory, the incoming raw data, the data portion of the overlays, and the outgoing processed events. This buffering is necessary since the memories of 168/E microprocessors are small compared to the main program and the amount of data being processed. The link to the computer facility is via a Unibus to IBM channel interface. A PDP11/04 controls the data flow. 7 figures, 4 tables
Directory of Open Access Journals (Sweden)
Eric Dewailly
Full Text Available OBJECTIVES: To assess the efficacy of a public health intervention to reduce blood mercury (Hg concentration levels in pregnant Bermudian women. METHODS: In 2003, we conducted a study entitled "Prenatal exposure of the Bermudian Population to Environmental Contaminants" which provided Bermuda's first baseline data on prenatal exposure to several environmental contaminants, including Hg. The mean Hg concentration from 42 healthy newborns measured in umbilical cord blood was 41.3 nmol/L, ranging from 5-160 nmol/L. This concentration was much higher than expected, being approximately 8 times the general levels found in Canada and the U.S. Furthermore, we estimated that 85% of total Hg measured was in the form of methylmercury (MeHg, indicating that seafood consumption was the primary source of Hg exposure during pregnancy in Bermuda. Locally sourced seafood was identified as the most significant possible contributory source of Hg exposure. In 2005 the authors began a complementary research programme to study the levels of Hg in local commercial fish species. Coming out of this research were specific local fish consumption guidelines issued by the Department of Health advising pregnant women to avoid those local fish species found to be high in Hg while still encouraging consumption of fish species having lower Hg levels. RESULTS: In 2010, under another research initiative, we returned to Bermuda to carry out another evaluation of Hg in human blood. Hg was measured in the blood of 49 pregnant women. The arithmetic mean Hg blood concentration was 6.6 nmol/L and the geometric mean 4.2 nmol/L. The maximum concentration found was 24 nmol/L. CONCLUSIONS: Hg exposure of Bermudian pregnant women has dropped significantly by a factor of around 5 since the foetal cord blood study in 2003.
International Nuclear Information System (INIS)
Baker, David M.; Murdoch, Thaddeus J.T.; Conti-Jerpe, Inga; Fogel, Marilyn
2017-01-01
For centuries, Bermuda has been challenged with wastewater management for the protection of human and environmental health. By quantifying the δ 15 N of the common sea fan Gorgonia ventalina sampled from 30 sites throughout Bermuda we show that sewage-derived nitrogen is detectable on nearshore coral reefs and declines across the lagoon to the outer rim. We also sampled gorgonians from two museum collections representing a 50y time-series (1958–2008). These samples revealed an increase in δ 15 N of > 4.0‰ until the mid-1970s, after which δ 15 N values slowly declined by ~ 2.0‰. A δ 15 N chronology from a gorgonian skeleton exhibited a similar decline over the last 30–40 years of approximately 0.6‰. We conclude that policies have been effective in reducing sewage impacts to Bermudian reefs. However, significant sources of sewage pollution persist and are likely have a strong impact on harbor and nearshore coral communities and human health.
Geotechnical properties of sediments from North Pacific and Northern Bermuda Rise
International Nuclear Information System (INIS)
Silva, A.J.; Laine, E.P.; Lipkin, J.; Heath, G.R.; Akers, S.A.
1980-01-01
Studies of geotechnical properties for the Sub-seabed Disposal Program have been oriented toward sediment characterization related to effectiveness as a containment media and determination of detailed engineering behavior. Consolidation tests of the deeper samples in the North Pacific clays indicate that the sediment column is normally consolidated. The in-situ coefficient of permeability (k) within the cored depth of 25 meters is relatively constant at 10 -7 cm/sec. Consolidated undrained (CIU) triaxial tests indicate stress-strain properties characteristic of saturated clays with effective angles of friction of 35 0 for smectite and 31 0 for illite. These results are being used in computer modeling efforts. Some general geotechnical property data from the Bermuda Rise are also discussed
International Nuclear Information System (INIS)
Al-Masri, M.S.; Mukhallati, H.; Al-Hamwi, A.
2011-10-01
transfer factors of Radium -226, lead-210 and Polonium-210 from contaminated soil with oil coproduced water to grazing plants in the north eastern region of Syria have been determined. contaminated soil was collected from one of the AL-Furat Petroleum Oil company oil fields;soil was distributed into several pots where the studied plants were planted in order to study the transfer factors of radioisotopes to them. Results have shown that the mean transfer factors of radium to green parts have reached has reached 0.0016 in Atriplex halimus L.,0.0021 in Atriplex canescens Nutt, 0.0025 in Atriplex Leucoclada Bioss,0.0082 in Bermuda grass and 0.0167 in Medicago Sativ L,which was the highest,while the transfer factors of polonium and lead were ten times higher than those for radium and reacted 0.012 in Atriplex Leucoclada Bioss, 0.011 in Atriplex canescens Nutt, 0.007 in Atriplex halimus L.0.32 in bermuda grass and 0.025 in Afelfa.(author)
30 CFR 210.202 - How do I submit sales summaries?
2010-07-01
... documents from your own records. You do not need to re-format them before submitting them to us: Data... washing costs Monthly Monthly Not Required Monthly Monthly Not Required (v) Transportation costs Monthly... Management, Solid Minerals and Geothermal Compliance and Asset Management, P.O. Box 25165, MS 390G1, Denver...
International Nuclear Information System (INIS)
Al-Masria, M.S.; Mukalallati, H.; Al-Hamwi, A.
2014-01-01
Transfer factors of 226 Ra, 210 Pb and 210 Po from soil contaminated with naturally occurring radioactive materials (NORM) in oil fields to some grazing plants were determined using pot experiments. Contaminated soil was collected from a dry surface evaporation pit from a Syrian oil field in the Der Ezzor area. Five types of plants (Atriplex halimus L., Atriplex canescens, Atriplex Leucoclada Bioss, Alfalfa and Bermuda grass) were grown and harvested three times over two years. The results show that the mean transfer factors of 226 Ra from the contaminated soil to the studied plant species were 1.6 x 10 -3 for Atriplex halimus L., 2.1 x 10 -3 for Atriplex canescens, 2.5 x 10 -3 for Atriplex Leucoclada Bioss, 8.2 x 10 -3 for Bermuda grass, and the highest value was 1.7 x 10 -2 for Alfalfa. Transfer factors of 210 Pb and 210 Po were higher than 226 Ra TFs by one order of magnitude and reached 7 x 10 -3 , 1.1 x 10 -2 , 1.2 x 10 -2 , 3.2 x 10 -2 and 2.5 x 10 -2 for Atriplex halimus, Atriplex canescens, Atriplex Leucoclada Bioss, Bermuda grass and Alfalfa, respectively. The results can be considered as base values for transfer factors of 226 Ra, 210 Pb and 210 Po in semiarid regions. (authors)
Olson, Storrs L.; Hearty, Paul J.
2010-01-01
During the last half million years, pulses of gigantism in the anagenetic lineage of land snails of the subgenus Poecilozonites on Bermuda were correlated with glacial periods when lower sea level resulted in an island nearly an order of magnitude larger than at present. During those periods, the island was colonized by large vertebrate predators that created selection pressure for large size and rapid growth in the snails. Extreme reduction in land area from rising seas, along with changes in ecological conditions at the onset of interglacial episodes, marked extinction events for large predators, after which snails reverted to much smaller size. The giant snails were identical in morphology during the last two glacials when the predators included a large flightless rail Rallus recessus (marine isotope stages (MIS) 4-2) and a crane Grus latipes and a duck Anas pachysceles (MIS 6). In a preceding glacial period (MIS 10), when the fauna also included the tortoise Hesperotestudo bermudae, the snails were not only large, but the shells were much thicker, presumably to prevent crushing by tortoises. Evolution of Poecilozonites provides an outstanding example of dramatic morphological change in response to environmental pressures in the absence of cladogenesis. PMID:20554560
International Nuclear Information System (INIS)
Guerrero-Zuniga, A.; Rojas-Contreras, A.; Rodriguez-Dorantes, A.; Montes-Villafan, S.
2009-01-01
Plant growth-promoting rhizobacteria (PGPR) are free-living bacteria that have the ability to relieve environmental stress in plants, increasing the plant growth potential. Of importance to phytoremediation, PGPR stimulate plant root development and enhance root growth.This study evaluated the growth response and the tolerance to phenanthrene of Bermuda grass: Cynodon dactylon inoculated with two phytohormone producer rhizobacteria: strains II and III, isolated from a contaminated soil with petroleum hydrocarbons. (Author)
Energy Technology Data Exchange (ETDEWEB)
Guerrero-Zuniga, A.; Rojas-Contreras, A.; Rodriguez-Dorantes, A.; Montes-Villafan, S.
2009-07-01
Plant growth-promoting rhizobacteria (PGPR) are free-living bacteria that have the ability to relieve environmental stress in plants, increasing the plant growth potential. Of importance to phytoremediation, PGPR stimulate plant root development and enhance root growth.This study evaluated the growth response and the tolerance to phenanthrene of Bermuda grass: Cynodon dactylon inoculated with two phytohormone producer rhizobacteria: strains II and III, isolated from a contaminated soil with petroleum hydrocarbons. (Author)
National Oceanic and Atmospheric Administration, Department of Commerce — CTD, bottle, and other data were collected from the PANULIRUS and other platforms from repetitive occupations of a hydrographic station off St. George's, Bermuda....
Examining the Impact of a Public Health Message on Fish Consumption in Bermuda.
Directory of Open Access Journals (Sweden)
Catherine McLean Pirkle
Full Text Available In 2003 mean cord blood mercury concentrations in pregnant Bermudian women exceeded levels associated with adverse health outcomes in children. The principal mercury source was local fish species. Public health messages were developed suggesting pregnant women reduce consumption of fish species with higher mercury concentrations (e.g. swordfish, substituting species containing lower mercury concentrations, and elevated omega-3 fatty acids (e.g. anchovies. Recent evidence indicates mercury concentrations in Bermuda's pregnant women have fallen five- fold.Assess whether changes in women's fish eating patterns during pregnancy are consistent with the public health messaging. Determine who is making changes to their diet during pregnancy and why.Mixed methods study with a cross-sectional survey of 121 pregnant women, including 13 opened-ended interviews. Health system, social vulnerability, public health messaging, and socio-demographic variables were characterized and related to changes in fish consumption during pregnancy. Qualitative data were coded according to nutritional advice messages, comprehension of communication strategies, and sources of information.95% of women surveyed encountered recommendations about fish consumption during pregnancy. 75% reported modifying fish eating behaviors because of recommendations. Principal sources of information about fish consumption in pregnancy were health care providers and the Internet. 71% of women reported reducing consumption of large fish species with greater mercury levels, but 60% reported reduced consumption of smaller, low mercury fish. No participant mentioned hearing about the benefits of fish consumption. More frequent exposure to public health messages during pregnancy was associated with lower reported consumption. Bermudian born women were less likely to reduce consumption of large fish species during pregnancy.In Bermuda, public health messages advocating reduced consumption of larger
Stanley Foundation, Muscatine, IA.
This is a report of a conference held in Bermuda in 1981 to discuss a multilateral approach to disarmament. The conference was an informal, off-the-record exchange of ideas and opinions among 24 diplomats and scholars from 18 countries and two international agencies. Participants considered current disarmament concepts, assessed UN disarmament…
Directory of Open Access Journals (Sweden)
ENEA CONSTANTIN
2015-12-01
Full Text Available We should never trust appearances: "the drum, with all the noise it makes is not only filled with wind"[1]. This old oriental proverb perfectly illustrates our proposal regarding the "true false" tax havens. Only at the beginning of this century, learned before firms to exercise their activity in the national territory, returned to international trade. The continuous search for new outlets to escape the growing production, export them first and then they were implanted overseas sales platforms and then installing production. Zero Haven sites or havens with zero tax consisting essentially of small economies, the British colonies (Cayman Islands, British Virgin Islands, dependent territories of the Commonwealth (Bermuda or territories became independent (Antigua, Bahamas 1963 or Vanuatu 1980. Our study will analyze tax havens most common: Bahamas, Bermuda or the Cayman Islands, where we find all models of reception that can be viewed in other areas zero-haven: International Business Companies (Antigua, the Virgin Islands, Nevis exemption schemes to insurance companies or banks (Barbados, Vanuatu. The subject of tax evasion subject of much debate, targeting both the domestic economic space and the world. Unlike their concerns globally, domestic concerns to reduce tax evasion resumes, especially on taxation of small businesses, avoiding knowingly scope of tax havens.
Goncalves Neto, A.; Johnson, R. J.; Bates, N. R.
2016-02-01
Rising sea level is one of the main concerns for human life in a scenario with global atmosphere and ocean warming, which is of particular concern for oceanic islands. Bermuda, located in the center of the Sargasso Sea, provides an ideal location to investigate sea level rise since it has a long term tide gauge (1933-present) and is in close proximity to deep ocean time-series sites, namely, Hydrostation `S' (1954-present) and the Bermuda Atlantic Time-Series Study site (1988-present). In this study, we use the monthly CTD deep casts at BATS to compute the contribution of steric height (SH) to the local sea surface height (SSH) for the past 24 years. To determine the relative contribution from the various water masses we first define 8 layers (Surface Layer, Upper Thermocline, Subtropical Mode-Water, Lower Thermocline, Antarctic Intermediate Water, Labrador Sea Water, Iceland-Scotland Overflow Water, Denmark Strait Overflow Water) based on neutral density criteria for which SH is computed. Additionally, we calculate the thermosteric and halosteric components for each of the defined neutral density layers. Surprisingly, the results show that, despite a 3.3mm/yr sea level rise observed at the Bermuda tide gauge, the steric contribution to the SSH at BATS has decreased at a rate of -1.1mm/yr during the same period. The thermal component is found to account for the negative trend in the steric height (-4.4mm/yr), whereas the halosteric component (3.3mm/yr) partially compensates the thermal signal and can be explained by an overall cooling and freshening at the BATS site. Although the surface layer and the upper thermocline waters are warming, all the subtropical and polar water masses, which represent most of the local water column, are cooling and therefore drive the overall SH contribution to the local SSH. Hence, it suggests that the mass contribution to the local SSH plays an important role in the sea level rise, for which we investigate with GRACE data.
7 CFR 1435.301 - Annual estimates and quarterly re-estimates.
2010-01-01
... CORPORATION, DEPARTMENT OF AGRICULTURE LOANS, PURCHASES, AND OTHER OPERATIONS SUGAR PROGRAM Flexible Marketing..., estimates, and re-estimates in this subpart will use available USDA statistics and estimates of production, consumption, and stocks, taking into account, where appropriate, data supplied in reports submitted pursuant...
DISCOVERY OF A GALAXY CLUSTER WITH A VIOLENTLY STARBURSTING CORE AT z = 2.506
Energy Technology Data Exchange (ETDEWEB)
Wang, Tao; Elbaz, David; Daddi, Emanuele; Valentino, Francesco; Burg, Remco van der; Zanella, Anita; Ciesla, Laure; Brun, Amandine Le [Laboratoire AIM-Paris-Saclay, CEA/DSM/Irfu, CNRS, Université Paris Diderot, Saclay, pt courrier 131, F-91191 Gif-sur-Yvette (France); Finoguenov, Alexis [Department of Physics, University of Helsinki, Gustaf Hällströmin katu 2a, FI-0014 Helsinki (Finland); Liu, Daizhong; Tan, Qinghua [Purple Mountain Observatory, Chinese Academy of Sciences, 2 West Beijing Road, Nanjing 210008 (China); Schreiber, Corentin [Leiden Observatory, Leiden University, NL-2300 RA Leiden (Netherlands); Martín, Sergio [European Southern Observatory, Alonso de Córdova 3107, Vitacura, Santiago (Chile); Strazzullo, Veronica; Pannella, Maurilio [Department of Physics, Ludwig-Maximilians-Universität, Scheinerstr. 1, D-81679 München (Germany); Gobat, Raphael [School of Physics, Korea Institute for Advanced Study, Hoegiro 85, Dongdaemun-gu, Seoul 130-722 (Korea, Republic of); Sargent, Mark [Department of Physics and Astronomy, University of Sussex, Brighton BN1 9QH (United Kingdom); Shu, Xinwen [Department of Physics, Anhui Normal University, Wuhu, Anhui, 241000 (China); Cappelluti, Nico [Department of Astronomy, Yale University, New Haven, CT 06511 (United States); Li, Yanxia, E-mail: tao.wang@cea.fr [Institute for Astronomy, University of Hawaii, 2680 Woodlawn Drive, Honolulu, HI 96822 (United States)
2016-09-01
We report the discovery of a remarkable concentration of massive galaxies with extended X-ray emission at z {sub spec} = 2.506, which contains 11 massive (M {sub *} ≳ 10{sup 11} M {sub ⊙}) galaxies in the central 80 kpc region (11.6 σ overdensity). We have spectroscopically confirmed 17 member galaxies with 11 from CO and the remaining ones from H α . The X-ray luminosity, stellar mass content, and velocity dispersion all point to a collapsed, cluster-sized dark matter halo with mass M {sub 200} {sub c} = 10{sup 13.9±0.2} M {sub ⊙}, making it the most distant X-ray-detected cluster known to date. Unlike other clusters discovered so far, this structure is dominated by star-forming galaxies (SFGs) in the core with only 2 out of the 11 massive galaxies classified as quiescent. The star formation rate (SFR) in the 80 kpc core reaches ∼3400 M {sub ⊙} yr{sup −1} with a gas depletion time of ∼200 Myr, suggesting that we caught this cluster in rapid build-up of a dense core. The high SFR is driven by both a high abundance of SFGs and a higher starburst fraction (∼25%, compared to 3%–5% in the field). The presence of both a collapsed, cluster-sized halo and a predominant population of massive SFGs suggests that this structure could represent an important transition phase between protoclusters and mature clusters. It provides evidence that the main phase of massive galaxy passivization will take place after galaxies accrete onto the cluster, providing new insights into massive cluster formation at early epochs. The large integrated stellar mass at such high redshift challenges our understanding of massive cluster formation.
Energy Technology Data Exchange (ETDEWEB)
Labuthe, A [Dassault Aviation, 92 - Saint Cloud (France)
1997-12-31
In order to evaluate the possibility to use heat pipes as efficient heat transfer devices in aircrafts, a study of their behaviour during strong accelerations is necessary. This study has been jointly carried out by the Laboratory of Thermal Studies of Poitiers (France) and Dassault Aviation company. It is based on a series of tests performed with an experimental apparatus that uses the centrifugal effect to simulate the acceleration fields submitted to the heat pipe. Un-priming - priming cycles have been performed under different power and acceleration levels and at various functioning temperatures in order to explore the behaviour of heat pipes: rate of un-priming and re-priming, functioning in blocked mode etc.. This preliminary study demonstrates the rapid re-priming of the tested heat pipes when submitted to favourable acceleration situations and the possibility to use them under thermosyphon conditions despite the brief unfavourable acceleration periods encountered. (J.S.)
Energy Technology Data Exchange (ETDEWEB)
Labuthe, A. [Dassault Aviation, 92 - Saint Cloud (France)
1996-12-31
In order to evaluate the possibility to use heat pipes as efficient heat transfer devices in aircrafts, a study of their behaviour during strong accelerations is necessary. This study has been jointly carried out by the Laboratory of Thermal Studies of Poitiers (France) and Dassault Aviation company. It is based on a series of tests performed with an experimental apparatus that uses the centrifugal effect to simulate the acceleration fields submitted to the heat pipe. Un-priming - priming cycles have been performed under different power and acceleration levels and at various functioning temperatures in order to explore the behaviour of heat pipes: rate of un-priming and re-priming, functioning in blocked mode etc.. This preliminary study demonstrates the rapid re-priming of the tested heat pipes when submitted to favourable acceleration situations and the possibility to use them under thermosyphon conditions despite the brief unfavourable acceleration periods encountered. (J.S.)
Sharing Data to Build a Medical Information Commons: From Bermuda to the Global Alliance.
Cook-Deegan, Robert; Ankeny, Rachel A; Maxson Jones, Kathryn
2017-08-31
The Human Genome Project modeled its open science ethos on nematode biology, most famously through daily release of DNA sequence data based on the 1996 Bermuda Principles. That open science philosophy persists, but daily, unfettered release of data has had to adapt to constraints occasioned by the use of data from individual people, broader use of data not only by scientists but also by clinicians and individuals, the global reach of genomic applications and diverse national privacy and research ethics laws, and the rising prominence of a diverse commercial genomics sector. The Global Alliance for Genomics and Health was established to enable the data sharing that is essential for making meaning of genomic variation. Data-sharing policies and practices will continue to evolve as researchers, health professionals, and individuals strive to construct a global medical and scientific information commons.
Shi, Haitao; Wang, Xin; Tan, Dun-Xian; Reiter, Russel J; Chan, Zhulong
2015-08-01
The fact of melatonin as an important antioxidant in animals led plant researchers to speculate that melatonin also acts in the similar manner in plants. Although melatonin has significant effects on alleviating stress-triggered reactive oxygen species (ROS), the involvement of melatonin in direct oxidative stress and the underlying physiological and molecular mechanisms remain unclear in plants. In this study, we found that exogenous melatonin significantly alleviated hydrogen peroxide (H2O2)-modulated plant growth, cell damage, and ROS accumulation in Bermuda grass. Additionally, 76 proteins significantly influenced by melatonin during mock or H2O2 treatment were identified by gel-free proteomics using iTRAQ (isobaric tags for relative and absolute quantitation). Metabolic pathway analysis showed that several pathways were markedly enhanced by melatonin and H2O2 treatments, including polyamine metabolism, ribosome pathway, major carbohydrate metabolism, photosynthesis, redox, and amino acid metabolism. Taken together, this study provides more comprehensive insights into the physiological and molecular mechanisms of melatonin in Bermuda grass responses to direct oxidative stress. This may relate to the activation of antioxidants, modulation of metabolic pathways, and extensive proteome reprograming. © 2015 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.
Directory of Open Access Journals (Sweden)
Usman Ali
2018-06-01
Full Text Available Climate change is a global phenomenon occurring throughout the world. Greenhouse gases (GHGs especially carbon dioxide (CO2 considered to be the major culprit to bring these changes. So, carbon (C sequestration by any mean could be useful to reduce the CO2 level in atmosphere. Turf grasses have the ability to sequester C and minimize the effects of GHGs on the environment. In order to study that how turf grasses can help in C sequestration, Bermuda grass (Cynodon dactylon was grown both at industrial and urban location and its effect on C storage were assessed by soil and plant analysis. Dry deposition of ammonium and nitrate was maximum at both locations through the year. However wet deposition was highest during the months of high rainfall. It was examined through soil analysis that soil organic matter, soil C and nitrogen in both locations increased after second mowing of grass. However, soil pH 6.68 in urban and 7.00 in industrial area and EC 1.86 dS/m in urban and 1.90 dS/m in industrial area decreased as the grass growth continue. Soil fresh weight (27.6 g in urban and (27.28 g industrial area also decreased after first and second mowing of grass. The C levels in plant dry biomass also increased which showed improved ability of plant to uptake C from the soil and store it. Similarly, chlorophyll contents were more in industrial area compared to urban area indicates the positive impact of high C concentration. Whereas stomatal conductance was reduced in high C environment to slow down respiration process. Hence, from present study it can be concluded that the Bermuda grass could be grown in areas with high C concentration in atmosphere for sequestrating C in soil.
2010-01-01
... renewable energy report (EE/RE report) alternative? 905.17 Section 905.17 Energy DEPARTMENT OF ENERGY ENERGY... energy efficiency and/or renewable energy report (EE/RE report) alternative? (a) Requests to submit an EE..., including any requirements for documenting customer energy efficiency and renewable energy activities. (b...
Multifilm kui tõsine asi / Marko Mägi
Mägi, Marko
1998-01-01
Esilinastus 6 animafilmi : "Vares ja hiired", autorid Priit Tender ja Mikk Rand; "Just märried", autor Peep Pedmanson; "Päevavalgus", autor Mait Laas; "Tom ja Fluffy", režissöörid Janno Põldma ja Heiki Ernits; "Bermuda", autor Ülo Pikkov; "Primavera", režissöörid Riho Unt ja Hardi Volmer
Eesti animafilme igale maitsele / Sulev Teinemaa
Teinemaa, Sulev, 1947-
1998-01-01
Esilinastus 6 animafilmi : "Vares ja hiired", autorid Priit Tender ja Mikk Rand; "Just märried", autor Peep Pedmanson; "Päevavalgus", autor Mait Laas; "Tom ja Fluffy", režissöörid Janno Põldma ja Heiki Ernits; "Bermuda", autor Ülo Pikkov; "Primavera", režissöörid Riho Unt ja Hardi Volmer
Aimdusi tsivilisatsioonist / Tarmo Teder
Teder, Tarmo, 1958-
1998-01-01
Esilinastus 6 animafilmi : "Vares ja hiired", autorid Priit Tender ja Mikk Rand; "Just märried", autor Peep Pedmanson; "Päevavalgus", autor Mait Laas; "Tom ja Fluffy", režissöörid Janno Põldma ja Heiki Ernits; "Bermuda", autor Ülo Pikkov; "Primavera", režissöörid Riho Unt ja Hardi Volmer
Animaalselt ja humaanselt / Karlo Funk
Funk, Karlo, 1971-
1998-01-01
Esilinastus 6 animafilmi : "Vares ja hiired", autorid Priit Tender ja Mikk Rand; "Just märried", autor Peep Pedmanson; "Päevavalgus", autor Mait Laas; "Tom ja Fluffy", režissöörid Janno Põldma ja Heiki Ernits; "Bermuda", autor Ülo Pikkov; "Primavera", režissöörid Riho Unt ja Hardi Volmer
Hu, Zhengrong; Fan, Jibiao; Chen, Ke; Amombo, Erick; Chen, Liang; Fu, Jinmin
2016-04-01
The phytohormone ethylene has been reported to mediate plant response to cold stress. However, it is still debated whether the effect of ethylene on plant response to cold stress is negative or positive. The objective of the present study was to explore the role of ethylene in the cold resistance of Bermuda grass (Cynodon dactylon (L).Pers.). Under control (warm) condition, there was no obvious effect of the ethylene precursor 1-aminocyclopropane-1-carboxylic acid (ACC) or the antagonist Ag(+) of ethylene signaling on electrolyte leakage (EL) and malondialdehyde (MDA) content. Under cold stress conditions, ACC-treated plant leaves had a greater level of EL and MDA than the untreated leaves. However, the EL and MDA values were lower in the Ag(+) regime versus the untreated. In addition, after 3 days of cold treatment, ACC remarkably reduced the content of soluble protein and also altered antioxidant enzyme activity. Under control (warm) condition, there was no significant effect of ACC on the performance of photosystem II (PS II) as monitored by chlorophyll α fluorescence transients. However, under cold stress, ACC inhibited the performance of PS II. Under cold condition, ACC remarkably reduced the performance index for energy conservation from excitation to the reduction of intersystem electron acceptors (PI(ABS)), the maximum quantum yield of primary photochemistry (φP0), the quantum yield of electron transport flux from Q(A) to Q(B) (φE0), and the efficiency/probability of electron transport (ΨE0). Simultaneously, ACC increased the values of specific energy fluxes for absorption (ABS/RC) and dissipation (DI0/RC) after 3 days of cold treatment. Additionally, under cold condition, exogenous ACC altered the expressions of several related genes implicated in the induction of cold tolerance (LEA, SOD, POD-1 and CBF1, EIN3-1, and EIN3-2). The present study thus suggests that ethylene affects the cold tolerance of Bermuda grass by impacting the antioxidant system
Animatsiooni vastu ei saa ükski / Mikk Rand
Rand, Mikk, 1970-
1998-01-01
21.5. esilinastuvad kinos "Sõprus" 6 animafilmi : "Vares ja hiired", autorid Priit Tender ja Mikk Rand; "Just märried", autor Peep Pedmanson; "Päevavalgus", autor Mait Laas; "Tom ja Fluffy", režissöörid Janno Põldma ja Heiki Ernits; "Bermuda", autor Ülo Pikkov; "Primavera", režissöörid Riho Unt ja Hardi Volmer
Esilinastuvad eesti animafilmid
1998-01-01
21.5. esilinastuvad kinos "Sõprus" 6 animafilmi : "Vares ja hiired", autorid Priit Tender ja Mikk Rand; "Just märried", autor Peep Pedmanson; "Päevavalgus", autor Mait Laas; "Tom ja Fluffy", režissöörid Janno Põldma ja Heiki Ernits; "Bermuda", autor Ülo Pikkov; "Primavera", režissöörid Riho Unt ja Hardi Volmer
Kuus uut Eesti filmi korraga ekraanil / Tarmo Teder
Teder, Tarmo, 1958-
1998-01-01
21.5. esilinastuvad kinos "Sõprus" 6 animafilmi : "Vares ja hiired", autorid Priit Tender ja Mikk Rand; "Just märried", autor Peep Pedmanson; "Päevavalgus", autor Mait Laas; "Tom ja Fluffy", režissöörid Janno Põldma ja Heiki Ernits; "Bermuda", autor Ülo Pikkov; "Primavera", režissöörid Riho Unt ja Hardi Volmer
Mutation breeding of vegetatively propagated turf and forage Bermuda grass
International Nuclear Information System (INIS)
Burton, G.W.; Hanna, W.W.
1982-01-01
Tifgreen, Tifway and Tifdwarf, sterile triploid (2n = 27)F 1 hybrids between Cynodon dactylon and C. transvaalensis, are widely used turf grasses bred at Tifton, Georgia. They cannot be improved by conventional breeding methods. Attempts to improve them by treating short dormant rhizome sections with EMS failed but exposing them to 7-9 kR of gamma radiation produced 158 mutants. These have been evaluated at Tifton, and Beltsville, Maryland, and nine that appear to be better than the parents in one or more characteristics were planted in 8 x 10 m plots in triplicate in 1977. Test results to date suggest that one or more of these will be good enough to warrant a name and release to the public. Coastcross-1 is an outstanding sterile F 1 hybrid Bermuda grass that gives 35% more beef per acre but lacks winter hardiness. Since 1971, several million sprigs of Coastcross-1 have been exposed to 7 kR and have been planted and screened for winter survival at the Georgia Mountain Experiment Station. Chlorophyll-deficient mutants have appeared and one mutant slightly, but significantly, more winter hardy than Coastcross-1 has been obtained. Sprigs of this mutant named Coastcross 1-M3 are being irradiated and screened in an attempt to increase its winter hardiness. (author)
Ruminal production of methane ''in vitro'' with Coast Cross No. 1 bermuda grass (Cynodon dactylon)
Energy Technology Data Exchange (ETDEWEB)
Geerken, C M; Funes, F; Gonzalez, R
1980-11-01
1. Samples of Coast Cross No. 1 bermuda grass (Cynodon dactylon) of 3, 6, 9, 12 and 15 days of cut, irrigated and fertilized at a rate of 400 kg N/ha/year, were used to determine their bromatological composition, digestibility and methane production ''in vitro''. 2. Crude protein concentration of the pasture fell sharply from 20 to 4% and crude fibre increased from 26 to 34% as the pasture grew older. DM digestibility decreased from 58 to 44% from the 6th to the 15th week of cut. Methane production ''in vitro'' was significantly lower (P is less than 0,01), at 3 and 6 weeks, than that obtained at older ages. The differences were more marked when calculated per unit of digested DM. 3. These results could be of interest in the search of a better utilization of dietary energy for grazing animals. (Refs. 16).
Butler, Afrachanna D; Wynter, Michelle; Medina, Victor F; Bednar, Anthony J
2016-06-01
Yuma Proving Grounds (YPG) in western Arizona is a testing range where Depleted uranium (DU) penetrators have been historically fired. A portion of the fired DU penetrators are being managed under controlled conditions by leaving them in place. The widespread use of DU in armor-penetrating weapons has raised environmental and human health concerns. The present study is focused on the onsite management approach and on the potential interactions with plants local to YPG. A 30 day study was conducted to assess the toxicity of DU corrosion products (e.g., schoepite and meta-schoepite) in two grass species that are native to YPG, Bermuda (Cynodon dactylon) and Purple Threeawn (Aristida purpurea). In addition, the ability for plants to uptake DU was studied. The results of this study show a much lower threshold for biomass toxicity and higher plant concentrations, particularly in the roots than shoots, compared to previous studies.
1998-01-01
21.5. esilinastuvad kinos "Sõprus" 6 animafilmi : "Vares ja hiired", autorid Priit Tender ja Mikk Rand; "Just märried", autor Peep Pedmanson; "Päevavalgus", autor Mait Laas; "Tom ja Fluffy", režissöörid Janno Põldma ja Heiki Ernits; "Bermuda", autor Ülo Pikkov; "Primavera", režissöörid Riho Unt ja Hardi Volmer. Aut. : M.R
Kuehl, Kristin; Jones, Ross; Gibbs, David; Richardson, Laurie
2011-03-01
On Bermuda reefs the brain coral Diploria labyrinthiformis is rarely documented with black band disease (BBD), while BBD-affected colonies of Diploria strigosa are common. D. labyrinthiformis on these reefs may be more resistant to BBD or less affected by prevailing environmental conditions that potentially diminish host defenses. To determine whether light and/or temperature influence BBD differently on these two species, infection experiments were conducted under the following experimental treatments: (1) 26 °C, ambient light; (2) 30 °C, ambient light; (3) 30 °C, low light; and (4) 30 °C, high light. A digital photograph of the affected area of each coral was taken each day for 7 days and analyzed with ImageJ image processing software. The final affected area was not significantly different between species in any of the four treatments. BBD lesions were smaller on both species infected under ambient light at 26 °C versus 30 °C. Low light at 30 °C significantly reduced the lesion size on both species when compared to colonies infected at the same temperature under ambient light. Under high light at 30 °C, BBD lesions were larger on colonies of D. strigosa and smaller on colonies of D. labyrinthiformis when compared to colonies infected under ambient light at the same temperature. The responses of both species suggests that BBD progression on both D. strigosa and D. labyrinthiformis is similarly influenced by a combination of light and temperature and that other factors present before infections become established likely contribute to the difference in BBD prevalence in Bermuda. Copyright © 2010 Elsevier Inc. All rights reserved.
The design and development of massive BES job submit and management system
International Nuclear Information System (INIS)
Shi Jingyan; Liang Dong; Sun Gongxing; Chen Gang
2010-01-01
The system was designed to provide an easy and efficient way for the physicists to run their physical jobs. The system sends jobs to the different computing backend under the request of the user, besides, the system can monitor the jobs status, re-submit the job automatically. The BES job is the typical data massive calculation. To realize the parallelized job running, the big job was split into many sub-jobs to be run on many worknodes at the same time. Web Service is adopted to provide users flexible interface. (authors)
Effect of desaturation and re-saturation on shale in underground galleries
International Nuclear Information System (INIS)
Pham, Q.T.
2006-03-01
The aim of this thesis is to characterize by experimental and numerical approaches the hydric, mechanical and hydro-mechanical effects due to the desaturation and re-saturation of the Eastern argillite, host rock of the Bure site, future underground radioactive waste disposal facility. Experimental and numerical approaches for the characterization of hydric transfers in argilites are presented. A simple identification method is proposed which uses the determination of the linearized hydric diffusivity from weight measurements performed on samples (thin tubes and plates) submitted to humidity steps according to a desaturation-re-saturation cycle. The hydric transfer is nonlinear. In order to interpret this phenomenon, a non-linear numerical model is established which takes into account the physical phenomena (hydraulic conduction, vapor diffusion, phase change..). The evolution of the physical and mechanical behaviour of the argillaceous rock with respect to the imposed humidity is then analyzed according to a desaturation-re-saturation cycle by successive steps. The hydric deformation, the velocity of ultrasonic waves propagation, the elastic properties, the rupture characteristics and the delayed phenomena depend on the hydric state of the material. The desaturation and re-saturation influence on a scale model of tunnel is analyzed. Thick tubes parallel or perpendicular to the stratification are used to show up the anisotropy of the rock. These tubes are submitted to hydric loads by blowing air with variable hygrometry through their center hole. A nonlinear poro-elastic model is used to interpret the anisotropic hydro-mechanical phenomena observed. It is shown that hydric loads can lead to the rupture of test samples which follow the anisotropic directions of the rock and which can be interpreted by the hydro-mechanical model as a violation of a rupture criterion in total pulling stress. Finally, numerical calculations for the phenomena generated by desaturation
On-site hydrolytic enzymes production from fungal co-cultivation of Bermuda grass and corn cob.
Amaro-Reyes, Aldo; Gracida, Jorge; Huizache-Peña, Nelson; Elizondo-García, Norberto; Salazar-Martínez, José; García Almendárez, Blanca E; Regalado, Carlos
2016-07-01
Solid state fermentation (SSF) is used to produce industrial enzymes. The objective of this study was to use a co-culture of Aspergillus niger GS1 and Trichoderma reesei, grown on a mixture of Bermuda grass and corn cob to obtain fermented forage (FF) rich in hydrolytic enzymes, as a value added ingredient for animal feed. FPase, amylase and xylanase productivities (dry matter, DM) were 8.8, 181.4, and 42.1Ug(-1)h(-1), respectively (1U=reducing sugars released min(-1)), after 12-16h of SSF with C/N=60. Cellulose, hemicellulose and lignin decreased 1.6-, 2.7- and 1.9-fold (DM), respectively. In vitro ruminal and true digestibility of DM was improved 2.4- and 1.4-fold. Ruminal digestion of FF reduced 1.32-fold the acetate:propionate ratio, which may reduce the environmental impact of ruminants feeding. On-site hydrolytic enzymes productivity using SSF without enzymes extraction could be of economic potential for digestibility improvement in animal feed. Copyright © 2016 Elsevier Ltd. All rights reserved.
Environmental assessment of metal exposure to corals living in Castle Harbour, Bermuda
Prouty, N.G.; Goodkin, N.F.; Jones, R.; Lamborg, C.H.; Storlazzi, C.D.; Hughen, K.A.
2013-01-01
Environmental contamination in Castle Harbour, Bermuda, has been linked to the dissolution and leaching of contaminants from the adjacent marine landfill. This study expands the evidence for environmental impact of leachate from the landfill by quantitatively demonstrating elevated metal uptake over the last 30 years in corals growing in Castle Harbour. Coral Pb/Ca, Zn/Ca and Mn/Ca ratios and total Hg concentrations are elevated relative to an adjacent control site in John Smith's Bay. The temporal variability in the Castle Harbour coral records suggests that while the landfill has increased in size over the last 35 years, the dominant input of metals is through periodic leaching of contaminants from the municipal landfill and surrounding sediment. Elevated contaminants in the surrounding sediment suggest that resuspension is an important transport medium for transferring heavy metals to corals. Increased winds, particularly during the 1990s, were accompanied by higher coral metal composition at Castle Harbour. Coupled with wind-induced resuspension, interannual changes in sea level within the Harbour can lead to increased bioavailability of sediment-bound metals and subsequent coral metal assimilation. At John Smith's Bay, large scale convective mixing may be driving interannual metal variability in the coral record rather than impacts from land-based activities. Results from this study provide important insights into the coupling of natural variability and anthropogenic input of contaminants to the nearshore environment.
QPS Upgrade and Re-commissioning
Denz, R
2009-01-01
Prior to the re-start of the Large Hadron Collider LHC in 2009 the protection system for superconducting devices QPS will be submitted to a substantial upgrade. The foreseen modifications will enhance the capability of the system in detecting problems related to the electrical interconnections between superconducting magnets as well as the detection of so-called aperture symmetric quenches in the LHC main magnets. The presentation will describe the design and implementation of the new protection layers and report on recent tests with prototype devices. It will address as well the planned steps for commissioning of the new system, possible limitations and the additional tools and procedures required to make use of its full capability. Finally the recent progress with respect to procurement, production, test and installation will be presented.
Directory of Open Access Journals (Sweden)
Malkus Kristen A
2009-06-01
Full Text Available Abstract While numerous hypotheses have been proposed to explain the molecular mechanisms underlying the pathogenesis of neurodegenerative diseases, the theory of oxidative stress has received considerable support. Although many correlations have been established and encouraging evidence has been obtained, conclusive proof of causation for the oxidative stress hypothesis is lacking and potential cures have not emerged. Therefore it is likely that other factors, possibly in coordination with oxidative stress, contribute to neuron death. Using Parkinson's disease (PD as the paradigm, this review explores the hypothesis that oxidative modifications, mitochondrial functional disruption, and impairment of protein degradation constitute three interrelated molecular pathways that execute neuron death. These intertwined events are the consequence of environmental exposure, genetic factors, and endogenous risks and constitute a "Bermuda triangle" that may be considered the underlying cause of neurodegenerative pathogenesis.
Directory of Open Access Journals (Sweden)
Sandra Furlan Nogueira
2011-06-01
Full Text Available This study investigated the microbial metabolism in Bermuda-grass Tifton 85 areas after potable-water and effluent irrigation treatments. The experiment was carried out in Lins/SP with samples taken in the rainy and dry seasons (2006 after one year and three years of irrigation management, and set up on an entirely randomized block design with four treatments: C (control, without irrigation or fertilization, PW (potable water + 520 kg of N ha-1 year-1; TE3 and TE0 (treated effluent + 520 kg of N ha-1 year-1 for three years and one year, respectively. The parameters determined were: microbial biomass carbon, microbial activity, and metabolic quotient. Irrigation with wastewater after three years indicated no alteration in soil quality for C and ET3; for PW, a negative impact on soil quality (microbial biomass decrease suggested that water-potable irrigation in Lins is not an adequate option. Microbial activity alterations observed in TE0 characterize a priming effect.
Sharing and re-use of phylogenetic trees (and associated data) to facilitate synthesis.
Stoltzfus, Arlin; O'Meara, Brian; Whitacre, Jamie; Mounce, Ross; Gillespie, Emily L; Kumar, Sudhir; Rosauer, Dan F; Vos, Rutger A
2012-10-22
Recently, various evolution-related journals adopted policies to encourage or require archiving of phylogenetic trees and associated data. Such attention to practices that promote sharing of data reflects rapidly improving information technology, and rapidly expanding potential to use this technology to aggregate and link data from previously published research. Nevertheless, little is known about current practices, or best practices, for publishing trees and associated data so as to promote re-use. Here we summarize results of an ongoing analysis of current practices for archiving phylogenetic trees and associated data, current practices of re-use, and current barriers to re-use. We find that the technical infrastructure is available to support rudimentary archiving, but the frequency of archiving is low. Currently, most phylogenetic knowledge is not easily re-used due to a lack of archiving, lack of awareness of best practices, and lack of community-wide standards for formatting data, naming entities, and annotating data. Most attempts at data re-use seem to end in disappointment. Nevertheless, we find many positive examples of data re-use, particularly those that involve customized species trees generated by grafting to, and pruning from, a much larger tree. The technologies and practices that facilitate data re-use can catalyze synthetic and integrative research. However, success will require engagement from various stakeholders including individual scientists who produce or consume shareable data, publishers, policy-makers, technology developers and resource-providers. The critical challenges for facilitating re-use of phylogenetic trees and associated data, we suggest, include: a broader commitment to public archiving; more extensive use of globally meaningful identifiers; development of user-friendly technology for annotating, submitting, searching, and retrieving data and their metadata; and development of a minimum reporting standard (MIAPA) indicating
Organic geochemistry and pore water chemistry of sediments from Mangrove Lake, Bermuda
Hatcher, P.G.; Simoneit, B.R.T.; MacKenzie, F.T.; Neumann, A.C.; Thorstenson, D.C.; Gerchakov, S.M.
1982-01-01
Mangrove Lake, Bermuda, is a small coastal, brackish-water lake that has accumulated 14 m of banded, gelatinous, sapropelic sediments in less than 104 yr. Stratigraphic evidence indicates that Mangrove Lake's sedimentary environment has undergone three major depositional changes (peat, freshwater gel, brackish-water gel) as a result of sea level changes. The deposits were examined geochemically in an effort to delineate sedimentological and diagenetic changes. Gas and pore water studies include measurements of sulfides, ammonia, methane, nitrogen gas, calcium, magnesium, chloride, alkalinity, and pH. Results indicate that sulfate reduction is complete, and some evidence is presented for bacterial denitrification and metal sulfide precipitation. The organic-rich sapropel is predominantly algal in origin, composed mostly of carbohydrates and insoluble macromolecular organic matter called humin with minor amounts of proteins, lipids, and humic acids. Carbohydrates and proteins undergo hydrolysis with depth in the marine sapropel but tend to be preserved in the freshwater sapropel. The humin, which has a predominantly aliphatic structure, increases linearly with depth and composes the greatest fraction of the organic matter. Humic acids are minor components and are more like polysaccharides than typical marine humic acids. Fatty acid distributions reveal that the lipids are of an algal and/or terrestrial plant source. Normal alkanes with a total concentration of 75 ppm exhibit two distribution maxima. One is centered about n-C22 with no odd/even predominance, suggestive of a degraded algal source. The other is centered at n-C31 with a distinct odd/even predominance indicative of a vascular plant origin. Stratigraphic changes in the sediment correlate to observed changes in the gas and pore water chemistry and the organic geochemistry. ?? 1982.
Production of {sup 186}Re and {sup 188}Re, and synthesis of {sup 188}Re-DTPA
Energy Technology Data Exchange (ETDEWEB)
Hashimoto, Kazuyuki; Motoishi, Shoji; Kobayashi, Katsutoshi; Izumo, Mishiroku [Department of Radioisotopes, Japan Atomic Energy Research Institute, Tokai, Ibaraki (Japan); Musdja, Muhammad Yanis
1999-08-01
Production of radioactive rhenium isotopes {sup 186}Re and {sup 188}Re, and synthesis of {sup 188}Re-DTPA have been studied. For {sup 186}Re, a production method by the {sup 185}Re(n, {gamma}) {sup 186}Re reaction in a reactor has been established. For {sup 188}Re, a production method by the double neuron capture reaction of {sup 186}W, which produces a {sup 188}W/{sup 188}Re generator, has been established. For synthesis of {sup 188}Re-DTPA, the optimum conditions, including pH, the amounts of regents and so on, have been determined. (author)
Re-telling, Re-evaluating and Re-constructing
Directory of Open Access Journals (Sweden)
Gorana Tolja
2013-11-01
Full Text Available 'Graphic History: Essays on Graphic Novels and/as History '(2012 is a collection of 14 unique essays, edited by scholar Richard Iadonisi, that explores a variety of complex issues within the graphic novel medium as a means of historical narration. The essays address the issues of accuracy of re-counting history, history as re-constructed, and the ethics surrounding historical narration.
Re-OPCAB vs. Re-CABG for myocardial revascularization.
Schütz, A; Mair, H; Wildhirt, S M; Gillrath, G; Lamm, P; Kilger, E; Reichart, B
2001-06-01
The present study compared redo coronary artery bypass grafting (Re-OPCAB) techniques with conventional redo coronary artery bypass grafting (Re-CABG) with particular focus on myocardial damage and clinical outcome parameters. Redo OPCAB (Re-OPCAB) was performed on 20 consecutive patients (15 males, mean age 63.2 +/- 9.3 years) using either the anterolateral approach for minimally invasive direct coronary artery bypass (n = 4) or the Octopus technique with regular sternotomy (n = 16). The Re-CABG group consisted of 20 consecutive patients (18 males, mean age 67.1 +/- 6.6 years). Groups did not differ in the number of atherosclerotic risk factors, or left ventricular, renal or liver function. Duration of surgery, number of bypass grafts and amount of transfused red blood cells did not differ significantly between both groups. Requirement of epinephrine (mg/h) within the first 24 h was lower in the Re-OPCAB group (Re-OPCAB: 0.14 +/- 0.22 vs. CABG: 0.88 +/- 0.97; p<0.01). In addition, CKMB levels at 24 h after operation were lower in the Re-OPCAB group (Re-OPCAB: 10.0 +/- 10.1 vs. Re-CABG: 38.7 +/- 28.1 U/l, p<0.001). There were no acute myocardial infarctions or deaths in the perioperative period. In the CABG group, there was a longer time period to extubation (hours) (Re-OPCAB: 9.8 +/- 3.9 vs. Re-CABG: 28.7 +/- 25.5; p<0.001), and the length of ICU stay was significantly prolonged (OPCAB: 1.3 +/- 0.5 versus Re-CABG: 4.4 +/- 8.7; p<0.001). The graft patency rate at follow-up was 95% in the Re-OPCAB group. Re-OPCAB results in decreased cardiac specific enzyme release, reduced requirement of inotropes and comparable clinical outcome in the early postoperative period. It is an appropriate alternative to conventional Re-CABG in selected patients awaiting reoperation for myocardial revascularization. Larger prospective and randomized trials are required to select the appropriate patient who benefits most from one or the other treatment regime.
Directory of Open Access Journals (Sweden)
R. H. R. Stanley
2012-06-01
Full Text Available We present three years of Apparent Oxygen Utilization Rates (AOUR estimated from oxygen and tracer data collected over the ocean thermocline at monthly resolution between 2003 and 2006 at the Bermuda Atlantic Time-series Study (BATS site. We estimate water ages by calculating a transit time distribution from tritium and helium-3 data. The vertically integrated AOUR over the upper 500 m, which is a regional estimate of export, during the three years is 3.1 ± 0.5 mol O2 m−2 yr−1. This is comparable to previous AOUR-based estimates of export production at the BATS site but is several times larger than export estimates derived from sediment traps or 234Th fluxes. We compare AOUR determined in this study to AOUR measured in the 1980s and show AOUR is significantly greater today than decades earlier because of changes in AOU, rather than changes in ventilation rates. The changes in AOU are likely a methodological artefact associated with problems with early oxygen measurements.
C. Selva Kumar
2011-01-01
Hypercholesteremia is one of the risk factors for coronary artery disease. The present study highlights the efficacy of Ayurvedic herbal formulation Cynodon dactylon (Bermuda grass) on histopathological study and DNA fragmentation analysis in experimentally induced hypercholesteremic rats. Four groups of rats were employed namely control, hypercholesterolemia rats (4% Cholesterol+1% cholic acid), Cynodon dactylon treatment in hypercholesteremic rats and Cynodon dactylon alone treated rats. Re...
International Nuclear Information System (INIS)
Busev, A.I.; Tiptsova, V.G.; Ivanov, V.M.
1978-01-01
The basic methods for determining rhenium in various objects are presented. The gravimetric determination of rhenium is based on a quantitative precipitation of ReO 4 - ions with tetraphenylarsonium chloride. The determination is not hindered by tungstates and molybdates. The potentiometric determination of rhenium in alloys (>=0.5% Re) is based on perrhenate ion reduction to Re(4) with the titrated solution of the Cr(2) salt. Re(7) is titrated in a hot sulfuric acid solution in the presence of KJ. The relative error of the method is 1 to 3%. The photometric determination of rhenium is performed by the rhodamide method in molybdenum-and tungsten-containing alloys and catalytically, in rocks, after it has been separated in the form of sulfide. The extraction-photometric determination of rhenium is carried out with the aid of methyl violet (analysis of a stock with a high content of Mo, W, Ta, Nb, Ti ahd Zr) and thio-oxine (the determination of Re is hindered by Au, Pt, Pd, Ru, Os, Rh, Ir). Also described are methods for differential-spectrophotometric determination of Re with the aid of thiocarbamide, as well as with the aid of dimethylglyoxime in the presence of SnCl 2 in an acid medium when Re is determined in its alloys with niobium and hafnium. It takes 2 hours to analyze the Hf-Re alloy and 3 hours to analyze the Nb-Re alloy, the standard deviation being 0.005 at 30-50% Re and 0.027 to 0.019 at 10-50% Re
Zheng, Jinsheng
2014-03-01
The Zhijintang Sanctum version of the re-revised edition of Jinling edition of Ben cao gang mu (Compendium of Materia Medica)collected by Zhao Huiyuan of Baihe, Henan Province in 2008 was opted as one of the third batch of the National Directory of Rare Ancient Worksin 2010. On the second cover page (patent page), it is recorded as"Original Jiangxi version". However, it is investigated to find that most of its paper sheets were reprinted after the original Jinling version, only scores of paper sheets were supplemented block-printed, including the additional block-printed second preface and Li Jianyuan's submitted report of the Jiangxi version, the re-revised time of which should be after the Jiangxi edition, or 1603. The exact time can be determined only by checking it carefully against another Jinling re-revised version (the Sheyuantang Sanctum edition).
Comparative studies of antibody anti-CD20 labeled with 188Re
International Nuclear Information System (INIS)
Dias, Carla Roberta de Barros Rodrigues
2010-01-01
Nuclear Medicine is an unique and important modality in oncology and the development of new tumor-targeted radiopharmaceuticals for both diagnosis and therapy is an area of interest for researchers. Rituximab (RTX) is a quimeric monoclonal antibody (mAb) (IgG 1) that specifically binds to CD20 antigen with high affinity and has been successfully used for the treatment of Non-Hodgkin Lymphoma (NHL) of cell B. The CD20 antigen is expressed over more than 90% of cell B NHL. Technetium-99m ( 99m Tc) and rhenium-188 ( 188 Re) are an attractive radionuclide pair for clinical use due to their favorable decay properties for diagnosis ( 99m Tc: T 1/2 = 6 h, γ radiation = 140 keV) and therapy ( 188 Re: T 1/2 = 17 h, maximum β energy = 2.12 MeV) and to their availability in the form of 99 Mo/ 99 mTc and 188 W/ 188 Re generators. The radionuclides can be conjugated to mAb using similar chemical procedures. The aim of this work was to study the labeling of anti-CD20 mAb (RTX) with 188 Re using two techniques: the direct labeling method [ 188 Re(V)] and the labeling method via the carbonyl nucleus [ 188 Re(I)]. Besides the quality control, the radiolabeled mAb was submitted to in vivo, in vitro and ex vivo biological studies. For the direct labeling, RTX was reducing by incubation with 2-mercaptoethanol for generating sulphydryl groups (-SH) and further labeled with 188 Re(V), in a study of several parameters in order to reach an optimized formulation. The labeling via the carbonyl nucleus both 99 mTc and 188 Re were employed through 2 different procedures: (1) labeling of intact RTX with 99 mTc(I) and (2) reduced RTX (RTX red ) labeled with 99 mTc(I)/ 188 Re(I). Also a parameter study was performed to obtain an optimized formulation. The quality control method for evaluating the radiochemical purity showed a good labeling yield (93%) for the direct method. The labeling method via carbonyl group, the results showed that the - SH groups of RTX red are a possible way of labeling
International Nuclear Information System (INIS)
Yakita, H.; Ogino, H.; Sala, A.; Okada, T.; Yamamoto, A.; Kishio, K.; Iyo, A.; Eisaki, H.; Shimoyama, J.
2015-01-01
Highlights: • We synthesized Co or Ni co-doped (Ca, RE)FeAs_2 with RE = La–Gd. • Co or Ni co-doping improved superconducting properties of all (Ca, RE)FeAs_2 samples. • T_c of (Ca, RE)FeAs_2 decreased with decreasing ionic radii of RE"3"+. • Eu doped samples showed exceptionally low T_c and long interlayer distance. • Long interlayer distance of Eu doped samples suggested co-existence of Eu"2"+ and Eu"3"+. - Abstract: Dependence of superconducting properties of (Ca, RE)(Fe, TM)As_2 [(Ca, RE)112, TM: Co, Ni)] on RE elements (RE = La–Gd) was systematically investigated. Improvement of superconducting properties by Co or Ni co-doping was observed for all (Ca, RE)112, which is similar to Co-co-doped (Ca, La)112 or (Ca, Pr)112. T_c of Co-co-doped samples decreased from 38 K for RE = La to 29 K for RE = Gd with decreasing ionic radii of RE"3"+. However, Co-co-doped (Ca, Eu)112 showed exceptionally low T_c = 21 K probably due to the co-existence of Eu"3"+ and Eu"2"+ suggested by longer interlayer distance d_F_e_–_F_e of (Ca, Eu)112 than other (Ca, RE)112.
Signorini, Sergio R.; McClain, Charles R.; Christian, James R.
2001-01-01
An ecosystem-carbon cycle model is used to analyze the biogeochemical-physical interactions and carbon fluxes in the Bermuda Atlantic Time-series Study (BATS) site for the period of 1992-1998. The model results compare well with observations (most variables are within 8% of observed values). The sea-air flux ranges from -0.32 to -0.50 mol C/sq m/yr, depending upon the gas transfer algorithm used. This estimate is within the range (-0.22 to -0.83 mol C/sq m/yr) of previously reported values which indicates that the BATS region is a weak sink of atmospheric CO2. The overall carbon balance consists of atmospheric CO2 uptake of 0.3 Mol C/sq m/yr, upward dissolved inorganic carbon (DIC) bottom flux of 1.1 Mol C/sq m/yr, and carbon export of 1.4 mol C/sq m/yr via sedimentation. Upper ocean DIC levels increased between 1992 and 1996 at a rate of approximately 1.2 (micro)mol/kg/yr, consistent with observations. However, this trend was reversed during 1997-1998 to -2.7 (micro)mol/kg/yr in response to hydrographic changes imposed by the El Nino-La Nina transition, which were manifested in the Sargasso Sea by the warmest SST and lowest surface salinity of the period (1992-1998).
Radioanalysis of RE enrichment of ion adsorption type RE ores
Zhao Shu Quan; Hu He Ping; Li Fu Sheng; Chen Ying Min; LiuShiMing
2002-01-01
Objective: To analyze the radioactivity in Rare Earth (RE) enrichment of ion adsorption type RE ores. Methods: Using HPGe-gamma spectrometer to analyze the activity ratio of gamma radionuclides in kind of samples, using FJ-2603 low background alpha, beta measurement apparatus to measure their total alpha and total beta activities, and using X-ray fluorescence spectrometer to analyze contents of La sub 2 O sub 3 and Y sub 2 O sub 3 , respectively. Results: HPGe gamma spectroscopy and X-ray fluorescence spectroscopy are simple, convenient and non-destructive methods of analyzing radionuclides and La sub 2 O sub 3 , Y sub 2 O sub 3 in RE enrichment of ion adsorption type RE ores, respectively. Conclusion: The basic data were provided for radiation protection and treatment of gas, liquid and solid waste in RE production of ion adsorption type RE ores; method and experience were provided for studying ion adsorption type RE ores
12 CFR 516.110 - Who may submit a written comment?
2010-01-01
... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Who may submit a written comment? 516.110 Section 516.110 Banks and Banking OFFICE OF THRIFT SUPERVISION, DEPARTMENT OF THE TREASURY APPLICATION PROCESSING PROCEDURES Comment Procedures § 516.110 Who may submit a written comment? Any person may submit a...
29 CFR 4010.13 - Confidentiality of information submitted.
2010-07-01
... REPORTING AND DISCLOSURE REQUIREMENTS ANNUAL FINANCIAL AND ACTUARIAL INFORMATION REPORTING § 4010.13 Confidentiality of information submitted. In accordance with § 4901.21(a)(3) of this chapter and ERISA section... 29 Labor 9 2010-07-01 2010-07-01 false Confidentiality of information submitted. 4010.13 Section...
Horst, P. A.; Maurrasse, F. J.; Sinninghe-Damsté, J. S.; Sandler, A.
2008-05-01
Chemostratigraphic studies of DSDP Site 386 on the Bermuda Rise and Site 144 on the Demerara Rise indicate that euxinic conditions developed at these deep-water sites during the time interval that corresponds to Oceanic Anoxic Event 2 (OAE 2). The data show a large increase in Fe/Al ratios, and dispersed pyrite aggregates (Site 386 Core 43, Section 3). Such findings at these deep oceanic sites are compatible with earlier studies showing that sediments in euxinic settings display increases in Fe/Al ratios due to the scavenging of dissolved Fe, and is also in agreement with previous Pr/Ph ratio of cyanobacteria showing low thermal stress, supporting in situ derivation. Elemental analyses at Site 386 also show that relatively high Sr/CaO ratios are present before and after OAE 2, indicating an increased contribution of biogenic carbonates, but not during the C/T boundary event. When Cr is plotted against Al2O3 in conjunction with a solid line representing the Cr/Al2O3 ratio in average shale, half of the samples fall above and half fall below this line. The values that plot above this line are all from Cores 47, 44, 43, and 42, which contain higher TOC. Their strong Cr enrichment with respect to the average shale can be indicative of an algal source of the OM, as this biota preferentially concentrates Cr. Competitive exclusion due to dominance of opportunistic prokaryotic blooms in combination with oxygen depletion can be invoked to explain the conditions that developed and were unfavorable to most other organisms throughout the water column during OAE 2. Sediments from DSDP Site 144 also reveal increased molecular fossils indicative of green sulfur bacteria, which are further characteristic of euxinic conditions (Kuypers et al., 2002; Forster et al., 2004). These results are in agreement with earlier works that showed lipids at DSDP Site 144 are predominantly of an autochthonous origin with primary production as the dominant source (Simoneit and Stuermer, 1982
Directory of Open Access Journals (Sweden)
Marco eCostanzi
2014-08-01
Full Text Available Fear allows organisms to cope with dangerous situations and remembering these situations has an adaptive role preserving individuals from injury and death. However, recalling traumatic memories can induce re-experiencing the trauma, thus resulting in a maladaptive fear. A failure to properly regulate fear responses has been associated with anxiety disorders, like Posttraumatic Stress Disorder (PTSD. Thus, re-establishing the capability to regulate fear has an important role for its adaptive and clinical relevance. Strategies aimed at erasing fear memories have been proposed, although there are limits about their efficiency in treating anxiety disorders. To re-establish fear regulation, here we propose a new approach, based on the re-evaluation of the aversive value of traumatic experience. Mice were submitted to a contextual-fear-conditioning paradigm in which a neutral context was paired with an intense electric footshock. Three weeks after acquisition, conditioned mice were treated with a less intense footshock (pain threshold. The effectiveness of this procedure in reducing fear expression was assessed in terms of behavioral outcomes related to PTSD (e.g. hyper-reactivity to a neutral tone, anxiety levels in a plus maze task, social avoidance, and learning deficits in a spatial water maze and of amygdala activity by evaluating c-fos expression. Furthermore, a possible role of lateral orbitofrontal cortex (lOFC in mediating the behavioral effects induced by the re-evaluation procedure was investigated. We observed that this treatment (i significantly mitigates the abnormal behavioral outcomes induced by trauma, (ii persistently attenuates fear expression without erasing contextual memory, (iii prevents fear reinstatement, (iv reduces amygdala activity and (v requires an intact lOFC to be effective.The results suggest that an effective strategy to treat pathological anxiety should address cognitive re-evaluation of traumatic experiences
30 CFR 285.607 - How do I submit my SAP?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How do I submit my SAP? 285.607 Section 285.607... Assessment Plan and Information Requirements for Commercial Leases § 285.607 How do I submit my SAP? You must submit one paper copy and one electronic version of your SAP to MMS at the address listed in § 285.110(a). ...
A Checklist for Submitting Your Risk Management Plan (RMP)
Important information about 2014 submissions and a checklist to consider in preparing and resubmitting a 5-year update, as required by 40 CFR part 68. Use the RMP*eSubmit software application, which replaced RMP*Submit.
Directory of Open Access Journals (Sweden)
Linda Monica Premazzi
2011-03-01
Full Text Available Com o objetivo de avaliar a influência de doses e épocas de aplicação de nitrogênio após o corte no fator de correção de área foliar, na taxa de alongamento de folhas e no comprimento e área da lâmina foliar do capim-bermuda tifton 85 (Cynodon spp foram conduzidos dois experimentos em casa de vegetação. Ambos os experimentos foram estabelecidos em vasos com capacidade para 7 kg de terra, com solo classificado como Neossolo Quartzarênico Órtico típico, em esquema fatorial 4 × 2, para avaliação de quatro doses de nitrogênio (0, 80, 160 e 240 mg kg-1 de solo e duas épocas de aplicação (imediatamente após o corte e sete dias após o corte das plantas. O delineamento experimental foi em blocos completos ao acaso, com quatro repetições. Com o fornecimento de nitrogênio, observou-se diminuição no fator de correção de área foliar. O nitrogênio proporciona variação positiva no comprimento foliar, na área da lâmina foliar e na taxa de alongamento da folha, variações que ocorreram em maior grandeza entre a não-aplicação de nitrogênio e a dose de 80 mg kg-1 de solo.With the objective of evaluating the influence of nitrogen rates and application time after cutting on correction factor for leaf area, on leaf elongation rate and on blade leaf length and area of tifton 85 bermudagrass (Cynodon spp, two experiments were carried out in a greenhouse. Both experiments were established in pots with capacity for 7 kg of soil classified as Entisol, in a 4 × 2 factorial scheme, for evaluation of four nitrogen rates (0, 80, 160 and 240 mg kg-1 of soil and two application times (immediately after cutting and seven days after cutting of the plants. It was used a complete randomized block design, with four replications. As nitrogen was supplied, it was observed a decrease in the correction factor for leaf area. There is a predominance of positive effects of nitrogen on leaf length, on leaf blade area and on leaf elongation rate
42 CFR 405.809 - Opportunity to submit evidence.
2010-10-01
... 42 Public Health 2 2010-10-01 2010-10-01 false Opportunity to submit evidence. 405.809 Section 405.809 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES MEDICARE PROGRAM FEDERAL HEALTH INSURANCE FOR THE AGED AND DISABLED Appeals Under the Medicare Part B Program § 405.809 Opportunity to submit...
Spontaneous growth of whiskers on RE-bearing intermetallic compounds of Sn-RE, In-RE, and Pb-RE
International Nuclear Information System (INIS)
Liu Meng; Xian Aiping
2009-01-01
A phenomenon of the whiskers growth on the bulk rare earth (RE)-intermetallic compounds of NdSn 3 , NdIn 3 , and LaPb 3 is reported. The whiskers formed spontaneously on all of the RE-intermetallic compounds after exposed to room ambience (21-28 deg. C/20-56% RH, relative humidity) for several days. Among the samples, the propensity of whisker growth for NdSn 3 is the strongest, on which the tin whiskers were flourishing and covered all of the surfaces after exposed to room ambience for 22 days; while LaPb 3 is the secondary and NdIn 3 is the last one. Observed by SEM, the whiskers were exhibited as different morphology, size, and number density. The XRD analysis confirms the existence of RE(OH) 3 after whiskers formed, also, the weight gain curve of the samples exposed to room ambience supports that a spontaneous chemical reaction of the RE-intermetallic compounds with water in room ambience takes place. In discussion, it is proposed that the fresh metal atoms released by the chemical reaction could be causative to result in nucleation and spontaneous growth of the whiskers, while the anisotropy of crystal structure could be a reason to understand the difference of the whisker growth behaviors between Sn and Pb.
Epitaxial growth of ReS2(001) thin film via deposited-Re sulfurization
Urakami, Noriyuki; Okuda, Tetsuya; Hashimoto, Yoshio
2018-02-01
In this paper, we present the formation of large-size rhenium disulfide (ReS2) films via the sulfurization of Re films deposited on sapphire substrates. The effects of sulfurization temperature and pressure on the crystal quality were investigated. A [001]-oriented single crystal of ReS2 films with 6 × 10 mm2 area was realized. By sulfurizing Re films at 1100 °C, ReS2 films with well-defined sharp interfaces to c-plane sapphire substrates could be formed. Below and above the sulfurization temperature of 1100 °C, incomplete sulfurization and film degradation were observed. The twofold symmetry of the monocrystalline in-plane structure composed of Re-Re bonds along with Re-S bonds pointed to a distorted 1T structure, indicating that this structure is the most stable atomic arrangement for ReS2. For a S/Re compositional ratio equal to or slightly lower than 2.0, characteristic Raman vibrational modes with the narrowest line widths were observed. The typical absorption peak of ReS2 can be detected at 1.5 eV.
Adaptive prostate IGRT combining online re-optimization and re-positioning: a feasibility study
International Nuclear Information System (INIS)
Li Taoran; Zhu Xiaofeng; Lee, W Robert; Vujaskovic, Zeljko; Yin Fangfang; Wu, Q Jackie; Thongphiew, Danthai
2011-01-01
In prostate radiation therapy, inter-fractional organ motion/deformation has posed significant challenges on reliable daily dose delivery. To correct for this issue, off-line re-optimization and online re-positioning have been used clinically. In this paper, we propose an adaptive images guided radiation therapy (AIGRT) scheme that combines these two correction methods in an anatomy-driven fashion. The AIGRT process first tries to find a best plan for the daily target from a plan pool, which consists of the original CT plan and all previous re-optimized plans. If successful, the selected plan is used for daily treatment with translational shifts. Otherwise, the AIGRT invokes the re-optimization process of the CT plan for the anatomy of the day, which is afterward added to the plan pool as a candidate for future fractions. The AIGRT scheme is evaluated by comparisons with daily re-optimization and online re-positioning techniques based on daily target coverage, organs at risk (OAR) sparing and implementation efficiency. Simulated treatment courses for 18 patients with re-optimization alone, re-positioning alone and AIGRT shows that AIGRT offers reliable daily target coverage that is highly comparable to daily re-optimization and significantly improves from re-positioning. AIGRT is also seen to provide improved OAR sparing compared to re-positioning. Apart from dosimetric benefits, AIGRT in addition offers an efficient scheme to integrate re-optimization to current re-positioning-based IGRT workflow.
DEFF Research Database (Denmark)
Pallassana, Venkataraman; Neurock, Matthew; Hansen, Lars Bruno
1999-01-01
not appear to provide an independent parameter for assessing surface reactivity. The weak chemisorption of hydrogen on the Pd-ML/Re(0001) surface relates to substantial lowering of the d-band center of Pd, when it is pseudomorphically deposited as a monolayer on a Re substrate. [S0163-1829(99)00331-2].......Gradient-corrected density-functional theory (DFT-GGA) periodic slab calculations have been used to analyze the binding of atomic hydrogen on monometallic Pd(111), Re(0001), and bimetallic Pd-mL/Re(0001) [pseudomorphic monolayer of Pd(111) on Re(0001)] and Re-ML/Pd(111) surfaces. The computed...
Spontaneous growth of whiskers on RE-bearing intermetallic compounds of Sn-RE, In-RE, and Pb-RE
Energy Technology Data Exchange (ETDEWEB)
Liu Meng [Shenyang National Laboratory for Materials Science, Institute of Metal Research, Chinese Academy of Science, 72 Wenhua Road, Shenyang 110016 (China); Xian Aiping, E-mail: ap.xian@imr.ac.c [Shenyang National Laboratory for Materials Science, Institute of Metal Research, Chinese Academy of Science, 72 Wenhua Road, Shenyang 110016 (China)
2009-11-03
A phenomenon of the whiskers growth on the bulk rare earth (RE)-intermetallic compounds of NdSn{sub 3}, NdIn{sub 3}, and LaPb{sub 3} is reported. The whiskers formed spontaneously on all of the RE-intermetallic compounds after exposed to room ambience (21-28 deg. C/20-56% RH, relative humidity) for several days. Among the samples, the propensity of whisker growth for NdSn{sub 3} is the strongest, on which the tin whiskers were flourishing and covered all of the surfaces after exposed to room ambience for 22 days; while LaPb{sub 3} is the secondary and NdIn{sub 3} is the last one. Observed by SEM, the whiskers were exhibited as different morphology, size, and number density. The XRD analysis confirms the existence of RE(OH){sub 3} after whiskers formed, also, the weight gain curve of the samples exposed to room ambience supports that a spontaneous chemical reaction of the RE-intermetallic compounds with water in room ambience takes place. In discussion, it is proposed that the fresh metal atoms released by the chemical reaction could be causative to result in nucleation and spontaneous growth of the whiskers, while the anisotropy of crystal structure could be a reason to understand the difference of the whisker growth behaviors between Sn and Pb.
30 CFR 218.580 - When do I submit Form MMS-4444?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false When do I submit Form MMS-4444? 218.580 Section 218.580 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE... Correspondence § 218.580 When do I submit Form MMS-4444? Initially, you must submit MMS Form-4444 by November 29...
45 CFR 149.320 - Universe of claims that must be submitted.
2010-10-01
... 45 Public Welfare 1 2010-10-01 2010-10-01 false Universe of claims that must be submitted. 149.320 Section 149.320 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES REQUIREMENTS RELATING TO HEALTH... Universe of claims that must be submitted. (a) Claims submitted for an early retiree, as defined in § 149.2...
Crystal structure of R.E. NiSn and R.E. PdSn equiatomic compounds
International Nuclear Information System (INIS)
Dwight, A.E.
1983-03-01
Call constants and volume per formula weight are tabulated for RE NiSn (RE = La to Lu, Y) and RE PdSn (RE = Nd to Ho). The unit cell constants are also plotted versus ionic radius of the RE; trends are noted
2011-07-08
... NUCLEAR REGULATORY COMMISSION [Docket No. 50-244; Docket No. 72-67] R.E. Ginna Nuclear Power Plant, LLC, R.E. Ginna Nuclear Power Plant, R.E. Ginna Independent Spent Fuel Storage Installation; Notice of... Facility Operating License No. DPR-18, for the R.E. Ginna Nuclear Power Plant (Ginna), currently held by R...
33 CFR 160.210 - Methods for submitting an NOA.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Methods for submitting an NOA... Conditions, and Certain Dangerous Cargos § 160.210 Methods for submitting an NOA. (a) Submission to the... the NVMC web site at http://www.nvmc.uscg.gov; (ii) Electronic submission of Extensible Markup...
30 CFR 218.560 - How do I submit Form MMS-4444?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How do I submit Form MMS-4444? 218.560 Section... Correspondence § 218.560 How do I submit Form MMS-4444? A copy of Form MMS-4444 and instructions may be obtained from MMS. It will also be posted on the MMS Web site. Submit the completed, signed form to the address...
30 CFR 210.101 - Who must submit production reports?
2010-07-01
... MANAGEMENT FORMS AND REPORTS Production Reports-Oil and Gas § 210.101 Who must submit production reports? (a... operator number. To obtain an operator number, refer to the MMS Minerals Production Reporter Handbook for... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Who must submit production reports? 210.101...
(ReTranslating as Re-membering
Directory of Open Access Journals (Sweden)
Julie Tarif
2016-07-01
Full Text Available This paper explores how (retranslation – interlingual and intersemiotic – can be perceived as a way of both remembering the literary legacy of other cultures but also as a way of re-membering/re-generating the body of literature(s of the importing culture. It focuses on what is called “a classic” and anchors its reflexion in polysystem theory and in the metaphorical vision of literary works as an organic living body. To do so, it concentrates on the British literary classic Oliver Twist and its translations and adaptations into French. The article addresses the following questions: What is to be remembered of certain works? Why, how and by whom are those works remembered?
40 CFR 60.2900 - When must I submit my waste management plan?
2010-07-01
... 40 Protection of Environment 6 2010-07-01 2010-07-01 false When must I submit my waste management... Waste Management Plan § 60.2900 When must I submit my waste management plan? You must submit a waste management plan prior to commencing construction, reconstruction, or modification. ...
International Nuclear Information System (INIS)
Colle, R.; Unterweger, M.P.; Hutchinson, J.M.R.
1996-01-01
As part of an international measurement intercomparison of instruments used to measure atmospheric 222 Rn, four participating laboratories made nearly simultaneous measurements of 222 Rn activity concentration in commonly sampled, ambient air over approximately a 2 week period, and three of these four laboratories participated in the measurement comparison of 14 introduced samples with known, but undisclosed (blind) 222 Rn activity concentration. The exercise was conducted in Bermuda in October 1991. The 222 Rn activity concentrations in ambient Bermudian air over the course of the intercomparison ranged from a few hundredths of a Bq · m -3 to about 2 Bq · m -3 , while the standardized sample additions covered a range from approximately 2.5 Bq · m -3 to 35 Bq · m -3 . The overall uncertainty in the latter concentrations was in the general range of 10%, approximating a 3 standard deviation uncertainty interval. The results of the intercomparison indicated that two of the laboratories were within very good agreement with the standard additions, and almost within expected statistical variations. These same two laboratories, however, at lower ambient concentrations, exhibited a systematic difference with an averaged offset of roughly 0.3 Bq · m -3 . The third laboratory participating in the measurement of standardized sample additions was systematically low by about 65% to 70%, with respect to the standard addition which was also confirmed in their ambient air concentration measurements. The fourth laboratory, participating in only the ambient measurement part of the intercomparison, was also systematically low by at least 40% with respect to the first two laboratories
Norris Reinero, Carol R; Decile, Kendra C; Berghaus, Roy D; Williams, Kurt J; Leutenegger, Christian M; Walby, William F; Schelegle, Edward S; Hyde, Dallas M; Gershwin, Laurel J
2004-10-01
Animal models are used to mimic human asthma, however, not all models replicate the major characteristics of the human disease. Spontaneous development of asthma with hallmark features similar to humans has been documented to occur with relative frequency in only one animal species, the cat. We hypothesized that we could develop an experimental model of feline asthma using clinically relevant aeroallergens identified from cases of naturally developing feline asthma, and characterize immunologic, physiologic, and pathologic changes over 1 year. House dust mite (HDMA) and Bermuda grass (BGA) allergen were selected by screening 10 privately owned pet cats with spontaneous asthma using a serum allergen-specific IgE ELISA. Parenteral sensitization and aerosol challenges were used to replicate the naturally developing disease in research cats. The asthmatic phenotype was characterized using intradermal skin testing, serum allergen-specific IgE ELISA, serum and bronchoalveolar lavage fluid (BALF) IgG and IgA ELISAs, airway hyperresponsiveness testing, BALF cytology, cytokine profiles using TaqMan PCR, and histopathologic evaluation. Sensitization with HDMA or BGA in cats led to allergen-specific IgE production, allergen-specific serum and BALF IgG and IgA production, airway hyperreactivity, airway eosinophilia, an acute T helper 2 cytokine profile in peripheral blood mononuclear cells and BALF cells, and histologic evidence of airway remodeling. Using clinically relevant aeroallergens to sensitize and challenge the cat provides an additional animal model to study the immunopathophysiologic mechanisms of allergic asthma. Chronic exposure to allergen in the cat leads to a variety of immunologic, physiologic, and pathologic changes that mimic the features seen in human asthma.
40 CFR 62.14715 - When must I submit my waste management plan?
2010-07-01
... 40 Protection of Environment 8 2010-07-01 2010-07-01 false When must I submit my waste management... submit my waste management plan? You must submit the waste management plan no later than April 5, 2004. ... POLLUTANTS Federal Plan Requirements for Commercial and Industrial Solid Waste Incineration Units That...
40 CFR 60.2060 - When must I submit my waste management plan?
2010-07-01
... 40 Protection of Environment 6 2010-07-01 2010-07-01 false When must I submit my waste management... Management Plan § 60.2060 When must I submit my waste management plan? You must submit a waste management... Commercial and Industrial Solid Waste Incineration Units for Which Construction Is Commenced After November...
Re-thinking residential mobility
van Ham, Maarten; Findlay, Allan M.
2015-01-01
While researchers are increasingly re-conceptualizing international migration, far less attention has been devoted to re-thinking short-distance residential mobility and immobility. In this paper we harness the life course approach to propose a new conceptual framework for residential mobility research. We contend that residential mobility and immobility should be re-conceptualized as relational practices that link lives through time and space while connecting people to structural conditions. Re-thinking and re-assessing residential mobility by exploiting new developments in longitudinal analysis will allow geographers to understand, critique and address pressing societal challenges. PMID:27330243
Synthesis of {sup 188}Re-DMSA complex using carrier-free {sup 188}Re
Energy Technology Data Exchange (ETDEWEB)
Hashimoto, Kazuyuki; Izumo, Mishiroku [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Islam, M S
1997-03-01
The synthesis of rhenium-DMSA labelled compound using carrier-free {sup 188}Re from the {sup 188}W/{sup 188}Re generator has been carried out. Stannous chloride was used as the reducing agent for reduction of rhenium and ascorbic acid was used as an antioxidant in the reaction media. The dependence of the yield of Re-DMSA complex upon the concentration of reducing agent, pH, reaction time, anti-oxidant, carrier and temperature was investigated. Under optimum conditions, the yield of Re-DMSA complexes were more than 98% for the carrier-free as well as carrier-added {sup 188}Re. The stability of the Re-DMSA complexes at different pH and time were also investigated. It was found that the Re-DMSA complex was very stable and did not undergo any changes or decomposition with the changes of pH from its initial values even after 48 hours of pH change for carrier-free as well as carrier-added complexes. (author)
45 CFR 2523.110 - Can Federal agencies submit multiple applications?
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Can Federal agencies submit multiple applications? 2523.110 Section 2523.110 Public Welfare Regulations Relating to Public Welfare (Continued) CORPORATION... AMERICORPS PROGRAM ASSISTANCE § 2523.110 Can Federal agencies submit multiple applications? No. The...
40 CFR 60.3011 - When must I submit my waste management plan?
2010-07-01
... 40 Protection of Environment 6 2010-07-01 2010-07-01 false When must I submit my waste management... Model Rule-Waste Management Plan § 60.3011 When must I submit my waste management plan? You must submit a waste management plan no later than 60 days following the initial performance test as specified in...
40 CFR 62.14585 - When must I submit my waste management plan?
2010-07-01
... 40 Protection of Environment 8 2010-07-01 2010-07-01 false When must I submit my waste management... Commenced Construction On or Before November 30, 1999 Waste Management Plan § 62.14585 When must I submit my waste management plan? You must submit a waste management plan no later than April 5, 2004. ...
Sundfeld, Daniel; Pavani, Caio Cesar; Schott, Timm Cornelius; Machado, Lucas Silveira; Pini, Núbia Inocêncya Pavesi; Bertoz, André Pinheiro de Magalhães; Sundfeld, Renato Herman
2018-04-20
The present dental bleaching case report describes a new method that precisely quantifies the daily wearing-times of the bleaching product by inserting a microsensor in the acetate custom tray. The bleaching efficacy was also discussed since the patient was previously submitted to enamel microabrasion. The patient was submitted to enamel microabrasion in 1987, and bleaching treatment was performed in 2005. In 2017, re-bleaching was executed using 10% peroxide carbamide. The electronic microsensor, TheraMon (TheraMon® microelectronic system; Sales Agency Gschladt, Hargelsberg, Austria), was embedded in the labial region of the upper and lower acetate trays to evaluate the wearing-times of the acetate trays/bleaching product. The patient was instructed to wear the tray for 6 to 8 h/day while sleeping. After 24 days of bleaching treatment, the data obtained from the TheraMon electronic devices was collected and interpreted. The patient did not entirely follow the bleaching treatment as recommended, as there was no evidence of use of the upper and lower trays for some days; additionally, the bleaching product was used for shorter and longer periods than was instructed. The TheraMon microeletronic device precisely measured the wearing-times of the acetate tray/bleaching product during the bleaching treatment. Teeth submitted to enamel microabrasion presented with a healthy clinical appearance after 30 years. Measuring the length and frequency of use of an acetate tray/bleaching product can be important to clinicians and patients for obtaining a controlled and adequate bleaching treatment.
Re-annotation and re-analysis of the Campylobacter jejuni NCTC11168 genome sequence
Directory of Open Access Journals (Sweden)
Dorrell Nick
2007-06-01
Full Text Available Abstract Background Campylobacter jejuni is the leading bacterial cause of human gastroenteritis in the developed world. To improve our understanding of this important human pathogen, the C. jejuni NCTC11168 genome was sequenced and published in 2000. The original annotation was a milestone in Campylobacter research, but is outdated. We now describe the complete re-annotation and re-analysis of the C. jejuni NCTC11168 genome using current database information, novel tools and annotation techniques not used during the original annotation. Results Re-annotation was carried out using sequence database searches such as FASTA, along with programs such as TMHMM for additional support. The re-annotation also utilises sequence data from additional Campylobacter strains and species not available during the original annotation. Re-annotation was accompanied by a full literature search that was incorporated into the updated EMBL file [EMBL: AL111168]. The C. jejuni NCTC11168 re-annotation reduced the total number of coding sequences from 1654 to 1643, of which 90.0% have additional information regarding the identification of new motifs and/or relevant literature. Re-annotation has led to 18.2% of coding sequence product functions being revised. Conclusions Major updates were made to genes involved in the biosynthesis of important surface structures such as lipooligosaccharide, capsule and both O- and N-linked glycosylation. This re-annotation will be a key resource for Campylobacter research and will also provide a prototype for the re-annotation and re-interpretation of other bacterial genomes.
Energy Technology Data Exchange (ETDEWEB)
Pham, Q.T
2006-03-15
The aim of this thesis is to characterize by experimental and numerical approaches the hydric, mechanical and hydro-mechanical effects due to the desaturation and re-saturation of the Eastern argillite, host rock of the Bure site, future underground radioactive waste disposal facility. Experimental and numerical approaches for the characterization of hydric transfers in argilites are presented. A simple identification method is proposed which uses the determination of the linearized hydric diffusivity from weight measurements performed on samples (thin tubes and plates) submitted to humidity steps according to a desaturation-re-saturation cycle. The hydric transfer is nonlinear. In order to interpret this phenomenon, a non-linear numerical model is established which takes into account the physical phenomena (hydraulic conduction, vapor diffusion, phase change..). The evolution of the physical and mechanical behaviour of the argillaceous rock with respect to the imposed humidity is then analyzed according to a desaturation-re-saturation cycle by successive steps. The hydric deformation, the velocity of ultrasonic waves propagation, the elastic properties, the rupture characteristics and the delayed phenomena depend on the hydric state of the material. The desaturation and re-saturation influence on a scale model of tunnel is analyzed. Thick tubes parallel or perpendicular to the stratification are used to show up the anisotropy of the rock. These tubes are submitted to hydric loads by blowing air with variable hygrometry through their center hole. A nonlinear poro-elastic model is used to interpret the anisotropic hydro-mechanical phenomena observed. It is shown that hydric loads can lead to the rupture of test samples which follow the anisotropic directions of the rock and which can be interpreted by the hydro-mechanical model as a violation of a rupture criterion in total pulling stress. Finally, numerical calculations for the phenomena generated by desaturation
40 CFR 60.2625 - When must I submit my waste management plan?
2010-07-01
... 40 Protection of Environment 6 2010-07-01 2010-07-01 false When must I submit my waste management... or Before November 30, 1999 Model Rule-Waste Management Plan § 60.2625 When must I submit my waste management plan? You must submit a waste management plan no later than the date specified in table 1 of this...
21 CFR 803.13 - Do I need to submit reports in English?
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Do I need to submit reports in English? 803.13... in English? (a) Yes. You must submit all written or electronic equivalent reports required by this part in English. (b) If you submit any reports required by this part in an electronic medium, that...
Labelling of Re-ABP with 188Re for bone pain palliation
International Nuclear Information System (INIS)
Arteaga de Murphy, Consuelo; Ferro-Flores, Guillermina; Pedraza-Lopez, Martha; Melendez-Alafort, Laura; Croft, B.Y.Barbara Y.; Ramirez, Flor de Maria; Padilla, Juan
2001-01-01
Etidronate and medronate have been labelled with technetium-99m ( 99m Tc-HEDP, 99m Tc-MDP) for bone scanning and, with rhenium-188 ( 188 Re-HEDP) to palliate the pain resulting from bone metastases. The objective of this study was to label alendronate, ABP, a new bisphosphonate, with SnF 2 -reduced- 188 Re. The reagents for the 5 mg ABP kit were SnF 2 , KReO 4 and gentisic acid at acid pH. The chemical, spectroscopic and microscopic characteristics, quality control, rat bone uptake of [ 188 Re]Re-ABP and similarities with 99m Tc-ABP are presented. We conclude that this is a promising new radiopharmaceutical for bone metastases pain palliation
Directory of Open Access Journals (Sweden)
Andy Petroianu
2008-09-01
Full Text Available objective: To evaluate the follow-up of patients submitted to splenectomy with preservation of the upper splenic pole. Methods: All patients undergoing subtotal splenectomy were invited to be reviewed. A total of 86 patients submitted to this surgery were studied. The procedure was performed due to one of the following conditions: portal hypertension due to schistosomiasis (n = 43, trauma (n = 31, Gaucher’s disease (n = 4, myeloid hepatosplenomegaly due to myelofibrosis (n = 3, splenomegalic retarded growth and sexual development (n = 2, severe pain due to splenic ischemia (n = 2 and pancreatic cystadenoma (n = 1. All patients underwent hematologic tests, immunological assessment, abdominal ultrasonography, computed tomography (CT, scintigraphy and endoscopy. Rresults: Increased white blood cell and platelet counts were the only hematological abnormalities. No immune deficit was found. Esophageal varices were still present in patients who underwent surgery because of portal hypertension, but none had a re-bleeding event. The ultrasonography, tomography and scintigraphy confirmed the presence of functional splenic remnants without significant size alteration. Conclusions: Subtotal splenectomy seems to be a safe procedure that can be useful to treat conditions involving the spleen. The functions of the splenic remnants are preserved during long periods of time.
40 CFR 167.90 - Where to obtain and submit forms.
2010-07-01
... establishments not found at the same location as their company headquarters, must submit applications and reports... establishments not found at the same location as their company headquarters to be submitted by the company headquarters to the Regional Office having jurisdiction over the State in which the company headquarters is...
30 CFR 253.40 - What OSFR evidence must I submit to MMS?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What OSFR evidence must I submit to MMS? 253.40... § 253.40 What OSFR evidence must I submit to MMS? (a) You must submit to MMS: (1) A single demonstration... unaltered Form MMS-1016; (3) MMS forms that identify your COFs (Form MMS-1021, Form MMS-1022), and the...
39 CFR 912.7 - Evidence and information to be submitted.
2010-07-01
... bearing on either the responsibility of the United States for the death or the damages claimed. (b... and information to be submitted. (a) Death. In support of a claim based on death, the claimant may be required to submit the following evidence or information: (1) An authenticated death certificate or other...
31 CFR 375.12 - How do I submit an offer?
2010-07-01
... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false How do I submit an offer? 375.12 Section 375.12 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL... way for any unauthorized tender submissions or for any delays, errors, or omissions in submitting...
10 CFR 14.23 - Evidence and information to be submitted.
2010-01-01
... and death. (8) Any other evidence or information which may have a bearing on either the responsibility... Procedures and Requirements § 14.23 Evidence and information to be submitted. (a) Death. In support of a claim based on death, the claimant may be required to submit the following evidence or information: (1...
76 FR 26223 - Petition for Rulemaking Submitted by Thomas Popik
2011-05-06
... Rulemaking Submitted by Thomas Popik AGENCY: Nuclear Regulatory Commission. ACTION: Petition for rulemaking... filed with the NRC by Thomas Popik. The petition was docketed by the NRC on March 15, 2011, and has been... received a petition for rulemaking on March 14, 2011 (PRM- 50-96). The petition was submitted by Mr. Thomas...
44 CFR 65.4 - Right to submit new technical data.
2010-10-01
... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Right to submit new technical... IDENTIFICATION AND MAPPING OF SPECIAL HAZARD AREAS § 65.4 Right to submit new technical data. (a) A community has..., other than those initiatedby FEMA, must be made in writing by the Chief Executive Officer of the...
37 CFR 2.54 - Requirements for drawings submitted on paper.
2010-07-01
... submitted on paper. 2.54 Section 2.54 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK... drawings submitted on paper. The drawing must meet the requirements of § 2.52. In addition, in a paper submission, the drawing should: (a) Be on non-shiny white paper that is separate from the application; (b) Be...
15 CFR 325.14 - Submitting reports.
2010-01-01
... 15 Commerce and Foreign Trade 2 2010-01-01 2010-01-01 false Submitting reports. 325.14 Section 325.14 Commerce and Foreign Trade Regulations Relating to Commerce and Foreign Trade (Continued) INTERNATIONAL TRADE ADMINISTRATION, DEPARTMENT OF COMMERCE MISCELLANEOUS REGULATIONS EXPORT TRADE CERTIFICATES...
Lapointe, Brian E.; O'Connell, Julie
1989-04-01
The green alga Cladophora prolifera (Chlorophyta, Cladophorales) has formed widespread blooms in Bermuda's inshore waters during the past 20 years, but, to date, no conclusive evidence links these blooms to nutrient enrichment. This study assessed the nutrient-dependance of productivity of Cladophora collected from Harrington Sound, a confined P-limited marine system where Cladophora first became abundant. Both N- and P-enrichment decreased the doubling time of Cladophora, which ranged from 14 days (with N and P enrichment) to 100 days (without enrichment). Nutrient enrichment also enhanced the light-saturated photosynthetic capacity (i.e. P max) of Cladophora, which ranged from 0·50 mg C g dry wt -1 h -1 (without enrichment) to 1·0 mg C g dry wt -1 h -1 (with enrichment). Tissue C:N, C:P and N:P ratios of unenriched Cladophora were elevated—25, 942, and 49, respectively—levels that suggest limitation by both N and P but primary limitation by P. Pore-waters under Cladophora mats had reduced salinities, elevated concentrations of NH 4, and high N:P ratios (N:P of 85), suggesting that N-rich groundwater seepage enriches Cladophora mats. The alkaline phosphatase capacity of Cladophora was high compared to other macroalgae in Harrington Sound, and its capacity was enhanced by N-enrichment and suppressed by P-enrichment. Because the productivity of Cladophora is nutrient-limited in shallow waters of Harrington Sound, enhanced growth and increased biomass of Cladophora result from cumulative seepage of N-rich groundwaters coupled with efficient utilization and recycling of dissolved organo-phosphorus compounds.
Energy Technology Data Exchange (ETDEWEB)
Moustapha, Moustapha E. [Department of Chemistry, University of Missouri-Columbia, Columbia, MO 65211 (United States); University of Missouri Research Reactor (MURR), University of Missouri-Columbia, Columbia, MO 65211 (United States); Ehrhardt, Gary J. [Department of Chemistry, University of Missouri-Columbia, Columbia, MO 65211 (United States); University of Missouri Research Reactor (MURR), University of Missouri-Columbia, Columbia, MO 65211 (United States); Smith, Charles J. [Department of Radiology, University of Missouri-Columbia, Columbia, MO 65211 (United States); University of Missouri Research Reactor (MURR), University of Missouri-Columbia, Columbia, MO 65211 (United States); Research Services, Harry S. Truman Memorial Veterans' Hospital, Columbia, MO 65201 (United States); Szajek, Lawrence P. [Positron Emission Tomography Department, National Institutes of Health, Bethesda, MD 20892-1180 (United States); Eckelman, William C. [Positron Emission Tomography Department, National Institutes of Health, Bethesda, MD 20892-1180 (United States); Jurisson, Silvia S. [Department of Chemistry, University of Missouri-Columbia, Columbia, MO 65211 (United States)]. E-mail: jurissons@missouri.edu
2006-01-15
The radioisotopes {sup 186}Re and {sup 188}Re have been extensively investigated for various forms of radiotherapy due to their useful and high-abundance {beta} particle emissions, low-abundance and imageable {gamma}-rays, and chemical resemblance to technetium. In addition, {sup 188}Re is available in no-carrier-added (NCA) form from long lived W-188 generators, whereas {sup 186}Re can be produced in large quantities from reactors, although not in NCA form. However, NCA {sup 186}Re can be produced on a cyclotron by a (p,n) reaction on {sup 186}W. The purpose of this study was to compare labeling of the peptide bombesin with these three forms of rhenium radioisotopes. Cyclotron-produced NCA {sup 186}Re was separated radiochemically from enriched {sup 186}W (96.9%) targets using high-purity methyl ethyl ketone (MEK). The resulting {sup 186}Re-MEK was then loaded onto a small alumina column to separate the resulting NCA {sup 186}Re from any remaining {sup 186}W. The experimental levels of impurities associated with {sup 186}Re at the end of the separation process were found to be 5.7x10{sup -6} Ci of {sup 182}Re (0.57%, t {sub 1/2}=12.7 h) and 1.283x10{sup -5} Ci of {sup 182m}Re (1.28%, t {sub 1/2}=2.67 days). The radionuclidic purity of the separated {sup 186}Re was found to be 99.6%, whereas the chemical identity was determined by reversed phase high-performance liquid chromatography (RP-HPLC) to be perrhenate ({sup 186}ReO{sub 4} {sup -}). Generator-produced {sup 188}ReO{sub 4} {sup -} from a {sup 188}W/{sup 188}Re generator (Oak Ridge National Laboratory) and CA {sup 186}ReO{sub 4} {sup -} produced from a {sup 185}Re(n,{gamma}){sup 186}Re reaction at the University of Missouri Research Reactor (MURR) were used for comparison with the NCA {sup 186}Re in subsequent studies. N{sub 3}S-5-Ava-BBN(7-14)NH{sub 2} conjugates provide flexibility for designing {sup 186,188}Re-labeled conjugates that retain high in vitro and in vivo specificity targeting of GRP receptor
28 CFR 54.225 - Educational institutions eligible to submit transition plans.
2010-07-01
... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Educational institutions eligible to submit transition plans. 54.225 Section 54.225 Judicial Administration DEPARTMENT OF JUSTICE (CONTINUED... Coverage § 54.225 Educational institutions eligible to submit transition plans. (a) Application. This...
Measurements of the microwave spectrum, Re-H bond length, and Re quadrupole coupling for HRe(CO)5
Kukolich, Stephen G.; Sickafoose, Shane M.
1993-11-01
Rotational transition frequencies for rhenium pentacarbonyl hydride were measured in the 4-10 GHz range using a Flygare-Balle type microwave spectrometer. The rotational constants and Re nuclear quadrupole coupling constants for the four isotopomers, (1) H187Re(CO)5, (2) H185Re(CO)5, (3) D187Re(CO)5, and (4) D185Re(CO)5, were obtained from the spectra. For the most common isotopomer, B(1)=818.5464(2) MHz and eq Q(187Re)=-900.13(3) MHz. The Re-H bond length (r0) determined by fitting the rotational constants is 1.80(1) Å. Although the Re atom is located at a site of near-octahedral symmetry, the quadrupole coupling is large due to the large Re nuclear moments. A 2.7% increase in Re quadrupole coupling was observed for D-substituted isotopomers, giving a rather large isotope effect on the quadrupole coupling. The Cax-Re-Ceq angle is 96(1)°, when all Re-C-O angles are constrained to 180°.
Re-irradiation tests of spent fuel at JMTR by means of re-instrumentation technique
International Nuclear Information System (INIS)
Nakamura, Jinichi; Shimizu, Michio; Endo, Yasuichi; Nabeya, Hideaki; Ichise, Kenichi; Saito, Junichi; Oshima, Kunio; Uetsuka, Hiroshi
1999-01-01
JAERI has developed re-irradiation test procedures of spent fuel irradiated at commercial reactor by means of re-instrumentation technique. Full length rods irradiated at commercial LWRs were re-fabricated to short length rods, and rod inner pressure gauges and fuel center thermocouples were re-instrumented to the rods. Re-irradiation tests to study the fuel behavior during power change were carried out by means of BOCA/OSF-1 facility at the JMTR. In the tests to study the fission gas release during power change, the rod inner pressure increase was observed during power change, especially during power reduction. The fission gas release during power reduction is estimated to be the release from fission gas bubbles on the grain boundary caused by the thermal stress in the pellet during power reduction. Re-irradiation test of gadolinia added fuel was performed by means of dual re-instrumentation technique (fuel center thermocouples and rod inner pressure gauge). A stepwise fission gas release during power change, and the following fuel center temperature change due to gap conductance change were observed. (author)
Studies of HEDP labelled with 188Re from different generators of 188W /188Re
International Nuclear Information System (INIS)
Marczewski, Barbara Szot
2006-01-01
The widespread interest in 188 Re for therapeutic applications, is due to its attractive 16,9 hours half-life, emission of a β - particle with maximum energy of 2.12 MeV and gamma-ray of 155 keV suitable for imaging. This work presents the radiolabelling of HEDP (etidronate) with 188 Re eluted from alumina-based 188 W/ 188 Re generators and tungstate-based 188 W/ 188 Re gel generators. Dependence of the yield of the 18 '8Re-HEDP on the concentration of the reduction agent, p H, reaction time, temperature and addition of carrier Re 2 O 7 were evaluated. The radiolabelling of 188 Re-HEDP procedure using the optimum conditions resulted a yield >= 98% for liquid and lyophilized kits. This basic formulation contains: 30 mg de HEDP, 7 mg de SnCl 2 , 3 mg de ascorbic acid and addition of 20 mug of Re 2 O 7 . The reactions were carried out with heating in boiling water for 30 minutes followed by 60 minutes of incubation. Another important aspect of this work was the radiochemical quality control comparing the results of PC, TLC and ion chromatography, along with the experiments with HPLC. The biological distribution proved the adequate bone uptake and in vivo stability of 188 Re-HEDP complexes. (author)
25 CFR 533.2 - Time for submitting management contracts and amendments.
2010-04-01
... 25 Indians 2 2010-04-01 2010-04-01 false Time for submitting management contracts and amendments. 533.2 Section 533.2 Indians NATIONAL INDIAN GAMING COMMISSION, DEPARTMENT OF THE INTERIOR MANAGEMENT CONTRACT PROVISIONS APPROVAL OF MANAGEMENT CONTRACTS § 533.2 Time for submitting management contracts and...
20 CFR 10.801 - How are medical bills to be submitted?
2010-04-01
... employees, except for treatment and supplies provided by nursing homes, shall be supported by medical... separate bill shall be submitted when the employee is discharged from treatment or monthly, if treatment for the work-related condition is necessary for more than 30 days. (1)(i) Hospitals shall submit...
40 CFR 152.93 - Citation of a previously submitted valid study.
2010-07-01
... Data Submitters' Rights § 152.93 Citation of a previously submitted valid study. An applicant may demonstrate compliance for a data requirement by citing a valid study previously submitted to the Agency. The... the original data submitter, the applicant may cite the study only in accordance with paragraphs (b...
30 CFR 210.104 - Must I submit these production reports electronically?
2010-07-01
... MINERALS REVENUE MANAGEMENT FORMS AND REPORTS Production Reports-Oil and Gas § 210.104 Must I submit these... Production Reporter Handbook for the most current reporting options, instructions, and security measures. The... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Must I submit these production reports...
27 CFR 73.31 - May I submit forms electronically to TTB?
2010-04-01
... TRADE BUREAU, DEPARTMENT OF THE TREASURY (CONTINUED) PROCEDURES AND PRACTICES ELECTRONIC SIGNATURES; ELECTRONIC SUBMISSION OF FORMS Electronic Filing of Documents with TTB § 73.31 May I submit forms electronically to TTB? Yes; you may submit an electronic form, instead of a paper form, to satisfy any reporting...
Degradation study of Durolon polycarbonate submitted to gamma radiation
International Nuclear Information System (INIS)
Miranda, A.; Sciani, V.
1992-01-01
The effect of gamma radiation from a cobalt 60 source in the 27000 Durolon polycarbonate irradiated with doses between 0,2 and 1000 kGy at 25 0 C was analyzed. For this reason the samples was submitted to the mechanical assay of tension, deformation and hardness and optical assay of transmittance. The obtained results show a good mechanical stability of the polycarbonate, when it was submitted to gamma irradiation in doses up to 20 kGy. (C.G.C.). 05 refs., 04 figs
31 CFR 103.81 - Submitting requests.
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Submitting requests. 103.81 Section 103.81 Money and Finance: Treasury Regulations Relating to Money and Finance FINANCIAL RECORDKEEPING... which the request is made. (b) A request filed by a corporation shall be signed by a corporate officer...
Investigation on thermophysical properties of RE{sub 6}UO{sub 12}(s) (RE = La, Pr, Nd, Sm)
Energy Technology Data Exchange (ETDEWEB)
Sahu, Manjulata, E-mail: manju@barc.gov.in [Radioanalytical Chemistry Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400085 (India); Krishnan, K. [Fuel Chemistry Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400085 (India); Jain, Dheeraj [Chemistry Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400085 (India); Saxena, M.K. [Radioanalytical Chemistry Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400085 (India); Dash, Smruti [Product development Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400085 (India)
2016-08-10
Highlights: • Synthesis of RE{sub 6}UO{sub 12}(s)(RE = La, Pr, Nd, Sm) was performed by combustion method and characterization by XRD. • Thermal expansion measurements were carried out on RE{sub 6}UO{sub 12}(s)(RE = Pr, and Sm) using HT-XRD. • Heat capacity of RE{sub 6}UO{sub 12}(s)(RE = La, Pr, Nd, Sm) was measured in the temperature range 300–870 K. • The nonstoichiometry in RE{sub 6}UO{sub 12}(s) was checked using TG, XPS, chemical analysis and electrical conductivity measurement. - Abstract: RE{sub 6}UO{sub 12}(s) (RE = La, Pr, Nd, Sm) was synthesized by citrate-nitrate combustion method. The synthesis condition for Pr{sub 6}UO{sub 12}(s) was optimized. Nonstoichiometry in these rare earth uranates in argon atmosphere was analysed using various techniques like thermogravimetry (TG), X-ray photo electron spectroscopy (XPS), chemical analysis and electrical conductivity measurements. Thermal expansions of RE{sub 6}UO{sub 12}(s) (RE = Pr and Sm) was studied in the temperature range 298–1273 K by high temperature X-ray powder diffractometry and compared with that of similar rare earth compounds reported in the literature. Heat capacity of RE{sub 6}UO{sub 12}(s) (RE = La, Pr, Nd, Sm) was measured by differential scanning calorimetry in the temperature range 300–870 K. Enthalpy, entropy and Gibbs energy functions of these compounds were computed from the measured heat capacity data.
Piaggio, L; Quintans, G; San Julián, R; Ferreira, G; Ithurralde, J; Fierro, S; Pereira, A S C; Baldi, F; Banchero, G E
2018-02-01
The objective of this study was to evaluate the effects of the energy restriction of gestation of adult ewes from day 45 to day 115 on lamb live performance parameters, carcass and meat traits. In experiment I, dietary energy was restricted at 70% of the metabolizable energy (ME) requirements, after which ewes were re-fed ad libitum until lambing. In experiment II, dietary energy was restricted at 60% of the ME requirements, and ewes were re-fed to ME requirements until lambing. All ewes grazed together from the end of the restriction periods to weaning. Lambs were weaned and lot fed until slaughter. Feed intake, weight gain and feed efficiency were recorded, and body fat thickness and ribeye area (REA) were measured in the longissimus thoracis muscle. After slaughter, carcass weight and yield, fat depth, carcass and leg length, and frenched rack and leg weights and yields were determined. Muscle fiber type composition, Warner-Bratzler shear force, pH and color were determined in the longissimus lumborum muscle. In experiment I, energy restriction followed by ad libitum feeding affected lamb birth weight (P0.05) were observed on later BW, REA, BF or carcass traits. Lambs born to non-restricted-fed ewes had higher (Penergy restriction followed by ME requirements feeding, affected (Pefficient (P=0.16) than lambs from unrestricted dams. Ribeye area and BF were not influenced by treatment. Treatment significantly affected slaughter weight, but had no effects on carcass yield and traits or on meat traits. The results obtained in both experiments indicate submitting ewes to energy restriction during gestation affects the performance of their progeny but the final outcome would depend on the ewe's re-feeding level during late gestation and the capacity of the offspring to compensate the in utero restriction after birth.
40 CFR 63.8818 - What reports must I submit and when?
2010-07-01
... other daily calibration checks. (f) The compliance report for a new or reconstructed flame lamination... not included in the list submitted with the Notification of Compliance Status in § 63.8816(h) (1), an... approved a different schedule for submission of reports under § 63.10(a), you must submit each compliance...
75 FR 8364 - Proposed Data Collections Submitted for Public Comment and Recommendations
2010-02-24
... on proposed data collection projects, the Centers for Disease Control and Prevention (CDC) will... data base containing identifying death record information submitted annually to NCHS by all the State...] Proposed Data Collections Submitted for Public Comment and Recommendations In compliance with the...
30 CFR 254.7 - How do I submit my response plan to the MMS?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How do I submit my response plan to the MMS... do I submit my response plan to the MMS? You must submit the number of copies of your response plan that the appropriate MMS regional office requires. If you prefer to use improved information technology...
DEFF Research Database (Denmark)
Hyttel, Trine E W; Bak, Geske S; Larsen, Solveig B
2015-01-01
The increasing use of de-torsion of the ovaries may result in re-torsion. This review addresses risk of re-torsion and describes preventive strategies to avoid re-torsion in pre-menarcheal girls, and fertile and pregnant women. We clinically reviewed PubMed, Embase, Trip and Cochrane databases. T...
Re-Entry Trauma: Asian Re-Integration after Study in the West
Pritchard, Rosalind
2011-01-01
Many students who re-locate from host to home country are said to undergo a process of reverse culture shock akin to bereavement, involving stages of a grieving process. This has been likened to a "W-curve" in which feelings fluctuate before reaching a more balanced state. The present study examined the re-acculturation of Taiwanese and…
Conte, Maureen H.; Ralph, Nate; Ross, Edith H.
Since 1978, the Oceanic Flux Program (OFP) time-series sediment traps have measured particle fluxes in the deep Sargasso Sea near Bermuda. There is currently a 20+yr flux record at 3200-m depth, a 12+yr flux at 1500-m depth, and a 9+yr record at 500-m depth. Strong seasonality is observed in mass flux at all depths, with a flux maximum in February-March and a smaller maximum in December-January. There is also significant interannual variability in the flux, especially with respect to the presence/absence of the December-January flux maximum and in the duration of the high flux period in the spring. The flux records at the three depths are surprisingly coherent, with no statistically significant temporal lag between 500 and 3200-m fluxes at our biweekly sample resolution. Bulk compositional data indicate an extremely rapid decrease in the flux of organic constituents with depth between 500 and 1500-m, and a smaller decrease with depth between 1500 and 3200-m depth. In contrast, carbonate flux is uniform or increases slightly between 500 and 1500-m, possibly reflecting deep secondary calcification by foraminifera. The lithogenic flux increases by over 50% between 500 and 3200-m depth, indicating strong deep water scavenging/repackaging of suspended lithogenic material. Concurrent with the rapid changes in flux composition, there is a marked reduction in the heterogeneity of the sinking particle pool with depth, especially within the mesopelagic zone. By 3200-m depth, the bulk composition of the sinking particle pool is strikingly uniform, both seasonally and over variations in mass flux of more than an order of magnitude. These OFP results provide strong indirect evidence for the intensity of reprocessing of the particle pool by resident zooplankton within mesopelagic and bathypelagic waters. The rapid loss of organic components, the marked reduction in the heterogeneity of the bulk composition of the flux, and the increase in terrigenous fluxes with depth are most
21 CFR 720.7 - Notification of person submitting cosmetic product ingredient statement.
2010-04-01
... 21 Food and Drugs 7 2010-04-01 2010-04-01 false Notification of person submitting cosmetic product... AND HUMAN SERVICES (CONTINUED) COSMETICS VOLUNTARY FILING OF COSMETIC PRODUCT INGREDIENT COMPOSITION STATEMENTS § 720.7 Notification of person submitting cosmetic product ingredient statement. When Form FDA...
International Nuclear Information System (INIS)
Kim, Junghwan; Jung, In-Ho
2015-01-01
Highlights: • The (Si-RE) (RE = Gd, Tb, Dy, Ho, Er, Tm, Lu and Y) systems have been reviewed. • The thermodynamic optimization of the (Si-RE) systems have been performed. • Systematic changes and similarities in the (Si-RE) systems were found. • The systematic approach resolved inconsistencies in the experimental data. • The systematic approach was used to assess the unexplored phase diagrams. - Abstract: A critical evaluation and optimisation of all available phase diagrams and thermodynamic data of the (Si-RE) (RE = Gd, Tb, Dy, Ho, Er, Tm, Lu and Y) systems was conducted to obtain reliable thermodynamic functions of all the phases in the system. In the thermodynamic modelling, a systematic analysis involving the similarity and periodicity observed in the lanthanide series was applied to resolve inconsistencies in the experimental data and to estimate the unknown thermodynamic properties and phase equilibria data. In particular, the phase diagrams and thermodynamic properties of (Si-Tm) and (Si-Lu) systems which are rarely investigated can be predicted from this approach. Systematic trends in thermodynamic properties of solid and liquid phases and phase diagram of the entire (Si-RE) systems were summarized
49 CFR Appendix II to Part 805 - Employees Required To Submit Statements
2010-10-01
...—Employees Required To Submit Statements Statements of employment and financial interests are required of the... 49 Transportation 7 2010-10-01 2010-10-01 false Employees Required To Submit Statements II...) Office of the managing director: (1) Legislative affairs officer. (2) Program analysis officer. (d...
Entrepreneurship as re-sourcing
DEFF Research Database (Denmark)
Korsgaard, Steffen; Anderson, Alistair; Gaddefors, Johan
Objectives The purpose of this paper is to re-examine the concept of entrepreneurship in light of the current financial and environmental crisis and its socio-spatial impact. Building on Hudson’s analysis of production in late-capitalist societies, we identify problems inherent in the dominant...... of grounding in material reality, lacking emphasis on environmental externalities and an impoverished conceptualization of spatial relations. Comparing this analysis with the dominant opportunistic image of the entrepreneur, leads us to formulate a critique of this image. In formulating an alternative we build...... The paper presents a “new image” of entrepreneurship as re-sourcing. The concept of re-sourcing emphasizes the dual meaning of the word resource as both a stock of supply and strategy or action adopted in adverse circumstances. Re-sourcing thus signifies a shift in focus from opportunities to resources...
Amacher, Jessica; Neuer, Susanne; Lomas, Michael
2013-09-01
We used denaturing gradient gel electrophoresis (DGGE) to examine the protist and cyanobacterial communities in the euphotic zone (0-120 m) and in corresponding 150 m particle interceptor traps at the Bermuda Atlantic Time-series Study (BATS) in a two-year monthly time-series from May 2008 to April 2010. Dinoflagellates were the most commonly detected taxa in both water column and trap samples throughout the time series. Diatom sequences were found only eight times in the water column, and only four times in trap material. Small-sized eukaryotic taxa, including the prasinophyte genera Ostreococcus, Micromonas, and Bathycoccus, were present in trap samples, as were the cyanobacteria Prochlorococcus and Synechococcus. Synechococcus was usually overrepresented in trap material, whereas Prochlorococcus was underrepresented compared to the water column. Both seasonal and temporal variability affected patterns of ribosomal DNA found in sediment traps. The two years of this study were quite different hydrographically, with higher storm activity and the passing of a cyclonic eddy causing unusually deep mixing in winter 2010. This was reflected in the DGGE fingerprints of the water column, which showed greater phylotype richness of eukaryotes and a lesser richness of cyanobacteria in winter of 2010 compared with the winter of 2009. Increases in eukaryotic richness could be traced to increased diversity of prasinophytes and prymnesiophytes. The decrease in cyanobacterial richness was in turn reflected in the trap composition, but the increase in eukaryotes was not, indicating a disproportionate contribution of certain taxa to sinking particle flux.
Directory of Open Access Journals (Sweden)
Kristen Nicolle Buck
2016-12-01
Full Text Available The organic complexation of dissolved iron (Fe was determined in depth profile samples collected from GEOTRACES Crossover Station A, the Bermuda Atlantic Time-series Study (BATS site, as part of the Dutch and U.S. GEOTRACES North Atlantic programs in June 2010 and November 2011, respectively. The two groups employed distinct competitive ligand exchange-adsorptive cathodic stripping voltammetry (CLE-AdCSV methods, and resulting ligand concentrations and conditional stability constants from each profile were compared. Excellent agreement was found between the total ligand concentrations determined in June 2010 and the strongest, L1-type, ligand concentrations determined in November 2011. Yet a primary distinction between the datasets was the number of ligand classes observed: a single ligand class was characterized in the June 2010 profile while two ligand classes were observed in the November 2011 profile. To assess the role of differing interpretation approaches in determining final results, analysts exchanged titration data and accompanying parameters from the profiles for reinterpretation. The reinterpretation exercises highlighted the considerable influence of the sensitivity (S parameter applied on interpretation results, consistent with recent intercalibration work on interpretation of copper speciation titrations. The potential role of titration data structure, humic-type substances, differing dissolved Fe concentrations, and seasonality are also discussed as possible drivers of the one versus two ligand class determinations between the two profiles, leading to recommendations for future studies of Fe-binding ligand cycling in the oceans.
28 CFR 14.4 - Administrative claims; evidence and information to be submitted.
2010-07-01
... bearing on either the responsibility of the United States for the death or the damages claimed. (b... submitted. (a) Death. In support of a claim based on death, the claimant may be required to submit the following evidence or information: (1) An authenticated death certificate or other competent evidence...
20 CFR 669.510 - What planning documents must an NFJP grantee submit?
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false What planning documents must an NFJP grantee submit? 669.510 Section 669.510 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF... Accountability, Planning and Waiver Provision § 669.510 What planning documents must an NFJP grantee submit? Each...
Examination of rotator cuff re-tear
International Nuclear Information System (INIS)
Kitahara, Hiroyuki; Yabe, Yoshihiro; Norimatsu, Takahiro; Adachi, Shinji; Sera, Keisuke
2010-01-01
The six-month post-operative re-tear rate in 72 arthroscopic rotator cuff repair cases was 16.3% by MRI. The re-tear rate of massive tears was 50%. We investigated the details of the re-tears by MRI and arthroscopic findings. High re-tear rates were connected with cuff tear size and fatty degeneration of muscle belly. Cases with poor cuff quality in arthroscopically showed high re-tear rate. These results suggest that surgery operation should be performed as soon as possible after diagnosis of cuff tear to obtain good results. Cases with damage of long head of the biceps (LHB) are likely to develop impingement causes of re-tears. Some type of rehabilitation is required to avoid impingement in such cases. (author)
Fuller, Tamara; Zhang, Saijun
2017-08-01
Despite decades of debate about the most effective ways to intervene with families reported to child protective services (CPS), little evidence exists regarding the types of services or approach that reduce children's risk of additional maltreatment. The current study used data collected during a statewide experimental evaluation of CPS to examine the impact of numerous service variables, family engagement, and family characteristics on the risk of maltreatment re-reports and substantiated re-reports among families initially reported for neglect and risk of harm. The sample included 4,868 families with screened-in reports that were randomly assigned to receive either an investigation or an assessment. The results of the Cox regression analyses found that service duration, intensity, and breadth were unrelated to maltreatment re-report or substantiated re-reports, but caseworker ratings of the service-need match were associated with both. The provision of domestic violence services was related to decreased risk of maltreatment re-reports. Increased levels of family engagement were associated with lowered risk of both maltreatment re-reports and substantiated re-reports. Once the effects of services, engagement, and family characteristics were taken into account, CPS response pathway (investigation or assessment) had no relationship to maltreatment re-reports or substantiated re-reports.
40 CFR 60.2755 - When must I submit my waste management plan?
2010-07-01
... 40 Protection of Environment 6 2010-07-01 2010-07-01 false When must I submit my waste management... waste management plan? You must submit the waste management plan no later than the date specified in... Compliance Times for Commercial and Industrial Solid Waste Incineration Units that Commenced Construction On...
30 CFR 250.468 - What well records am I required to submit?
2010-07-01
... OIL AND GAS AND SULPHUR OPERATIONS IN THE OUTER CONTINENTAL SHELF Oil and Gas Drilling Operations...) You must submit copies of logs or charts of electrical, radioactive, sonic, and other well-logging... drilling operations in the GOM OCS Region, you must submit form MMS-133, Well Activity Report, to the...
45 CFR 35.4 - Administrative claims; evidence and information to be submitted.
2010-10-01
... bearing on either the responsibility of the United States for the death or the damages claimed. (b... information to be submitted. (a) Death. In support of a claim based on death, the claimant may be required to submit the following evidence or information: (1) An authenticated death certificate or other competent...
Directory of Open Access Journals (Sweden)
Matthew J Ajemian
Full Text Available Declines of large sharks and subsequent release of elasmobranch mesopredators (smaller sharks and rays may pose problems for marine fisheries management as some mesopredators consume exploitable shellfish species. The spotted eagle ray (Aetobatus narinari is the most abundant inshore elasmobranch in subtropical Bermuda, but its predatory role remains unexamined despite suspected abundance increases and its hypothesized specialization for mollusks. We utilized a combination of acoustic telemetry, benthic invertebrate sampling, gut content analysis and manipulative experiments to assess the impact of spotted eagle rays on Bermudian shellfish resources. Residency and distribution of adult spotted eagle rays was monitored over two consecutive summers in Harrington Sound (HS, an enclosed inshore lagoon that has historically supported multiple recreational and commercial shellfish species. Telemetered rays exhibited variable fidelity (depending on sex to HS, though generally selected regions that supported relatively high densities of potential mollusk prey. Gut content analysis from rays collected in HS revealed a diet of mainly bivalves and a few gastropods, with calico clam (Macrocallista maculata representing the most important prey item. Manipulative field and mesocosm experiments with calico clams suggested that rays selected prey patches based on density, though there was no evidence of rays depleting clam patches to extirpation. Overall, spotted eagle rays had modest impacts on local shellfish populations at current population levels, suggesting a reduced role in transmitting cascading effects from apex predator loss. However, due to the strong degree of coupling between rays and multiple protected mollusks in HS, ecosystem-based management that accounts for ray predation should be adopted.
Directory of Open Access Journals (Sweden)
Juan Ormeño-Núñez
2008-09-01
Full Text Available Two field trials (Los Andes 1998-1999 and Santiago 2004-2005 were carried out to determine growth inhibition of yellow nutsedge (Cyperus esculentus L. and bermudagrass (Cynodon dactylon (L. Pers., growing on the plantation row, by mulch derived from a rye (Secale cereale L. cover crop established between grapevine (Vitis vinifera L. rows on overhead (cv. Flame Seedless and vertical (cv. Cabernet Sauvignon training. Spring mowing of the rye sown in the fall allowed for developing a thick and long lasting mulch along the grape rows. Nutsedge and bermudagrass control was 81 and 82%, respectively, and was more effective than conventional chemical (in the row + mechanical (between rows control. Glyphosate at 2% for nutsedge and 1% for bermudagrass control, applied twice (October and December, was insufficient to control either perennial weed adequately. Total broadleaved and grass/sedge weed control was 67.3 and 43.0% more effective with the rye mulch than with conventional treatments at Los Andes and Santiago, respectively. Perennial weed control levels could be explained as the new foliage of yellow nutsedge and bermudagrass was particularly susceptible to the shading provided by the rye mulch assembled prior to mid spring shoot emergence, and this effect remained active up until the beginning of autumn. The subsequent rye foliage mowing at the vegetative stage fully expressed the allelopathic effect produced by this local rye cultivar. The use of rye cover crop management and mulch could be applied as an effective weed control technique in conventional, as well as organic deciduous tree orchards.En dos ensayos de campo (Los Andes 1998-1999 y Santiago 2004-2005 se determinó el efecto inhibitorio sobre chufa (Cyperus esculentus L. y pasto bermuda (Cynodon dactylon (L. Pers. de residuos de centeno (Secale cereale L. establecido en otoño entre las hileras de vides (Vitis vinifera L. en parronal (cv. Flame Seedless y espaldera (cv. Cabernet Sauvignon
Duffort, O; Calabozo, B; González, R; Carpizo, J A; Barber, D; Polo, F
2004-12-01
Pollen of Bermuda grass (Cynodon dactylon) is an important cause of pollinosis in many areas of the world. Most patients show sensitivity to the major allergen Cyn d 1, a glycoprotein composed of a number of isoforms with a molecular mass of 31-32 kDa. The aim of this work was to develop a monoclonal antibody (mAb)-based ELISA to quantify Cyn d 1, and to assess the correlation of the allergen content with the biological activity of C. dactylon pollen extracts. After fusion of myeloma cells with spleen cells from a BALB/c mouse immunized with C. dactylon pollen extract, Cyn d 1-specific mAbs secreting hybridomas were selected, and the antibodies characterized. One of them (4.4.1) was used as the capture antibody in an ELISA method for Cyn d 1 quantitation. An anti-Cyn d 1 rabbit serum was used as the second antibody. Cyn d 1 was purified by immunoaffinity chromatography with mAb 4.4.1, characterized, and used as the standard in the assay. The identity, purity and isoallergen composition of affinity-purified Cyn d 1 was confirmed by N-terminal amino acid sequencing, SDS-PAGE, Western blot and 2D electrophoresis. The Cyn d 1 ELISA is highly specific and sensitive, with a detection limit of 0.24 ng/ml and a linear range of 1.1-9.2 ng/ml. An excellent correlation was found when the content of Cyn d 1, measured in 16 different extracts, was compared with the allergenic activity of the same extracts determined by RAST inhibition. The results prove the usefulness of the Cyn d 1 ELISA for the standardization of C. dactylon-allergen products on the basis of major allergen content. 2004 S. Karger AG, Basel.
12 CFR 793.4 - Administrative claims; evidence and information to be submitted.
2010-01-01
... evidence or information which may have a bearing on the responsibility of the United States for the death... GOVERNMENT Procedures § 793.4 Administrative claims; evidence and information to be submitted. (a) Death. In support of a claim based on death, the claimant may be required to submit the following evidence or...
18 CFR 154.302 - Previously submitted material.
2010-04-01
... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Previously submitted material. 154.302 Section 154.302 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY... concurrently with the rate change filing. There must be furnished to the Director, Office of Energy Market...
Sports video games: re-shaping football and re-defining fandom?
ervine bangor ac uk, j.
2017-01-01
This paper will examine ways in which football video games, such as Football Manager and FIFA, are re- shaping the sport of football and re-defining the relationship between fans and the sport. In so doing, it will explore ways in which football video games have been portrayed in both the UK and France through close study of the press, academic literature, the press and popular culture.To begin with, it will be argued that dismissive attitudes of some journalists and football managers towards...
Morinaga, Osamu; Tanaka, Hiroyuki; Shoyama, Yukihiro
2006-01-02
A chromatographic immunostaining method has been developed for the determination of ginsenoside Re (G-Re) in ginseng samples on a polyethersulphone (PES) membrane. G-Re standard and the extracts of ginseng roots were applied to a PES membrane and developed by methanol-water-acetic acid (45:55:1, by volume). G-Re was clearly detected by an immunostaining method using a monoclonal antibody against G-Re. The coloring spots of G-Re were analyzed quantitatively using NIH Image software indicating at least 0.125 microg of G-Re was detectable. G-Re can be analyzed quantitatively between 0.25 and 4.0 microg.
Calculation and evaluation of the activation cross sections for 187Re(n,2n)186m,gRe reactions
International Nuclear Information System (INIS)
Huang Xiaolong; Lu Hanlin; Zhou Chunmei
1998-01-01
The activation cross sections for 187 Re(n,2n) 186m,g Re reactions are calculated using UNF code. The calculations are in good agreement with the re-evaluated measured data. Finally the excitation function for 187 Re(n,2n) 186m,g Re reactions are evaluated and recommended based on present calculations and evaluated decay data
Imbery, Terence A; Diaz, Nicholas; Greenfield, Kristy; Janus, Charles; Best, Al M
2016-10-01
Preclinical fixed prosthodontics is taught by Department of Prosthodontics faculty members at Virginia Commonwealth University School of Dentistry; however, 86% of all clinical cases in academic year 2012 were staffed by faculty members from the Department of General Practice. The aims of this retrospective study were to quantify the quality of impressions, accuracy of laboratory work authorizations, and most common errors and to determine if there were differences between the rate of errors in cases supervised by the prosthodontists and the general dentists. A total of 346 Fixed Prosthodontic Laboratory Tracking Sheets for the 2012 academic year were reviewed. The results showed that, overall, 73% of submitted impressions were acceptable at initial evaluation, 16% had to be poured first and re-evaluated for quality prior to pindexing, 7% had multiple impressions submitted for transfer dies, and 4% were rejected for poor quality. There were higher acceptance rates for impressions and work authorizations for cases staffed by prosthodontists than by general dentists, but the differences were not statistically significant (p=0.0584 and p=0.0666, respectively). Regarding the work authorizations, 43% overall did not provide sufficient information or had technical errors that delayed prosthesis fabrication. The most common errors were incorrect mountings, absence of solid casts, inadequate description of margins for porcelain fused to metal crowns, inaccurate die trimming, and margin marking. The percentages of errors in cases supervised by general dentists and prosthodontists were similar for 17 of the 18 types of errors identified; only for margin description was the percentage of errors statistically significantly higher for general dentist-supervised than prosthodontist-supervised cases. These results highlighted the ongoing need for faculty development and calibration to ensure students receive the highest quality education from all faculty members teaching fixed
The Bay of Pigs: Revisiting Two Museums
Directory of Open Access Journals (Sweden)
Peter Read
2007-08-01
Full Text Available The Museum of Playa Giron (the Bay of Pigs in the region of Cienega De Zapata, Cuba, celebrates the repulse of Brigade 2506 as the first reverse of US imperialism on the American continents. The equivalent Brigade 2506 Museum in Miami, dedicated to and maintained by the members of Brigade 2506, celebrates defeat at the Bay of Pigs as moral victory for the Cuban exiles. The forces were indeed implacable foes. Yet between the museums can be detected some curious similarities. Both present the common theme of the confrontation between forces of good and evil. Both celebrate the philosophy that dying for one’s country is the greatest good a citizen may achieve. Both museums fly the common Cuban flag. Both museums identify a common enemy: the United States of America. This article, by comparing the displays in the two museums, analyses some cultural elements of what, despite decades of separation, in some ways remains a common Cuban culture.
75 FR 60404 - Information Collection Request Submitted to Office of Management and Budget
2010-09-30
... [OMB Control Number: 3002-0003] Information Collection Request Submitted to Office of Management and... United States will submit an Information Collection Request (ICR) to the Office of Management and Budget (OMB) requesting approval for the following collection of information: 3002-0003, Substitute...
Gear, Jim
1993-01-01
The Re-Think Tree is a simple framework to help individuals assess and improve their behaviors related to environmental issues. The branches of the tree in order of priority are refuse, reduce, re-use, and recycle. Roots of the tree include such things as public opinion, education, and watchdog groups. (KS)
The carcinogenic effects of aspartame: The urgent need for regulatory re-evaluation.
Soffritti, Morando; Padovani, Michela; Tibaldi, Eva; Falcioni, Laura; Manservisi, Fabiana; Belpoggi, Fiorella
2014-04-01
Aspartame (APM) is an artificial sweetener used since the 1980s, now present in >6,000 products, including over 500 pharmaceuticals. Since its discovery in 1965, and its first approval by the US Food and Drugs Administration (FDA) in 1981, the safety of APM, and in particular its carcinogenicity potential, has been controversial. The present commentary reviews the adequacy of the design and conduct of carcinogenicity bioassays on rodents submitted by G.D. Searle, in the 1970s, to the FDA for market approval. We also review how experimental and epidemiological data on the carcinogenic risks of APM, that became available in 2005 motivated the European Commission (EC) to call the European Food and Safety Authority (EFSA) for urgent re-examination of the available scientific documentation (including the Searle studies). The EC has further requested that, if the results of the evaluation should suggest carcinogenicity, major changes must be made to the current APM specific regulations. Taken together, the studies performed by G.D. Searle in the 1970s and other chronic bioassays do not provide adequate scientific support for APM safety. In contrast, recent results of life-span carcinogenicity bioassays on rats and mice published in peer-reviewed journals, and a prospective epidemiological study, provide consistent evidence of APM's carcinogenic potential. On the basis of the evidence of the potential carcinogenic effects of APM herein reported, a re-evaluation of the current position of international regulatory agencies must be considered an urgent matter of public health. © 2014 Wiley Periodicals, Inc.
Re-use of disposable coil dialysers
International Nuclear Information System (INIS)
Abbud Filho, M.
1980-01-01
Re-use of disposable dialysers has been in practice for over 16 years throughout the world but it still is a polemical subject. The main justification for it is the reduction of costs in the hemodialytic treatment. We evaluated the technique of re-use that we adopt by studying 33 patients who should re-utilize coil dialysers for 8 consecutive hemodialysis sessions. We investigated: 1) small and middle molecules clearances trough a radioisotopic method; 2) the integrity of the system regarding bacterial invasion; 3) the frequency of anti-N antibodies; 4) aspects of scanning electron microscopy (SEM) of dialysis membrane after re-use. We observed no changes in the dialysers performance during re-use. We conclude that the re-use of dialyzers is feasible, without risks for the patients, allowing marked reduction of costs, thus making possible to offer treatment to a larger number of uremic patients. (author)
2011-12-05
...) Submit repair report 3 1008(f) Submit report of pipeline failure analysis...... 30 1008(g) Submit plan of... usual and customary business practice; required burden is minimal to make available to BSEE. Estimated... and provide your total capital and startup cost components or annual operation, maintenance, and...
Status report on the HFR conversion and re-licensing project
International Nuclear Information System (INIS)
Wijtsma, F.G.
2003-01-01
In 1999 the HFR license holder (JRC, Petten, the Netherlands) initiated a project to study the conversion of the HFR from HEU to LEU. The first phase of this project consisted of a parametric study to determine the optimum fuel element and control rod design within given boundary conditions such as geometry, density, performance and cycle length. Results of this study are a 22 plates fuel element (550 g 235 U) at a density of 4.8 g.cm -3 and a 17 plates control rod (440 g 235 U). The second phase contains all aspects related to the conversion including a full-scale test irradiation of a prototype LEU element. The actual conversion of the HFR requires a new license. For this reason the re-licensing project has started in 2001. In this context many studies have been performed e.g. Risk Scoping Study, Safety Analyses, TOPA (Technical, Operational, Personnel and Administrative) evaluation. The license application will be based on a new Safety Report and an Environmental Impact Statement and will be submitted to the competent Authorities at the end of October 2003. (author)
24 CFR 3282.354 - Submittal of false information or refusal to submit information.
2010-04-01
... 24 Housing and Urban Development 5 2010-04-01 2010-04-01 false Submittal of false information or... ENFORCEMENT REGULATIONS Primary Inspection Agencies § 3282.354 Submittal of false information or refusal to submit information. The submittal of false information or the refusal to submit information required...
27 CFR 73.34 - When is an electronically submitted form considered timely filed?
2010-04-01
... AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY (CONTINUED) PROCEDURES AND PRACTICES ELECTRONIC SIGNATURES; ELECTRONIC SUBMISSION OF FORMS Electronic Filing of Documents with TTB § 73.34 When is an electronically submitted form considered timely filed? If you submit a form to our electronic...
Charge Carrier Trapping Processes in RE2O2S (RE = La, Gd, Y, and Lu)
Luo, H.; Bos, A.J.J.; Dorenbos, P.
2017-01-01
Two different charge carrier trapping processes have been investigated in RE2O2S:Ln3+ (RE = La, Gd, Y, and Lu; Ln = Ce, Pr, and Tb) and RE2O2S:M (M = Ti4+ and Eu3+). Cerium, praseodymium and terbium act as recombination centers and hole trapping centers while host intrinsic defects provide the
7 CFR 28.954 - Costs of submitting samples.
2010-01-01
... 7 Agriculture 2 2010-01-01 2010-01-01 false Costs of submitting samples. 28.954 Section 28.954 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE COMMODITY STANDARDS AND STANDARD CONTAINER...
International Nuclear Information System (INIS)
Kim, Junghwan; Jung, In-Ho
2012-01-01
Highlights: ► The Mn–RE (RE = La, Ce, Pr, Nd and Sm) systems have been critically reviewed. ► The thermodynamic optimization of the Mn–RE systems have been performed. ► Systematic changes in the phase diagrams and thermodynamic properties were found. ► The systematic approach resolved inconsistencies in the experimental data. - Abstract: Critical evaluation and optimization of all available phase diagram and thermodynamic data for the Mn–RE (RE = La, Ce, Pr, Nd and Sm) systems have been conducted to obtain reliable thermodynamic functions of all the phases in the system. In the thermodynamic modeling, it is found that the Mn–RE systems show systematic changes in the phase diagrams and thermodynamic properties such as enthalpy of mixing in liquid state in the order of periodic number in the lanthanide series. This systematic thermodynamic modeling approach for all light RE elements can allow to resolve inconsistencies in the experimental data.
International Nuclear Information System (INIS)
Ho, C H; Lee, H W; Wu, C C
2004-01-01
The polarization sensitive behaviour of the band-edge transitions in ReS 2 and ReSe 2 layered compounds was studied using polarized-transmission and polarized-thermoreflectance (PTR) measurements with polarization angles from θ = 0 deg. (Evector parallel b-axis) to θ = 90 deg. (Evector perpendicular b-axis) at 300 K. The polarization dependence of the polarized energy gaps of ReS 2 and ReSe 2 shows a sinusoidal-like variation with respect to the angular change of the linearly polarized light. The angular dependences of the polarized energy gaps of ReS 2 and ReSe 2 were evaluated. The polarization sensitive behaviour of the band-edge excitons in rhenium disulfide and diselenide was characterized using angular dependent PTR measurements from θ = 0 deg. to 90 deg. The polarized transition intensities of the band-edge excitons (E 1 ex and E 2 ex ) of ReX 2 (X = S, Se) demonstrate a sinusoidal variation with respect to the angular change of the linearly polarized light. The angular dependence of the polarized transition probabilities of E 1 ex and E 2 ex is analysed. The polarization sensitive behaviours of ReX 2 (X = S, Se) layers are discussed
Re-design, re-use and recycle of temporary houses
Energy Technology Data Exchange (ETDEWEB)
Arslan, Hakan [Department of Construction, Faculty of Technical Education, University of Abant Izzet Baysal, Duzce 81100 (Turkey)
2007-01-15
Disasters are recurring to global problems, which results in homelessness. The affected region had economical, environmental and social problems as well. In relief and reconstruction phases, the need for integrated management appeared in order to use the national sources actively and productively. Especially housing implementations had an important role for future development of the affected region. For accelerating the reconstruction of the region and forming a sustainable community, which maintains itself socially, environmentally and economically over time; energy usage for construction should be kept to a minimum. Past research in Turkey shows that the cost of temporary houses (to be used as the short term shelter) had a ratio of 10-15% of the total expenses of whole construction activity. For saving money and protecting the environment and conserving scarce resources, the affected region must consider the option of temporary houses to meet their short and long-term need during the reconstruction process. After the end of usage, temporary houses should be able to be re-used for the same or new function. This study is a test of re-design and re-use of a temporary housing site; by using recycled materials, minimum energy and voluntary participation so that this site can finally become a permanent housing site. (author)
Energy Technology Data Exchange (ETDEWEB)
Lu, Zhao; Zhang, Lijun [Central South Univ., Changsha (China). State Key Lab of Powder Metallurgy; Tang, Ying [Thermo-Calc Software AB, Solna (Sweden)
2017-06-15
This paper first provides a critical review of experimental and theoretically-predicted diffusivities in both liquid and fcc Al-Si-Mg-RE (RE = Ce, Sc) alloys as-reported by previous researchers. The modified Sutherland equation is then employed to predict self- and impurity diffusivities in Al-Si-Mg-RE melts. The self-diffusivity of metastable fcc Sc is evaluated via the first-principles computed activation energy and semi-empirical relations. Based on the critically-reviewed and presently evaluated diffusivity information, atomic mobility descriptions for liquid and fcc phases in the Al-Si-Mg-RE systems are established by means of the Diffusion-Controlled TRAnsformation (DICTRA) software package. Comprehensive comparisons show that most of the measured and theoretically-predicted diffusivities can be reasonably reproduced by the present atomic mobility descriptions. The atomic mobility descriptions for liquid and fcc Al-Si-Mg-RE alloys are further validated by comparing the model-predicted differential scanning calorimetry curves for RE-containing A357 alloys during solidification against experimental data. Detailed analysis of the curves and microstructures in RE-free and RE-containing A357 alloys indicates that both Ce and Sc can serve as the grain refiner for A357 alloys, and that the grain refinement efficiency of Sc is much higher.
International Nuclear Information System (INIS)
Lu, Zhao; Zhang, Lijun
2017-01-01
This paper first provides a critical review of experimental and theoretically-predicted diffusivities in both liquid and fcc Al-Si-Mg-RE (RE = Ce, Sc) alloys as-reported by previous researchers. The modified Sutherland equation is then employed to predict self- and impurity diffusivities in Al-Si-Mg-RE melts. The self-diffusivity of metastable fcc Sc is evaluated via the first-principles computed activation energy and semi-empirical relations. Based on the critically-reviewed and presently evaluated diffusivity information, atomic mobility descriptions for liquid and fcc phases in the Al-Si-Mg-RE systems are established by means of the Diffusion-Controlled TRAnsformation (DICTRA) software package. Comprehensive comparisons show that most of the measured and theoretically-predicted diffusivities can be reasonably reproduced by the present atomic mobility descriptions. The atomic mobility descriptions for liquid and fcc Al-Si-Mg-RE alloys are further validated by comparing the model-predicted differential scanning calorimetry curves for RE-containing A357 alloys during solidification against experimental data. Detailed analysis of the curves and microstructures in RE-free and RE-containing A357 alloys indicates that both Ce and Sc can serve as the grain refiner for A357 alloys, and that the grain refinement efficiency of Sc is much higher.
Development of Premacy Hydrogen RE Hybrid
Energy Technology Data Exchange (ETDEWEB)
Wakayama, N. [Mazda Motor Corporation, Hiroshima (Japan)
2010-07-01
Hydrogen powered ICE (internal combustion engine) vehicles can play an important role as an automotive power source in the future, because of its higher reliability and cost performance than those of fuel cell vehicles. Combined with hydrogen, Mazda's unique rotary engine (RE) has merits such as a prevention of hydrogen pre-ignition. Mazda has been developing hydrogen vehicles with the hydrogen RE from the early 1990s. Premacy (Mazda5) Hydrogen RE Hybrid was developed and launched in 2009, following RX-8 Hydrogen RE delivered in 2006. A series hybrid system was adopted in Premacy Hydrogen RE Hybrid. A traction motor switches its windings while the vehicle is moving. This switching technology allows the motor to be small and high-efficient. The lithium-ion high voltage battery, which has excellent input-output characteristics, was installed. These features extend the hydrogen fuel driving range to 200 km and obtain excellent acceleration performance. The hydrogen RE can be also operated by gasoline (Dual Fuel System). The additional gasoline operation makes hydrogen vehicles possible to drive in non-hydrogen station area. With approval from the Japanese Ministry of Land Infrastructure and Transport, Mazda Premacy Hydrogen RE Hybrid was delivered successfully to the Japanese market in the form of leasing. (orig.)
(Re)politicising and (re)positioning prevention: community ...
African Journals Online (AJOL)
They also signal a need to critically re-evaluate “community mobilisation” as an AIDS prevention tradition. Intersecting social and political power dynamics play a significant role in both opening up and constraining community mobilisation efforts. This paper proposes the need for a pedagogical turn to “deep organising” and ...
A RE-INTRODUCTION TO ANOMALIES OF CRITICALITY
International Nuclear Information System (INIS)
Puigh, R.J.
2009-01-01
In 1974, a small innocuous document was submitted to the American Nuclear Society's Criticality Safety Division for publication that would have lasting impacts on this nuclear field The author was Duane Clayton, manager of the Battelle Pacific Northwest National Laboratory's Critical Mass Lab, the world's preeminent reactor critical experimenter with plutonium solutions. The document was entitled, 'Anomalies of Criticality'. 'Anomalies...' was a compilation of more than thirty separate and distinct examples of departures from what might be commonly expected in the field of nuclear criticality. Mr. Clayton's publication was the derivative of more than ten thousand experiments and countless analytical studies conducted world-wide on every conceivable reactor system imaginable: from fissile bearing solutions to solids, blocks to arrays of fuel rods, low-enriched uranium oxide systems to pure plutonium and highly enriched uranium systems. After publication, the document was commonly used within the nuclear fuel cycle and reactor community to train potential criticality/reactor analysts, experimenters and fuel handlers on important things for consideration when designing systems with critically 'safe' parameters in mind The purpose of this paper is to re-introduce 'Anomalies of Criticality' to the current Criticality Safety community and to add new 'anomalies' to the existing compendium. By so doing, it is the authors' hope that a new generation of nuclear workers and criticality engineers will benefit from its content and might continue to build upon this work in support of the nuclear renaissance that is about to occur
DEFF Research Database (Denmark)
Lindberg-Larsen, M.; Jørgensen, C. C.; Hansen, Torben Bæk
2014-01-01
of hospital stay was four days (interquartile range: 3 to 5), with a 90 days re-admission rate of 9.9%, re-operation rate of 3.5% and mortality rate of 0.2%. The age ranges of 51 to 55 years (p = 0.018), 76 to 80 years (p re-admission...
49 CFR 655.49 - Refusal to submit to a drug or alcohol test.
2010-10-01
... 49 Transportation 7 2010-10-01 2010-10-01 false Refusal to submit to a drug or alcohol test. 655... TRANSIT ADMINISTRATION, DEPARTMENT OF TRANSPORTATION PREVENTION OF ALCOHOL MISUSE AND PROHIBITED DRUG USE IN TRANSIT OPERATIONS Types of Testing § 655.49 Refusal to submit to a drug or alcohol test. (a) Each...
Directory of Open Access Journals (Sweden)
Thayna Nogueira dos Santos
Full Text Available ABSTRACT The aim of the study was to investigate the association between oxidative stress and DNA damage with grafting time in patients submitted to autologous hematopoietic stem-cell transplantation (HSCT. The study included 37 patients submitted to autologous HSCT diagnosed with Multiple Myeloma (MM and lymphoma (Hodgkin’s and non-Hodgkin’s. Biomarkers of oxidative stress and DNA damage index (DI were performed at baseline (pre-CR of the disease and during the conditioning regimen (CR, one day after the HSCT, ten days after HSCT and twenty days after HSCT, as well as in the control group consisting of 30 healthy individuals. The outcomes showed that both groups of patients had an hyperoxidative state with high DI when compared to baseline and to the control group and that the CR exacerbated this condition. However, after the follow-up period of the study, this picture was re-established to the baseline levels of each pathology. The study patients with MM showed a mean grafting time of 10.75 days (8 to 13 days, with 10.15 days (8 to 15 days for the lymphoma patients. In patients with MM, there was a negative correlation between the grafting time and the basal levels of GPx (r = -0.54; p = 0.034, indicating that lower levels of this important enzyme are associated with a longer grafting time. For the DI, the correlation was a positive one (r = 0.529; p = 0.030. In the group with lymphoma, it was observed that the basal levels of NOx were positively correlated with grafting time (r = 0.4664, p = 0.032. The data indicate the potential of these biomarkers as predictors of toxicity and grafting time in patients with MM and Lymphomas submitted to autologous HSCT.
Status report on seismic re-evaluation
International Nuclear Information System (INIS)
1998-01-01
In May 1997, a meeting of the PWG 3 Sub Group on the Seismic Behaviour of Structures agreed several priority objectives, of which one was the production of a status report on seismic re-evaluation. Seismic re-evaluation is identified as the process of carrying out a re-assessment of the safety of existing nuclear power plants for a specified seismic hazard. This may be necessary when no seismic hazard was considered in the original design of the plant, the relevant codes and regulations have been revised, the seismic hazard for the site has been re-assessed or there is a need to assess the capacity of the plant for severe accident conditions and behaviour beyond the design basis. Re-evaluation may also be necessary to resolve an issue, or to assess the impact of new findings or knowledge. A questionnaire on the subject was issued to all members of the Seismic Sub Group in the summer of 1997, and responses to the questionnaire had been received from most members by the end of 1997. This report is based on the responses to the questionnaire, together with comment and discussion within the group. The questionnaire covered the following main topics of interest in relation to seismic re-evaluation: General and Legislative Framework, Overall Approach, Input Definition and Analysis Methods, Scope of Plant and Assessment of As-built Situation, Assessment criteria, Outcome of Re-evaluations, Research. The responses to the questionnaire have been collated and reviewed with the objective of comparing current practice in the field of seismic re-evaluation in member countries, and a number of important points have been identified in relation to the position of seismic re-evaluation in the nuclear power industry throughout the world. It is evident that seismic re-evaluation is a relatively mature process that has been developing for some time, with most countries adopting similar practices, often based on principles which have been developed in the US nuclear industry. Seismic
Identification of a potential superhard compound ReCN
International Nuclear Information System (INIS)
Fan, Xiaofeng; Li, M.M.; Singh, David J.; Jiang, Qing; Zheng, W.T.
2015-01-01
Highlights: • We identify a new ternary compound ReCN with theoretical calculation. • The ternary compound ReCN is with two stable structures with P63mc and P3m1. • ReCN is a semiconductor from the calculation of electronic structures. • ReCN is found to possess the outstanding mechanical properties. • ReCN may be synthesized relatively easily. - Abstract: We identify a new ternary compound, ReCN and characterize its properties including structural stability and indicators of hardness using first principles calculations. We find that there are two stable structures with space groups P63mc (HI) and P3m1 (HII), in which there are no C–C and N–N bonds. Both structures, H1 and III are elastically and dynamically stable. The electronic structures show that ReCN is a semiconductor, although the parent compounds, ReC 2 and ReN 2 are both metallic. ReCN is found to possess the outstanding mechanical properties with the large bulk modulus, shear modulus and excellent ideal strengths. In addition, ReCN may perhaps be synthesized relatively easily because it becomes thermodynamic stable with respect to decomposition at very low pressures
National Oceanic and Atmospheric Administration, Department of Commerce — Profile data collected as part of the Bermuda-Atlantic Time Series Study (BATS) from Bermuda Institute of Ocean Sciences (BIOS; formerly BBSR)
InSpiRe - Intelligent Spine Rehabilitation
DEFF Research Database (Denmark)
Bøg, Kasper Hafstrøm; Helms, Niels Henrik; Kjær, Per
Rapport on InSpiRe-projektet: InSpiRe er et nationalt netværk, der skal fremme mulighederne for intelligent genoptræning i forhold til ryglidelser. I netværket mødes forskere, virksomheder, kiropraktorer og fysioterapeuter for at udvikle nye genoptrænings og/eller behandlingsteknologier.......Rapport on InSpiRe-projektet: InSpiRe er et nationalt netværk, der skal fremme mulighederne for intelligent genoptræning i forhold til ryglidelser. I netværket mødes forskere, virksomheder, kiropraktorer og fysioterapeuter for at udvikle nye genoptrænings og/eller behandlingsteknologier....
Infection by Cryptosporidium parvum in renal patients submitted to renal transplant or hemodialysis
Directory of Open Access Journals (Sweden)
Chieffi Pedro Paulo
1998-01-01
Full Text Available The frequency of infection by Cryptosporidium parvum was determined in two groups of renal patients submitted to immunosuppression. One group consisted of 23 renal transplanted individuals, and the other consisted of 32 patients with chronic renal insufficiency, periodically submitted to hemodialysis. A third group of 27 patients with systemic arterial hypertension, not immunosuppressed, was used as control. During a period of 18 months all the patients were submitted to faecal examination to detect C. parvum oocysts, for a total of 1 to 6 tests per patient. The results showed frequencies of C. parvum infection of 34.8%, 25% and 17.4%, respectively, for the renal transplanted group, the patients submitted to hemodialysis and the control group. Statistical analysis showed no significant differences among the three groups even though the frequency of C. parvum infection was higher in the transplanted group. However, when the number of fecal samples containing C. parvum oocysts was taken in account, a significantly higher frequency was found in the renal transplanted group.
18 CFR 344.2 - Manner of submitting quotations.
2010-04-01
... quotations. 344.2 Section 344.2 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT OF ENERGY REGULATIONS UNDER THE INTERSTATE COMMERCE ACT FILING QUOTATIONS FOR U.S. GOVERNMENT SHIPMENTS AT REDUCED RATES § 344.2 Manner of submitting quotations. (a) The quotation or tender...
Analysis of suspected wildlife crimes submitted for forensic examinations in Scotland.
Millins, Caroline; Howie, Fiona; Everitt, Charles; Shand, Michael; Lamm, Catherine
2014-09-01
This study describes the occurrence of suspected wildlife crimes submitted for forensic examination in Scotland in 2010. The study aims were to determine which types of crimes were committed, which species were targeted, and the outcome of investigations, in order to assess the contribution of forensic examinations in the prosecution of wildlife crimes. Information on suspected wildlife crimes submitted between January 1 and December 31, 2010 to the SAC Consulting: Veterinary Services Disease Surveillance Centers, Science and Advice for Scottish Agriculture, and to the University of Glasgow, was used. The location of suspected crimes, the species targeted, cause of death, and types of the 188 submitted wildlife crimes were summarized. More information regarding cases involving birds were submitted than cases involving mammals, and included 114 raptors, 14 waterfowl, and 22 "other bird species." Mammal cases (n = 38) included 12 badgers, 8 foxes, 7 deer, 4 hares, and 7 "other mammals." The cause of death was determined in 124 suspected crimes; malicious or accidental trauma was the most likely cause of death in 72, and 33 were poisoned. Forensic evidence supporting criminal activity was found in 53 cases, and poisoning was the most frequent crime recorded. At least five individuals were successfully prosecuted, representing 2.7 % of submissions. It was challenging to track cases from submission through to prosecution and laboratories conducting forensic investigations were often not informed of the outcome of prosecutions or court decisions.
Concentration of 188Re-Perrhenate for Therapeutic Radiopharmaceuticals
International Nuclear Information System (INIS)
Bokhari, T.H.; Hina, S.; Ahmad, M.; Iqbal, M.
2013-01-01
Summary: Rhenium-188 (T1/2=16.9h) has great potential for a variety of therapeutic applications, including radionuclide synovectomy, oncology and bone pain palliation. The radioactive concentration of 188Re is dependent upon the specific activity of 188W, which dictates the bed size of the alumina/gel column. Due to the high content of inactive tungsten in neutron irradiated WO3, large columns containing aluminum oxide or gel are needed to prepare to double neutron capture based 188W/188Re generators that results in large elution volumes containing relatively high188W contents and low concentrations of /sup 188/ ReO/sub 4/ This decrease in specific volume of 188ReO/sub 4/ places a limitation because a high radioactive concentration of 188ReO4 - is always needed for filling angioplasty balloons or other therapeutic radiopharmaceuticals like188Re -EHDP 188Re -EDTMP, 188Re - MAG3 and 188Re -DTPA. We report post elution concentration of 188ReO4 - using in- house prepared lead cation exchange and alumina columns. Using these columns high bolus volume (10 mL saline) of 188ReO4 - can conveniently be concentrated in 1 mL of physiological saline for therapeutic use. (author)
Thermolysis of salts of [ReCl6]2- and [ReBr6]2- anions
International Nuclear Information System (INIS)
Gubanov, A.I.; Korenev, S.V.; Gromilov, S.A.; Shubin, Yu.V.
2003-01-01
Thermal decomposition of the [Pd(NH 3 ) 4 ][ReG 6 ], [Pt(NH 3 ) 4 ][ReG 6 ], (NH 4 ) 2 [ReG 6 ] complexes, where G = Cl, Br, was studied in the inert atmosphere. Certain regularities of the thermolysis were established. Finished products of the thermolysis of binary complexes in the inert atmosphere were demonstrated to be two-phase systems containing two solid solutions - one on the basis of the platinum (palladium) fcc-lattice, another - on the basis of the rhenium hcp lattice. One-phase solid palladium - rhenium solutions were established to be obtained during reduction of the studied complexes in the hydrogen atmosphere [ru
Arterial hypertension and associated factors in patients submitted to myocardial revascularization
Directory of Open Access Journals (Sweden)
Flávia Cortez Colósimo
2015-04-01
Full Text Available OBJECTIVE To identify the prevalence of arterial hypertension and associated factors in patients submitted to myocardial revascularization. METHOD Cross-sectional study using the database of a hospital in São Paulo (SP, Brazil containing 3010 patients with coronary artery disease submitted to myocardial revascularization. A multiple logistic regression was performed to identify variables independently associated with hypertension (statistical significance: p1.3: (OR=1.37;CI:1.09-1.72. CONCLUSION A high prevalence of arterial hypertension and association with both non-modifiable and modifiable factors was observed.
Stress analysis in pipelines submitted to internal pressure - and temperature transients
International Nuclear Information System (INIS)
Mansur, T.R.
1981-08-01
Experimental determination of the structural behaviour of a thermal-hydraulic loop, when submitted to simultaneous fast change of pressure and temperature, was performed. For this, electrical strain-gages were positioned at some critical points in order to measure the deformation conditions of the structure. The study of the kinetics of the deformation revealed the presence of important transient stresses, mainly from thermal origin. After this transient behaviour, the structure is submitted to a thermal stress, which is shown to be strongly dependent on the degree of restraint of the structure. (Author) [pt
Particulate organic carbon mass distribution at the Bermuda Atlantic Time-series Study (BATS) site
Gundersen, Kjell; Orcutt, Karen M.; Purdie, Duncan A.; Michaels, Anthony F.; Knap, Anthony H.
Errors in total particulate organic carbon (total POC) measurements caused by particles settling in Niskin water samplers, loss of bacterial cells during filtration and undersampling of rare particles such as the diazotrophic cyanobacterium Trichodesmium spp. were investigated at the Bermuda Atlantic Time-series Study (BATS) site. Regular core samples of temperature, primary production, bacterial abundance, chlorophyll- a (Chl- a) and POC were collected at monthly intervals from 1991 to 1996. During this period of time, shorter investigations of particles settling in water samples (1991-1992), bacterial cells lost during filtration (1992-1993), and Trichodesmium abundance (1995-1996) were performed at the BATS site. The BATS site shows striking seasonal patterns in hydrography and phytoplankton primary productivity, with a strong maximum immediately following the deep winter mixing of the water column. Following the peak in primary production, bacterial abundance showed only slightly elevated levels in spring. Maxima of Chl- a and POC also were associated with the primary production peaks, but these particle concentrations became less pronounced through summer and fall. An average of 26% of total POC collected in Niskin water bottles settled below the spigot before it could be sampled. An average of 47% of all bacterial cells passed the nominal pore size of a Whatman GF/F filter, and total POC measurements generated from GF/F filtered seawater samples had to be corrected for this loss. The average integrated stocks of total POC in the upper 65 m of the water column was 32% pigmented phytoplankton, 15% microheterotrophs, 54% other detrital matter (32 : 15 : 54). Phytoplankton C equaled bacterial C in the 65-135 m depth range (16 : 19 : 65), but phytoplankton C was virtually non-existent deeper than 135 m (2 : 14 : 74). Bacterial C biomass was higher than phytoplankton in surface waters outside the spring bloom period, but carbon not accounted for by phytoplankton
International Nuclear Information System (INIS)
Poquillon, D.
1997-10-01
Usually, for the integrity assessment of defective components, well established rules are used: global approach to fracture. A more fundamental way to deal with these problems is based on the local approach to fracture. In this study, we choose this way and we perform numerical simulations of intergranular crack initiation and intergranular crack propagation. This type of damage can be find in components of fast breeder reactors in 316 L austenitic stainless steel which operate at high temperatures. This study deals with methods coupling partly the behaviour and the damage for crack growth in specimens submitted to various thermomechanical loadings. A new numerical method based on finite element computations and a damage model relying on quantitative observations of grain boundary damage is proposed. Numerical results of crack initiation and growth are compared with a number of experimental data obtained in previous studies. Creep and creep-fatigue crack growth are studied. Various specimen geometries are considered: compact Tension Specimens and axisymmetric notched bars tested under isothermal (600 deg C) conditions and tubular structures containing a circumferential notch tested under thermal shock. Adaptative re-meshing technique and/or node release technique are used and compared. In order to broaden our knowledge on stress triaxiality effects on creep intergranular damage, new experiments are defined and conducted on sharply notched tubular specimens in torsion. These isothermal (600 deg C) Mode II creep tests reveal severe intergranular damage and creep crack initiation. Calculated damage fields at the crack tip are compared with the experimental observations. The good agreement between calculations and experimental data shows the damage criterion used can improve the accuracy of life prediction of components submitted to intergranular creep damage. (author)
Design analysis of a Helium re-condenser
Muley, P. K.; Bapat, S. L.; Atrey, M. D.
2017-02-01
Modern helium cryostats deploy a cryocooler with a re-condenser at its II stage for in-situ re-condensation of boil-off vapor. The present work is a vital step in the ongoing research work of design of cryocooler based 100 litre helium cryostat with in-situ re-condensation. The cryostat incorporates a two stage Gifford McMahon cryocooler having specified refrigerating capacity of 40 W at 43 K for I stage and 1 W at 4.2 K for II stage. Although design of cryostat ensures thermal load for cryocooler below its specified refrigerating capacity at the second stage, successful in-situ re-condensation depends on proper design of re-condenser which forms the objective of this work. The present work proposes design of helium re-condenser with straight rectangular fins. Fins are analyzed for optimization of thermal performance parameters such as condensation heat transfer coefficient, surface area for heat transfer, re-condensing capacity, efficiency and effectiveness. The present work provides design of re-condenser with 19 integral fins each of 10 mm height and 1.5 mm thickness with a gap of 1.5 mm between two fins, keeping in mind the manufacturing feasibility, having efficiency of 80.96 % and effectiveness of 10.34.
17 CFR 145.9 - Petition for confidential treatment of information submitted to the Commission.
2010-04-01
... may summarily reject the submitter's request for confidential treatment with leave to the submitter to... treatment of information submitted to the Commission. 145.9 Section 145.9 Commodity and Securities Exchanges... treatment of information submitted to the Commission. (a) Purpose. This section provides a procedure by...
78 FR 63501 - Request To Submit a Two-Part Application-Northwest Medical Isotopes, LLC
2013-10-24
... new accident precursors are created by allowing an applicant to submit a construction permit... certain regulatory requirements, which, if granted, would allow the submittal of a construction permit... facility applicants subject to 10 CFR 51.20(b) \\1\\ may submit the information required for a construction...
India RE Grid Integration Study
Energy Technology Data Exchange (ETDEWEB)
Cochran, Jaquelin M [National Renewable Energy Laboratory (NREL), Golden, CO (United States)
2017-09-08
The use of renewable energy (RE) sources, primarily wind and solar generation, is poised to grow significantly within the Indian power system. The Government of India has established a target of 175 gigawatts (GW) of installed RE capacity by 2022, including 60 GW of wind and 100 GW of solar, up from 29 GW wind and 9 GW solar at the beginning of 2017. Thanks to advanced weather and power system modeling made for this project, the study team is able to explore operational impacts of meeting India's RE targets and identify actions that may be favorable for integration.
National Oceanic and Atmospheric Administration, Department of Commerce — Chemical, biological, and physical profile data collected as part of the Bermuda-Atlantic Time Series Study (BATS) for the period 1988-December 2006 at Bermuda...
Paula, Mayara H.; Barbosa, Rafael I.; Marcolino, Alexandre M.; Elui, Valéria M. C.; Rosén, Birgitta; Fonseca, Marisa C. R.
2016-01-01
BACKGROUND: Mirror therapy has been used as an alternative stimulus to feed the somatosensory cortex in an attempt to preserve hand cortical representation with better functional results. OBJECTIVE: To analyze the short-term functional outcome of an early re-education program using mirror therapy compared to a late classic sensory program for hand nerve repair. METHOD: This is a randomized controlled trial. We assessed 20 patients with median and ulnar nerve and flexor tendon repair using the Rosen Score combined with the DASH questionnaire. The early phase group using mirror therapy began on the first postoperative week and lasted 5 months. The control group received classic sensory re-education when the protective sensation threshold was restored. All participants received a patient education booklet and were submitted to the modified Duran protocol for flexor tendon repair. The assessments were performed by the same investigator blinded to the allocated treatment. Mann-Whitney Test and Effect Size using Cohen's d score were used for inter-group comparisons at 3 and 6 months after intervention. RESULTS: The primary outcome (Rosen score) values for the Mirror Therapy group and classic therapy control group after 3 and 6 months were 1.68 (SD=0.5); 1.96 (SD=0.56) and 1.65 (SD=0.52); 1.51 (SD=0.62), respectively. No between-group differences were observed. CONCLUSION: Although some clinical improvement was observed, mirror therapy was not shown to be more effective than late sensory re-education in an intermediate phase of nerve repair in the hand. Replication is needed to confirm these findings. PMID:26786080
Directory of Open Access Journals (Sweden)
Mayara H. Paula
2016-02-01
Full Text Available BACKGROUND: Mirror therapy has been used as an alternative stimulus to feed the somatosensory cortex in an attempt to preserve hand cortical representation with better functional results. OBJECTIVE: To analyze the short-term functional outcome of an early re-education program using mirror therapy compared to a late classic sensory program for hand nerve repair. METHOD: This is a randomized controlled trial. We assessed 20 patients with median and ulnar nerve and flexor tendon repair using the Rosen Score combined with the DASH questionnaire. The early phase group using mirror therapy began on the first postoperative week and lasted 5 months. The control group received classic sensory re-education when the protective sensation threshold was restored. All participants received a patient education booklet and were submitted to the modified Duran protocol for flexor tendon repair. The assessments were performed by the same investigator blinded to the allocated treatment. Mann-Whitney Test and Effect Size using Cohen's d score were used for inter-group comparisons at 3 and 6 months after intervention. RESULTS: The primary outcome (Rosen score values for the Mirror Therapy group and classic therapy control group after 3 and 6 months were 1.68 (SD=0.5; 1.96 (SD=0.56 and 1.65 (SD=0.52; 1.51 (SD=0.62, respectively. No between-group differences were observed. CONCLUSION: Although some clinical improvement was observed, mirror therapy was not shown to be more effective than late sensory re-education in an intermediate phase of nerve repair in the hand. Replication is needed to confirm these findings.
Simulation of the ATV Re-Entry Obsrvations
Bastida Virgili, B.; Krag, H.; Lips, T.; De Pasquale, E.
2010-09-01
The first ATV was launched on 9th March 2008 and, after a successful mission, the last phase was a controlled destructive re-entry on 29th September 2008, shortly after 13:30 UTC, in which the remains of the ATV and its load fell into the South Pacific Ocean. In order to better understand the re-entry processes, an insitu optical observation campaign was launched to record and analyze the ATV controlled re-entry with several instruments on board of two airplanes and also from the ISS. This observation campaign was successful and triggered several different still-ongoing studies on the extraction and analysis of data to draw conclusions on the adequacy of the re-entry break-up and explosion models used for the safety analysis of the ATV re-entry. This paper addresses the validation process for ESA’s model for re-entry survivability and on-ground risk assessment for explosive re-entry events using the observation data. The underlying rationale is to improve the models for the benefit of planning and execution of future controlled re-entries and in risk calculation in case of uncontrolled ones. The re-entry trajectory of the ATV, the explosive event and the trajectories of the fragments are simulated with the existing ESA tools and the EVOLVE explosion model. Additional software has been developed to simulate airborne sensor field of view(FOV) crossings based on the aircraft trajectories, attitude profile, sensor mounts and FOVs. Sensor performance and object radiation are modeled in order to generate synthetic images for the different sensors in the ISS and the two airplanes. These synthetic images and synthetic videos are compared with the available reentry observations of the ATV. This paper will present the software and techniques to generate synthetic imagery. It will give results of the comparison between the simulated and the real trajectories and fragmentation and explain the subsequent validation process of the ESA re-entry tools and the potential
L-acetylcarnitine enhances functional muscle re-innervation.
Pettorossi, V E; Brunetti, O; Carobi, C; Della Torre, G; Grassi, S
1991-01-01
The efficacy of L-acetylcarnitine and L-carnitine treatment on motor re-innervation was analyzed by evaluating different muscular parameters describing functional muscle recovery after denervation and re-innervation. The results show that L-acetylcarnitine markedly enhances functional muscle re-innervation, which on the contrary is unaffected by L-carnitine. The medial gastrocnemius muscle was denervated by cutting the nerve at the muscle entry point. After 20 days the sectioned nerve was resutured into the medial gastrocnemius muscle, and the extent of re-innervation was monitored 45 days later. L-acetylcarnitine-treated animals show significantly higher twitch and tetanic tensions of re-innervated muscle. Furthermore the results, obtained by analysing the twitch time to peak and tetanic contraction-relaxation times, suggest that L-acetylcarnitine mostly affects the functional re-innervation of slow motor units. The possible mechanisms by which L-acetylcarnitine facilitates such motor and nerve recovery are discussed.
2506-IJBCS-Article-Djossou D Cabinet
African Journals Online (AJOL)
hp
shown any correlation between F- and the four elements (Ca2+, NO3. -, NH4+ , NO2. - ). ... brand (combo pH & EC). The water was then ... is done in dry season. Laboratory analysis focused on Ca2+,. NH4+, F-, NO3. -, NO2. - elements that are measured out by an ionic liquid chromatography and a spectrophotometer.
International Nuclear Information System (INIS)
Duatti, A.
2009-01-01
Radiopharmaceuticals incorporating the β-emitting radionuclide Re-188 are still attracting much interest for their potential application in nuclear medicine as therapeutic agents. There are many advantages of employing this class of radioactive compounds as briefly summarized in the following. (1) Re-188 emits a high-energy β- particle (2.1 MeV) that can be efficiently used to deliver high-dose radiation to the target. (2) Re-188 concomitantly emits a 155-keV γ photon that can be conveniently employed to obtain good-quality SPECT images of the biodistribution of Re-188 radiopharmaceuticals and, ultimately, following in vivo the course of the therapy. (3) Re-188 has a relatively short half-life (17 hours) that may allow multiple treatments of the same patient's disease. (4) Re-188 is a radiometal belonging to the same group of Tc-99m in the transition metal series of the Periodic Table, and shares with its cogener similar (though not identical) chemical properties that could be useful for designing a broad class of Re-188 radiopharmaceuticals having the same biodistribution properties of the corresponding Tc-99m analogues. (5) Similarly to Tc-99m, the radionuclide Re-188 is produced in high-specific activity through the 188 W/ 188 Re transportable generator system. A first challenge encountered in the attempt to develop efficient labeling procedures for Re-188 was related to the low radiochemical yield usually observed in tracer-level preparations of Re-188 radiopharmaceuticals starting from generator-produced [ 188 ReO 4 ]-. This drawback is commonly associated with the low value of the standard reduction potential of the tetraoxo anion as compared to the corresponding Tc-99m pertechnetate anion. In recent years, we reported a simple and efficient procedure for overcoming this problem based on a general chemical principle called 'expansion of the coordination sphere' and involving the addition to the reaction vial of an ancillary ligand (usually, chelating hard
41 CFR 105-50.402 - Reports submitted to the Office of Management and Budget.
2010-07-01
... Office of Management and Budget. 105-50.402 Section 105-50.402 Public Contracts and Property Management... submitted to the Office of Management and Budget. Copies of the foregoing reports will be submitted by the Administrator to the Office of Management and Budget not later than March 30 of each year. ...
Comparative NMR investigation of the Re-based borides
Lue, C. S.; Tao, Y. F.; Su, T. H.
2008-07-01
We report a systematic study of the rhenium-based borides, ReB2 , Re7B3 , and Re3B , by means of the B11 nuclear magnetic resonance (NMR) spectroscopy. While Re7B3 and Re3B are superconductors, ReB2 exhibits no superconducting signature but is of current interest due to its superhard mechanical property. Since the major focus of this investigation is their electronic characteristics in the normal states, we performed the measurements at temperatures between 77 and 295 K. For Re7B3 and Re3B , s -character electrons were found to be responsible for the observed B11 NMR Knight shift and spin-lattice relaxation rate (1/T1) . From T1 analysis, we thus deduce the partial Bs Fermi-level density of states (DOS) of both borides. On the other hand, the relaxation rate of ReB2 is mainly associated with p electrons, similar to the cases of OsB2 and RuB2 . In addition, the extracted B2p Fermi-level DOS is in good agreement with the theoretical prediction from band-structure calculations.
Voyage dans le noir. Trous noirs, matière noire, énergie noire et antimatière
CERN. Geneva; Alvarez-Gaume, Luis; Grojean, Christophe
2009-01-01
Et si nous faisions avec les physiciens un voyage dans le noir ? De l'astrophysique à la physique des particules les trois noirs, la matière noire, l'énergie noire ou l’antimatière intriguent et fascinent. Que sont ces objets qui bousculent nos idées et qui véhiculent parfois des craintes irraisonnées? Luis Alvarez-Gaume, Michael Doser et Christophe Grojean, physiciens du CERN vous invitent à mettre en lumière (!) les constituants de base de la matière et à explorer les mystères de la physique contemporaine. Une soirée lumineuse pour éclairer des concepts et ne plus avoir peur du noir.
Allele Re-sequencing Technologies
DEFF Research Database (Denmark)
Byrne, Stephen; Farrell, Jacqueline Danielle; Asp, Torben
2013-01-01
The development of next-generation sequencing technologies has made sequencing an affordable approach for detection of genetic variations associated with various traits. However, the cost of whole genome re-sequencing still remains too high to be feasible for many plant species with large...... alternative to whole genome re-sequencing to identify causative genetic variations in plants. One challenge, however, will be efficient bioinformatics strategies for data handling and analysis from the increasing amount of sequence information....
Biomolecule labelling by 186 Re
International Nuclear Information System (INIS)
Lungu, Valeria Viorica; Mihailescu, Gabriela; Dumitrescu, Gabriela
1998-01-01
The aim of this study is to develop and improve the existing radiolabelling techniques of peptides and monoclonal antibodies with 186 Re and 188 Re as potential agents for cancer targeted radiotherapy. We selected the following methods and techniques for direct labelling of peptides and monoclonal antibody: 1. Prereduction of -S-S- bridges of biomolecule to sulfhydryls using reducing agents: ascorbic acid, cysteine, active hydrogen, 2,3 dimercaptopropanol. The prereduction reactions are controlled by massic ratios of reduction agents/biomolecule, pH, temperature and time of incubation; 2. Reduction of 186 Re O 4 - stannous chloride in acid and alkaline pH; 3. Coupling reaction of 186 Re (red) with the biomolecule controlled by the time and temperature of incubation, the influence of pH regarding the binding of 186 Re to the biomolecules. The quality control was effected by chromatography techniques (paper and elution gel chromatography) on labeled biomolecule before and after purification. The elution gel chromatography was spectrophotometricaly monitored at 280 nm. In the same time the radioactivity of samples was measured using a gamma counter. All the results confirm in vitro stability of labeled biomolecule. The biological evaluation studies regarding accumulation and biological affinity will be controlled by scintigraphy method. Biodistribution studies will be effected to Walker tumor bearing animals at 4 and 24 hours after injections. (authors)
20 CFR 703.105 - Copies of forms of policies to be submitted with application.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Copies of forms of policies to be submitted... REGULATIONS Authorization of Insurance Carriers § 703.105 Copies of forms of policies to be submitted with... of the Office copies of the forms of policies which the applicant proposes to issue in writing...
2013-12-17
... Environmental Protection Agency has submitted an information collection request (ICR), ``Performance Evaluation... ENVIRONMENTAL PROTECTION AGENCY [EPA-HQ-OECA-2013-0547; FRL 9903-29-OEI] Information Collection Request Submitted to OMB for Review and Approval; Comment Request; Performance Evaluation Studies on...
Neutron diffraction studies on structural and magnetic properties of RE2NiGe3 (RE=La, Ce)
International Nuclear Information System (INIS)
Kalsi, Deepti; Rayaprol, S.; Siruguri, V.; Peter, Sebastian C.
2014-01-01
We report the crystallographic properties of RE 2 NiGe 3 (RE=La, Ce) synthesized by arc melting. Rietveld refinement on the powder neutron diffraction (ND) data suggest both compounds are isostructural and crystallize in the non-centrosymmetric Er 2 RhSi 3 type structure having hexagonal space group P6 ¯ 2c. In the crystal structure of RE 2 NiGe 3 , two dimensional arrangements of nickel and germanium atoms lead to the formation of hexagonal layers with rare earth atoms sandwiched between them. Magnetic susceptibility measurements performed in low fields exhibit antiferromagnetic ordering in cerium compound around (T o =) 3.2 K. Neutron diffraction measurements at 2.8 K (i.e., at T
Recurring Anomaly Detection System (ReADS)
National Aeronautics and Space Administration — Overview: ReADS can analyze text reports, such as aviation reports and problem or maintenance records. ReADS uses text clustering algorithms to group loosely related...
49 CFR 551.63 - May a foreign manufacturer submit a designation by email or facsimile?
2010-10-01
... email or facsimile? 551.63 Section 551.63 Transportation Other Regulations Relating to Transportation... foreign manufacturer submit a designation by email or facsimile? No, the statute requires designation... designation documents submitted via email or facsimile, as they do not satisfy this requirement. ...
Dosimetry of patients submitted to cerebral PET/CT for the diagnosis of mild cognitive impairment
Energy Technology Data Exchange (ETDEWEB)
Santana, Priscila do Carmo; Oliveira, Paulo Marcio Campos de; Bernardes, Felipe Dias; Mamede, Marcelo, E-mail: pridili@gmail.com [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil); Mourao, Arnaldo Prata [Centro Federal de Educacao Tecnologica de Minas Gerais (CEFET), Belo Horizonte, MG (Brazil); Silva, Teogenes Augusto da [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)
2014-11-15
Objective: the present study was aimed at evaluating the effective radiation dose in patients submitted to PET/CT for the diagnosis of mild cognitive impairment. Materials and methods: TLD-100 detectors inserted into an Alderson Rando® anthropomorphic phantom were utilized to measure the absorbed dose coming from the CT imaging modality. The anthropomorphic phantoms (male and female adult versions) were submitted to the same technical protocols for patients’ images acquisition. The absorbed dose resulting from the radiopharmaceutical injection was estimated by means of the model proposed by the ICRP publication 106. Results: the effective dose in patients submitted to this diagnostic technique was approximately (5.34 ± 1.99) mSv. Conclusion: optimized protocols for calculation of radioactive activity injected into patients submitted to this diagnostic technique might contribute to reduce the effective radiation dose resulting from PET/CT in the diagnosis of mild cognitive impairment. (author)
Dosimetry of patients submitted to cerebral PET/CT for the diagnosis of mild cognitive impairment
International Nuclear Information System (INIS)
Santana, Priscila do Carmo; Oliveira, Paulo Marcio Campos de; Bernardes, Felipe Dias; Mamede, Marcelo; Mourao, Arnaldo Prata; Silva, Teogenes Augusto da
2014-01-01
Objective: the present study was aimed at evaluating the effective radiation dose in patients submitted to PET/CT for the diagnosis of mild cognitive impairment. Materials and methods: TLD-100 detectors inserted into an Alderson Rando® anthropomorphic phantom were utilized to measure the absorbed dose coming from the CT imaging modality. The anthropomorphic phantoms (male and female adult versions) were submitted to the same technical protocols for patients’ images acquisition. The absorbed dose resulting from the radiopharmaceutical injection was estimated by means of the model proposed by the ICRP publication 106. Results: the effective dose in patients submitted to this diagnostic technique was approximately (5.34 ± 1.99) mSv. Conclusion: optimized protocols for calculation of radioactive activity injected into patients submitted to this diagnostic technique might contribute to reduce the effective radiation dose resulting from PET/CT in the diagnosis of mild cognitive impairment. (author)
Familiære abdominale aortaaneurismer
DEFF Research Database (Denmark)
Mejnert Jørgensen, Trine; Lindholt, Jes S.; Høgh, Annette Langager
Formål og baggrund: Det er velkendt, at risikoen for at udvikle et abdominalt aortaaneurisme (AAA) er væsentligt forøget blandt førstegradsslægtninge til AAA-patienter, men tidligere studier er få og svært sammenlignelige, ligesom man ikke har kunnet belyse, om familiære tilfælde af AAA fremtræder...... mere aggressivt end ikke-familiære. Man ved således meget lidt om væksthastighed, prognose for ruptur, alder ved diagnose og operation og risiko for AAA-relaterede dødsfald for denne gruppe. Projektet vil forsøge at besvare følgende: Hvor stor er forekomsten af AAA blandt førstegradsslægtninge til AAA......-patienter på landsplan og er familiære tilfælde af AAA mere aggressive i form af lavere gennemsnitsalder ved diagnose og operation, hurtigere vækstrate, større rupturrisiko og højere forekomst af AAA-relaterede dødsfald end ikke-familiære AAA? Design: Projektet er et retrospektivt case-kontrolstudie, hvor man...
RE-Powering’s Electronic Decision Tree
Developed by US EPA's RE-Powering America's Land Initiative, the RE-Powering Decision Trees tool guides interested parties through a process to screen sites for their suitability for solar photovoltaics or wind installations
Business process re-engineering in service operations
International Nuclear Information System (INIS)
McClintock, J.W.
1995-01-01
The concept of business process re-engineering, and how it was applied to the operations of the Consumers Gas Company were discussed. Business process re-engineering was defined as the improvement of the efficiency of the customer-service process, and the overall improvement of practices and operations. The re-engineering project was said to involve a thorough analysis of information technology, current limitations, and business operational needs, undertaken on an enterprise-wide basis. Viewed generically,a re-engineering project was said to have six major components: (1) business drivers (i.e. the articulation of the Company's strategic issues); (2) benchmark measures; (3) future state process models; (4) cost/benefit analysis; (5) a change management plan; and (6) a development plan. Business improvements expected to result from the project include reduced cost of operation, reduction of waste, and a substantially complete re-design of the business process. Management of the project involved a team approach, and help of a consultant to identify the scope of the re-design, its limitations, and future state. A life expectancy of approximately 10 years was given for the re-engineering plan, with annual benefits (in terms of cost reduction) of $4.6 million by the year 2000
Space-Efficient Re-Pair Compression
DEFF Research Database (Denmark)
Bille, Philip; Gørtz, Inge Li; Prezza, Nicola
2017-01-01
Re-Pair [5] is an effective grammar-based compression scheme achieving strong compression rates in practice. Let n, σ, and d be the text length, alphabet size, and dictionary size of the final grammar, respectively. In their original paper, the authors show how to compute the Re-Pair grammar...... in expected linear time and 5n + 4σ2 + 4d + √n words of working space on top of the text. In this work, we propose two algorithms improving on the space of their original solution. Our model assumes a memory word of [log2 n] bits and a re-writable input text composed by n such words. Our first algorithm runs...
29 CFR 551.5 - Information to be submitted.
2010-07-01
... employees compensated under the plan, including information as to the types of goods delivered, their points... application of the plan which are relied upon to support a finding that the plan has the general purpose and... 29 Labor 3 2010-07-01 2010-07-01 false Information to be submitted. 551.5 Section 551.5 Labor...
30 CFR 285.601 - When am I required to submit my plans to MMS?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false When am I required to submit my plans to MMS... Information Requirements § 285.601 When am I required to submit my plans to MMS? Your plan submission...) You must provide sufficient data and information with your COP for MMS to complete the needed reviews...
Energy Technology Data Exchange (ETDEWEB)
Singh, J. (Canterbury Univ. (United Kingdom). Biological Lab.); Reghebi, K.; Lazarus, C.R.; Clarke, S.E.M. (Guy' s Hospital, London (United Kingdom)); Callahan, A.P.; Knapp, F.F. Jr. (Oak Ridge National Lab., TN (United States)); Blower, P.J. (Kent and Canterbury Hospital (United Kingdom))
1993-03-01
The preparative conditions for [sup 186]Re(V)DMSA and [sup 188]Re(V)DMSA (DMSA = meso-dimercaptosuccinic acid), [beta]-emitting radiopharmaceuticals that have been shown to localize in medullary thyroid carcinoma, require modification depending on the amount of carrier rhenium and the chemical form and medium in which the rhenium is supplied. Preparative conditions are described for use with carrier-free [sup 188]ReO[sub 4][sup -] in saline, and for use with [sup 186]ReO[sub 4][sup -] in saline, sodium hydroxide or nitric acid. Preparation of [sup 186]Re(V)DMSA (carrier present up to 2 mg per 2.5 ml reaction volume) requires a DMSA:SnCl[sub 2]:Re ratio of 10:5:1 at 100[sup o]C for 30 min. Addition of excess nitric acid or hydrochloric acid up to a concentration of 155 mM does not reduce the yield from 100%. A commercial DMSA kit vial (e.g. Amerscan DMSA) can be used for preparation of [sup 188]Re(V)DMSA (carrier free) provided the required is in a volume of less than 1 ml per vial. A convenient method of concentrating the [sup 188]Re generator eluate to the required volume is described. (Author).
Re-irradiation for abdominal tumor. Preliminary results
International Nuclear Information System (INIS)
Narisada, Hiroyuki; Imada, Hajime; Tomoda, Yoshinori
2012-01-01
The purpose of this study was to assess the efficacy of loco-regional radiotherapy for recurrent abdominal tumor treated with re-irradiation. Re-irradiated areas of 16 patients were eight of pelvic space, five of retroperitonium and three of liver or porta hepatica. Eligibility criteria of re-irradiation were success of initial irradiation, no other effective treatment except re-irradiation, constancy of bowel gas at hunger status and respiratory movement, visceral dosage reduction at re-irradiation. Total dose of initial, second course of radiation were 51.3±10.8 Gy, 50.6±14.2 Gy, respectively. Interval of initial and second course of radiation were 16.6±10.2 months. Local control after second course of radiation was four cases of complete response, five of partial response and seven of stable disease. Median survival periods were 55 months after initial treatment and 28 months after second course of radiation. In two cases of pelvic reirradiation, skin to pelvic space fistula was occurred. Re-irradiation for abdominal tumor may become useful salvage treatment. (author)
International Nuclear Information System (INIS)
Perraudeau, Jean
1976-01-01
The objective of this research thesis is to study problems related to re-entrance, and, more particularly, to study a re-entrance system for a CII 90.40 computer. Such a system can be realised under a programmed or cabled form, and both approaches are described and compared. A generalisation of this comparison is briefly proposed. As the computer already possesses a programmed re-entrance system, the author focuses on the study of the cabled re-entrance system which results in an improvement of performance and possibilities provided by this computer, particularly for its use in real time. The design, realisation and development of such a cabled system are reported. A first part reports a theoretical study on re-entrance (definition, problems, applications), a presentation of the computer, a description of the programmed re-entrance system, a presentation of the principle of the chosen cabled re-entrance system, a definition of the structure and operating mode of the cabled pile and a description of its various components, and a flowchart analysis of function execution. The second part reports the practical realisation: definition, technological overview, technology used in the cabled pile, sequencing and multiplexing principle, impulse transmission, logical layouts, and circuit adjustments. The third part presents practical example. An assessment and perspectives are finally discussed
Onboard autonomous mission re-planning for multi-satellite system
Zheng, Zixuan; Guo, Jian; Gill, Eberhard
2018-04-01
This paper presents an onboard autonomous mission re-planning system for Multi-Satellites System (MSS) to perform onboard re-planing in disruptive situations. The proposed re-planning system can deal with different potential emergency situations. This paper uses Multi-Objective Hybrid Dynamic Mutation Genetic Algorithm (MO-HDM GA) combined with re-planning techniques as the core algorithm. The Cyclically Re-planning Method (CRM) and the Near Real-time Re-planning Method (NRRM) are developed to meet different mission requirements. Simulations results show that both methods can provide feasible re-planning sequences under unforeseen situations. The comparisons illustrate that using the CRM is average 20% faster than the NRRM on computation time. However, by using the NRRM more raw data can be observed and transmitted than using the CRM within the same period. The usability of this onboard re-planning system is not limited to multi-satellite system. Other mission planning and re-planning problems related to autonomous multiple vehicles with similar demands are also applicable.
2010-01-01
... SUBMITTED INFORMATION § 193.5 How may I submit safety or security information and have it protected from... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false How may I submit safety or security information and have it protected from disclosure? 193.5 Section 193.5 Aeronautics and Space FEDERAL AVIATION...
International Nuclear Information System (INIS)
Ermakov, A.I.; Belousov, V.V.; Drobot, D.V.; Shcheglov, P.A.
2006-01-01
The geometrical structures, charge distributions, dipole moments, frequencies of normal vibrations, NMR spectra, and total energies of the chemical bonds for the rhenium alkoxy derivatives Re 2 O 3 (OMe) 6 , Re 4 O 6 (OMe) 12 , and ReMoO 2 (OMe) 7 were calculated by the DFT-B3LYP and Hartree-Fock ab initio methods based on the effective core potential theory (LANL2DZ approximation) and the semiempirical PM3(tm) method. Two optimized structures of Re 2 O 3 (OMe) 6 with close energies were found to substantially differ in geometry, 1 H, 13 C, and 17 O NMR spectra, and dipole moment. Various characteristics of the electronic structures and the trans-effect of the ligands in the compounds under consideration were discussed [ru
Existing reflection seismic data re-processing
International Nuclear Information System (INIS)
Higashinaka, Motonori; Sano, Yukiko; Kozawa, Takeshi
2005-08-01
This document is to report the results of existing seismic data re-processing around Horonobe town, Hokkaido, Japan, which is a part of the Horonobe Underground Research Project. The main purpose of this re-processing is to recognize the subsurface structure of Omagari Fault and fold system around Omagari Fault. The seismic lines for re-processing are TYHR-A3 line and SHRB-2 line, which JAPEX surveyed in 1975. Applying weathering static correction using refraction analysis and noise suppression procedure, we have much enhanced seismic profile. Following information was obtained from seismic re-processing results. TYHR-A3 line: There are strong reflections, dipping to the west. These reflections are corresponding western limb of anticline to the west side of Omagari Fault. SHRB-2 line: There are strong reflections, dipping to the west, at CDP 60-140, while there are reflections, dipping to the east, to the east side of CDP 140. These reflections correspond to the western limb and the eastern limb of the anticline, which is parallel to Omagari FAULT. This seismic re-processing provides some useful information to know the geological structure around Omagari Fault. (author)
Dissecting the Re-Os molybdenite geochronometer.
Barra, Fernando; Deditius, Artur; Reich, Martin; Kilburn, Matt R; Guagliardo, Paul; Roberts, Malcolm P
2017-11-22
Rhenium and osmium isotopes have been used for decades to date the formation of molybdenite (MoS 2 ), a common mineral in ore deposits and the world's main source of molybdenum and rhenium. Understanding the distribution of parent 187 Re and radiogenic daughter 187 Os isotopes in molybdenite is critical in interpreting isotopic measurements because it can compromise the accurate determination and interpretation of mineralization ages. In order to resolve the controls on the distribution of these elements, chemical and isotope mapping of MoS 2 grains from representative porphyry copper-molybdenum deposits were performed using electron microprobe and nano-scale secondary ion mass spectrometry. Our results show a heterogeneous distribution of 185,187 Re and 192 Os isotopes in MoS 2 , and that both 187 Re and 187 Os isotopes are not decoupled as previously thought. We conclude that Re and Os are structurally bound or present as nanoparticles in or next to molybdenite grains, recording a complex formation history and hindering the use of microbeam techniques for Re-Os molybdenite dating. Our study opens new avenues to explore the effects of isotope nuggeting in geochronometers.
How to submit an ATIP request | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Corporations, businesses, and organizations with a Canadian presence have the right to make an access to Information request. Please note that an applicant may be charged additional search fees and/or preparation fees in regards to a request they have submitted under the Access to Information Act.
15 CFR 711.5 - Numerical precision of submitted data.
2010-01-01
... 15 Commerce and Foreign Trade 2 2010-01-01 2010-01-01 false Numerical precision of submitted data. 711.5 Section 711.5 Commerce and Foreign Trade Regulations Relating to Commerce and Foreign Trade (Continued) BUREAU OF INDUSTRY AND SECURITY, DEPARTMENT OF COMMERCE CHEMICAL WEAPONS CONVENTION REGULATIONS...
International Nuclear Information System (INIS)
Lopes, Paula Regina Corain; Osso Junior, Joao Alberto
2009-01-01
Amongst some currently radioisotopes, 99m Tc and 188 Re present adequate decay properties for use in Nuclear Medicine. In the current times the most diagnosis examinations are performed with 99m Tc and 188 Re is one radioisotope of potential use in therapy techniques. The objective of this work consists of determining the capacity of some adsorbent materials for retention of molybdenum and tungsten, aiming the optimization of generator systems of 99 Mo- 99m Tc and 188 W- 188 Re with suitable characteristics for application in Nuclear Medicine. Known amounts, in mass, of molybdenum and tungsten were percolated through different chromatographic columns containing different commercial adsorbent materials such as: PZC (poly-zirconium compound), acid alumina and calcinated alumina used in the routine preparation of 99 Mo- 99m Tc generators at IPEN. The tungsten ( 188 W), as well the PZC used in this project, supplied by Russia and Japan, respectively, through the International Atomic Energy Agency (IAEA) and used without any previous preparation. Also trace amounts of 99 Mo and 188 W were added to the initial solutions and the generators were assembled. The 99 Mo- 99m Tc generators were then eluted with known volumes of 0.9% NaCl solution every 24 hours whereas the 188 W- 188 Re generators were eluted every 48 hours. The eluted samples were analyzed by Gamma Spectroscopy and later submitted to quality control evaluation. The results showed that the PZC presents superior retention capacity for Mo of 97.50mg Mo/gPZC, higher than in acid and calcinated alumina, however the elution efficiency at lower pHs is not so high. With regards to the experiments carried out with 188 W and alumina, it was verified that the elution efficiency of 188 Re was not reproducible and the retention capacity of W was 90.23mgW/gAl 2 O 3 at pH 7. (author)
Fitness in paradise: quality of forensic reports submitted to the Hawaii judiciary.
Robinson, Richard; Acklin, Marvin W
2010-01-01
This paper examined quality of forensic reports submitted to the Hawaii Judiciary. Hawaii utilizes a three panel system for assessing fitness to proceed, where two psychologists and one psychiatrist submit independent reports to the Court. Utilizing a survey instrument based on previous research and nationally-derived quality standards, 150 competency to stand trial (CST) reports were examined. Reports demonstrated pervasive mediocrity with respect to quality (Mean QC=68.95, SD=15.21). One quarter (N=38) of the reports scored at or above 80% of the maximum possible score. Levels of CST agreement between evaluators and evaluators and judges were high. Report quality did not differ as a function of evaluator professional identity. Full-time employed evaluators submitted a greater number of reports above the quality criterion. For those evaluators who attended the March training, reports demonstrated significantly improved quality. Suggestions for enhancing report quality are offered with a special attention to inclusion of report elements, focus on inclusion of historical elements, and clearly described rationales supporting forensic opinions. (7664 words. Competency to stand trial, inter-rater agreement).
News from the Library: Share your work, submit your thesis to CDS!
CERN Library
2011-01-01
Are you a student paid by CERN, using CERN equipment or advised by CERN staff and you are currently writing a thesis? Then you should know that you are welcome to submit your final work to the CERN Document Server (CDS), where it will be made available by Open Access. This is the most efficient way of sharing your work within the community - your thesis will certainly find a much greater audience than if you follow the advice of certain dubious publishing companies (see the article Free access to science... but at what cost? published in this issue). At the same time, you ensure long-term storage of your file. All theses qualify, from bachelor to PhD, and any language is accepted. You simply go to CDS and submit your work. If your thesis was written some years ago it is still not too late to submit it; it will then get a new life on CDS! More information here. CERN Theses collection here. If you have any questions or submission problems, please do not hesitate to contact Catherine Cart. ...
Processing and properties of large grain (RE)BCO
International Nuclear Information System (INIS)
Cardwell, D.A.
1998-01-01
The potential of high temperature superconductors to generate large magnetic fields and to carry current with low power dissipation at 77 K is particularly attractive for a variety of permanent magnet applications. As a result large grain bulk (RE)-Ba-Cu-O ((RE)BCO) materials have been developed by melt process techniques in an attempt to fabricate practical materials for use in high field devices. This review outlines the current state of the art in this field of processing, including seeding requirements for the controlled fabrication of these materials, the origin of striking growth features such as the formation of a facet plane around the seed, platelet boundaries and (RE) 2 BaCuO 5 (RE-211) inclusions in the seeded melt grown microstructure. An observed variation in critical current density in large grain (RE)BCO samples is accounted for by Sm contamination of the material in the vicinity of the seed and with the development of a non-uniform growth morphology at ∼4 mm from the seed position. (RE)Ba 2 Cu 3 O 7-δ (RE-123) dendrites are observed to form and bro[en preferentially within the a/b plane of the lattice in this growth regime. Finally, trapped fields in excess of 3 T have been reported in irr[iated U-doped YBCO and (RE) 1+x Ba 2-x Cu 3 O y (RE=Sm, Nd) materials have been observed to carry transport current in fields of up to 10 T at 77 K. This underlines the potential of bulk (RE)BCO materials for practical permanent magnet type applications. (orig.)
BIFOCAL STEREO FOR MULTIPATH PERSON RE-IDENTIFICATION
Directory of Open Access Journals (Sweden)
G. Blott
2017-11-01
Full Text Available This work presents an approach for the task of person re-identification by exploiting bifocal stereo cameras. Present monocular person re-identification approaches show a decreasing working distance, when increasing the image resolution to obtain a higher reidentification performance. We propose a novel 3D multipath bifocal approach, containing a rectilinear lens with larger focal length for long range distances and a fish eye lens of a smaller focal length for the near range. The person re-identification performance is at least on par with 2D re-identification approaches but the working distance of the approach is increased and on average 10% more re-identification performance can be achieved in the overlapping field of view compared to a single camera. In addition, the 3D information is exploited from the overlapping field of view to solve potential 2D ambiguities.
36 CFR 1206.86 - What additional materials must I submit with the final narrative report?
2010-07-01
... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false What additional materials must I submit with the final narrative report? 1206.86 Section 1206.86 Parks, Forests, and Public... narrative report? You must submit the materials determined by the Commission as found in the NHPRC grant...
2013-12-02
... January 2, 2014 for the assurance of consideration. ADDRESSES: Submit comments to the Office of... submitted is subject to subsequent audit and adjustment. A. Federal Oil and Gas Valuation Regulations The... allow or not allow one or both of the relief options . . . (d) If a State decides in advance . . . that...
Stability Analysis for HIFiRE Experiments
Li, Fei; Choudhari, Meelan M.; Chang, Chau-Lyan; White, Jeffery A.; Kimmel, Roger; Adamczak, David; Borg, Matthew; Stanfield, Scott; Smith, Mark S.
2012-01-01
The HIFiRE-1 flight experiment provided a valuable database pertaining to boundary layer transition over a 7-degree half-angle, circular cone model from supersonic to hypersonic Mach numbers, and a range of Reynolds numbers and angles of attack. This paper reports selected findings from the ongoing computational analysis of the measured in-flight transition behavior. Transition during the ascent phase at nearly zero degree angle of attack is dominated by second mode instabilities except in the vicinity of the cone meridian where a roughness element was placed midway along the length of the cone. The growth of first mode instabilities is found to be weak at all trajectory points analyzed from the ascent phase. For times less than approximately 18.5 seconds into the flight, the peak amplification ratio for second mode disturbances is sufficiently small because of the lower Mach numbers at earlier times, so that the transition behavior inferred from the measurements is attributed to an unknown physical mechanism, potentially related to step discontinuities in surface height near the locations of a change in the surface material. Based on the time histories of temperature and/or heat flux at transducer locations within the aft portion of the cone, the onset of transition correlated with a linear N-factor, based on parabolized stability equations, of approximately 13.5. Due to the large angles of attack during the re-entry phase, crossflow instability may play a significant role in transition. Computations also indicate the presence of pronounced crossflow separation over a significant portion of the trajectory segment that is relevant to transition analysis. The transition behavior during this re-entry segment of HIFiRE-1 flight shares some common features with the predicted transition front along the elliptic cone shaped HIFiRE-5 flight article, which was designed to provide hypersonic transition data for a fully 3D geometric configuration. To compare and contrast the
Framework for ReSTful Web Services in OSGi
Shams, Khawaja S.; Norris, Jeffrey S.; Powell, Mark W.; Crockett, Thomas M.; Mittman, David S.; Fox, Jason M.; Joswig, Joseph C.; Wallick, Michael N.; Torres, Recaredo J.; Rabe, Kenneth
2009-01-01
Ensemble ReST is a software system that eases the development, deployment, and maintenance of server-side application programs to perform functions that would otherwise be performed by client software. Ensemble ReST takes advantage of the proven disciplines of ReST (Representational State Transfer. ReST leverages the standardized HTTP protocol to enable developers to offer services to a diverse variety of clients: from shell scripts to sophisticated Java application suites
Glover, D. M.; Conte, M.
2002-12-01
Of considerable scientific interest is the role remineralization plays in the global carbon cycle. It is the ``biological pump'' that fixes carbon in the upper water column and exports it for long time periods to the deep ocean. From a global carbon cycle point-of-view, it is the processes that govern remineralization in the mid- to deep-ocean waters that provide the feedback to the biogeochemical carbon cycle. In this study we construct an ecosystem model that serves as a mechanistic link between euphotic processes and mesopelagic and bathypelagic processes. We then use this prognostic model to further our understanding of the unparalleled time-series of deep-water sediment traps (21+ years) at the Oceanic Flux Program (OFP) and the euphotic zone measurements (10+ years) at the Bermuda Atlantic Time-series Site (BATS). At the core of this mechanistic ecosystem model of the mesopelagic zone is a model that consists of an active feeding habit zooplankton, a passive feeding habit zooplankton, large detritus (sinks), small detritus (non-sinking), and a nutrient pool. As the detritus, the primary source of food, moves through the water column it is fed upon by the active/passive zooplankton pair and undergoes bacterially mediated remineralization into nutrients. The large detritus pool at depth gains material from the formation of fecal pellets from the passive and active zooplankton. Sloppy feeding habits of the active zooplankton contribute to the small detrital pool. Zooplankton mortality (both classes) also contribute directly to the large detritus pool. Aggregation and disaggregation transform detrital particles from one pool to the other and back again. The nutrients at each depth will gain from detrital remineralization and zooplankton excretion. The equations that model the active zooplankton, passive zooplankton, large detritus, small detritus, and nutrients will be reviewed, results shown and future model modifications discussed.
76 FR 61351 - Combined Notice of Filings #1
2011-10-04
... MBR Baseline Tariff Filing to be effective 9/22/2011. Filed Date: 09/22/2011. Accession Number... submits tariff filing per 35.1: ECNY MBR Re-File to be effective 9/22/2011. Filed Date: 09/22/2011... Industrial Energy Buyers, LLC submits tariff filing per 35.1: NYIEB MBR Re-File to be effective 9/22/2011...
Inan, U; Gurel, M
2017-02-01
Instrument fracture is a serious concern in endodontic practice. The aim of this study was to investigate the surface quality of new and used rotary nickel-titanium (NiTi) instruments manufactured by the traditional grinding process and twisting methods. Total 16 instruments of two rotary NiTi systems were used in this study. Eight Twisted Files (TF) (SybronEndo, Orange, CA, USA) and 8 Mtwo (VDW, Munich, Germany) instruments were evaluated. New and used of 4 experimental groups were evaluated using an atomic force microscopy (AFM). New and used instruments were analyzed on 3 points along a 3 mm. section at the tip of the instrument. Quantitative measurements according to the topographical deviations were recorded. The data were statistically analyzed with paired samples t-test and independent samples t-test. Mean root mean square (RMS) values for new and used TF 25.06 files were 10.70 ± 2.80 nm and 21.58 ± 6.42 nm, respectively, and the difference between them was statistically significant (P instruments produced by twisting method (TF 25.06) had better surface quality than the instruments produced by traditional grinding process (Mtwo 25.06 files).
2011-11-02
... operators submit this form to local franchising authorities or the Commission, in situations where the FCC... changes in external costs. Cable operators submit FCC Form 1240 to their respective local franchising...
International Nuclear Information System (INIS)
Langhorn, J.B.; Black, M.A.; McGinn, P.J.
1999-01-01
The phases RE 2 BaCuO 5 /RE 4 Ba 2 Cu 2 O 10 phases (where RE is a mixture of Nd, Sm, Gd, Eu, Y and Yb) have been synthesized in an oxygen atmosphere and subsequently characterized. The mixing of RE elements which inherently form the RE 2 BaCuO 5 phase through the peritectic decomposition of REBa 2 Cu 3 O 7-x (RE123) (i.e. Sm, Gd, Eu, Y, Yb), was observed to give homogeneous mixing of the elements in the 211 phase. In contrast it was found that on mixing Nd with other RE elements a mixture of the Nd 4-2x Ba 2+2x Cu 2-x O 10-2x (Nd422) and RE 2 BaCuO 5 (RE211) phases resulted. It was also observed that on mixing Nd with other REs a finite amount of the RE is substituted into the Nd422 phase and Nd into the RE211. (author)
Diagnostic criteria for Menière's disease.
Lopez-Escamez, Jose A; Carey, John; Chung, Won-Ho; Goebel, Joel A; Magnusson, Måns; Mandalà, Marco; Newman-Toker, David E; Strupp, Michael; Suzuki, Mamoru; Trabalzini, Franco; Bisdorff, Alexandre
2015-01-01
This paper presents diagnostic criteria for Menière's disease jointly formulated by the Classification Committee of the Bárány Society, The Japan Society for Equilibrium Research, the European Academy of Otology and Neurotology (EAONO), the Equilibrium Committee of the American Academy of Otolaryngology-Head and Neck Surgery (AAO-HNS) and the Korean Balance Society. The classification includes two categories: definite Menière's disease and probable Menière's disease. The diagnosis of definite Menière's disease is based on clinical criteria and requires the observation of an episodic vertigo syndrome associated with low- to medium-frequency sensorineural hearing loss and fluctuating aural symptoms (hearing, tinnitus and/or fullness) in the affected ear. Duration of vertigo episodes is limited to a period between 20 minutes and 12 hours. Probable Menière's disease is a broader concept defined by episodic vestibular symptoms (vertigo or dizziness) associated with fluctuating aural symptoms occurring in a period from 20 minutes to 24 hours.
13 CFR 120.830 - Reports a CDC must submit.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Reports a CDC must submit. 120.830 Section 120.830 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Development... each new associate and staff, a Statement of Personal History (for use by non-bank lenders and CDCs...
42 CFR 1008.11 - Who may submit a request.
2010-10-01
... 42 Public Health 5 2010-10-01 2010-10-01 false Who may submit a request. 1008.11 Section 1008.11 Public Health OFFICE OF INSPECTOR GENERAL-HEALTH CARE, DEPARTMENT OF HEALTH AND HUMAN SERVICES OIG... advisory opinion regarding an existing arrangement or one which the requestor in good faith specifically...
2013-10-23
... promulgated under SNAP require that Motor Vehicle Air Conditioners (MVACs) retrofitted to use a SNAP... Request Submitted to OMB for Review and Approval; Comment Request; Mobile Air Conditioner Retrofitting... Environmental Protection Agency has submitted an information collection request (ICR), Mobile Air Conditioner...
The peer-review system: time for re-assessment?
DEFF Research Database (Denmark)
Larsen, Poul Scheel; Riisgard, H. U.; Quinn, G
2000-01-01
Referees are the backbone of quality control. They need more recognition for their work. In an open exchange of opinions among a number of leading editors and experienced reviewers one suggestion has wide support: It should no longer be 'free' to submit a manuscript to a scientific journal. While...... cash payment for reviews is not considered a good idea, a 'payback in kind' system is favored: i.e., if you want to submit papers to a journal you must be willing to review for that journal....
Directory of Open Access Journals (Sweden)
Mario Pacheco, Alicia Cuevas, Javier González-Platas, Carlos Kremer*
2015-03-01
Full Text Available Abstract: A novel Re(V-Re(II nitrosyl complex, [Re(O2(pyz 4][Re(NOBr4(pyz] (pyz = pyrazine was prepared and characterized by X-ray diffraction, elemental analysis, infrared and ultraviolet-visible absorption spectra. This product is obtained in the initial steps of the reaction of (NBu4[Re(NOBr4(EtOH] with pyrazine. Both, the cation and the anion are mononuclear complexes. The Re(V atom in the cation is six-coordinate with four nitrogen atoms from pyrazine ligands, and two oxo ligands. The Re(II anion is also six-coordinate, with four bromide ligands, a linear nitrosyl group and one nitrogen from pyrazine. The spectroscopic studies are discussed and compared with those already reported separately for the cation and the anion. Supporting information: X-Ray (CIF file
2010-10-01
... submitting quotations under the simplified acquisition threshold-non-commercial. 1352.213-71 Section 1352.213... quotations under the simplified acquisition threshold—non-commercial. As prescribed in 48 CFR 1313.302-1-70, insert the following provision: Instructions for Submitting Quotations Under the Simplified Acquisition...
Small Commercial Building Re-tuning: A Primer
Energy Technology Data Exchange (ETDEWEB)
Cort, Katherine A.; Hostick, Donna J.; Underhill, Ronald M.; Fernandez, Nicholas; Katipamula, Srinivas
2013-09-30
To help building owners and managers address issues related to energy-efficient operation of small buildings, DOE has developed a Small Building Re-tuning training curriculum. This "primer" provides additional background information to understand some of the concepts presented in the Small Building Re-tuning training. The intent is that those who are less familiar with the buidling energy concepts will review this material before taking the building re-tuning training class.
40 CFR 63.4910 - What notifications must I submit?
2010-07-01
..., accuracy, and completeness of the report. Such certifications must also comply with the requirements of 40... need to submit copies of any test reports. (i) Mass fraction of organic HAP for one coating, for one... mass of organic HAP contained in the waste materials for which you are claiming an allowance in...
Ma, Qian; Lu, Mengkai; Yang, Ping; Zhang, Aiyu; Cao, Yongqiang
2014-06-01
In this study, a series of LaNbTiO6:RE(3+) (RE = Tb, Dy, Ho) down-converting phosphors were synthesized using a modified sol-gel combustion method, and their photoluminescence (PL) properties were investigated as a function of activator concentration and annealing temperature. The resultant particles were characterized using X-ray diffraction, transmission electron microscopy, scanning electron microscopy, UV/Vis diffuse reflectance spectroscopy and PL spectra. The highly crystalline LaNbTiO6:RE(3+) (RE = Tb, Dy, Ho) phosphors with an average size of 200-300 nm obtained at 1100°C have an orthorhombic aeschynite-type structure and exhibit the highest luminescent intensity in our study range. The emission spectra of LaNbTiO6:RE(3+) (RE = Tb, Dy, Ho) phosphors under excitations at UV/blue sources are mainly composed of characteristic peaks arising from the f-f transitions of RE(3+), including 489 nm ((5) D4 → (7) F6) and 545 nm ((5) D4 → (7) F5) for Tb(3+), 476 and 482 nm ((4) F9/2 → (6) H15/2) and 571 nm ((4) F9/2 → (6) H13/2) for Dy(3+), and 545 nm ((5) F4 + (5) S2 → (5) I8) for Ho(3+), respectively. The luminescent mechanisms were further investigated. It can be expected that these phosphors are of intense interest and potential importance for many optical applications. Copyright © 2013 John Wiley & Sons, Ltd.
Pressure vessels supported in the soil submitted to axissymetrical loads
International Nuclear Information System (INIS)
Gouvea, J.P. de; Bevilacqua, L.
1982-01-01
A pressure vessel, spherical segment or vertical cylinder, is supported in the soil and submitted to axissymetrical loads. The soil is considered as a semi-infinite elastic solid and the support as a lattice. The method of rigidity is used. (E.G.) [pt
CATTLE PRODUCTIVE PERFORMANCE EVALUATION CONFINED SUBMITTED IMMUNOCASTRATION
Directory of Open Access Journals (Sweden)
J. M. Maluf
2016-09-01
Full Text Available In order to evaluate the performance and carcass characteristics of cattle cross breeds ½ Aberdeen Angus x ½Nelore and Nelore confined submitted to immunocastration 218 male animals were used, feedlot, averaging 342 kg, divided into three experimental groups, T1: 117 steers ½ Angus x ½ Nelore no castrated (ANC, T2: 51 Nelore steers uncastrated (NNC and T3: 50 Nellore steers immunocastrated (NIC. The experiment lasted 144 days of confinement. The selection of animals for group formation was according to the individual weight, breed, sex condition and age. For immunocastration it wasused Bopriva® vaccine. The rating was finished according to the parameter used by the meatpacking industry ranging from 1 to 5. The experimental design was completely randomized in three groups. For the analyzes the variables studied statistics were submitted to analysis of variance (ANOVA and Tukey test both at the 5% level of significance. The results showed differences (p <0.01 at various features of productive performance and carcass between treatments. For slaughter weight, the ANC animals were higher (with 582.1 kg to Nelore, regardless of sexual condition, and the NNC were in turn heavier than the NIC, 527.4 and 503.7 respectively. Finally, it observed that the use of immunocastration in Nellore animals provided a decrease in productive performance of confined animals, but provided better finish carcass similar to crossbred (ANC.
188W→188Re generator for biomedical applications
International Nuclear Information System (INIS)
Kamioki, Hiroshi; Mirzadeh, S.; Lambrecht, R.M.; Knapp, R. Jr.; Dadachova, K.
1994-01-01
An alumina-based 188 W → 188 Re generator was evaluated for 188 Re yield and elution profile and 188 W breakthrough using various reagents for a three-month period. To address the problem of low specific volume, the generator was eluted with reagents which could be easily destroyed by gentle evaporation from acidic solutions (e.g. NH 4 Cl and NH 4 NO 3 ). We also evaluated a proposed ''alumina/anion-exchange'' tandem generator for the preparation of highly purified 188 Re as perrhenic acid. In parallel studies, the adsorption dynamics of tungsten on alumina showed a sharp rise in the tungsten breakthrough at W/Al 2 O 3 ratio of ∼ 120 mg/g corresponding to a distribution constant of ∼ 8400 from nitrate solution at 0.05 M ionic strength. In adsorption on anion exchange resins, carrier-free 188 Re exhibited a behavior very similar to that of macroscopic quantities of Re. These studies further demonstrated the long and useful shelf-life of 188 W → 188 Re generator. (orig.)
Jacques Rancière and indisciplinarity
Baronian, M.A.; Rosello, M.
2008-01-01
This is the transcript of an interview conducted with Jacques Rancière by Marie-Aude Baronian and Mireille Rosello from the University of Amsterdam and ASCA. A version of this interview was published in Dutch by Valiz (NL), in a volume of studies on Jacques Rancière that appeared in the Netherlands
Directory of Open Access Journals (Sweden)
Helenita Antonia de Oliveira
2018-01-01
Full Text Available The aim of this study was to determine whether oxidative stress markers are influenced by low-intensity laser therapy (LLLT in rats subjected to a high-intensity resistive exercise session (RE. Female Wistar rats divided into three experimental groups (Ctr: control, 4J: LLLT, and RE and subdivided based on the sampling times (instantly or 24 h postexercise underwent irradiation with LLLT using three-point transcutaneous method on the hind legs, which was applied to the gastrocnemius muscle at the distal, medial, and proximal points. Laser (4J or placebo (device off were carried out 60 sec prior to RE that consisted of four climbs bearing the maximum load with a 2 min time interval between each climb. Lipoperoxidation levels and antioxidant capacity were obtained in muscle. Lipoperoxidation levels were increased (4-HNE and CL markers instantly post-RE. LLLT prior to RE avoided the increase of the lipid peroxidation levels. Similar results were also notified for oxidation protein assays. The GPx and FRAP activities did not reduce instantly or 24 h after RE. SOD increased 24 h after RE, while CAT activity did not change with RE or LLLT. In conclusion, LLLT prior to RE reduced the oxidative stress markers, as well as, avoided reduction, and still increased the antioxidant capacity.
Absolute counting of 188Re radiopharmaceuticals
International Nuclear Information System (INIS)
Ravindra, Anuradha; Kulkarni, D.B.; Joseph, Leena; Kulkarni, M.S.
2018-01-01
Rhenium-188 is radiopharmaceutical that belongs to the group of strong beta-weak gamma emitters. It emits high energy beta particles, (E β m ax = 2.12MeV) and weak gamma rays (E γ = 155 keV) hence makes it suitable for wide variety of therapeutic as well as diagnostic applications. Therapeutic applications include therapy of tumors, radionuclide synovectomy, bone pain palliation, intra vascular radiation therapy etc. 188 Re-labeled medicines have been employed increasingly in the therapy of tumors and vascular restenosis. To ensure that patient receives the appropriate radiation dose during the treatment, both the activity standardization and the determination of sensitivity coefficient of the secondary standard for 188 Re have become important tasks. This paper presents the methods and results obtained for the following measurements a) Standardisation of the 188 Re by using the 4π proportional counter (4πPC)-gamma extrapolation method b) Determination of sensitivity coefficient (pA/MBq) of the secondary standard ionization chamber type Centronic IG12, 20A for 188 Re
41 CFR 301-75.205 - Is the interviewee required to submit a travel claim to us?
2010-07-01
... required to submit a travel claim to us? 301-75.205 Section 301-75.205 Public Contracts and Property Management Federal Travel Regulation System TEMPORARY DUTY (TDY) TRAVEL ALLOWANCES AGENCY RESPONSIBILITIES 75... reimbursed, then he or she must submit a travel claim in accordance with your agency procedures in order to...
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false May the Governor delegate responsibility for developing and submitting the State Plan? 641.310 Section 641.310 Employees' Benefits EMPLOYMENT AND TRAINING... developing and submitting the State Plan, provided that any such delegation is consistent with State law and...
2010-05-04
... Part 1530 Sugar Re-Export Program, the Sugar-Containing Products Re-Export Program, and the Polyhydric...), Additional U.S. Note 6, which authorizes entry of raw cane sugar under subheading 1701.11.20 of the HTS for the production of polyhydric alcohols, except polyhydric alcohols for use as a substitute for sugar in...
Re-assessment of dose from the Vinten extremity dosemeter
International Nuclear Information System (INIS)
O'Hagan, J.B.; Pearson, A.J.; Dutt, J.C.
1989-01-01
A procedure is described for re-assessing the dose from the Vinten extremity dosemeter using phototransferred thermoluminescence. The technique produces a linear response up to 50 Sv. The re-assessment efficiency is approximately 10% for the first re-assessment and 3-5% for the second re-assessment. The detection threshold values (at the 95% confidence level) are 3 mSv and 9 mSv respectively. (author)
Energy Technology Data Exchange (ETDEWEB)
Stewart, Gillian, E-mail: gstewart@qc.cuny.ed [Queens College, CUNY Flushing, NY 11367 (United States); Moran, S. Bradley, E-mail: moran@gso.uri.ed [Graduate School of Oceanography, URI Narragansett, RI 02882 (United States); Lomas, Michael W., E-mail: Michael.Lomas@bios.ed [Bermuda Institute for Ocean Sciences, St. George' s, GE01 (Bermuda); Kelly, Roger P., E-mail: rokelly@gso.uri.ed [Graduate School of Oceanography, URI Narragansett, RI 02882 (United States)
2011-05-15
Particle-reactive, naturally occurring radionuclides are useful tracers of the sinking flux of organic matter from the surface to the deep ocean. Since the Joint Global Ocean Flux Study (JGOFS) began in 1987, the disequilibrium between {sup 234}Th and its parent {sup 238}U has become widely used as a technique to measure particle export fluxes from surface ocean waters. Another radionuclide pair, {sup 210}Po and {sup 210}Pb, can be used for the same purpose but has not been as widely adopted due to difficulty with accurately constraining the {sup 210}Po/{sup 210}Pb radiochemical balance in the ocean and because of the more time-consuming radiochemical procedures. Direct comparison of particle flux estimated in different ocean regions using these short-lived radionuclides is important in evaluating their utility and accuracy as tracers of particle flux. In this paper, we present paired {sup 234}Th/{sup 238}U and {sup 210}Po/{sup 210}Pb data from oligotrophic surface waters of the subtropical Northwest Atlantic and discuss their advantages and limitations. Vertical profiles of total and particle size-fractionated {sup 210}Po and {sup 234}Th activities, together with particulate organic carbon (POC) concentrations, were measured during three seasons at the Bermuda Atlantic Time-series Study (BATS) site. Both {sup 210}Po and {sup 234}Th reasonably predict sinking POC flux caught in sediment traps, and each tracer provides unique information about the magnitude and efficiency of the ocean's biological pump.
Pt, Re and Pt-Re incorporation in sulfated zirconia as catalysts for n-pentane isomerization
International Nuclear Information System (INIS)
Aboul-Gheit, A.K.; El-Desouki, D.S.; Abdel-Hamid, S.M.; Ghoneim, S.A.; Ibrahim, A.H.; Gad, F.K.; Abdel-Aleem, G.M.
2010-01-01
Two groups of modified Sulfated Zirconia (S Z) catalysts were prepared by the sol-gel method. The first group was modified by four different concentrations of Pt metal (0.15, 0.30, 0.45 and 0.60 wt %), whereas the second group contained Pt-Re combinations on SZ. All the prepared catalysts were characterized by XRD, TPR, TEM, TGA, IR spectroscopy as well as surface properties using the BET method. The catalytic activity of the catalysts was examined for the hydro isomerization of n-pentane to iso-pentane. The catalytic activity was found to increase with increasing Pt concentration in the mono metallic catalysts. The combination of Re ion with Pt on SZ results in significant changes in the characters and activities of the catalysts. The 0.45 wt % Pt + 0.15 wt % Re/SZ catalyst exhibited the highest selective compared to other metal ratios investigated
DEFF Research Database (Denmark)
Pedersen, Kasper Steen; Sigrist, Marc; Sørensen, Mikkel Agerbæk
2014-01-01
studied including the slow relaxation of the magnetization observed below ca. 4 K. This slow dynamic is preserved for the one-dimensional coordination polymer [Zn(viz)4(ReF 6)]1 (2, viz=1-vinylimidazole), demonstrating the irrelevance of low symmetry for such magnetization dynamics in systems with easy......-plane-type anisotropy. The ability of fluoride to mediate significant exchange interactions is exemplified by the isostructural [Ni(viz)4(ReF6)]1 (3) analogue in which the ferromagnetic NiII-ReIV interaction (+10.8 cm-1) dwarfs the coupling present in related cyanide-bridged systems. These results reveal [ReF6...
24 CFR 220.821 - Items to be filed on submitting claim.
2010-04-01
... filed on submitting claim. Within 30 days after the filing of the notice of intention to file claim, or... principal of the mortgage indebtedness; (h) All records, ledger cards, documents, books, papers and accounts...
Protein (Viridiplantae): 888289 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available 0727 3803:10727 ... 3814:10727 ... 163735:2506 ... 3883:1736 ... 3885:1736 ... hypothetical protein PHAVU_009G116600g Phaseolus vulgaris MKKNRMMIM...ICSVGVVWMLLVGGSYGEQCGRQAGGALCPGGNCCSQFGWCGSTTDYCGKDCQSQC
Lamb, Christopher R; Mai, Wilfried
2015-01-01
Better understanding of the reasons why manuscripts are rejected, and recognition of the most frequent manuscript flaws identified by reviewers, should help submitting authors to avoid these pitfalls. Of 219 manuscripts submitted to Veterinary Radiology & Ultrasound in 2012, none (0%) was accepted without revision, four (2%) were withdrawn by the authors, 99 (45%) were accepted after revision, and 116 (53%) were rejected. All manuscripts for which minor revision was requested, and 73/86 (85%) manuscripts for which major revision was requested, were ultimately accepted. Acceptance rate was greater for retrospective studies and for manuscripts submitted from countries in which English was the primary language. The prevalences of flaws in manuscripts were poor writing (62%), deficiencies in data (60%), logical or methodological errors (28%), content not suitable for Veterinary Radiology & Ultrasound (26%), and lack of new or useful knowledge (25%). Likelihood of manuscript rejection was greater for lack of new or useful knowledge and content not suitable than for other manuscript flaws. The lower acceptance rate for manuscripts from countries in which English was not the primary language was associated with content not suitable and not poor writing. Submitting authors are encouraged to do more to recognize and address manuscript flaws before submission, for example by internal review. Specifically, submitting authors should express clearly the potential added value of their study in the introduction section of their manuscript, describe completely their methods and results, and consult the Editor-in-Chief if they are uncertain whether their subject matter would be suitable for the journal. © 2014 American College of Veterinary Radiology.
Surface studies of Os Re W alloy-coated impregnated tungsten cathodes
International Nuclear Information System (INIS)
Ares Fang, C.S.; Maloney, C.E.
1990-01-01
Impregnated tungsten cathodes half-coated with Re/W (or Os/W) alloy and Os Re W alloy at right angles were studied to compare the effects of Os Re W alloy coatings on the electron emission and emission mechanisms. Constant surface metal compositions of 32% Os--29% Re--39% W and 35% Os--26% Re--39% W were obtained from the activated surfaces initially coated with 40% Os--40% Re--20% W and 35% Os--45% Re--20% W alloys, respectively. Thermionic emission microscopy measurements showed that the Os Re W alloy-coated surface gives an average effective work function of 0.29, 0.08, and 0.03 eV lower than the uncoated, Re/W and Os/W alloy-coated surfaces. An effective work function of 1.73 eV was obtained from an activated Os Re W alloy surface. Auger studies exhibited a smaller BaO coverage and a higher barium coverage in excess of BaO stoichiometry on the Os Re W alloy-coated surface compared to the uncoated, Re/W and Os/W alloy-coated surfaces
McPhatter, Lee P; Debboun, Mustapha
2009-12-01
Field experiments were conducted on the Fort Sam Houston Military Reservation, San Antonio, TX, in fall 2008 to observe the attractiveness of selected botanical infusions to ovipositing female mosquitoes. The following infusions were tested in Centers for Disease Control and Prevention gravid traps: Bermuda grass (Cynodon dactylon), oak leaf (Quercus virginiana), acacia leaf (Acacia schaffneri), rabbit chow (alfalfa pellets), and algae (Spirogyra sp.). Four (Bermuda, acacia, oak, and algae) of the 5 infusions were effective in collecting Culex quinquefasciatus, Cx. nigripalpus, and Cx. erraticus. Of the 4 infusions, Bermuda collected the greatest number of the mosquitoes sampled. Female Aedes albopictus mosquitoes were collected in moderate numbers during this study.
Fertilizing properties of farm manure submitted to methane fermentation, according to pot tests
Energy Technology Data Exchange (ETDEWEB)
Kuzelewski, L; Pentkowski, A
1962-01-01
In order to compare the fertilizing properties of the ordinary farm manure stored and fermented in dung hills with those of the manure submitted to CH/sub 4/ fermentation, pot tests with oats and potatoes were carried out. Investigation showed that: N losses taking place during CH/sub 4/ fermentation are much smaller than those from manure fermented in dung-hills. Because of different fermentation processes, the losses of solid matter in the CH/sub 4/ fermentation were greater than in manure fermented and stored in dung-hills. Although the manure submitted to CH/sub 4/ fermentation contained more N, its effect on crops was almost identical with the effect of ordinary manure. Experiments have shown that it is not necessary to cover with soil the manure submitted to the CH/sub 4/ fermentation after spreading it. Whether it was covered with soil or not, there was no difference in crop yield. Manure fermenting in O-free atmosphere may contain products harmful to plants, but they oxidize quickly on exposure to the atmosphere. 53 references.
20 CFR 266.12 - Effect of matters or actions submitted or taken by legal guardian, etc.
2010-04-01
... taken by legal guardian, etc. 266.12 Section 266.12 Employees' Benefits RAILROAD RETIREMENT BOARD... submitted or taken by legal guardian, etc. All matters and actions in connection with an annuity submitted or taken by the guardian or other person legally vested with the care of the person or estate of an...
DEFF Research Database (Denmark)
Jensen, Tim
2016-01-01
As a university discipline, the academic study of religions (ASR) has produced a critical approach to the study of religion which is (or ought be), I think, of fundamental importance for a modern secular and enlightened democratic state. However, the ”study-of-religions” approach has percolated...... with limited success into society at large as well as into the primary and secondary educational systems of Western democracies. Too often so-called religious education (RE) really is religious or confessional, and even so-called non-confessional RE is, mostly if not always, mixed with crypto......-confessional approaches, inculcation of moral values (not least those claimed to be Christian) and the promoting of religion as a resource for a more ”spiritual” approach to life. While these goals may be in line with the traditional use of the public school as the key instrument of the (nation-) state to try to confer...
Fang, C M; Haas, C; Groot, R A D
1997-01-01
The transition-metal dichalcogenides ReX sub 2 (X = S or Se) and TcS sub 2 with a d sup 3 electron configuration have distorted CdCl sub 2 and Cd(OH) sub 2 structures, respectively, with the Re(Tc) atoms in each layer forming parallelogram-shaped connected clusters (diamond chain). Ab-initio band-structure calculations were performed for ReX sub 2 and TcS sub 2 , and the hypothetical undistorted 1T-TcS sub 2 and 3R-ReX sub 2 structures. The calculations show that ReS sub 2 , ReSe sub 2 and TcS sub 2 are semiconductors with energy gaps of about 1.0 eV, 0.5 eV and 0.7 eV, respectively, while for the undistorted structures the Fermi level is in the partly filled band of d sub x sub sup 2 sub - sub y sub sup 2 and d sub x sub y orbitals of the t sub 2 sub g manifold. X-ray photoemission spectra for the core levels and valence band of ReSe sub 2 and ReS sub 2 are presented. The valence x-ray photoemission spectra showed that ReS sub 2 is a p-type semiconductor with an energy gap of about 1.5 eV, while ReSe sub 2 i...
30 CFR 210.204 - How do I submit facility data?
2010-07-01
... 210.204 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT FORMS AND REPORTS Production and Royalty Reports-Solid Minerals § 210.204 How do I submit facility... stockpile inventory. (3) You must include in your facility data all production processed in the facility...
Phase characterization of Re-based diffusion barrier layer on Nb substrate
International Nuclear Information System (INIS)
Sugiarti, Eni; Wang, Youngmin; Hashimoto, Naoyuki; Ohnuki, Somei; Narita, Toshio
2011-01-01
An electron microscopy phase characterization was carried out for a Re-based diffusion barrier layer, which was deposited on the Nb substrate used as an ultra high temperature material. The coating process produced three layers; an outer Cr(Re) layer, an intermediate Cr-Nb-Re layer, and an inner Nb(Re) layer. The Cr-Nb-Re layer is considered to act as a diffusion barrier layer between the substrate and the outer Cr(Re) reservoir layer. The Cr(Re) and Nb(Re) layers are in single phase with a similar bcc structures, but they are different in structure from the intermediate layer, which is composed of a dual phase of Re 63 Cr 20 Nb 17 with a cubic structure and Nb 42 Re 33 Cr 25 with a hexagonal structure determined by transmission electron microscopy (TEM) in this study. (author)
Higgins, Janet R; Lin, Feng-Chang; Evans, James P
2016-01-01
Plagiarism is common and threatens the integrity of the scientific literature. However, its detection is time consuming and difficult, presenting challenges to editors and publishers who are entrusted with ensuring the integrity of published literature. In this study, the extent of plagiarism in manuscripts submitted to a major specialty medical journal was documented. We manually curated submitted manuscripts and deemed an article contained plagiarism if one sentence had 80 % of the words copied from another published paper. Commercial plagiarism detection software was utilized and its use was optimized. In 400 consecutively submitted manuscripts, 17 % of submissions contained unacceptable levels of plagiarized material with 82 % of plagiarized manuscripts submitted from countries where English was not an official language. Using the most commonly employed commercial plagiarism detection software, sensitivity and specificity were studied with regard to the generated plagiarism score. The cutoff score maximizing both sensitivity and specificity was 15 % (sensitivity 84.8 % and specificity 80.5 %). Plagiarism was a common occurrence among manuscripts submitted for publication to a major American specialty medical journal and most manuscripts with plagiarized material were submitted from countries in which English was not an official language. The use of commercial plagiarism detection software can be optimized by selecting a cutoff score that reflects desired sensitivity and specificity.
78 FR 72139 - Forms Submitted to the Office of Management and Budget for Extension of Clearance
2013-12-02
... SELECTIVE SERVICE SYSTEM Forms Submitted to the Office of Management and Budget for Extension of Clearance AGENCY: Selective Service System. ACTION: Notice. The following forms have been submitted to the Office of Management and Budget (OMB) for extension of clearance in compliance with the Paperwork Reduction Act (44 U.S.C. Chapter 35): SSS FOR...
Hydrogen-induced structural transition in single layer ReS2
Yagmurcukardes, M.; Bacaksiz, C.; Senger, R. T.; Sahin, H.
2017-09-01
By performing density functional theory-based calculations, we investigate how structural, electronic and mechanical properties of single layer ReS2 can be tuned upon hydrogenation of its surfaces. It is found that a stable, fully hydrogenated structure can be obtained by formation of strong S-H bonds. The optimized atomic structure of ReS2H2 is considerably different than that of the monolayer ReS2 which has a distorted-1T phase. By performing phonon dispersion calculations, we also predict that the Re2-dimerized 1T structure (called 1T {{}\\text{R{{\\text{e}}2}}} ) of the ReS2H2 is dynamically stable. Unlike the bare ReS2 the 1T {{}\\text{R{{\\text{e}}2}}} -ReS2H2 structure which is formed by breaking the Re4 clusters into separated Re2 dimers, is an indirect-gap semiconductor. Furthermore, mechanical properties of the 1T {{}\\text{R{{\\text{e}}2}}} phase in terms of elastic constants, in-plane stiffness (C) and Poisson ratio (ν) are investigated. It is found that full hydrogenation not only enhances the flexibility of the single layer ReS2 crystal but also increases anisotropy of the elastic constants.
DEFF Research Database (Denmark)
Holm, Karina Ellegaard; Frederiksen, Kirsten Søndergaard; Kolind, Torsten
2016-01-01
Kapitlet undersøger forholdet til fest og rus blandt unge med anden etnisk baggrund end dansk. Det er tydeligt, at alkohol, fester, rus og kropslighed opleves forskelligt blandt de interviewede; for nogle handler fest om mad, dans, musik og at gøre sig lækker, mens det for andre også handler om r...... sammen med fulde klassekammerater. Selv de få, som beretter om rusmiddelbrug, fortæller, at det foregår med målet om at være optimal....
Renzi, Adolfo; Talento, Pasquale; Giardiello, Cristiano; Angelone, Giovanni; Izzo, Domenico; Di Sarno, Giandomenico
2008-10-01
Obstructed defaecation syndrome (ODS) represents a very common clinical problem. The aim of the this prospective multicenter study was to evaluate the efficacy and safety of stapler trans-anal rectal resection (STARR) performed by a new dedicated device, CCS-30 Contour Transtar, in patients with ODS caused by rectal intussusception (RI) and/or rectocele (RE). All the patients who underwent STARR for ODS caused by RI and/or RE at Colorectal Surgery Units of S. Stefano Hospital, Naples, Gepos Hospital, Telese, Benevento and S. Maria della Pietà Hospital, Casoria, Naples, Italy were prospectively introduced into a database. Preoperatively, all the patients underwent anorectal manometry and cinedefecography. The grade of ODS was assessed using a dedicated obstructed defaecation syndrome score (ODS-S). All the patients with a ODS-S >or=12 and RI and/or RE were enrolled. Patients were followed up clinically at 6 months. Thirty patients, 28 (93.3%) women, mean age 56.6+/-12.7 years, underwent STARR, by Transtar, between February and October 2006. Preoperatively, ODS-S was 15.8+/-2.4. RI was present in 26 (89.6%) and RE (34.4+/-15.2 mm) in 27 (93.1%) patients. No major postoperative complications occurred. The length of hospital stay was 2.5+/-0.6 days. At 6-month follow-up, ODS-S was 5.0+/-2.3 (P<0.001). Successful outcome was achieved in 25 (86.2%) patients. STARR, performed by the new dedicated device, CCS-30 Contour Transtar, seems to be an effective and safe procedure to treat ODS caused by RE and/or RI. A longer follow-up and a larger number of patients is needed to confirm these results.
41 CFR 105-50.401 - Reports submitted to the Congress.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Reports submitted to the Congress. 105-50.401 Section 105-50.401 Public Contracts and Property Management Federal Property... Congress. (a) The Administrator of General Services will furnish annually to the respective Committees on...
13 CFR 108.2004 - Contents of application submitted by SSBICs.
2010-01-01
... the amount of Regulatory Capital it intends to raise after December 21, 2000, and the amount of... MARKETS VENTURE CAPITAL (âNMVCâ) PROGRAM Requirements and Procedures for Operational Assistance Grants to... increase in its Regulatory Capital since December 21, 2000. (b) Plan. An SSBIC must submit a plan...
41 CFR 102-192.100 - How do we submit our annual mail management report to GSA?
2010-07-01
... management report to GSA? If your agency is a large agency, as defined in § 102-192.35, you must submit... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false How do we submit our annual mail management report to GSA? 102-192.100 Section 102-192.100 Public Contracts and Property...
Re-Sonification of Objects, Events, and Environments
Fink, Alex M.
Digital sound synthesis allows the creation of a great variety of sounds. Focusing on interesting or ecologically valid sounds for music, simulation, aesthetics, or other purposes limits the otherwise vast digital audio palette. Tools for creating such sounds vary from arbitrary methods of altering recordings to precise simulations of vibrating objects. In this work, methods of sound synthesis by re-sonification are considered. Re-sonification, herein, refers to the general process of analyzing, possibly transforming, and resynthesizing or reusing recorded sounds in meaningful ways, to convey information. Applied to soundscapes, re-sonification is presented as a means of conveying activity within an environment. Applied to the sounds of objects, this work examines modeling the perception of objects as well as their physical properties and the ability to simulate interactive events with such objects. To create soundscapes to re-sonify geographic environments, a method of automated soundscape design is presented. Using recorded sounds that are classified based on acoustic, social, semantic, and geographic information, this method produces stochastically generated soundscapes to re-sonify selected geographic areas. Drawing on prior knowledge, local sounds and those deemed similar comprise a locale's soundscape. In the context of re-sonifying events, this work examines processes for modeling and estimating the excitations of sounding objects. These include plucking, striking, rubbing, and any interaction that imparts energy into a system, affecting the resultant sound. A method of estimating a linear system's input, constrained to a signal-subspace, is presented and applied toward improving the estimation of percussive excitations for re-sonification. To work toward robust recording-based modeling and re-sonification of objects, new implementations of banded waveguide (BWG) models are proposed for object modeling and sound synthesis. Previous implementations of BWGs
STS-134 Re-Rendezvous Design History
Stuit, Timothy D.
2011-01-01
In preparation to provide the capability for the Orion spacecraft to rendezvous with the International Space Station (ISS), a new suite of relative navigation sensors are in development and will be tested on one of the final Space Shuttle missions to ISS. The National Aeronautics and Space Administration (NASA) commissioned a flight test of prototypes of the instruments on STS-134, in order to test their performance in the space environment during the nominal rendezvous and docking, as well as a re-rendezvous dedicated to testing the prototype sensors following the undocking of the Space Shuttle Orbiter at the end of the mission. Unlike the initial rendezvous and docking, the re-rendezvous profile would replicate the newly designed Orion coelliptic approach trajectory, something never before attempted with the Shuttle Orbiter. Therefore, there were a number of new parameters that needed to be conceived of, designed, and tested for this re-rendezvous to make the flight test successful. And all of this work had to be integrated with the normal operations of the ISS and Shuttle and had to conform to the constraints of the mission and vehicles. The result of this work is a separation and re-rendezvous trajectory design that will prove not only the design of the relative navigation sensors for the Orion vehicle, but also will serve as a proof of concept for the Orion rendezvous trajectory itself. This document presents the analysis and decision making process involved in attaining the final STS-134 re-rendezvous design.
Study on the preparation and stability of 188Re biomolecules via EHDP
International Nuclear Information System (INIS)
Ferro-Flores, G.; Garcia-Salinas, L.; Paredes-Gutierrez, L.; Hashimoto, K.; Melendez-Alafort, L.; Murphy, C.A.
2001-01-01
A direct labelling technique via ethane-1-hydroxy-1,1-diphosphonic acid (EHDP) as a weak competing ligand was developed for the preparation of several biomolecules: 188 Re-monoclonal antibody ior cea1 against carcinoembryonic antigen ( 188 Re-MoAb), biotinylated 188 Re-MoAb ( 188 Re-MoAb-biotin), 188 Re-polyclonal IgG ( 188 Re-IgG), 188 Re-peptide (somatostatine analogue peptide b-(2-naphtyl)-D-Ala-Cys-Tyr-D-Trp-Lys-Val-Cys-Thr-amide), 188 Re-MoAb fragments ( 188 Re-F(ab') 2 ) and biotinylated 188 Re-F(ab') 2 ( 188 Re-F(ab') 2 -biotin). The reaction conditions such as pH, temperature, weak ligand concentration and stannous chloride concentration were optimized during the radiolabelling of each biomolecule. Before the labelling procedure, disulphide bridge groups of the biomolecules were reduced with 2-mercaptoethanol (2-ME). To obtain 188 Re labelled antibodies and peptides in high radiochemical yields (>90%) via EHDP, it was necessary to use acidic conditions and a high concentration of stannous chloride to allow the redox reaction Re +7 →Re +5 :Re +4 . The labelling of MoAb and F(ab') 2 with 188 Re via EHDP was also evaluated employing a pretargeted technique by avidin-biotin strategy in normal mice, demonstrating that the 188 Re-labelled biotinylated antibodies are stable complexes in vivo. The 188 Re-peptide complex prepared by this method, was stable for 24 h and no radiolytic degradation was observed. (author)
Beneficial Re-use of Decommissioned Former Nuclear Facilities
International Nuclear Information System (INIS)
Boing, L.E.
1997-01-01
With the decision to decommission a nuclear facility, it is necessary to evaluate whether to fully demolish a facility or to re-use the facility in some capacity. This evaluation is often primarily driven by both the past mission of the site and the facility and the site's perceived future mission. In the case where the facility to be decommissioned is located within a large research or industrial complex and represents a significant resource to the site's future mission, it may be a perfect candidate to be re-used in some fashion. However, if the site is a rather remote older facility with little chance of being modified to today's standards for its re-use, the chances for its re-use will be substantially reduced. In this presentation, some specific cases of former nuclear facilities being decommissioned and re-used will be reviewed and some factors required to be considered in making this decision will be reviewed
Defense programs business practices re-engineering QFD exercise
International Nuclear Information System (INIS)
Murray, C.; Halbleib, L.
1996-03-01
The end of the cold war has resulted in many changes for the Nuclear Weapons Complex (NWC). We now work in a smaller complex, with reduced resources, a smaller stockpile, and no new phase 3 weapons development programs. This new environment demands that we re-evaluate the way we design and produce nuclear weapons. The Defense Program (DP) Business Practices Re-engineering activity was initiated to improve the design and production efficiency of the DP Sector. The activity had six goals: (1) to identify DP business practices that are exercised by the Product Realization Process (PRP); (2) to determine the impact (positive, negative, or none) of these practices on defined, prioritized customer criteria; (3) to identify business practices that are candidates for elimination or re-engineering; (4) to select two or three business practices for re-engineering; (5) to re-engineer the selected business practices; and (6) to exercise the re-engineered practices on three pilot development projects. Business practices include technical and well as administrative procedures that are exercised by the PRP. A QFD exercise was performed to address (1)-(4). The customer that identified, defined, and prioritized the criteria to rate the business practices was the Block Change Advisory Group. Five criteria were identified: cycle time, flexibility, cost, product performance/quality, and best practices. Forty-nine business practices were identified and rated per the criteria. From this analysis, the group made preliminary recommendations as to which practices would be addressed in the re-engineering activity. Sixteen practices will be addressed in the re-engineering activity. These practices will then be piloted on three projects: (1) the Electronic Component Assembly (ECA)/Radar Project, (2) the B61 Mod 11, and (3) Warhead Protection Program (WPP)
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-03-01
Production of the radioactive rhenium isotopes {sup 186}Re and {sup 188}Re, and synthesis of their labeled compounds have been studied together with the biodistributions of the compounds. This work was carried out by the Working Group on Radioactive Rhenium, consisting of researchers of JAERI and some universities, in the Subcommittee for Production and Radiolabeling under the Consultative Committee of Research on Radioisotopes. For {sup 186}Re, production methods by the {sup 185}Re(n,{gamma}){sup 186}Re reaction in a reactor and by the {sup 186}W(p,n){sup 186}Re reaction with an accelerator, which can produce nocarrier-added {sup 186}Re, have been established. For {sup 188}Re, a production method by the double neutron capture reaction of {sup 186}W, which produces a {sup 188}W/{sup 188}Re generator, has been established. For labeling of bisphosphonate, DMSA, DTPA, DADS, aminomethylenephosphonate and some monoclonal antibodies with the radioactive rhenium isotopes, the optimum conditions, including pH, the amounts of reagents and so on, have been determined for each compound. The biodistributions of each of the labeled compounds in mice have been also obtained. (author)
13 CFR 108.2005 - Contents of plan submitted by SSBICs.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Contents of plan submitted by... Operational Assistance. The SSBIC must describe how it plans to use its grant funds to provide Operational... types of Operational Assistance it proposes to provide, and how it plans to provide the Operational...
Image re-sampling detection through a novel interpolation kernel.
Hilal, Alaa
2018-06-01
Image re-sampling involved in re-size and rotation transformations is an essential element block in a typical digital image alteration. Fortunately, traces left from such processes are detectable, proving that the image has gone a re-sampling transformation. Within this context, we present in this paper two original contributions. First, we propose a new re-sampling interpolation kernel. It depends on five independent parameters that controls its amplitude, angular frequency, standard deviation, and duration. Then, we demonstrate its capacity to imitate the same behavior of the most frequent interpolation kernels used in digital image re-sampling applications. Secondly, the proposed model is used to characterize and detect the correlation coefficients involved in re-sampling transformations. The involved process includes a minimization of an error function using the gradient method. The proposed method is assessed over a large database of 11,000 re-sampled images. Additionally, it is implemented within an algorithm in order to assess images that had undergone complex transformations. Obtained results demonstrate better performance and reduced processing time when compared to a reference method validating the suitability of the proposed approaches. Copyright © 2018 Elsevier B.V. All rights reserved.
Synthesis of metallic ReO3 nanowires
International Nuclear Information System (INIS)
Myung, Dongshin; Lee, Yumin; Lee, Jaeyeon; Kim, Myung Hwa; Yu, Hak Ki; Lee, Jong-Lam; Baik, Jeong Min; Kim, Woong
2010-01-01
We present the synthesis of highly crystalline metallic rhenium trioxide (ReO 3 ) nanowires via a simple physical vapor transport at 300 C for the first time. Based on HRTEM, the ReO 3 nanowires exhibit a core of perfect cubic perovskite-type single crystal structure with a shell of thin amorphous and disordered structures of less than 2 nm in the near surface layers. Possibly this is due to proton intercalation induced by the surface reaction of single crystal ReO 3 with water. (copyright 2010 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)
International Nuclear Information System (INIS)
Suen, Nian-Tzu; Bobev, Svilen
2012-01-01
Reported are the synthesis and structural characterization of Ce_5Mg_8Ge_8 (its own structure type), CeMg_2_-_xGe_2_+_x (BaAl_4-type structure), RE_4Mg_7Ge_6 (RE = Ce-Nd, Sm; La_4Mg_7Ge_6-type structure), and RE_4Mg_5Ge_6 (RE = Ce, Pr; Tm_4Zn_5Ge_6-type structure). The structures of these compounds have been established by single-crystal and powder X-ray diffraction. These compounds are closely related to each other not only in their chemical compositions but also in their structures. A common structural feature of all are MgGe_4 tetrahedra, which are connected by corner- and/or edge-sharing into complex polyanionic frameworks with the rare-earth metal atoms filling the ''empty'' space. The structures are compared to known types of structures, and we have investigated the chemical bonding in Ce_5Mg_8Ge_8 with electronic structure calculations, which were carried out by the tight-bonding linear muffin-tin orbital (TB-LMTO) method. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
Efficient Conditional Proxy Re-encryption with Chosen-Ciphertext Security
Weng, Jiang; Yang, Yanjiang; Tang, Qiang; Deng, Robert H.; Bao, Feng
Recently, a variant of proxy re-encryption, named conditional proxy re-encryption (C-PRE), has been introduced. Compared with traditional proxy re-encryption, C-PRE enables the delegator to implement fine-grained delegation of decryption rights, and thus is more useful in many applications. In this
Wilde, Alison; Glendinning, Caroline
2012-11-01
Home-care re-ablement is a short-term, intensive service that helps people to (re-) establish their capacity and confidence in performing basic personal care and domestic tasks at home, thereby reducing needs for longer term help. Home-care re-ablement is an increasingly common feature of English adult social care services; there are similar service developments in Australia and New Zealand. This paper presents evidence from semi-structured interviews conducted in early 2010 with 34 service users and 10 carers from five established re-ablement services in England. The interviews formed part of a larger, mixed-methods study into the immediate and longer term impacts and cost-effectiveness of home-care re-ablement services. There was clear evidence that interviewees felt that they had benefitted from re-ablement services; most service users and their families valued the intervention. However, the interviews also identified potential barriers to optimal independence for some service users, particularly those with progressive conditions, sensory impairments, specific cultural needs, or who lived alone. The beneficial impacts of re-ablement could also be reduced if users failed to understand the aims of the service, or if the service failed to provide support with activities or outcomes that were particularly important to the service user or carer. Putting the lived experiences of people receiving re-ablement at the centre of analysis, this paper concludes that re-ablement services have the potential for enhanced effectiveness, particularly if there is more understanding of users' own priorities and concepts of independence. © 2012 Blackwell Publishing Ltd.
Experimental test on aluminium rod submitted to a laminar water flow
International Nuclear Information System (INIS)
Britto Aghina, L.O. de; Cruz, J.R.B.
1986-06-01
The result obtained from a experiment with an aluminium rod submitted to a laminar water flow is compared to the result predicted by empirical correlations used in the vibration analysis of the RPR reactor fuel rods. (L.C.J.A.)
A single crystal study of RE{sub 14}Co{sub 3}In{sub 3} (RE = Y, Tb, Dy, Ho, Er)
Energy Technology Data Exchange (ETDEWEB)
Zaremba, V.I.; Kalychak, Y.M.; Dzevenko, M.V. [Inorganic Chemistry Dept., Ivan Franko National Univ. of Lviv (Ukraine); Rodewald, U.Ch.; Heying, B.; Poettgen, R. [Inst. fuer Anorganische und Analytische Chemie, Westfaelische Wilhelms-Univ. Muenster (Germany)
2006-01-01
The rare earth-cobalt-indides RE{sub 14}Co{sub 3}In{sub 3} (RE = Y, Tb, Dy, Ho, Er) were prepared in polycrystalline form from the elements by arc-melting. Small single crystals were grown through a special annealing sequence. The compounds were investigated on the basis of X-ray powder and single crystal data: Lu{sub 14}Co{sub 2}In{sub 3} (Gd{sub 14}Co{sub 3}In{sub 2.7}) type, P4{sub 2}/nmc, Z = 4, a = 959.0(1), c = 2319.1(5) pm, wR2 = 0.055, 2289 F{sup 2} values, 65 variables for Y{sub 13.90}Co{sub 2.99}In{sub 3.02}, a = 953.8(1), c = 2315.8(5) pm, wR2 = 0.108, 2357 F{sup 2} values, 65 variables for Tb{sub 13.92}Co{sub 3.01}In{sub 2.92}, a = 949.24(3), c = 2296.5(1) pm, wR2 = 0.129, 2518 F{sup 2} values, 65 variables for Dy{sub 13.90}Co{sub 2.97}In{sub 2.95}, a = 946.3(1), c = 2289.0(5) pm, wR2 = 0.099, 2297 F{sup 2} values, 64 variables for Ho{sub 14}Co{sub 2.80}In{sub 2.89}, and a = 941.0(1), c = 2274.2(5) pm, wR2 = 0.140, 2450 F{sup 2} values, 65 variables for Er{sub 13.83}Co{sub 2.88}In{sub 3.10}. All RE{sub 14}Co{sub 3}In{sub 3} indides show a small degree of In/Co mixing (between 7 and 16% Co) on the 4c In1 site and defects on the 8g Co1 positions (between 84 and 95% Co). Except for the holmium compound, the RE{sub 14}Co{sub 3}In{sub 3} intermetallics also reveal RE/In mixing on the 4c RE1 sites, leading to the refined compositions. The seven crystallographically independent RE sites have between 9 and 10 nearest RE neighbors. The RE{sub 14}Co{sub 3}In{sub 3} structures consist of a complex intergrowth of rare earth based polyhedra. Both cobalt sites have a distorted trigonal-prismatic rare earth coordination. An interesting feature is the In2-In2 dumb-bell with an In2-In2 distance of 300 pm (for Ho{sub 14}Co{sub 2.80}In{sub 2.89}). The crystal chemistry of the RE{sub 14}Co{sub 3}In{sub 3} indides is discussed. (orig.)
International Nuclear Information System (INIS)
Mahdaoui, Fatima
2013-01-01
The Re-Os radiogenic system is well adapted to the dating of oils and bitumen. However the meaning of the obtained age is ambiguous. This is mainly due to gaps in our knowledge of the geochemical behavior and the speciation of Re and Os in oils. Specifically, use of the Re-Os geo-chronometer requires an understanding of how Re-Os behavior can lead to the fulfillment of the conditions necessary for the development of an isochron. These conditions are: i) the isotopic homogenization of oils at the scale of a petroleum field ii) the fractionation of Re from Os so as to obtain samples with various Re/Os ratios iii) the closure of the system during the period of radiogenic ingrowth of the daughter isotope, that is, from the time of the event of interest to the present day. Experimental investigation of the organic geochemical behavior of Re and Os in oils under various conditions, designed as analogs of the different stages of petroleum generation and evolution, were performed in order to evaluate the use of the Re-Os system as a geo-chronometer in the context of a direct use on petroleum. The possibility of Re-Os fractionation resulting from asphaltene loss during oil evolution was investigated by sequential asphaltene precipitation in the laboratory. This study determined that Re and Os are mainly located in the most polar asphaltene fractions, that is, in the first to precipitate. This study also demonstrated that Re/Os ratios are not disturbed by asphaltene loss during the evolution of oils, unless this loss is unrealistically large. Thus asphaltene precipitation during migration and emplacement is not responsible for the Re/Os fractionation required for the use of the geo-chronometer. The possibility of metal transfer from formation waters to petroleum was studied by performing contact experiments between oils and aqueous solutions of Re and Os of various concentrations over a wide range of temperatures and for varying periods of time. This study demonstrated a
Directory of Open Access Journals (Sweden)
Emmanuel Chabata
2011-10-01
Full Text Available
Abstract: In this article a comparative analysis of Duramazwi ReChiShona (DRC and Duramazwi Guru ReChiShona (DGC is made. Both DRC and DGC are monolingual Shona dictionaries compiled by a team of researchers under the African Languages Lexical (ALLEX Project, now the African Languages Research Institute (ALRI. During the compilation process, DRC was known as the General Shona Dictionary and DGC as the Advanced Shona Dictionary. A simple analysis of these titles shows that the dictionaries are similar in some ways and also different in others. The writer tries to show the ways in which DGC is regarded as a more advanced dictionary when compared to DRC. Although the argument of the article is mainly built on those differences which make DGC the more advanced, attention is also paid to the similarities between the dictionaries.
Keywords: ALLEX PROJECT, ALRI, DURAMAZWI RECHISHONA, DURAMAZWI GURU RECHISHONA, DICTIONARY, SHONA, HEADWORD, SENSE, MONOLINGUAL DICTIONARY, CORPUS, IDIOM, PROVERB, PITHY SAYING
Opsomming: 'n Gevorderde woordeboek? Ooreenkomste en verskille tussen Duramazwi ReChiShona en Duramazwi Guru ReChiShona. In hierdie artikel word 'n vergelykende ontleding van Duramazwi ReChiShona (DRC en Duramazwi Guru ReChiShona (DGC gemaak. Sowel die DRC en DGC is eentalige Sjonawoordeboeke, saamgestel deur ?n span navorsers by die African Languages Lexical (ALLEX Project, tans die African Languages Research Institute (ALRI. Gedurende die samestellingsproses was DRC bekend as die Algemene Sjonawoordeboek en DGC as die Gevorderde Sjonawoordeboek. 'n Eenvoudige ontleding van hierdie titels toon dat die woordeboeke op sommige maniere eenders en op ander ook verskillend is. Die skrywer probeer die maniere aantoon waarop DGC beskou word as 'n meer gevorderde woordeboek wanneer dit met DRC vergelyk word. Alhoewel die argument van die artikel hoofsaaklik gebou is op daardie verskille wat DGC die gevorderdste maak, word ook aandag gegee aan
Didactical formulation of the Ampère law
International Nuclear Information System (INIS)
Barchiesi, Dominique
2014-01-01
The Ampère law is useful to calculate the magnetostatic field in the cases of distributions of current with high degree of symmetry. Nevertheless the magnetic field produced by a thin straight wire carrying a current I requires the Biot–Savart law and the use of the Ampère law leads to a mistake. A didactical formulation of the Ampère law is proposed to prevent misinterpretations. (letters and comments)
Energy Technology Data Exchange (ETDEWEB)
Samuha, S. [Department of Materials Engineering, Ben Gurion University of the Negev, Beer Sheva 84105 (Israel); NRCN, P.O. Box 9001, Beer Sheva 84190 (Israel); Grushko, B. [MaTecK, Jülich D 52428 (Germany); PGI-5, Forschungszentrum Jülich, Jülich D 52425 (Germany); Meshi, L., E-mail: Louisa@bgu.ac.il [Department of Materials Engineering, Ben Gurion University of the Negev, Beer Sheva 84105 (Israel); Ilse Katz Institute for Nanoscale Science & Technology, Ben Gurion University of the Negev, Beer Sheva 84105 (Israel)
2016-06-15
Partial isothermal sections at 800, 650 and 590 °C were constructed for an Al-rich compositional range of Al–Cu–Re. The maximal solubility of Cu in the Al{sub 11}Re{sub 4}, h-Al{sub 4}Re and l-Al{sub 4}Re phases was found to be ∼6, 4.5, and 2.3 at% respectively, while the solubility of Re in the Al–Cu θ, η{sub 1} and ε{sub 2} phases was below 0.5 at%. Below 740 °C, a ternary hexagonal phase (P6{sub 3}, a = 1.1029 and c = 1.2746 nm) is formed in a small compositional range close to Al{sub 65}Cu{sub 25}Re{sub 10}. Its structural model was deduced by direct methods applied on the precession electron diffraction tomography data. - Highlights: • Al–Cu–Re was studied at 540–1030 °C up to 25 at% Re and 60 at% Cu. • Al{sub 11}Re{sub 4}, h-Al{sub 4}Re and l-Al{sub 4}Re dissolve 6, 4.5 and 2.3 at% Cu, respectively. • Earlier reported ternary compound Al{sub 8}CuRe was not confirmed. • Earlier reported ternary compound Al{sub 7}Cu{sub 2}Re is probably Al{sub 6.2}Cu{sub 2}Re. • Crystal structure of hexagonal Al{sub 6.2}Cu{sub 2}Re was solved.
Kastler, Alfred
1976-01-01
La matière nous est connue et jusque dans sa structure intime : l'aspect qu'offre le monde industrialisé en est une preuve suffisante, la bombe atomique ou à hydrogène, un signe spectaculaire. Pourtant, selon Alfred Kastler, dont le témoignage en pareil domaine fait naturellement autorité, la matière mérite plus encore d'être appelée "étrange".
Complexation of 188Re-phosphonates: in vitro and in vivo studies
International Nuclear Information System (INIS)
Faintuch, B.L.; Muramoto, E.; Faintuch, S.
2003-01-01
MDP (methylenediphosphonate) and HEDP (hydroxyethylidene diphosphonate), both disphosphonates, and EDTMP (ethylenediamine tetramethylene phosphonic acid), a tetraphosphonate ligand, have been previously labeled with 188 Re for use in metastatic bone-pain palliation. The aim of this study was a comparison between the three complexes 188 Re-MDP, 188 Re-HEDP and 188 Re-EDTMP concerning the complexation conditions, in order to achieve maximum yield, stability and bone uptake. Methods: MDP was dissolved in water and HEDP and EDTMP were dissolved in NaOH 1 N followed by reduction of pH with HCl 1 N. To all mixtures stannous chloride and 188 ReO 4 - were added in a nitrogen atmosphere. The preparations were heated in boiling water bath for 15 min. Yield as well as radiochemical stability was estimated by ITLC. Different concentrations of phosphonates and stannous chloride were evaluated. Biodistribution studies in Swiss mice were done for the three 188 Re-phosphonates that presented the best radiochemical yield. The optimal ligand concentration for maximum complexation was 85.2 mM for MDP, 72.8 mM for HEDP and 45.8 mM for EDTMP. The best amount of SnCl 2 .2H 2 O was 1.5 mg/mL for 188 Re-HEDP and 1 mg/mL for both 188 Re-MDP and 188 Re-EDTMP. In these conditions the three complexes showed a complexation rate above 95%. Reasonable radiochemical stability for 24 hours was achieved by 188 Re-EDTMP when employing ascorbic acid. All products showed a great uptake by the kidneys. 188 Re-EDTMP had the greatest uptake by femur (3.1 ± 0.2% ID/g) followed by 188 Re-MDP (1.2 ± 0.1% ID/g) and 188 Re-HEDP (1.0 ± 0.1% ID/g), 4 hours post injection. 188 Re-EDTMP displayed a femur bone/muscle ratio of 28.5, 188 Re-MDP 4.9 and 188 Re-HEDP 4.9. In conclusion 188 Re-EDTMP demonstrated the best potential as a radiopharmaceutical for bone cancer pain relief, encouraging further dosimetric studies and clinical trials. (orig.)
Suddenly included: cultural differences in experiencing re-inclusion.
Pfundmair, Michaela; Graupmann, Verena; Du, Hongfei; Frey, Dieter; Aydin, Nilüfer
2015-03-01
In the current research, we examined whether re-inclusion (i.e. the change from a previous state of exclusion to a new state of inclusion) was perceived differently by people with individualistic and collectivistic cultural backgrounds. Individualists (German and Austrian participants) but not collectivists (Chinese participants) experienced re-inclusion differently than continued inclusion: While collectivistic participants did not differentiate between both kinds of inclusion, individualistic participants showed reduced fulfilment of their psychological needs under re-inclusion compared to continued inclusion. The results moreover revealed that only participants from individualistic cultures expressed more feelings of exclusion when re-included than when continually included. These exclusionary feelings partially mediated the relationship between the different states of inclusion and basic need fulfilment. © 2014 International Union of Psychological Science.
Directory of Open Access Journals (Sweden)
Wood Scott A
2002-01-01
Full Text Available To understand the aqueous species important for transport of rhenium under supercritical conditions, we conducted a series of solubility experiments on the Re–ReO2 buffer assemblage and ReS2. In these experiments, pH was buffered by the K–feldspar–muscovite–quartz assemblage; in sulfur-free systems was buffered by the Re–ReO2 assemblage; and and in sulfur-containing systems were buffered by the magnetite–pyrite–pyrrhotite assemblage. Our experimental studies indicate that the species ReCl40 is dominant at 400°C in slightly acidic to near-neutral, and chloride-rich (total chloride concentrations ranging from 0.5 to 1.0 M environments, and ReCl3+ may predominate at 500°C in a solution with total chloride concentrations ranging from 0.5 to 1.5 M. The results also demonstrate that the solubility of ReS2 is about two orders of magnitude less than that of ReO2. This finding not only suggests that ReS2 (or a ReS2 component in molybdenite is the solubility-controlling phase in sulfur-containing, reducing environments but also implies that a mixing process involving an oxidized, rhenium-containing solution and a solution with reduced sulfur is one of the most effective mechanisms for deposition of rhenium. In analogy with Re, TcS2 may be the stable Tc-bearing phase in deep geological repositories of radioactive wastes.
30 CFR 285.905 - When must I submit my decommissioning application?
2010-07-01
... application? 285.905 Section 285.905 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE RENEWABLE ENERGY ALTERNATE USES OF EXISTING FACILITIES ON THE OUTER CONTINENTAL SHELF Decommissioning Decommissioning Applications § 285.905 When must I submit my decommissioning application? You must...
Need for re-skilltraining towards make in India initiative
Directory of Open Access Journals (Sweden)
Anita Singh
2016-12-01
Full Text Available With rapid change in global environment and technology, Indian corporate and industry is facing a big hurdle to fill existing jobs due to shortage of skilled manpower. To fill this gap the government has taken ‘Make in India’ initiative for skilling and re skilling manpower. Most of the Indian IT companies have shifted their focus from hiring to training and re skilling their employees at every level to match the needs of their client and make the organization cost effective. Training brings about attitudinal changes, improves skill, and there by improves job performance. The study attempts to understand attitude of employees towards imparting Re Skilling Training program, whether employees feels that re-skilling training is necessary or they are burdened by it. The basic focus of this paper is to identify the factor that influence employees attitude towards re-skilling. A survey is conducted to attain the objectives of the research. Respondents are the employees working in IT sector. Finding of the study includes that employees agree that re-killing is important for job growth and it also helps them in learning new technology and skills .They are of the opinion that re skilling provides them with better growth opportunities and enhances overall performance of the organization.
Seismic re-evaluation of French nuclear power plants
International Nuclear Information System (INIS)
Andrieu, R.
1995-01-01
After a presentation of the seismic inputs which have been taken into account in the design of the French Nuclear Power Plants, the re-assessed values of these inputs are shown. Some considerations about the specificity of the French PWR program with regard to the standardisation of plants are given together with the present objectives of seismic re-evaluations. Finally the main results of the seismic re-analysis being performed for the Phenix Fast Reactor are considered. (author)
Energy Technology Data Exchange (ETDEWEB)
Lopes, Paula Regina Corain; Osso Junior, Joao Alberto, E-mail: paulinhacorain@usp.b, E-mail: jaosso@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)
2009-07-01
Amongst some currently radioisotopes, {sup 99m}Tc and {sup 188}Re present adequate decay properties for use in Nuclear Medicine. In the current times the most diagnosis examinations are performed with {sup 99m}Tc and {sup 188}Re is one radioisotope of potential use in therapy techniques. The objective of this work consists of determining the capacity of some adsorbent materials for retention of molybdenum and tungsten, aiming the optimization of generator systems of {sup 99}Mo-{sup 99m}Tc and {sup 188}W-{sup 188}Re with suitable characteristics for application in Nuclear Medicine. Known amounts, in mass, of molybdenum and tungsten were percolated through different chromatographic columns containing different commercial adsorbent materials such as: PZC (poly-zirconium compound), acid alumina and calcinated alumina used in the routine preparation of {sup 99}Mo-{sup 99m}Tc generators at IPEN. The tungsten ({sup 188}W), as well the PZC used in this project, supplied by Russia and Japan, respectively, through the International Atomic Energy Agency (IAEA) and used without any previous preparation. Also trace amounts of {sup 99}Mo and {sup 188}W were added to the initial solutions and the generators were assembled. The {sup 99}Mo-{sup 99m}Tc generators were then eluted with known volumes of 0.9% NaCl solution every 24 hours whereas the {sup 188}W-{sup 188}Re generators were eluted every 48 hours. The eluted samples were analyzed by Gamma Spectroscopy and later submitted to quality control evaluation. The results showed that the PZC presents superior retention capacity for Mo of 97.50mg Mo/gPZC, higher than in acid and calcinated alumina, however the elution efficiency at lower pHs is not so high. With regards to the experiments carried out with {sup 188}W and alumina, it was verified that the elution efficiency of {sup 188}Re was not reproducible and the retention capacity of W was 90.23mgW/gAl{sub 2}O{sub 3} at pH 7. (author)
18 CFR 35.5 - Rejection of material submitted for filing.
2010-04-01
... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Rejection of material submitted for filing. 35.5 Section 35.5 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY... that fails to comply with this Part may be rejected by the Director of the Office of Energy Market...
Citation analysis of doctoral theses submitted to the department of ...
African Journals Online (AJOL)
This is a bibliometric study carried out on eighty doctoral theses submitted to the Department of Library, Archival and Information Studies at the University of Ibadan, with the aim of determining the characteristics of citations in the theses. Most of the citations were to journals and books. Majority of the sources cited were old.
Directory of Open Access Journals (Sweden)
Isabelle Gautier
2017-08-01
Full Text Available Abstract Background There is a great need for high quality clinical research for children. The European Pediatric Regulation aimed to improve the quality of clinical trials in order to increase the availability of treatments for children. The main purpose of this study was to assess the evolution of both the number and the quality of pediatric trial protocols that were submitted to a French Institutional Review Board (IRB00009118 before and after the initiation of the EU Pediatric Regulation. Methods All protocols submitted to the IRB00009118 between 2003 and 2014 and conducting research on subjects under eighteen years of age were eligible. The quality of randomized clinical trials was assessed according to the guidelines developed by the Enhancing the QUAlity and Transparency Of health Research (EQUATOR Network and ranked using the Jadad score. Results Out of 622 protocols submitted to the Institutional Review Board (IRB, 21% (133/622 included children. Among these 133 pediatric protocols, the number of submitted pediatric protocols doubled between the two studied periods. From 2003 to 2008, 47 protocols including 21 institutionally sponsored were submitted to the IRB and from 2009 until 2014, 86 protocols including 48 institutionally sponsored were submitted. No significant trend was observed on the quality of RCTs. The overall median score of RCTs on the Jadad scale was high (3.5, 70.0% of protocols had a Jadad score ≥ 3, and 30.0% had a score < 3. Conclusion Following the EU Pediatric Regulation, the number of pediatric protocols submitted to the IRB00009118 tends to increase, but no change was noticed regarding their quality.
Thermal expansion and conductivity of RE2Sn2O7 (RE = La, Nd, Sm, Gd, Er and Yb) pyrochlores
International Nuclear Information System (INIS)
Feng, J.; Xiao, B.; Zhou, R.; Pan, W.
2013-01-01
Graphical abstract: Calculated cohesive energies and formation enthalpies of RE 2 Sn 2 O 7 compounds. The formation enthalpies at 298 K are more close to the experimental values. -- The calculated cohesive energies and formation enthalpies of Rare earth stannate (RE 2 Sn 2 O 7 ) compounds are in good agreement with the corresponding experimental values. The thermal expansion coefficients (TECs) of rare earth stannates are 7–9 × 10 −6 K −1 at high temperature. The results show that local spin density approximation predicts smaller TECs than the real values. The computed thermal conductivity of RE 2 Sn 2 O 7 is 1.8–2.5 W (m · K) −1 at 1273 K using the Slack–Clarke model, indicating that RE 2 Sn 2 O 7 compounds exhibit good thermal insulating properties at high temperature
188W/188Re Generator System and Its Therapeutic Applications
Directory of Open Access Journals (Sweden)
A. Boschi
2014-01-01
Full Text Available The 188Re radioisotope represents a useful radioisotope for the preparation of radiopharmaceuticals for therapeutic applications, particularly because of its favorable nuclear properties. The nuclide decay pattern is through the emission of a principle beta particle having 2.12 MeV maximum energy, which is enough to penetrate and destroy abnormal tissues, and principle gamma rays (Eγ=155 keV, which can efficiently be used for imaging and calculations of radiation dose. 188Re may be conveniently produced by 188W/188Re generator systems. The challenges related to the double neutron capture reaction route to provide only modest yield of the parent 188W radionuclide indeed have been one of the major issues about the use of 188Re in nuclear medicine. Since the specific activity of 188W used in the generator is relatively low (<185 GBq/g, the eluted Re188O4- can have a low radioactive concentration, often ineffective for radiopharmaceutical preparation. However, several efficient postelution concentration techniques have been developed, which yield clinically useful Re188O4- solutions. This review summarizes the technologies developed for the preparation of 188W/188Re generators, postelution concentration of the 188Re perrhenate eluate, and a brief discussion of new chemical strategies available for the very high yield preparation of 188Re radiopharmaceuticals.
Production aspects of broiler breeders submitted to different drinker types
Directory of Open Access Journals (Sweden)
LP Colvero
2014-03-01
Full Text Available The objective of this study was of evaluate the influence of different drinker types on the egg production, water intake, mortality, poultry litter relative humidity, egg weight, eggshell percentage, and egg specific gravity of broiler breeders. The experiment was carried out in a commercial farm with 37- to 44-wk-old broiler breeders. A randomized block experimental design, consisting of two treatments (bell or nipple drinkers with four replicates of 4.000 females each, was applied. Data were submitted to analysis of variance, and means were compared by the test of Student-Newman-Keuls at 5% significance level. Birds submitted to nipple drinkers presented lower water intake (p0.05 of drinker type on egg production or mortality. Poultry litter relative humidity was lower (p<0.05 under the nipple-drinker system. Birds drinking from bell drinkers produced heavier eggs (p<0.05 between weeks 39 and 40. Hens drinking from bell drinkers laid eggs with higher specific gravity and eggshell percentage. It was concluded that nipple drinkers can be used for broiler breeders during lay.
Person Re-Identification by Camera Correlation Aware Feature Augmentation.
Chen, Ying-Cong; Zhu, Xiatian; Zheng, Wei-Shi; Lai, Jian-Huang
2018-02-01
The challenge of person re-identification (re-id) is to match individual images of the same person captured by different non-overlapping camera views against significant and unknown cross-view feature distortion. While a large number of distance metric/subspace learning models have been developed for re-id, the cross-view transformations they learned are view-generic and thus potentially less effective in quantifying the feature distortion inherent to each camera view. Learning view-specific feature transformations for re-id (i.e., view-specific re-id), an under-studied approach, becomes an alternative resort for this problem. In this work, we formulate a novel view-specific person re-identification framework from the feature augmentation point of view, called Camera coR relation Aware Feature augmenTation (CRAFT). Specifically, CRAFT performs cross-view adaptation by automatically measuring camera correlation from cross-view visual data distribution and adaptively conducting feature augmentation to transform the original features into a new adaptive space. Through our augmentation framework, view-generic learning algorithms can be readily generalized to learn and optimize view-specific sub-models whilst simultaneously modelling view-generic discrimination information. Therefore, our framework not only inherits the strength of view-generic model learning but also provides an effective way to take into account view specific characteristics. Our CRAFT framework can be extended to jointly learn view-specific feature transformations for person re-id across a large network with more than two cameras, a largely under-investigated but realistic re-id setting. Additionally, we present a domain-generic deep person appearance representation which is designed particularly to be towards view invariant for facilitating cross-view adaptation by CRAFT. We conducted extensively comparative experiments to validate the superiority and advantages of our proposed framework over state
PSpectRe: a pseudo-spectral code for (P)reheating
International Nuclear Information System (INIS)
Easther, Richard; Finkel, Hal; Roth, Nathaniel
2010-01-01
PSpectRe is a C++ program that uses Fourier-space pseudo-spectral methods to evolve interacting scalar fields in an expanding universe. PSpectRe is optimized for the analysis of parametric resonance in the post-inflationary universe and provides an alternative to finite differencing codes, such as Defrost and LatticeEasy. PSpectRe has both second- (Velocity-Verlet) and fourth-order (Runge-Kutta) time integrators. Given the same number of spatial points and/or momentum modes, PSpectRe is not significantly slower than finite differencing codes, despite the need for multiple Fourier transforms at each timestep, and exhibits excellent energy conservation. Further, by computing the post-resonance equation of state, we show that in some circumstances PSpectRe obtains reliable results while using substantially fewer points than a finite differencing code. PSpectRe is designed to be easily extended to other problems in early-universe cosmology, including the generation of gravitational waves during phase transitions and pre-inflationary bubble collisions. Specific applications of this code will be described in future work
International Nuclear Information System (INIS)
Sailerova, Eva; Billinghurst, M.W.
2003-01-01
The formation of 188 Re-tartrate for use in transchelation reactions and the transchelation of the 188 Re onto albumin was studied. Two labelled tartrate products were separated using a non-traditional mobile phase on ITLC strips. Tartrate labelling yield increases with pH but so does the instability when the product is exposed to air. Lower pH's are preferred when oxygen-free labelling conditions can be achieved. Higher tin levels protect against air oxidation. Stability of the Re-tartrate complex is supported by addition of ascorbic acid and ferrous sulphate, however both these agents decreased the rate of the formation of the Re-tartrate complex. The labelling efficiency of a perrhenate solution decreased with the time for which it is stored prior to the labelling reaction, depending on the radioactive concentration. Re-albumin transchelation efficiency increases with the tartrate concentration, while increased stability of the Re-tartrate complex lowers the transchelation yields of Re-albumin
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What information must I submit with my SAP to... Assessment Plan § 285.611 What information must I submit with my SAP to assist MMS in complying with NEPA and other relevant laws? (a) You must submit with your SAP detailed information to assist MMS in complying...
International Nuclear Information System (INIS)
Winchester, J.W.
1977-01-01
As an example of the application of the PIXE analysis technique to the study of sulfur and related trace metals in aerosol samples from nonurban locations, results obtained from a remote continental station in the Southern Hemisphere, Chacaltaya Mountain near La Paz, Bolivia, and a mid-ocean station in the Atlantic of the Northern Hemisphere, at Bermuda, are compared. In Bolivian filter samples, the proportions of Si, K, Ca, Ti, Fe, Rb, and Sr are within the ranges expected from the subaerial erosion of major rock types of the earth's crust. However, the proportions, relative to Fe, of S, Cu, Zn, As, and Pb are enriched 10-100 times in comparison with the compositions of major rock types. In Bermuda cascade impactor samples summed over all particle sizes, the ratio S/Zn and the relative proportions of K, Ca, and Fe resemble those observed in Bolivia. Total Fe concentrations in Bermuda average about 60 ng/m 3 , similar to concentrations observed in Bolivia. However, the ratios S/Fe and Zn/Fe are 10 times greater in Bermuda than in Bolivia, and these ratios are greatest for smallest particles and decrease sharply with increasing particle size. The higher S and Zn concentrations in Bermuda may result from the combined effect of natural processes which control the atmospheric enrichment of chalcophile elements of long range transport from pollution sources in urban and industrial centers. (Auth.)
Nye militære trends i den syriske borgerkrig
DEFF Research Database (Denmark)
Engen, Torben Toftgaard; Kjellund, Jon
2018-01-01
I den flerårige syriske borgerkrig har der fundet tre nye militære trends sted, der peger imod, at fremtidens landmilitære kampplads vil være væsensforskellig fra indsatserne i Irak og Afghanistan. Denne rapport analyserer de tre trends inden for digitaliseringen af den hybride krigsførelse og ka...
Seismic re-evaluation process in Medzamor-2 NPP
International Nuclear Information System (INIS)
Zadoyan, P.
2000-01-01
Seismic re-evaluation process for Medzamor-2 NPP describes the following topics: program implementation status; re-evaluation program structure; regulatory procedure and review plan; current tasks and practice; and regulatory assessment and research programs
Strain induced optical properties of BaReO3
Kumavat, Sandip R.; Kansara, Shivam; Gupta, Sanjeev K.; Sonvane, Yogesh
2018-05-01
Here, we have performed strain induce optical properties of BaReO3 by using density functional theory (DFT). We noticed that after applying intrinsic and extrinsic strain to the BaReO3, it shows the metallic behavior. We also studied optical properties, which show good activity in the ultraviolet region. The results show that after applying intrinsic and extrinsic strain to BaReO3 the absorption peaks are shifted towards the high UV region of the spectrum. Thus, we concluded that, BaReO3 material with extrinsic strain can be useful for high frequency UV device and optoelectronic devices.
Evaluation of the motility function of the gall - bladder in subject submitted to a vagotomy
International Nuclear Information System (INIS)
Szegoe, T.
1989-01-01
The emptying of the gallbladder was studied in 13 patients submited to truncal vagotomy, 14 to selective vagotomy, associated to hemi-gastrectomy and reconstruction of the digestive tract through gastroduodenostomy; 15 pacients submited to proximal gastrix vagotomy and 15 controls. The evaluation was done by the injection of 185 MBq (5 mCi) of DISIDA - 99m Tc and images were obtained in gamma-camera at 70, 100, 115 and 130 minutes after the venous injection of the radioisotope. (L.M.J.) [pt
Re: Request for Correction - IRIS Assessment for Trichloroethylene
Letter from Faye Graul providing supplemental information to her Request for Correction for Threshold of Trichloroethylene Contamination of Maternal Drinking Waters submitted under the Information Quality Act.
Re-evaluation of atomic bomb radiation
International Nuclear Information System (INIS)
Okajima, Shunzo
1984-01-01
The background and current status of the re-evaluation of atomic bomb (A-bomb) radiation doses are presented. Problems in re-evaluating radiation doses are discussed: spectra of gamma-rays and neutrons emitted in the air, A-bomb structures, and meterological elements should be taken into account. In Japan, in an attempt to estimate A-bomb radiation doses, radioactive residues contained in roof tiles, bricks, rocks, and teeth and shell button of clothes are being actually measured. (Namekawa, K.)
Directory of AFRL/HEA Technical Publications Submitted to DTIC from 1969 to 2007
National Research Council Canada - National Science Library
Bell, Herbert H; Casey, Elizabeth P
2007-01-01
...) has submitted technical publications to the Defense Technical Information Center (DTIC) documenting the unique research and development efforts conducted by this organization to improve warfighter training...
Irradiation induced precipitation in tungsten based, W-Re alloys
Williams, R. K.; Wiffen, F. W.; Bentley, J.; Stiegler, J. O.
1983-03-01
Tungsten-base alloys containing 5, 11, and 25 pct Re were irradiated in the EBR-II reactor. Irradiation temperatures ranged from 600 to 1500 °C. All compositions were irradiated to fluences in the range 4.3 to 6.1 X 1025 n/m2 (E > 0.1 MeV), and three 25 pct Re samples were also irradiated to 3.7 X 1026 n/m2 at temperatures 700 to 900 °C. Postirradiation examination included measurement of electrical resistivity at room temperature and lower temperatures, X-ray diffraction, optical metallography, microprobe analysis, and transmission electron microscopy. Irradiation induced resistivity decreases observed in most of the samples suggested second-phase precipitation. Complete results confirmed the precipitate formation in all samples, in disagreement with existing phase diagrams for the W-Re system. Electron diffraction showed the precipitates to be consistent with the cubic, Re-rich X-phase and inconsistent with the σ-phase. Large variations in precipitate morphology and distribution were observed between the different compositions and irradiation conditions. For the 5 and 11 pct Re-alloys, spherically symmetric strain fields surrounded the equiaxed precipitate particles, and were observed even where no particles were visible. These strain fields are believed to arise from local Re enrichment. Thermoelectric data show that the precipitation can lead to decalibration of W/Re thermocouples.
A study of the Al-rich part of the Al-Re alloy system
International Nuclear Information System (INIS)
Balanetskyy, S.; Grushko, B.
2008-01-01
The Al-rich part of the Al-Re phase diagram was reinvestigated by scanning and transmission electron microscopy, powder X-ray diffraction and differential thermal analysis. The earlier reported Al 12 Re, Al 6 Re, and Al 11 Re 4 phases were confirmed. Close to the Al 4 Re composition a high-temperature h-Al 4 Re and a low-temperature l-Al 4 Re phase were found to be formed at slightly different compositions. Both exhibited compositional ranges. A new phase was revealed close to the Al 3 Re composition. The Al 11 Re 4 phase is formed congruently at 1650 deg. C, Al 3 Re peritectically at 1610 deg. C, h-Al 4 Re peritectically at 1410 deg. C, l-Al 4 Re peritectically at ∼1000 deg. C, Al 6 Re peritectically at 813 deg. C and Al 12 Re peritectically at 746 deg. C. Finally, the Al 12 Re-(Al) eutectic is formed at 658 deg. C. The Al 3 Re and h-Al 4 Re are decomposed by eutectoid reactions at ∼946 and 833 deg., respectively. The structure of the h-Al 4 Re phase has not yet been clarified, but it is distinctly different from the Al 4 W phase suggested earlier. The structure of l-Al 4 Re was confirmed. The Al 3 Re phase was found to have a monoclinic structure with a = 0.5180(4) nm, b = 3.97641(9) nm, c = 0.4955(3) nm and β = 99.55(7) o
Re-irradiation for metastatic brain tumors with whole-brain radiotherapy
International Nuclear Information System (INIS)
Akiba, Takeshi; Kunieda, Etsuo; Kogawa, Asuka; Komatsu, Tetsuya; Tamai, Yoshifumi; Ohizumi, Yukio
2012-01-01
The objective of this study was to determine whether second whole-brain irradiation is beneficial for patients previously treated with whole-brain irradiation. A retrospective analysis was done for 31 patients with brain metastases who had undergone re-irradiation. Initial whole-brain irradiation was performed with 30 Gy/10 fractions for 87% of these patients. Whole-brain re-irradiation was performed with 30 Gy/10 fractions for 42% of these patients (3-40 Gy/1-20 fractions). Three patients underwent a third whole-brain irradiation. The median interval between the initial irradiation and re-irradiation was 10 months (range: 2-69 months). The median survival time after re-irradiation was 4 months (range: 1-21 months). The symptomatic improvement rate after re-irradiation was 68%, and the partial and complete tumor response rate was 55%. Fifty-two percent of the patients developed Grade 1 acute reactions. On magnetic resonance imaging, brain atrophy was observed in 36% of these patients after the initial irradiation and 74% after re-irradiation. Grade ≥2 encephalopathy or cognitive disturbance was observed in 10 patients (32%) after re-irradiation. Based on univariate analysis, significant factors related to survival after re-irradiation were the location of the primary cancer (P=0.003) and the Karnofsky performance status at the time of re-irradiation (P=0.008). A Karnofsky performance status ≥70 was significant based on multivariate analysis (P=0.050). Whole-brain re-irradiation for brain metastases placed only a slight burden on patients and was effective for symptomatic improvement. However, their remaining survival time was limited and the incidence of cognitive disturbance was rather high. (author)
Re-irradiation of recurrent esophageal cancer after primary definitive radiotherapy
Energy Technology Data Exchange (ETDEWEB)
Kim, Young Suk; Lee, Chang Geol; Kim, Kyung Hwan; Kim, Tae Hyung [Dept. of Radiation Oncology, Yonsei University Health System, Yonsei University College of Medicine, Seoul (Korea, Republic of)
2012-12-15
For recurrent esophageal cancer after primary definitive radiotherapy, no general treatment guidelines are available. We evaluated the toxicities and clinical outcomes of re-irradiation (re-RT) for recurrent esophageal cancer. We analyzed 10 patients with recurrent esophageal cancer treated with re-RT after primary definitive radiotherapy. The median time interval between primary radiotherapy and re-RT was 15.6 months (range, 4.8 to 36.4 months). The total dose of primary radiotherapy was a median of 50.4 Gy (range, 50.4 to 63.0 Gy). The total dose of re-RT was a median of 46.5 Gy (range, 44.0 to 50.4 Gy). The median follow-up period was 4.9 months (range, 2.6 to 11.4 months). The tumor response at 3 months after the end of re-RT was complete response (n = 2), partial response (n = 1), stable disease (n = 2), and progressive disease (n = 5). Grade 5 tracheoesophageal fistula developed in three patients. The time interval between primary radiotherapy and re-RT was less than 12 months in two of these three patients. Late toxicities included grade 1 dysphagia (n = 1). Re-RT of recurrent esophageal cancer after primary radiotherapy can cause severe toxicity.
Re-irradiation of recurrent esophageal cancer after primary definitive radiotherapy
International Nuclear Information System (INIS)
Kim, Young Suk; Lee, Chang Geol; Kim, Kyung Hwan; Kim, Tae Hyung
2012-01-01
For recurrent esophageal cancer after primary definitive radiotherapy, no general treatment guidelines are available. We evaluated the toxicities and clinical outcomes of re-irradiation (re-RT) for recurrent esophageal cancer. We analyzed 10 patients with recurrent esophageal cancer treated with re-RT after primary definitive radiotherapy. The median time interval between primary radiotherapy and re-RT was 15.6 months (range, 4.8 to 36.4 months). The total dose of primary radiotherapy was a median of 50.4 Gy (range, 50.4 to 63.0 Gy). The total dose of re-RT was a median of 46.5 Gy (range, 44.0 to 50.4 Gy). The median follow-up period was 4.9 months (range, 2.6 to 11.4 months). The tumor response at 3 months after the end of re-RT was complete response (n = 2), partial response (n = 1), stable disease (n = 2), and progressive disease (n = 5). Grade 5 tracheoesophageal fistula developed in three patients. The time interval between primary radiotherapy and re-RT was less than 12 months in two of these three patients. Late toxicities included grade 1 dysphagia (n = 1). Re-RT of recurrent esophageal cancer after primary radiotherapy can cause severe toxicity.
International Nuclear Information System (INIS)
Trotignon, L.; Bienvenu, P.; Provitina, O.; Rose, J.; Khoury, H.; Trocellier, P.; Mercier, F.; Raimbault, L.
2005-01-01
Full text of publication follows: The site of Maqarin (Jordan), in which natural cements occur as a result of the combustion metamorphism of a bio-micrite, is studied since 1989 as a natural analogue for the long term evolution of a cementitious repository environment [1]. Several trace elements of interest (Cr, Se, Mo, Re) are mobilized on this site by percolating groundwaters and migrate along high pH plumes. Laboratory scale column experiments were conducted in which crushed materials (cement, bio-micrite) collected on site were submitted to leaching by deionized water or Ca(OH) 2 equilibrated solutions. The evolution of Cr, Mo, Se and Re was monitored in leachates during the experiments. Characterizations of the solid phase using several techniques were also conducted in order to locate these elements in the mineral phases. Comparison of experimental data with records of trace element concentration in Maqarin groundwaters gives some insight on Re, Cr, Se and Mo sources and sinks in this environment. Both the imprint of the past combustion event and present day redox transformations explain several features of the datasets. However, due to the high complexity of the cements, in which trace elements are often distributed among several mineral phases, it is presently not possible to link in a straightforward way individual mineral dissolution processes and trace element signals in waters. [1] Khoury H. N., Salameh E., Clark I. D., Fritz P., Bajjali W., Milodowski A. E., Cave M. R. and Alexander W. R. 1992. A natural analogue of high pH cement pore waters from the Maqarin area of northern Jordan. I: Introduction to the site. J. Geochem. Explor. 46: 117-132. (authors)
The oxidation of ReCl_5 with oleum: synthesis and crystal structure of Re_2O_4Cl_4(SO_4)
International Nuclear Information System (INIS)
Betke, Ulf; Wickleder, Mathias S.
2012-01-01
The reaction of ReCl_5 and fuming sulfuric acid (25 % SO_3) in a sealed glass tube at 200 C led to red, needle shaped single crystals of Re_2O_4Cl_4(SO_4) (monoclinic, C2/c, a = 1501.8(2) pm, b = 1545.9(2) pm, c = 945.18(8) pm, β = 98.761(9) , Z = 8). In the crystal structure the [ReO_2] moieties are linked by [SO_4]"2"- tetrahedra to chains along the [101] direction. Each sulfate ion connects four rhenium atoms, additional two chloride ions complete the octahedral coordination sphere of each rhenium atom according to "1_∞[ReO_2_/_1Cl_2_/_1(SO_4)_2_/_4]. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
Energy Technology Data Exchange (ETDEWEB)
Vasseur, F.; Comet, B.; Faivre-Pierret, M.; Coche-Dequeant, B.; Degardin, M.; Lefebvre, J.L.; Lacornerie, T.; Lartigau, E. [Departement universitaire de radiotherapie, centre Oscar Lambret, 59 - Lille (France); Universite Lille-2, 59 (France)
2010-10-15
The authors report a work aimed at assessing the feasibility and toxicity of a re-irradiation treatment in stereotactic conditions using CyberKnife and cetuximab in the case of local relapses of epidermoid cancers of the ORL sphere. Thirty three patients have been submitted to this treatment between June 2007 and April 2009. Although six patients died by six months, this treatment seems to be a good alternative, and presents an acceptable short-term toxicity. Further studies are needed to compare this technique to other therapeutic techniques, and to assess the risk of long term complications. Short communication
Discussion of submitted posters for Section 2.3 (Rangeland Germplasm Resources)
As part of the IX International Rangeland Congress held in Rosario, Argentina, a total of 70 posters from 17 countries were submitted to Section 2.3 (Rangeland Germplasm Resources). These posters documented research conducted in five major regions of the world: South America, North America, Africa...
15 CFR 711.2 - Who submits declarations, reports, and advance notifications.
2010-01-01
... 15 Commerce and Foreign Trade 2 2010-01-01 2010-01-01 false Who submits declarations, reports, and advance notifications. 711.2 Section 711.2 Commerce and Foreign Trade Regulations Relating to Commerce and Foreign Trade (Continued) BUREAU OF INDUSTRY AND SECURITY, DEPARTMENT OF COMMERCE CHEMICAL WEAPONS...
40 CFR 63.6009 - What notifications must I submit and when?
2010-07-01
... National Emissions Standards for Hazardous Air Pollutants: Rubber Tire Manufacturing Notifications, Reports... this subpart. (d) If you are required to conduct a performance test, you must submit a notification of intent to conduct a performance test at least 60 calendar days before the performance test is scheduled...
Perks of Tracking What You're Eating
It’s important to keep track of the steps you’re taking toward nourishing your body with a healthier diet. By keeping track of what you’re eating—even for a couple of weeks— you may be able to identify patterns that are helping—or hurting—your goals for nourishing your body in a healthy way.
2010-04-01
... testimony, make a statement or submit to interview? 516.2 Section 516.2 Indians NATIONAL INDIAN GAMING... whom this part applies give testimony, make a statement or submit to interview? (a) No person to whom... regulation, shall provide testimony, make a statement or submit to interview. (b) Whenever a subpoena...
Mahdaoui, Fatima; Michels, Raymond; Reisberg, Laurie; Pujol, Magali; Poirier, Yannick
2015-06-01
Several recent studies have raised the exciting possibility that oils can be dated using the Re-Os radioisotope system. However the exact nature of the events dated by this technique often remains unclear. Geochronologic interpretation of Re-Os data for oils is hampered by our limited knowledge of how these metals behave in petroleum systems. In particular, it is difficult to understand how isotopic homogenization, an essential prerequisite for the development of an isochronal relationship, can be achieved at the scale of a petroleum basin. The mechanisms capable of fractionating the Re/Os ratio in a suite of oils are also poorly understood. For this reason, we have performed an experimental study aimed at investigating the behavior of Re and Os during a particularly widespread phenomenon in petroleum systems, the interaction of formation waters with oils during migration. Contact experiments between natural oils and aqueous solutions enriched in Re and/or Os were carried out for varying lengths of time (6 h to 5 months), at different temperatures (25-150 °C), over a wide range of metal concentrations in the enriched solution (0.001-100 μg/g for Re; 1 and 10 ng/g for Os). In addition, the effect of oil composition on Re-Os exchange at the water-oil interface was examined by testing two oils with very different properties. All of our results demonstrate that Re and Os are transferred massively and very rapidly from the aqueous solution to the organic phase. This is true regardless of temperature or oil composition. It is also true for a very wide range of metal concentrations in the aqueous solution, up to an apparent saturation level that exceeds natural concentrations in oils by several orders of magnitude. Given the efficiency of Re and Os transfer from water to oil demonstrated here, and assuming that our findings are applicable to natural conditions, water/oil ratios of only about 250 would be needed to explain the Re and Os contents of most oils, based on
Re-utilization of concrete from decommissioned nuclear facilities by re-clinkering
International Nuclear Information System (INIS)
Costes, J.R.
1998-01-01
Usually concrete is reused as aggregates. To maximize reusing by producing a new concrete, separation of its fundamental components (aggregates, sand, cement) is required. But can already hydrated cement be re-clinkered and become new good cement again? This paper shows how specimen of pure cement paste of ordinary Portland cement was hydrated then crushed and reclinkerised. Chemical and, X ray diffraction analysis, electronic microscope coupled with X fluorescence observations, demonstrate that very few differences occurs in the cement paste before and after re-clinkering; mechanical properties of the reactivated powder are very satisfactory, even exceeding the strength of the original pure cement paste. As this process involves heating up to 1450 deg C, some of the contamination (caesium, ruthenium) may also be eliminated by volatilization and recovery on filters. This process could be very promising to complete recycle large quantities of low level contaminated concrete inside the nuclear industry as alternative to storage in specific and expensive dump, as it is now the case for steel materials. (authors)
Preparation and characterization of sintered Mo-Re alloys
International Nuclear Information System (INIS)
Morito, F.
1993-01-01
By the method of powder metallurgy, we have tried to fabricate Mo-Re alloys, which were electron beam weldable. Severe quality control was carried out during the whole fabrication process focused to reducing oxygen contamination. It is inevitable that the starting raw powders of Mo and Re were both high purity with 99.99 mass% up. Moreover, high vacuum sintering was performed before final sintering with high-purity hydrogen gas. As a result, we obtained electron beam weldable Mo-Re alloys, the total oxygen content of which was about 10 mass ppm or less, respectively. Several specimens were melted by electron beam welding (EBW) method. It was found that EBW gives an easy and effective survey to examine the weldability and the quality of the materials. Fracture surfaces examined by AES exhibited very low content of oxygen, carbon and nitrogen or that less than detectability limit. In conclusion, we have succeeded to obtain defect-free welds of sintered Mo-Re alloys. Furthermore it was found that Mo-Re alloys showed excellent potentialities not only in mechanical properties at low temperature but also in the respects of microstructure. (orig.)
MetReS, an Efficient Database for Genomic Applications.
Vilaplana, Jordi; Alves, Rui; Solsona, Francesc; Mateo, Jordi; Teixidó, Ivan; Pifarré, Marc
2018-02-01
MetReS (Metabolic Reconstruction Server) is a genomic database that is shared between two software applications that address important biological problems. Biblio-MetReS is a data-mining tool that enables the reconstruction of molecular networks based on automated text-mining analysis of published scientific literature. Homol-MetReS allows functional (re)annotation of proteomes, to properly identify both the individual proteins involved in the processes of interest and their function. The main goal of this work was to identify the areas where the performance of the MetReS database performance could be improved and to test whether this improvement would scale to larger datasets and more complex types of analysis. The study was started with a relational database, MySQL, which is the current database server used by the applications. We also tested the performance of an alternative data-handling framework, Apache Hadoop. Hadoop is currently used for large-scale data processing. We found that this data handling framework is likely to greatly improve the efficiency of the MetReS applications as the dataset and the processing needs increase by several orders of magnitude, as expected to happen in the near future.
Voigts, Clemens
2014-01-01
In der Dissertation wurden die Altäre von Selinunt, einer griechischen Kolonie auf Sizilien, mit den Methoden der Bauforschung untersucht. Die neun behandelten Brandopferaltäre sind monumentale Quaderbauten, die bis zu 20 m Länge erreichen. Sie stammen aus der Blütezeit Selinunts, dem 6. und 5. Jh. v. Chr. Die Bauten waren bereits im 19. und 20. Jh. freigelegt worden und wurden nun in Bauaufnahmen dokumentiert, zeichnerisch rekonstruiert und zeitlich eingeordnet. Dabei ließ sich an ihnen eine...
Configurations of the Re-scan Confocal Microscope (RCM) for biomedical applications
de Luca, G. M. R.; Desclos, E.; Breedijk, R. M. P.; Dolz-Edo, L.; Smits, G. J.; Bielefeld, P.; Picavet, L.; Fitzsimons, C. P.; Hoebe, R.; Manders, E. M. M.
2017-01-01
The new high-sensitive and high-resolution technique, Re-scan Confocal Microscopy (RCM), is based on a standard confocal microscope extended with a re-scan detection unit. The re-scan unit includes a pair of re-scanning mirrors that project the emission light onto a camera in a scanning manner. The
Configurations of the Re-scan Confocal Microscope (RCM) for biomedical applications
De Luca, G.M.R.; Desclos, E.; Breedijk, R.M.P.; Dolz-Edo, L.; Smits, G.J.; Nahidiazar, L.; Bielefeld, P.; Picavet, L.; Fitzsimons, C.P.; Hoebe, R.; Manders, E.M.M.
The new high-sensitive and high-resolution technique, Re-scan Confocal Microscopy (RCM), is based on a standard confocal microscope extended with a re-scan detection unit. The re-scan unit includes a pair of re-scanning mirrors that project the emission light onto a camera in a scanning manner. The
The business of refractive laser assisted cataract surgery (ReLACS).
Berdahl, John P; Jensen, Matthew P
2014-01-01
Refractive Laser Assisted Cataract Surgery (ReLACS) combines the femtosecond laser with other noncovered tests and services in an attempt to reduce spectacle dependence in combination with cataract surgery. Significant interest is present among ophthalmologists who are considering adopting this technology, however significant capital outlays and continuing expenses can make the decision to adopt ReLACS foreboding. We review the financial considerations of ReLACS and review the trends seen in early adopters of this technology. Recent findings have shown that ReLACS is a growing segment of cataract surgery. Most practices who have implemented the technology have broken even and have a positive outlook on the financial return of implementing the ReLACS program. The average break-even analysis point for practices is around 230 cases a year. ReLACS is growing and appears to be a financial viable approach for many practices.
Analysis of final year DVM research projects submitted to the Faculty ...
African Journals Online (AJOL)
This study analyzed the intellectual output of the undergraduate final year students. research projects submitted to the Faculty of Veterinary Medicine, Usmanu Danfodiyo University, Sokoto, from 1994 to 2004. The findings of the study show that a total of 194 research projects were produced within the period under study.
30 CFR 210.105 - May I submit these production reports manually?
2010-07-01
... addressed to Minerals Management Service, P.O. Box 17110, Denver, Colorado 80217-0110; or (2) Special... 30 Mineral Resources 2 2010-07-01 2010-07-01 false May I submit these production reports manually? 210.105 Section 210.105 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR...
20 CFR 645.415 - What planning information must a State submit in order to receive a formula grant?
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false What planning information must a State submit in order to receive a formula grant? 645.415 Section 645.415 Employees' Benefits EMPLOYMENT AND... Grants Administration § 645.415 What planning information must a State submit in order to receive a...
Checklist of fossil decapod crustaceans from tropical America. Part I: Anomura and Brachyura
Directory of Open Access Journals (Sweden)
Javier Luque
2017-10-01
Full Text Available Abstract Our knowledge of fossil crustaceans from the tropics has increased considerably during recent decades, thanks to novel findings and the re-examination of museum specimens. However, several previous records have been misidentified, numerous museum specimens have never been reported, and many new discoveries are yet to be published. Here, we present a detailed, up-to-date, and revised checklist for every marine, terrestrial, or freshwater fossil decapod crustacean occurrence from tropical America known to us, including their age, geographic occurrences, and related literature. We recognize the occurrence of at least 32 superfamilies, 69 families, 190 genera, and 415 species of brachyurans (‘true’ crabs, and anomurans (‘false’ crabs, hermit crabs, squat lobsters, and allies, several of them previously unknown. The checklist comprises records from three main geographic regions: 1 northern South America (Bolivia, Brazil, Chile, Colombia, Ecuador, Peru, Venezuela; 2 Central America and southern North America (Belize, Costa Rica, Honduras, Panama, Mexico, southern and central Florida; and 3 the Caribbean Islands + Bermuda (Anguilla, Antigua, Aruba, Bahamas, Barbados, Bermuda, Bonaire, Cuba, Curaçao, Dominican Republic, The Grenadines, Haiti, Jamaica, Puerto Rico, Saint Bartélemy, Saint Martin, Trinidad. Previous findings, new occurrences, and the revised systematic placement for several problematic/misidentified records, indicate that the fossil record of anomurans and brachyurans in tropical America is more diverse than previously envisioned, with a considerable degree of endemism at the genus- and species-levels.
Itinerant-electron antiferromagnetism and superconductivity in bcc Cr-Re alloys
International Nuclear Information System (INIS)
Nishihara, Y.; Yamaguchi, Y.; Kohara, T.; Tokumoto, M.
1985-01-01
The magnetic and superconducting properties of bcc Cr-Re alloys with up to 40 at. % Re were studied via measurements of the magnetic susceptibility, electrical resistivity, and nuclear magnetic resonance of the Re nuclei. Antiferromagnetic order coexists with superconductivity above 18 at. % Re. The results were analyzed with the coexistence model of spin-density waves and superconductivity. In the Re-concentration range greater than 18 at. %, about 10% of the Fermi surface satisfies the nesting condition and the rest of it contributes to form the superconducting gap. This model also explains the increase in the superconducting transition temperature and the decrease in the magnetic susceptibility by annealing as a competing effect between spin-density waves and superconductivity
Gutiérrez, Cristian E
2016-01-01
Now in its second edition, this monograph explores the Monge-Ampère equation and the latest advances in its study and applications. It provides an essentially self-contained systematic exposition of the theory of weak solutions, including regularity results by L. A. Caffarelli. The geometric aspects of this theory are stressed using techniques from harmonic analysis, such as covering lemmas and set decompositions. An effort is made to present complete proofs of all theorems, and examples and exercises are offered to further illustrate important concepts. Some of the topics considered include generalized solutions, non-divergence equations, cross sections, and convex solutions. New to this edition is a chapter on the linearized Monge-Ampère equation and a chapter on interior Hölder estimates for second derivatives. Bibliographic notes, updated and expanded from the first edition, are included at the end of every chapter for further reading on Monge-Ampère-type equations and their diverse applications in th...
A study on plate anchor detailing systems of shear re-bar
International Nuclear Information System (INIS)
Tsurumaki, S.; Ujiie, K.; Nishikawa, T.; Kitayama, K.
1995-01-01
For shell walls and base slabs in reactor buildings, besides a large amount of main bars, numerous shear re-bars have been employed to resist to out-of-plane force. As a result , detailing work involving shear re-bar is extremely involved. For example, the employed re-bar anchor method differs from the ordinary methods in which, a end of shear re-bar with 135-degrees hook or with anchor plate type and another re-bar end with 90-degrees hook are used. However the structural characteristics in members using shear re-bar of the bolt-mounted anchor plate have not yet been examined. A test was performed to confirm the effects of anchor methods for shear re-bars on shearing behavior of members. This paper describes the test plan, method and results. (author). 12 figs., 7 tabs
Weinstein, Margery
2011-01-01
"You're hired!" Those two words are easy to say, but it's not always easy to find the right employee. Success hinges on hiring interviews--and they require quite a bit of training to get right. Much of the work in identifying the best people for open positions falls to line-of-business managers. In this article, Verizon Wireless, Umpqua Bank,…
20 CFR 667.120 - What planning information must a State submit in order to receive a formula grant?
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false What planning information must a State submit in order to receive a formula grant? 667.120 Section 667.120 Employees' Benefits EMPLOYMENT AND... INVESTMENT ACT Funding § 667.120 What planning information must a State submit in order to receive a formula...
Energy Technology Data Exchange (ETDEWEB)
Ahlawat, Rachna, E-mail: rachnaahlawat2003@yahoo.com
2015-07-25
Highlights: • Sol–gel process is used to obtain spherical nanocrystallites of SiO{sub 2}:RE{sub 2}O{sub 3} [RE = Y, Gd] powder. • Effect of four steps annealing is studied on micro strain, nanocrystallite size and dislocation density. • Optical properties are examined by absorption spectra and PL. • SiO{sub 2}:RE{sub 2}O{sub 3} [RE = Y, Gd] binary oxides are promising materials for high temperature structural applications. - Abstract: SiO{sub 2}:RE{sub 2}O{sub 3} [RE = Y, Gd] powder were prepared by wet chemical technique and the prepared binary oxides annealed at 500 °C and 900 °C. The crystalline structure, phase transformation, and surface morphologies of as-prepared and annealed samples were investigated by XRD and TEM. The normal transmission was measured using FTIR spectroscopy. Optical properties have been studied with UV–Vis spectroscopy and PL study. XRD results shows that the as prepared samples of SiO{sub 2}:RE{sub 2}O{sub 3} [RE = Y, Gd] powder has mixed phases of RE(NO{sub 3}){sub 3} and Si(OH){sub 3}. However, cubic rare earth oxide phase alone is found for annealed samples. The strain values are calculated from W–H plot for annealed samples. TEM micrograph shows that the samples are composed of individual spherical nanocrystallites at 500 °C and aggregated nanocrystallites at 900 °C. From the UV–Vis spectra, it is found that the position of the absorption peak is shifted toward the higher wavelength side when annealing temperature is increased. In the PL spectra, the broad emission bands are observed between 570–600 nm and the presence of O–Si–O (silica) and metal oxide is confirmed by FTIR spectra.
RDM lifetimes measurements in 179Re
International Nuclear Information System (INIS)
Chamoli, S.; Joshi, P.; Kumar, A.; Govil, I.M.; Singh, R.P.; Chatturvedi, L.
2001-01-01
The study of Re nuclei in the mass region from 170-190 is of particular interest as they lie in a region where the Nilsson orbitals exhibit large driving effects on the nuclear shape, presenting the strong possibility of shape coexistence. To see the variation of the deformation driving property of different bands and the other related phenomena like delay in band crossing frequency for intruder configuration h 92 in these nuclei with increasing in neutron number the lifetime measurement in 179 Re nucleus is done
5th environmental report submitted by the Hessian Government
International Nuclear Information System (INIS)
1992-01-01
The 5th environmental report submitted by the Hessian Government informs about the success of environmental policies in the period under review and discuss the future tasks and targets with emphasis on I) environmental quality in Hesse (A. Nature and ladscape, B. water, C. air, D. noise, E. chemicals, industrial monitoring, F. wastes, G. pollutants in the food chain, H. radioactivity and radiation protection), II) selected instruments and points of main effort, III) work and environment; Appendix. (BBR) [de
34 CFR 656.10 - What combined application may an institution submit?
2010-07-01
... LANGUAGE AND AREA STUDIES OR FOREIGN LANGUAGE AND INTERNATIONAL STUDIES How Does One Apply for a Grant... 34 Education 3 2010-07-01 2010-07-01 false What combined application may an institution submit? 656.10 Section 656.10 Education Regulations of the Offices of the Department of Education (Continued...
40 CFR 63.9350 - What reports must I submit and when?
2010-07-01
... new or reconstructed affected source that must meet the emission limitation, you must submit a... there is no deviation from the applicable emission limitation and the CEMS or CPMS was not out-of... reconstructed engine test cell/stand during the reporting period. (3) A summary of the total duration of the...
30 CFR 210.55 - May I submit this royalty report manually?
2010-07-01
... to Minerals Management Service, P.O. Box 5810, Denver, Colorado 80217-5810; or (2) Special courier or... 30 Mineral Resources 2 2010-07-01 2010-07-01 false May I submit this royalty report manually? 210.55 Section 210.55 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS...
Discriminative Multi-View Interactive Image Re-Ranking.
Li, Jun; Xu, Chang; Yang, Wankou; Sun, Changyin; Tao, Dacheng
2017-07-01
Given an unreliable visual patterns and insufficient query information, content-based image retrieval is often suboptimal and requires image re-ranking using auxiliary information. In this paper, we propose a discriminative multi-view interactive image re-ranking (DMINTIR), which integrates user relevance feedback capturing users' intentions and multiple features that sufficiently describe the images. In DMINTIR, heterogeneous property features are incorporated in the multi-view learning scheme to exploit their complementarities. In addition, a discriminatively learned weight vector is obtained to reassign updated scores and target images for re-ranking. Compared with other multi-view learning techniques, our scheme not only generates a compact representation in the latent space from the redundant multi-view features but also maximally preserves the discriminative information in feature encoding by the large-margin principle. Furthermore, the generalization error bound of the proposed algorithm is theoretically analyzed and shown to be improved by the interactions between the latent space and discriminant function learning. Experimental results on two benchmark data sets demonstrate that our approach boosts baseline retrieval quality and is competitive with the other state-of-the-art re-ranking strategies.
Software Toolchain for Large-Scale RE-NFA Construction on FPGA
Directory of Open Access Journals (Sweden)
Yi-Hua E. Yang
2009-01-01
and O(n×m memory by our software. A large number of RE-NFAs are placed onto a two-dimensional staged pipeline, allowing scalability to thousands of RE-NFAs with linear area increase and little clock rate penalty due to scaling. On a PC with a 2 GHz Athlon64 processor and 2 GB memory, our prototype software constructs hundreds of RE-NFAs used by Snort in less than 10 seconds. We also designed a benchmark generator which can produce RE-NFAs with configurable pattern complexity parameters, including state count, state fan-in, loop-back and feed-forward distances. Several regular expressions with various complexities are used to test the performance of our RE-NFA construction software.
Automatic re-contouring in 4D radiotherapy
International Nuclear Information System (INIS)
Lu, Weiguo; Olivera, Gustavo H; Chen, Quan; Chen, Ming-Li; Ruchala, Kenneth J
2006-01-01
Delineating regions of interest (ROIs) on each phase of four-dimensional (4D) computed tomography (CT) images is an essential step for 4D radiotherapy. The requirement of manual phase-by-phase contouring prohibits the routine use of 4D radiotherapy. This paper develops an automatic re-contouring algorithm that combines techniques of deformable registration and surface construction. ROIs are manually contoured slice-by-slice in the reference phase image. A reference surface is constructed based on these reference contours using a triangulated surface construction technique. The deformable registration technique provides the voxel-to-voxel mapping between the reference phase and the test phase. The vertices of the reference surface are displaced in accordance with the deformation map, resulting in a deformed surface. The new contours are reconstructed by cutting the deformed surface slice-by-slice along the transversal, sagittal or coronal direction. Since both the inputs and outputs of our automatic re-contouring algorithm are contours, it is relatively easy to cope with any treatment planning system. We tested our automatic re-contouring algorithm using a deformable phantom and 4D CT images of six lung cancer patients. The proposed algorithm is validated by visual inspections and quantitative comparisons of the automatic re-contours with both the gold standard segmentations and the manual contours. Based on the automatic delineated ROIs, changes of tumour and sensitive structures during respiration are quantitatively analysed. This algorithm could also be used to re-contour daily images for treatment evaluation and adaptive radiotherapy
Rooney, Alan D.; Selby, David; Houzay, Jean-Pierre; Renne, Paul R.
2010-01-01
The exceptionally well-preserved sedimentary rocks of the Taoudeni basin, NW Africa represent one of the world's most widespread (> 1 M km 2) Proterozoic successions. Hitherto, the sedimentary rocks were considered to be Mid Tonian based on Rb-Sr illite and glauconite geochronology of the Atar Group. However, new Re-Os organic-rich sediment (ORS) geochronology from two drill cores indicates that the Proterozoic Atar Group is ˜ 200 Ma older (1107 ± 12 Ma, 1109 ± 22 Ma and 1105 ± 37 Ma). The Re-Os geochronology suggests that the Rb-Sr geochronology records the age of diagenetic events possibly associated with the Pan African collision. The new Re-Os geochronology data provide absolute age constraints for recent carbon isotope chemostratigraphy which suggests that the Atar Group is Mesoproterozoic and not Neoproterozoic. The new Re-Os ORS geochronology supports previous studies that suggest that rapid hydrocarbon generation (flash pyrolysis) from contact metamorphism of a dolerite sill does not significantly disturb the Re-Os ORS systematics. Modelled contact conditions suggest that the Re-Os ORS systematics remain undisturbed at ˜ 650 °C at the sill/shale contact and ≥ 280 °C 20 m from the sill/shale contact. Moreover, the Re-Os geochronology indicates that the West African craton has a depositional history that predates 1100 Ma and that ORS can be correlated on a basin-wide scale. In addition, the Re-Os depositional ages for the ORS of the Taoudeni basin are comparable to those of ORS from the São Francisco craton, suggesting that these cratons are correlatable. This postulate is further supported by identical Os i values for the Atar Group and the Vazante Group of the São Francisco craton.
Kinetic Monte-Carlo modeling of hydrogen retention and re-emission from Tore Supra deposits
International Nuclear Information System (INIS)
Rai, A.; Schneider, R.; Warrier, M.; Roubin, P.; Martin, C.; Richou, M.
2009-01-01
A multi-scale model has been developed to study the reactive-diffusive transport of hydrogen in porous graphite [A. Rai, R. Schneider, M. Warrier, J. Nucl. Mater. (submitted for publication). http://dx.doi.org/10.1016/j.jnucmat.2007.08.013.]. The deposits found on the leading edge of the neutralizer of Tore Supra are multi-scale in nature, consisting of micropores with typical size lower than 2 nm (∼11%), mesopores (∼5%) and macropores with a typical size more than 50 nm [C. Martin, M. Richou, W. Sakaily, B. Pegourie, C. Brosset, P. Roubin, J. Nucl. Mater. 363-365 (2007) 1251]. Kinetic Monte-Carlo (KMC) has been used to study the hydrogen transport at meso-scales. Recombination rate and the diffusion coefficient calculated at the meso-scale was used as an input to scale up and analyze the hydrogen transport at macro-scale. A combination of KMC and MCD (Monte-Carlo diffusion) method was used at macro-scales. Flux dependence of hydrogen recycling has been studied. The retention and re-emission analysis of the model has been extended to study the chemical erosion process based on the Kueppers-Hopf cycle [M. Wittmann, J. Kueppers, J. Nucl. Mater. 227 (1996) 186].
Production of carrier-free 188Re in the past ten years in Taiwan
International Nuclear Information System (INIS)
Bor-Tsung Hsieh; Institute of Nuclear Energy Research, Taiwan; Wan-Yu Lin; Tsai-Yueh Luo; Kai-Yuan Cheng
2007-01-01
Twenty clinical scale alumina-based 188 W/ 188 Re generators and carrier-free 188 Re has been produced at the Institute of Nuclear Energy Research (INER-Taiwan) for over ten years. 2845.6 GBq (76.9 Ci) of 188 Re-perrhenate solution has been eluted from generators during the past ten years. We have used the harvesting 188 Re solution for labeling radiopharmaceuticals, such as 188 Re-HEDP, 188 Re-MDP, 188 Re-microsphere, 188 Relipiodol, and 188 Re-sulfur colloid, etc. The average eluting yield of 188 Re is 78.6±5.8% that was investigated at 1115 harvesting times from 20 generators. Each generator can be used more than six months but the Millipore needs to be changed every two months for smooth harvesting and high yield of 188 Re solution. (author)
42 CFR 405.213 - Re-evaluation of a device categorization.
2010-10-01
... 42 Public Health 2 2010-10-01 2010-10-01 false Re-evaluation of a device categorization. 405.213... Decisions That Relate to Health Care Technology § 405.213 Re-evaluation of a device categorization. (a... experimental/investigational (Category A) may request re-evaluation of the categorization decision. (2) A...
(Re)Discovering University Autonomy
DEFF Research Database (Denmark)
This book challenges traditional approach to university autonomy which is based on four pillars: organisational, financial, human resource, and academic. The main thesis is that a fuller understanding of university autonomy can only be obtained through a more holistic view of the complex inter-re...
Goal-Equivalent Secure Business Process Re-engineering
DEFF Research Database (Denmark)
Acosta, Hugo Andrés Lópes; Massacci, Fabio; Zannone, Nicola
2008-01-01
that they are somehow “equivalent”. In this paper we propose a method for passing from SI*, a modeling language for capturing and modeling functional, security, and trust organizational and system requirements, to business process specifications and vice versa. In particular, starting from an old secure business......The introduction of information technologies in health care systems often requires to re-engineer the business processes used to deliver care. Obviously, the new and re-engineered processes are observationally different and thus we cannot use existing model-based techniques to argue...... process, we reconstruct the functional and security requirements at organizational level that such a business process was supposed to meet (including the trust relations that existed among the members of the organization). To ensure that the re-engineered business process meets the elicited requirements...
Summary of Country Reports Submitted to the Energy Efficiency Working Party: October 2011
Energy Technology Data Exchange (ETDEWEB)
NONE
2011-07-01
The purpose of this summary report is to highlight energy efficiency policy action and planning in IEA member countries submited to the Energy Efficiency Working Party (EEWP) from March to September 2011.
Privacy Act System of Records: Invention Reports Submitted to the EPA, EPA-38
Learn about the Invention Reports Submitted to the EPA System, including who is covered in the system, the purpose of data collection, routine uses for the system's records, and other security procedures.
Equilibrium polymerization models of re-entrant self-assembly
Dudowicz, Jacek; Douglas, Jack F.; Freed, Karl F.
2009-04-01
As is well known, liquid-liquid phase separation can occur either upon heating or cooling, corresponding to lower and upper critical solution phase boundaries, respectively. Likewise, self-assembly transitions from a monomeric state to an organized polymeric state can proceed either upon increasing or decreasing temperature, and the concentration dependent ordering temperature is correspondingly called the "floor" or "ceiling" temperature. Motivated by the fact that some phase separating systems exhibit closed loop phase boundaries with two critical points, the present paper analyzes self-assembly analogs of re-entrant phase separation, i.e., re-entrant self-assembly. In particular, re-entrant self-assembly transitions are demonstrated to arise in thermally activated equilibrium self-assembling systems, when thermal activation is more favorable than chain propagation, and in equilibrium self-assembly near an adsorbing boundary where strong competition exists between adsorption and self-assembly. Apparently, the competition between interactions or equilibria generally underlies re-entrant behavior in both liquid-liquid phase separation and self-assembly transitions.
188Re(V) Nitrido Radiopharmaceuticals for Radionuclide Therapy.
Boschi, Alessandra; Martini, Petra; Uccelli, Licia
2017-01-19
The favorable nuclear properties of rhenium-188 for therapeutic application are described, together with new methods for the preparation of high yield and stable 188 Re radiopharmaceuticals characterized by the presence of the nitride rhenium core in their final chemical structure. 188 Re is readily available from an 188 W/ 188 Re generator system and a parallelism between the general synthetic procedures applied for the preparation of nitride technetium-99m and rhenium-188 theranostics radiopharmaceuticals is reported. Although some differences between the chemical characteristics of the two metallic nitrido fragments are highlighted, it is apparent that the same general procedures developed for the labelling of biologically active molecules with technetium-99m can be applied to rhenium-188 with minor modification. The availability of these chemical strategies, that allow the obtainment, in very high yield and in physiological condition, of 188 Re radiopharmaceuticals, gives a new attractive prospective to employ this radionuclide for therapeutic applications.
188Re(V) Nitrido Radiopharmaceuticals for Radionuclide Therapy
Boschi, Alessandra; Martini, Petra; Uccelli, Licia
2017-01-01
The favorable nuclear properties of rhenium-188 for therapeutic application are described, together with new methods for the preparation of high yield and stable 188Re radiopharmaceuticals characterized by the presence of the nitride rhenium core in their final chemical structure. 188Re is readily available from an 188W/188Re generator system and a parallelism between the general synthetic procedures applied for the preparation of nitride technetium-99m and rhenium-188 theranostics radiopharmaceuticals is reported. Although some differences between the chemical characteristics of the two metallic nitrido fragments are highlighted, it is apparent that the same general procedures developed for the labelling of biologically active molecules with technetium-99m can be applied to rhenium-188 with minor modification. The availability of these chemical strategies, that allow the obtainment, in very high yield and in physiological condition, of 188Re radiopharmaceuticals, gives a new attractive prospective to employ this radionuclide for therapeutic applications. PMID:28106830
Preparation of 186Re complexes of dimercaptosuccinic acid hydroxy ethylidine diphosphonate
International Nuclear Information System (INIS)
Kothari, K.; Pillai, M.R.A.; Unni, P.R.; Mathakar, A.R.; Shimpi, H.H.; Noronha, O.P.D.; Samuel, A.M.
1998-01-01
99m Tc(V)-DMSA and 99m Tc-HEDP are widely used for imaging medullary carcinoma and bone, respectively. 186 Re-HEDP is now well established as a therapeutic radiopharmaceutical for palliation of pain due to bone metastases. It is expected that 186/188 Re(V)-DMSA could find application for treating medullary carcinoma. In the present paper we report the work carried out for the preparation of 186 Re complexes of DMSA and HEDP and their bio-distribution studies in Wistar rats. 186 Re was prepared by irradiation of natural Re metal at a flux of 3x10 13 neutrons/cm 2 /s for seven days and processed after a cooling period of four days. The specific activity of 186 Re formed was ∼35 mCi/mg. Complexes with RC purity >98% could be prepared in both the cases by carefully optimizing the reaction conditions. Bio-distribution studies carried out in rats revealed that pharmacological behaviour of 186 Re(V)-DMSA was similar to that of 99m Tc(V)-DMSA. 186 Re-HEDP showed a bone uptake of ∼ 30% at 3 h post injection which remained almost constant for 48 h. (author)
International Nuclear Information System (INIS)
Oliveira, Jetro Pereira de; Batista, Delano Valdivino Santos; Bardella, Lucia Helena; Carvalho, Arnaldo Rangel
2009-01-01
Objective: The present study was aimed at developing a thermoluminescent dosimetric system capable of assessing the doses delivered to the rectum of patients submitted to high-dose-rate brachytherapy for uterine cervix cancer. Materials and methods: LiF:Mg,Ti,Na powder was the thermoluminescent material utilized for evaluating the rectal dose. The powder was divided into small portions (34 mg) which were accommodated in a capillary tube. This tube was placed into a rectal probe that was introduced into the patient's rectum. Results: The doses delivered to the rectum of six patients submitted to high-dose-rate brachytherapy for uterine cervix cancer evaluated by means of thermoluminescent dosimeters presented a good agreement with the planned values based on two orthogonal (anteroposterior and lateral) radiographic images of the patients. Conclusion: The thermoluminescent dosimetric system developed in the present study is simple and easy to be utilized as compared to other rectal dosimetry methods. The system has shown to be effective in the evaluation of rectal doses in patients submitted to high-dose-rate brachytherapy for uterine cervix cancer. (author)
A theoretical approach to the re-suspension factor
Directory of Open Access Journals (Sweden)
Magnoni M.
2012-04-01
Full Text Available The atmospheric re-suspension of radionuclides is a well-known phenomenon that consists in the re-injection into the atmosphere of previously deposited radioactivity. The process is driven by the action of wind on surfaces and can act as an additional source of radiation exposure by inhalation, after the deposition has finished. It is thus defined as the re-suspension factor, a parameter K generally considered as a time depending function and defined as the ratio of Ca, the volumetric air activity concentration (Bq m−3 and I0 (Bq m−2, the radioactivity deposition at time zero. The re-suspension factor concept is very useful in radioprotection in order to estimate the inhalation of radionuclides re-suspended from contaminated surfaces when direct atmospheric measurements are lacking or difficult to perform. However, the choice of the proper values of K is usually not a simple task, being quite site-specific and related to the meteorological, géomorphologie and environmental characteristics of the area to be studied. Moreover, several investigations showed clearly that the values of K are a decreasing function of time. For that reason, K values span several orders of magnitude: typical values in the range 10−5–10−10 m−1 are reported in literature for different environmental conditions and time elapsed since the deposition event. The current available models for the re-suspension factor are based on empirical formulas whose parameters are highly site dependent and cannot easily be related to some physical quantity. In this paper a simple physical model for the re-suspension factor is proposed and tested with available environmental radioactivity data (137Cs, collected since 1986 (Chernobyl fallout. The new model not only allows a satisfactory description of the experimental data like even the current empirical models do, but it is also able to connect the K values to quantities with a physical meaning (such as, for example a diffusion
Fort, Douglas J; Mathis, Michael; Fort, Chelsea E; Fort, Hayley M; Bacon, Jamie P
2015-06-01
A modified tier 1 Endocrine Disruptor Screening Program (EDSP) 21-d fish short-term reproduction assay (FSTRA) was used to evaluate the effects of sediment exposure from freshwater and brackish ponds in Bermuda on reproductive fecundity and endocrine function in fathead minnow (Pimephales promelas) and killifish (Fundulus heteroclitus). Reproductively active male and female fish were exposed to control sediment and sediment from 2 freshwater ponds (fathead minnow) and 2 marine ponds (killifish) contaminated with polyaromatic hydrocarbons and metals via flow-through exposure for 21 d. Reproductive fecundity was monitored daily. At termination, the status of the reproductive endocrine system was assessed by the gonadosomatic index, gonadal histology, plasma steroids (estrogen [E2], testosterone [T], and 11-ketotestosterone [11-KT]), steroidogenic enzymes (aromatase and combined 3β/17β -hydroxysteroid dehydrogenase [3β/17β-HSD]), and plasma vitellogenin (VTG). Decreased reproductive fecundity, lower male body weight, and altered endocrinological measures of reproductive status were observed in both species. Higher plasma T levels in female minnows and 11-KT levels in both male and female minnows and female killifish exposed to freshwater and brackish sediments, respectively. Decreased female E2 and VTG levels and gonadal cytochrome P19 (aromatase) activity were also found in sediment exposed females from both species. No effect on female 3β/17β-HSD activity was found in either species. The FSTRA provided a robust model capable of modification to evaluate reproductive effects of sediment exposure in fish. © 2015 SETAC.
77 FR 42314 - Proposed Data Collections Submitted for Public Comment and Recommendations
2012-07-18
... characteristics of the work environment, such as the norms, rules, and common understandings that influence employees' perceptions of the importance that the organization places on safety. NIOSH requests OMB approval...] Proposed Data Collections Submitted for Public Comment and Recommendations In compliance with the...
75 FR 33614 - Adequacy Status of the Submitted 2009 PM2.5
2010-06-14
... that transportation activities will not produce new air quality violations, worsen existing violations... the Submitted 2009 PM 2.5 Motor Vehicle Emission Budgets for Transportation Conformity Purposes for..., PM 2.5 nonattainment areas to be adequate for transportation conformity purposes. The transportation...
The effects of vascularized tissue transfer on re-irradiation
International Nuclear Information System (INIS)
Narayan, K.; Ashton, M.W.; Taylor, G.I.
1996-01-01
Purpose: Nowadays, radical re-irradiation of locally recurrent squamous cell carcinoma is being increasingly tried. The process usually involves some form of surgical excision and vascularized tissue transfer followed by re-irradiation. The aim of this study was to examine the extent of protection from the effects of re-irradiation provided by vascularized tissue transfer. Methods and Materials: One hundred Sprague Dawley rats had their left thighs irradiated to a total dose of 72Gy in 8 fractions, one fraction per day, 5 days per week. The rats were then divided into two groups: At 4 months, one half of the rats had 50% of their quadriceps musculature excised and replaced with a vascularized non-irradiated rectus abdominous myocutaneous flap. The other group served as the control. Six months following the initial radiotherapy all rats were then re-irradiated with either 75 or 90% of the original dose. Incidence of necrosis and the extent of necrosis was measured. Microvasculature of control, transplanted muscle and recipient site was studied by micro-corrosion cast technique and histology of cast specimen. tissues were sampled at pre-irradiation and at 2, 6 and 12 months post re-irradiation. Microvascular surface area was measured from the histology of cast specimen. Results: Necrosis in the control group was clinically evident at 6 weeks post re irradiation and by 10 months all rats developed necrosis. Forty per cent of the thigh that received 75% of the original dose on re-irradiation did not develop any necrosis by 13 months. Other groups developed necrosis to variable extents, however a rim of tissue around the graft always survived. The average thickness of surviving tissue was 9mm. (range being 4-25 mm). None of the transferred flap nor re-irradiated recipient quadriceps developed necrosis. Conclusion: 1. Transplanted rectus abdominus myocutaneous flap and undisturbed muscle have similar radiation tolerance. 2. Vascularized myocutaneous flap offers
Synthesis of ReN3 Thin Films by Magnetron Sputtering
Directory of Open Access Journals (Sweden)
G. Soto
2014-01-01
Full Text Available In this work ReNx films were prepared by reactive magnetron sputtering at room temperature and deposited on a silicon wafer. It was found that the diffractograms of the nitrogen-rich rhenium film are consistent with those produced by high-pressure high-temperature methods, under the assumption that the film is oriented on the substrate. Using density functional calculations it was found that the composition of this compound could be ReN3, instead of ReN2, as stated on previous works. The ReN3 compound fits in the Ama2 (40 orthorhombic space group, and due to the existence of N3 anions between Re layers it should be categorized as an azide. The material is exceptionally brittle and inherently unstable under indentation testing.
Solubility and superconductivity in RE(Ba2-xREx)Cu3O7+δ (RE = Nd, Sm, Eu, Gd, Dy)
International Nuclear Information System (INIS)
Zhang, K.; Dabrowski, B.; Segre, C.U.; Hinks, D.G.; Schuller, I.K.; Jorgensen, J.D.; Slaski, M.
1987-10-01
Solid solutions of RE(Ba 2-x RE x )Cu 3 O 7- δ (RE=Nd,Sm,Eu,Gd,Dy) for x=0 to x=0.5 have been investigated. X-ray and resistivity measurements show that there exists a solid solution region, through which, the structure changes from orthorhombic to tetragonal and the superconducting properties are depressed. The solubility limits depend strongly on the size of the rare-earth ion, with the smallest (Dy) showing no appreciable solubility. The superconducting transition temperature versus x for all of the rare-earth ion substitutions falls on a universal curve, indicating that the Ba sites are extremely ionic and magnetically isolated. 20 refs., 4 figs
Staged abdominal re-operation for abdominal trauma.
Taviloglu, Korhan
2003-07-01
To review the current developments in staged abdominal re-operation for abdominal trauma. To overview the steps of damage control laparotomy. The ever increasing importance of the resuscitation phase with current intensive care unit (ICU) support techniques should be emphasized. General surgeons should be familiar to staged abdominal re-operation for abdominal trauma and collaborate with ICU teams, interventional radiologists and several other specialties to overcome this entity.
Leadership processes for re-engineering changes to the health care industry.
Guo, Kristina L
2004-01-01
As health care organizations seek innovative ways to change financing and delivery mechanisms due to escalated health care costs and increased competition, drastic changes are being sought in the form of re-engineering. This study discusses the leader's role of re-engineering in health care. It specifically addresses the reasons for failures in re-engineering and argues that success depends on senior level leaders playing a critical role. Existing studies lack comprehensiveness in establishing models of re-engineering and management guidelines. This research focuses on integrating re-engineering and leadership processes in health care by creating a step-by-step model. Particularly, it illustrates the four Es: Examination, Establishment, Execution and Evaluation, as a comprehensive re-engineering process that combines managerial roles and activities to result in successfully changed and reengineered health care organizations.
Synthesis of a '4+1' Re(V) complex from Re(III), and its ...
African Journals Online (AJOL)
bis(2-hydroxybenzyl)-2-(2-aminoethyl)dimethylamine) was prepared from the oxidation of [ReCl3(MeCN)(PPh3)2] by dioxygen in the presence of H2had in ethanol. This reaction was done under reflux conditions for a relatively short reaction ...
188Re labeling and biodistribution of magnetic nanoparticles for the tumor targeting
International Nuclear Information System (INIS)
Li Guiping; Zhang Hui; Wang Yongxian; Zhang Chunfu
2006-01-01
Objective: To prepare 188 Re labeled monoclonal antibody (Herceptin)-coated magnetic nanoparticles for tumor targeting and to study its biodistribution in mice. Methods: Herceptin and histidine were covalently linked to the amine group upon silica-coated magnetic nanoparticles modified by N-[3-(trimethyoxysilyl)prowl]-ethylenediamine using glutaraldehyde method. The Herceptin-coated magnetic nanoparticles and Herceptin were radiolabeled with 188 Re by a direct labelling method, whereas the histidine-coated magnetic nanoparticles was radiolabeled with 188 Re using fac-[ 188 Re(CO) 3 (H 2 0) 3 ] + as a precursor. The labelling efficiency and immunoreactivity as well as labelling stability were determined. Also, the biodistribution of 188 Re-magnetic and 188 Re-Herceptin-magnetic nanoparticles were observed in mice. Results: Herceptin-coated magnetic nanoparticles was characterized by transmission electron microscope (TEM) with diameter about 60 nm, while histidine-coated magnetic nanoparticles about 30 nm. The labeling efficiency for 188 Re-Herceptin, 188 Re-magnetic nanoparticles and 188 Re-Herceptin-magnetic nanoparticles were all > 90% and had a better stability in vitro. The immunoreactivity of Herceptin linked to magnetic nanoparticles was still high. The biodistribution in mice was shown that 188 Re-magnetic nanoparticles and 188 Re-Herceptin- magnetic nanoparticles had higher radioactivity levels in blood. Magnetic nanoparticles with diameter of 30 or 60 nm had a long half-life in blood stream and were accumulated in liver. Conclusion: The efficiency and stability of labelling Herceptin-coated magnetic nanoparticles and labelling magnetic nanoparticles with 188 Re are suitable for in vivo study in tumor-beating nude mice models. (authors)
International Nuclear Information System (INIS)
Seidel, Stefan; Rodewald, Ute C.; Poettgen, Rainer; Janka, Oliver
2017-01-01
Fourteen ternary gallides RE_4Rh_9Ga_5, RE_5Rh_1_2Ga_7 and RE_7Rh_1_8Ga_1_1 (RE=Y, La-Nd, Sm, Gd, Tb) were synthesized from the elements by arc-melting, followed by different annealing sequences either in muffle or induction furnaces. The samples were characterized through Guinier powder patterns and the crystal structures of Ce_4Rh_9Ga_5, Ce_5Rh_1_2Ga_7, Ce_7Rh_1_8Ga_1_1, Nd_5Rh_1_0_._4_4_(_4_)Ga_8_._5_6_(_4_), Nd_4Rh_9Ga_5 and Gd_4Rh_9Ga_5 were refined from single crystal X-ray diffractometer data. The new gallides are the n=2, 3 and 5 members of the RE_2_+_n Rh_3_+_3_n Ga_1_+_2_n structure series in the Parthe intergrowth concept. The slabs of these intergrowth structures derive from the cubic Laves phase MgCu_2 (Mg_2Ni_3Si as ternary variant) and CaCu_5 (CeCo_3B_2 as ternary variant). Only the Nd_5Rh_1_0_._4_4_(_4_)Ga_8_._5_6_(_4_) crystal shows Rh/Ga mixing within the Laves type slabs. Magnetic susceptibility measurements reveal Pauli paramagnetism for Y_4Rh_9Ga_5 and Curie-Weiss paramagnetism for Gd_4Rh_9Ga_5 and Tb_4Rh_9Ga_5. Low-temperature data show ferromagnetic ordering at T_C=78.1 (Gd_4Rh_9Ga_5) and 55.8 K (Tb_4Rh_9Ga_5).
Regional Energy Deployment System (ReEDS)
Energy Technology Data Exchange (ETDEWEB)
Short, W.; Sullivan, P.; Mai, T.; Mowers, M.; Uriarte, C.; Blair, N.; Heimiller, D.; Martinez, A.
2011-12-01
The Regional Energy Deployment System (ReEDS) is a deterministic optimization model of the deployment of electric power generation technologies and transmission infrastructure throughout the contiguous United States into the future. The model, developed by the National Renewable Energy Laboratory's Strategic Energy Analysis Center, is designed to analyze the critical energy issues in the electric sector, especially with respect to potential energy policies, such as clean energy and renewable energy standards or carbon restrictions. ReEDS provides a detailed treatment of electricity-generating and electrical storage technologies and specifically addresses a variety of issues related to renewable energy technologies, including accessibility and cost of transmission, regional quality of renewable resources, seasonal and diurnal generation profiles, variability of wind and solar power, and the influence of variability on the reliability of the electrical grid. ReEDS addresses these issues through a highly discretized regional structure, explicit statistical treatment of the variability in wind and solar output over time, and consideration of ancillary services' requirements and costs.
32 CFR 634.51 - Procedures for impoundment.
2010-07-01
... complete DD Form 2506 (Vehicle Impoundment Report) as a record of the actions taken. (i) An inventory... not be inventoried. Such articles should be opened only if necessary to identify the owner of the...
The collaborative ec project ReCosy - 16203
International Nuclear Information System (INIS)
Kienzler, Bernhard; Buckau, Gunnar
2009-01-01
The Collaborative Project (CP) ReCosy (Redox Controlling Systems) was established in 2008. It falls within the EURATOM program and is implemented within the European Commission's 7. Framework Program. Main objectives of CP ReCosy are the sound understanding of redox phenomena controlling the long-term release/retention of radionuclides in nuclear waste disposal and providing tools to apply the results to Performance Assessment/Safety Case. Although redox is not a new geochemical problem, different questions are still not resolved and thus raised by implementers and scientists. Radionuclide redox transformations on minerals are considered to be decisive scenarios in various FEP lists. 32 institutions from 13 European countries contribute to the 4-years CP by i) development of advanced analytical tools, ii) investigations of processes responsible for redox control (thermodynamically and kinetically controlled processes, surface reactions and microbial processes), iii) provision of required data on redox controlling processes, and iv) response of the disposal systems to external/internal disturbances. Systems which are investigated comprise simple very well defined ones under controlled laboratory conditions, complex laboratory systems, near-natural systems in the laboratory, real systems, and near-field systems controlled spent nuclear fuel. The scientific results of the CP ReCosy are reported during annual workshops (AW). The first AW took place in February 10-12, 2009. The scientific contributions underwent a peer review and are published in the form of workshop proceedings together with scientific-technical overview papers of the different project work packages. The present paper summarizes the main results obtained after the first year of ReCosy. The status during the project preparation phase of the CP ReCosy is published elsewhere. (authors)
Zinc allocation and re-allocation in rice
Stomph, Tjeerd Jan; Jiang, Wen; Van Der Putten, Peter E. L.; Struik, Paul C.
2014-01-01
Aims: Agronomy and breeding actively search for options to enhance cereal grain Zn density. Quantifying internal (re-)allocation of Zn as affected by soil and crop management or genotype is crucial. We present experiments supporting the development of a conceptual model of whole plant Zn allocation and re-allocation in rice. Methods: Two solution culture experiments using 70Zn applications at different times during crop development and an experiment on within-grain distribution of Zn are reported. In addition, results from two earlier published experiments are re-analyzed and re-interpreted. Results: A budget analysis showed that plant zinc accumulation during grain filling was larger than zinc allocation to the grains. Isotope data showed that zinc taken up during grain filling was only partly transported directly to the grains and partly allocated to the leaves. Zinc taken up during grain filling and allocated to the leaves replaced zinc re-allocated from leaves to grains. Within the grains, no major transport barrier was observed between vascular tissue and endosperm. At low tissue Zn concentrations, rice plants maintained concentrations of about 20 mg Zn kg−1 dry matter in leaf blades and reproductive tissues, but let Zn concentrations in stems, sheath, and roots drop below this level. When plant zinc concentrations increased, Zn levels in leaf blades and reproductive tissues only showed a moderate increase while Zn levels in stems, roots, and sheaths increased much more and in that order. Conclusions: In rice, the major barrier to enhanced zinc allocation towards grains is between stem and reproductive tissues. Enhancing root to shoot transfer will not contribute proportionally to grain zinc enhancement. PMID:24478788
75 FR 1790 - Proposed Data Collections Submitted for Public Comment and Recommendations
2010-01-13
... projected needs for training. NCHS also asks individual candidates for training to submit an application... respondents, including through the use of automated collection techniques or other forms of information... Statistics Training Application, (OMB No. 0920-0217 exp. 7/ 31/2010)--Extension--National Center for Health...
Re-Greening Ethiopia: History, Challenges and Lessons
Directory of Open Access Journals (Sweden)
Mulugeta Lemenih
2014-07-01
Full Text Available In Ethiopia, deforestation rates remain high and the gap between demand and domestic supply of forest products is expanding, even though government-initiated re-greening efforts began over a century ago. Today, over 3 million hectares (ha of degraded forest land are under area exclosure; smallholder plantations cover 0.8 million ha; and state-owned industrial plantations stagnate at under 0.25 million ha. This review captures experiences related to re-greening practices in Ethiopia, specifically with regards to area exclosure and afforestation and reforestation, and distills lessons regarding processes, achievements and challenges. The findings show that farmers and non-governmental organizations (NGOs are the main players, and that the private sector has so far played only a small role. The role of the government was mixed: supportive in some cases and hindering in others. The challenges of state- and NGO-led re-greening practices are: inadequate involvement of communities; poorly defined rehabilitation objectives; lack of management plans; unclear responsibilities and benefit-sharing arrangements; and poor silvicultural practices. The lessons include: a more active role for non-state actors in re-greening initiatives; more attention to market signals; devolution of management responsibility; clear definition of responsibilities and benefit-sharing arrangements; and better tenure security, which are all major factors to success.
Zhou, Hong-Bo; Li, Yu-Hao; Lu, Guang-Hong
Under high energy (14 eV) neutrons irradiation in nuclear fusion devoices, tungsten (W) will undergo transmutation to its near-neighbors in the periodic table, such as rhenium (Re), osmium (Os), etc. The transmutation elements Re and Os will precipitate and form new Re/Os-rich phase, and further significantly degrade the mechanical properties of W. Here, we have investigated the mechanism for the irradiation-induced Re/Os clustering in W using the first-principles method and thermodynamic models. It is found that there is strong attraction between Re/Os and self-interstitial atom (SIA) in W. The SIA can be easily trapped by Re/Os once overcoming a low energy barrier, and form W-Re/Os complex dumbbell. The diffusion energy barrier of W-Re/Os is much lower than that of Re/Os diffusing via mono-vacancy or even vacancy clusters. Further, the W-Re/Os can be easily trapped by the substitutional Re/Os atoms, and form high stable Re-Re/Os-Os dumbbell structure. Most importantly, the Re-Re/Os-Os dumbbell can serve as trapping centre for subsequent interstitial-Re/Os, leading to the growth of Re/Os-rich clusters in W. Our finding suggests an interstitial-mediated mechanism for the irradiation-induced Re/Os clustering in W. This research is supported by the National Magnetic Confinement Fusion Program with Grant No. 2013GB109002, and the National Natural Science Foundation of China with Grant No. 11675011.
EPA RE-Powering Screening Shapefile
U.S. Environmental Protection Agency — The U.S. Environmental Protection Agency (EPA) Office of Land and Emergency Management (OLEM) Center for Program Analysis (CPA) initiated the RE-Powering America’s...
Indides RE{sub 3}T{sub 2}In{sub 4} (RE = Y, Gd-Tm, Lu; T = Ni, Ru, Rh) with a ZrNiAl superstructure
Energy Technology Data Exchange (ETDEWEB)
Heying, Birgit; Niehaus, Oliver; Rodewald, Ute C.; Poettgen, Rainer [Univ. Muenster (Germany). Inst. fuer Anorganische und Analytische Chemie
2016-07-01
Three series of rare earth-transition metal-indides RE{sub 3}T{sub 2}In{sub 4} (RE=Y, Gd-Tm, Lu; T=Ni, Ru, Rh) were synthesized from arc-melted RE{sub 3}T{sub 2} precursor compounds and indium tear shot in sealed niobium ampoules using different annealing sequences. The new indides crystallize with the hexagonal Lu{sub 3}Co{sub 2}In{sub 4}-type structure, space group P anti 6. All samples were characterized on the basis of Guinier powder patterns and six structures were refined from single crystal X-ray diffractometer data. The RE{sub 3}T{sub 2}In{sub 4} structures are derived from the ZrNiAl type through RE/In ordering, paralleled by a symmetry reduction from P anti 62m to P anti 6. This induces twinning for some of the investigated crystals. The main crystal chemical motifs of the RE{sub 3}T{sub 2}In{sub 4} structures are trigonal prisms of rare earth, respectively indium atoms that are filled by the transition metals.
First paper from Tevatron Run II submitted by CDF collaboration
2003-01-01
"Scientists of the Collider Detector at Fermilab submitted today (March 19) the first scientific publication of Collider Run II to the science journal Physical Review D. The paper titled "Measurement of the Mass Difference m(Ds+)-m(D+) at CDF II" summarizes the results of an analysis carried out by CDF scientists Christoph Paus and Ivan Furic, MIT, describing the mass measurement of particles containing charm quarks" (1 page).
Liflyand, E.
2012-01-01
We study an extension to Fourier transforms of the old problem on absolute convergence of the re-expansion in the sine (cosine) Fourier series of an absolutely convergent cosine (sine) Fourier series. The results are obtained by revealing certain relations between the Fourier transforms and their Hilbert transforms.
Re-discovering indigenous knowledge – Ulwazi Lwemveli for ...
African Journals Online (AJOL)
Therefore, the imperative to re-discover and re-store IK cannot be underestimated since building on this knowledge is particularly effective in helping to reach those living in rural communities. This knowledge is often the main asset they control, and certainly one with which they are more familiar. The case studies discussed ...
National Oceanic and Atmospheric Administration, Department of Commerce — Microfiche publication of the Mississippi Delta Bight Studies, Offshore Primary Production (R/E-5), Louisiana Sea Grant Program, was submitted by R.E. Turner and...
Fang, CM; Wiegers, GA; Haas, C; deGroot, RA
1997-01-01
The transition-metal dichalcogenides ReX2 (X = Sor Se) and TcS2 with a d(3) electron configuration have distorted; CdCl2 and Cd(OH)(2) structures, respectively, with the Re(Tc) atoms in each layer forming parallelogram-shaped connected clusters (diamond chain). Ab-initio band-structure calculations
Third-Party Evaluation of Petro Tex Hydrocarbons, LLC, ReGen Lubricating Oil Re-refining Process
Energy Technology Data Exchange (ETDEWEB)
Compere, A L [ORNL; Griffith, William {Bill} L [ORNL
2009-04-01
This report presents an assessment of market, energy impact, and utility of the PetroTex Hydrocarbons, LLC., ReGen process for re-refining used lubricating oil to produce Group I, II, and III base oils, diesel fuel, and asphalt. PetroTex Hydrocarbons, LLC., has performed extensive pilot scale evaluations, computer simulations, and market studies of this process and is presently evaluating construction of a 23 million gallon per year industrial-scale plant. PetroTex has obtained a 30 acre site in the Texas Industries RailPark in Midlothian Texas. The environmental and civil engineering assessments of the site are completed, and the company has been granted a special use permit from the City of Midlothian and air emissions permits for the Texas Commission on Environmental Quality.
Energy Technology Data Exchange (ETDEWEB)
Forbes, Scott [Department of Chemistry and Chemical Biology, McMaster University, 1280 Main Street West, Hamilton, Ontario L8S 4M1 (Canada); Yuan, Fang [Department of Chemistry and Chemical Biology, McMaster University, 1280 Main Street West, Hamilton, Ontario L8S 4M1 (Canada); Institute for Materials Science, 1-1 Namiki, Tsukuba, Ibaraki 305-0044 (Japan); Kosuda, Kosuke; Kolodiazhnyi, Taras [Institute for Materials Science, 1-1 Namiki, Tsukuba, Ibaraki 305-0044 (Japan); Mozharivskyj, Yurij, E-mail: mozhar@mcmaster.ca [Department of Chemistry and Chemical Biology, McMaster University, 1280 Main Street West, Hamilton, Ontario L8S 4M1 (Canada)
2016-10-15
The Ca{sub 2}RE{sub 7}Pn{sub 5}O{sub 5} phases (RE=Pr, Sm, Gd, Dy; Pn=Sb, Bi) were successfully prepared from high temperature reactions at 1225–1300 °C. These phases maintain the same structure types as the parent RE{sub 9}Pn{sub 5}O{sub 5} phases, except for a Ca/RE mixing. The study and preparation of these phases was motivated by the desire to shift the metallic type properties of the parent RE{sub 9}Pn{sub 5}O{sub 5} phases to a level more suitable for thermoelectric applications. Electrical resistivity measurements performed on pure, bulk samples indicated all phases to be narrow band gap semiconductors or semimetals, supporting the charge balanced electron count of the Ca{sub 2}RE{sub 7}Pn{sub 5}O{sub 5} composition. Unfortunately, all samples are too electrically resistive for any potential usage as thermoelectrics. Electronic band structure calculations performed on idealized RE{sub 9}Pn{sub 5}O{sub 5} structures revealed the presence of a pseudogap at the Fermi level, which is consistent with the observed electrical resistivity and Seebeck coefficient behavior. - Graphical abstract: Ca substitution in RE{sub 9}Pn{sub 5}O{sub 5} leads to charge-balanced Ca{sub 2}RE{sub 7}Pn{sub 5}O{sub 5} phases with semiconducting or semimetallic properties. - Highlights: • The RE{sub 9}Pn{sub 5}O{sub 5} structure may be stabilized with calcium substitution in the form of Ca{sub 2}RE{sub 7}Pn{sub 5}O{sub 5}. • The Ca{sub 2}RE{sub 7}Pn{sub 5}O{sub 5} phases maintain the parent P 4/n structure, albeit with Ca/RE mixing. • The Ca{sub 2}RE{sub 7}Sb{sub 5}O{sub 5} phases behave as semiconductors while Ca{sub 2}RE{sub 7}Bi{sub 5}O{sub 5} are semimetals with electron-electron correlations. • Electronic structure calculations yield a semimetal-like density of states for both Ca{sub 2}RE{sub 7}Sb{sub 5}O{sub 5} and Ca{sub 2}RE{sub 7}Bi{sub 5}O{sub 5}.
41 CFR 301-52.7 - When must I submit my travel claim?
2010-07-01
... travel claim? 301-52.7 Section 301-52.7 Public Contracts and Property Management Federal Travel Regulation System TEMPORARY DUTY (TDY) TRAVEL ALLOWANCES ARRANGING FOR TRAVEL SERVICES, PAYING TRAVEL EXPENSES, AND CLAIMING REIMBURSEMENT 52-CLAIMING REIMBURSEMENT § 301-52.7 When must I submit my travel...
76 FR 28192 - Petition for Rulemaking Submitted by the Nuclear Energy Institute
2011-05-16
... NUCLEAR REGULATORY COMMISSION 10 CFR Part 26 [Docket No. PRM-26-5; NRC-2010-0304] Petition for Rulemaking Submitted by the Nuclear Energy Institute AGENCY: Nuclear Regulatory Commission. ACTION: Petition... Anthony R. Pietrangelo, on behalf of the Nuclear Energy Institute (NEI), the petitioner, in the planned...
15 CFR 711.7 - Where to submit declarations, reports and advance notifications.
2010-01-01
... 15 Commerce and Foreign Trade 2 2010-01-01 2010-01-01 false Where to submit declarations, reports and advance notifications. 711.7 Section 711.7 Commerce and Foreign Trade Regulations Relating to Commerce and Foreign Trade (Continued) BUREAU OF INDUSTRY AND SECURITY, DEPARTMENT OF COMMERCE CHEMICAL...
2010-04-01
... submitted to and approved or not disapproved by the Secretary of Agriculture. 1.54 Section 1.54 Commodity... Secretary of Agriculture. Notwithstanding any provision of these rules, any bylaw, rule, regulation, or resolution of a contract market that was submitted to the Secretary of Agriculture pursuant or § 1.38(a) or...
Weight gain in newborns submitted to skin-to-skin contact
Directory of Open Access Journals (Sweden)
Ana Karine da Costa Monteiro Souza
Full Text Available ABSTRACT Purpose: to compare the weight gain among newborns submitted to the kangaroo method and those not submitted to it, and to analyze the factors that may influence this gain: length of hospital stay, gestational age, corrected gestational age, birth weight, weight on the first day of follow-up, duration of gastric tube feeding, duration of oral feeding, and type of diet. Methods: a cross-sectional, quantitative study, with 86 newborns divided into two groups: group 1, with 48 neonates undergoing skin-to-skin contact and Group 2, 38 newborns who did not have this contact. Weights were recorded until hospital discharge. Results: a greater weight gain in Group 1, a longer time of hospitalization in Group 2, and a significant difference in weight gain related to the type of diet in Group 2. Conclusion: skin-to-skin contact has a positive influence on weight gain and length of hospital stay of newborns. The use of an infant formula does not influence weight gain for dyads who experienced skin-to-skin contact. Gestational age, corrected gestational age, birth weight, weight on the first day of follow-up, duration of gastric tube feeding, duration of oral feeding are not correlated with weight gain.
77 FR 70828 - Proposed Extension of Information Collection Requests Submitted for Public Comment
2012-11-27
... DEPARTMENT OF LABOR Employee Benefits Security Administration Proposed Extension of Information Collection Requests Submitted for Public Comment AGENCY: Employee Benefits Security Administration... collection requirements and provide the requested data in the desired format. The Employee Benefits Security...
78 FR 30333 - Proposed Extension of Information Collection Requests Submitted for Public Comment
2013-05-22
... DEPARTMENT OF LABOR Employee Benefits Security Administration Proposed Extension of Information Collection Requests Submitted for Public Comment AGENCY: Employee Benefits Security Administration... collection requirements and provide the requested data in the desired format. The Employee Benefits Security...
Re-injection accelerates groundwater clean up at Fernald, Fluor Fernald, Inc
International Nuclear Information System (INIS)
Dave Brettschneider; William Hertel; Ken Broberg
2000-01-01
A successful one year long, field scale demonstration of the use of groundwater re-infection at Fernald was recently completed bringing DOE one step closer to achieving an accelerated site remediation (DOE 2000). The demonstration marks the end of a several year effort to evaluate whether: re-injection could be conducted efficiently at Fernald, and if the approved aquifer remedy at Fernald would benefit by incorporating re-infection. Evaluation of re-injection technology involved not only technical considerations, but also participation and cooperation of regulators and stakeholders. The demonstration was considered to be unique in that it was integrated into the design of the current approved aquifer remedy and utilized the existing remediation infrastructure. Information collected during the demonstration indicated that re-injection wells could be operated efficiently at Fernald and that the current approved groundwater remedy should be modified to include the use of re-injection
Salvage Re-Irradiation for Recurrent Head and Neck Cancer
International Nuclear Information System (INIS)
Lee, Nancy; Chan, Kelvin; Bekelman, Justin E.; Zhung, Joanne; Mechalakos, James; Narayana, Ashwatha; Wolden, Suzanne; Venkatraman, Ennapadam S.; Pfister, David; Kraus, Dennis; Shah, Jatin; Zelefsky, Michael J.
2007-01-01
Purpose: To present a retrospective review of treatment outcomes for recurrent head and neck (HN) cancer patients treated with re-irradiation (re-RT) at a single medical center. Methods and Materials: From July 1996-September 2005, 105 patients with recurrent HN cancer underwent re-RT at our institution. Sites included were: the neck (n = 21), nasopharynx (n 21), paranasal sinus (n = 18), oropharynx (n = 16), oral cavity (n = 9), larynx (n = 10), parotid (n = 6), and hypopharynx (n = 4). The median prior RT dose was 62 Gy. Seventy-five patients received chemotherapy with their re-RT (platinum-based in the majority of cases). The median re-RT dose was 59.4 Gy. In 74 (70%), re-RT utilized intensity-modulated radiation therapy (IMRT). Results: With a median follow-up of 35 months, 18 patients were alive with no evidence of disease. The 2-year loco-regional progression-free survival (LRPFS) and overall survival rates were 42% and 37%, respectively. Patients who underwent IMRT, compared to those who did not, had a better 2-year LRPF (52% vs. 20%, p < 0.001). On multivariate analysis, non-nasopharynx and non-IMRT were associated with an increased risk of loco-regional (LR) failure. Patients with LR progression-free disease had better 2-year overall survival vs. those with LR failure (56% vs. 21%, p < 0.001). Acute and late Grade 3-4 toxicities were reported in 23% and 15% of patients. Severe Grade 3-4 late complications were observed in 12 patients, with a median time to development of 6 months after re-RT. Conclusions: Based on our data, achieving LR control is crucial for improved overall survival in this patient population. The use of IMRT predicted better LR tumor control. Future aggressive efforts in maximizing tumor control in the recurrent setting, including dose escalation with IMRT and improved chemotherapy, are warranted
Composition and local bonding in RE-Si-M-O-N (M=Mg, Al ; RE=La, Lu) glasses
Energy Technology Data Exchange (ETDEWEB)
Fouquet-Parry, V. [Service de Physique et de Chimie des Surfaces et des Interfaces, DSM/DRECAM/SPCSI, CEA Saclay, 91191 Gif sur Yvette Cedex (France); Paumier, F. [Laboratoire de Metallurgie Physique - UMR 6630 CNRS, Department of Materials Sciences, University of Poitiers (France); Guittet, M.J. [Service de Physique et de Chimie des Surfaces et des Interfaces, DSM/DRECAM/SPCSI, CEA Saclay, 91191 Gif sur Yvette Cedex (France); Gautier-Soyer, M. [Service de Physique et de Chimie des Surfaces et des Interfaces, DSM/DRECAM/SPCSI, CEA Saclay, 91191 Gif sur Yvette Cedex (France)], E-mail: mgautiersoyer@cea.fr; Satet, R.; Hoffmann, M.J. [Institut fuer Keramik im Maschinenbau, Universitaet Karlsruhe (Thailand), Haid-und-Neu-Strasse 7, D 76131 Karlsruhe (Germany); Becher, P.F.; Painter, G.S. [Metals and Ceramics Division, Oak Ridge National Laboratory, Oak Ridge, TN (United States)
2008-05-30
Two series of oxynitride glasses, RE-Si-Mg-O-N (M=Mg, Al ; RE=La, Lu), have been studied by X-Ray photoelectron spectroscopy (XPS). The oxygen 1s photoelectron lineshape reveals a striking difference depending on the rare earth, both in the Mg series and in the Al series. Specifically, the oxygen 1s photoelectron lines of the La doped glasses are broader than the ones of the Lu doped glasses. This result is an experimental evidence that Lu has a larger affinity for oxygen versus nitrogen than La, as theoretically predicted by the first-principles calculations by Painter et al.
Digital Intraoral Imaging Re-Exposure Rates of Dental Students.
Senior, Anthea; Winand, Curtis; Ganatra, Seema; Lai, Hollis; Alsulfyani, Noura; Pachêco-Pereira, Camila
2018-01-01
A guiding principle of radiation safety is ensuring that radiation dosage is as low as possible while yielding the necessary diagnostic information. Intraoral images taken with conventional dental film have a higher re-exposure rate when taken by dental students compared to experienced staff. The aim of this study was to examine the prevalence of and reasons for re-exposure of digital intraoral images taken by third- and fourth-year dental students in a dental school clinic. At one dental school in Canada, the total number of intraoral images taken by third- and fourth-year dental students, re-exposures, and error descriptions were extracted from patient clinical records for an eight-month period (September 2015 to April 2016). The data were categorized to distinguish between digital images taken with solid-state sensors or photostimulable phosphor plates (PSP). The results showed that 9,397 intraoral images were made, and 1,064 required re-exposure. The most common error requiring re-exposure for bitewing images was an error in placement of the receptor too far mesially or distally (29% for sensors and 18% for PSP). The most common error requiring re-exposure for periapical images was inadequate capture of the periapical area (37% for sensors and 6% for PSP). A retake rate of 11% was calculated, and the common technique errors causing image deficiencies were identified. Educational intervention can now be specifically designed to reduce the retake rate and radiation dose for future patients.
Directory of Open Access Journals (Sweden)
Menenakos Charalambos
2006-06-01
Full Text Available Abstract Background Taurolidine (TRD is a novel agent with multimodal antineoplastic effects. We present the case of a tumor remission after intravenous administration of taurolidine in a patient with gastric cancer re-recurrence. Case presentation A 58 years old male patient suffering from a gastric adenocarcinoma was submitted to partial gastrectomy and partial liver resection (pT2, pN1, pM1L (liver segment 2, N0, V0. 24 months later a local recurrence was diagnosed and the patient was reoperated. Postoperatively the patient underwent a palliative chemotherapy with eloxatin, FU, and leucovorin. A subsequent CT-revealed a liver metastasis and a recurrence adjacent to the hepatic artery. After successful radiofrequency ablation of the liver metastasis the patient was intravenously treated with 2% taurolidine. The patient endured the therapy well and no toxicity was observed. CT-scans revealed a stable disease without a tumor progression or metastatic spread. After 39 cycles the patient was submitted to left nephrectomy due to primary urothelial carcinoma and died 2 days later due to myocardial infarction. Postmortem histology of the esophageal-jejunal anastomosis and liver revealed complete remission of the known metastasized gastric adenocarcinoma. Conclusion The intravenous treatment with 2% taurolidine led to a histological remission of the tumor growth without any toxicity for the patient.
Re-vitalizing an indigenous language
DEFF Research Database (Denmark)
Hansen, Annette Skovsted
2014-01-01
The re-vitalization of indigenous languages depend on political and legal support and the imple-mentation of language rights depend on knowledge of vocabulary and grammar structures of the individual languages. Throughout the nineteenth century world, compilers of dictionaries adapted indigenous...... languages to match standards defined in nation-building and, thereby, enabled latent possibilities for indigenous populations to re-vitalize their languages in connection with the United Nations Year for Indigenous Peoples in 1993, and the first United Nations Decade for Indigenous Peoples, 1995......–2004. This article focuses on dictionaries of the languages of the Ainu populations in the borderlands between the nation-states Japan and Russia. The main argument is that the Ainu Cultural Promotion Act promulgated in 1997 had a significant impact on the production and purpose of Ainu dictionaries...
Successful Enterprise System Re-Implementation
DEFF Research Database (Denmark)
Svejvig, Per
2017-01-01
Achieving success in enterprise systems (ES) implementations is challenging. The success rate is not high in view of the sums invested by many organizations in these companywide systems. The literature is charged with reasons for unsuccessful implementations, such as a lack of top management...... support and insufficient change management. Contrary to this research, empirical data from an ES re-implementation in a Scandinavian high-tech company shows successful implementation despite many problematic shifts in outsourcing partners. Therefore, it is natural to ask: why was the re......-implementation of the ES at SCANDI successful despite the major troubles encountered during the project? Building an analysis based on ten Critical Success Factors (CSFs) combined with an investigation into the institutional structures at play, we present several reasons for the successful implementation. The CSF analysis...
Mera, M.
2009-01-01
This article examines the relationship between texts that are re-invented for different media and/or contexts including: film remakes, prequels and sequels, video games that become films and vice versa, internet mashups, and television series that move across geographical borders. The article points to significant sources in this emerging field and presents some of the challenges that arise in relation to its study. In particular questions of originality, fidelity, repetition and difference a...
Disease elimination and re-emergence in differential-equation models.
Greenhalgh, Scott; Galvani, Alison P; Medlock, Jan
2015-12-21
Traditional differential equation models of disease transmission are often used to predict disease trajectories and evaluate the effectiveness of alternative intervention strategies. However, such models cannot account explicitly for probabilistic events, such as those that dominate dynamics when disease prevalence is low during the elimination and re-emergence phases of an outbreak. To account for the dynamics at low prevalence, i.e. the elimination and risk of disease re-emergence, without the added analytical and computational complexity of a stochastic model, we develop a novel application of control theory. We apply our approach to analyze historical data of measles elimination and re-emergence in Iceland from 1923 to 1938, predicting the temporal trajectory of local measles elimination and re-emerge as a result of disease migration from Copenhagen, Denmark. Copyright © 2015 Elsevier Ltd. All rights reserved.
Five-Year NRHP Re-Evaluation of Historic Buildings Assessment
Energy Technology Data Exchange (ETDEWEB)
Ullrich, R A; Heidecker, K R
2011-09-12
The Lawrence Livermore National Laboratory (LLNL) 'Draft Programmatic Agreement among the Department of Energy and the California State Historic Preservation Officer Regarding Operation of Lawrence Livermore National Laboratory' requires a review and re-evaluation of the eligibility of laboratory properties for the National Register of Historic Places (NRHP) every five years. The original evaluation was published in 2005; this report serves as the first five-year re-evaluation. This re-evaluation includes consideration of changes within LLNL to management, to mission, and to the built environment. it also determines the status of those buildings, objects, and districts that were recommended as NRHP-eligible in the 2005 report. Buildings that were omitted from the earlier building list, those that have reached 50 years of age since the original assessment, and new buildings are also addressed in the re-evaluation.
34 CFR 35.4 - Administrative claim; evidence and information to be submitted.
2010-07-01
... the interval between injury and death. (8) Any other evidence or information which may have a bearing...) Death. In support of a claim based on death, the claimant may be required to submit the following evidence or information: (1) An authenticated death certificate or other competent evidence showing cause...
75 FR 80861 - Agency Forms Submitted for OMB Review, Request for Comments
2010-12-23
... collection techniques or other forms of information technology. Comments to RRB or OIRA must contain the OMB..., information needed to ensure secure system access from employers who voluntarily opt to use the RRB's Internet... (RRB) is submitting five (5) Information Collection Requests (ICR) to the Office of Information and...
40 CFR 355.21 - In what format should the information be submitted?
2010-07-01
... (CONTINUED) SUPERFUND, EMERGENCY PLANNING, AND COMMUNITY RIGHT-TO-KNOW PROGRAMS EMERGENCY PLANNING AND NOTIFICATION Emergency Planning How to Comply § 355.21 In what format should the information be submitted? EPA... 40 Protection of Environment 27 2010-07-01 2010-07-01 false In what format should the information...
Sparse Contextual Activation for Efficient Visual Re-Ranking.
Bai, Song; Bai, Xiang
2016-03-01
In this paper, we propose an extremely efficient algorithm for visual re-ranking. By considering the original pairwise distance in the contextual space, we develop a feature vector called sparse contextual activation (SCA) that encodes the local distribution of an image. Hence, re-ranking task can be simply accomplished by vector comparison under the generalized Jaccard metric, which has its theoretical meaning in the fuzzy set theory. In order to improve the time efficiency of re-ranking procedure, inverted index is successfully introduced to speed up the computation of generalized Jaccard metric. As a result, the average time cost of re-ranking for a certain query can be controlled within 1 ms. Furthermore, inspired by query expansion, we also develop an additional method called local consistency enhancement on the proposed SCA to improve the retrieval performance in an unsupervised manner. On the other hand, the retrieval performance using a single feature may not be satisfactory enough, which inspires us to fuse multiple complementary features for accurate retrieval. Based on SCA, a robust feature fusion algorithm is exploited that also preserves the characteristic of high time efficiency. We assess our proposed method in various visual re-ranking tasks. Experimental results on Princeton shape benchmark (3D object), WM-SRHEC07 (3D competition), YAEL data set B (face), MPEG-7 data set (shape), and Ukbench data set (image) manifest the effectiveness and efficiency of SCA.
2010-04-01
... elements of FDA Form 3500A: (a) Patient information (Form 3500A, Block A). You must submit the following...) Device information (Form 3500A, Block D). You must submit the following: (1) Brand name; (2) Type of...
International Nuclear Information System (INIS)
Qu, Xiaofei; Cao, Lixin; Liu, Wei; Su, Ge; Wang, Pingping; Schultz, Isabel
2012-01-01
Highlights: ► New long-lasting CdSiO 3 : Mn 2+ , RE 3+ (RE = Tb, Eu, Nd) phosphors were synthesized by a sol–gel method. ► The afterglow performance of the CdSiO 3 : Mn 2+ , Eu 3+ phosphor was the best. ► The role of RE 3+ co-doped into the CdSiO 3 : Mn 2+ matrix was discussed in this paper. -- Abstract: Mn 2+ and RE 3+ (RE = Tb, Eu, Nd) co-doped CdSiO 3 orange phosphors were prepared at 1050 °C by a sol–gel method. The phase and crystallinity of the synthesized materials were investigated by X-ray powder diffraction (XRD) and scanning electron microscopy (SEM). The luminescence characteristics were analyzed using photoluminescence (PL) spectra, afterglow decay curves, long-lasting phosphorescence spectra, and thermoluminescence (TL) spectra. Due to the difference in co-doped rare earth ionic radii, it varied greatly in trap density and trap depth caused by the different defects deriving from RE 3+ ions co-doping into the CdSiO 3 : Mn 2+ host. The afterglow intensity and time for these samples increased as follows: CdSiO 3 : Mn 2+ 0.2%, Nd 3+ 0.8% 3 : Mn 2+ 0.4%, Tb 3+ 0.8% 3 : Mn 2+ 0.4%, Eu 3+ 0.3%. CdSiO 3 : Mn 2+ 0.4%, Eu 3+ 0.3% had the best afterglow properties, which could be due to the proper traps formed by Eu 3+ ions co-doping into the host. The role of RE 3+ co-doped into the CdSiO 3 : Mn 2+ matrix and the possible long-lasting phosphorescence process was also discussed in this paper.
Stability of fault submitted to fluid injections
Brantut, N.; Passelegue, F. X.; Mitchell, T. M.
2017-12-01
Elevated pore pressure can lead to slip reactivation on pre-existing fractures and faults when the coulomb failure point is reached. From a static point of view, the reactivation of fault submitted to a background stress (τ0) is a function of the peak strength of the fault, i.e. the quasi-static effective friction coefficient (µeff). However, this theory is valid only when the entire fault is affected by fluid pressure, which is not the case in nature, and during human induced-seismicity. In this study, we present new results about the influence of the injection rate on the stability of faults. Experiments were conducted on a saw-cut sample of westerly granite. The experimental fault was 8 cm length. Injections were conducted through a 2 mm diameter hole reaching the fault surface. Experiments were conducted at four different order magnitudes fluid pressure injection rates (from 1 MPa/minute to 1 GPa/minute), in a fault system submitted to 50 and 100 MPa confining pressure. Our results show that the peak fluid pressure leading to slip depends on injection rate. The faster the injection rate, the larger the peak fluid pressure leading to instability. Wave velocity surveys across the fault highlighted that decreasing the injection-rate leads to an increase of size of the fluid pressure perturbation. Our result demonstrate that the stability of the fault is not only a function of the fluid pressure requires to reach the failure criterion, but is mainly a function of the ratio between the length of the fault affected by fluid pressure and the total fault length. In addition, we show that the slip rate increases with the background effective stress and with the intensity of the fluid pressure pertubation, i.e. with the excess shear stress acting on the part of the fault pertubated by fluid injection. Our results suggest that crustal fault can be reactivated by local high fluid overpressures. These results could explain the "large" magnitude human-induced earthquakes
Factors having implications on re-retinal detachments after silicone oil removal
Directory of Open Access Journals (Sweden)
Manish P Nagpal
2012-01-01
Full Text Available Aim: To investigate factors having implications on re-retinal detachments (reRD after silicone oil removal (SOR. Materials and Methods: A retroprospective study of 412 eyes (with attached retina after vitrectomy with silicone oil for rhegmatogenous RD which underwent SOR was conducted and were followed up for six months after SOR. They were studied for various factors like encirclage, 360° retinopexy, oil emulsification at the time of SOR, duration of oil tamponade and previous retinal surgeries prior to SOR with their implications on reRD after SOR. Results: Encirclage, 360 laser barrage, both, emulsification of oil (P=0.021, P=0.001, P=0.001, P=0.001, respectively were associated with lower risks of reRD after SOR whereas duration of tamponade (P=0.980 was not. Conclusion: Factors like encirclage, 360 retinopexy, their combination, oil emulsification reduced the incidence of re RD after SOR whereas duration of tamponade does not have statistical significant correlation with re RD after SOR.
Fetal dose determination in patients with breast cancer submitted to radiotherapy
International Nuclear Information System (INIS)
Melo, H.C.; Roesler, I.C.; Leon, E.
1985-01-01
The exposure that the fetus receive during radiotherapy treatment for patients with breast cancer submitted to cobalt 60 and linear accelerator of 6 MV is studied. Measurements with a rando-Alderson Phantom and ionization chamber for each individualized irradiation field, at the body level where the fetus is localized during the several stages of pregnancy, are made. (M.A.C.) [pt
14 CFR 120.11 - Refusal to submit to a drug or alcohol test by a Part 61 certificate holder.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Refusal to submit to a drug or alcohol test...: CERTIFICATION AND OPERATIONS DRUG AND ALCOHOL TESTING PROGRAM Individuals Certificated Under Parts 61, 63, and 65 § 120.11 Refusal to submit to a drug or alcohol test by a Part 61 certificate holder. (a) This...
14 CFR 120.15 - Refusal to submit to a drug or alcohol test by a Part 65 certificate holder.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Refusal to submit to a drug or alcohol test...: CERTIFICATION AND OPERATIONS DRUG AND ALCOHOL TESTING PROGRAM Individuals Certificated Under Parts 61, 63, and 65 § 120.15 Refusal to submit to a drug or alcohol test by a Part 65 certificate holder. (a) This...
14 CFR 120.13 - Refusal to submit to a drug or alcohol test by a Part 63 certificate holder.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Refusal to submit to a drug or alcohol test...: CERTIFICATION AND OPERATIONS DRUG AND ALCOHOL TESTING PROGRAM Individuals Certificated Under Parts 61, 63, and 65 § 120.13 Refusal to submit to a drug or alcohol test by a Part 63 certificate holder. (a) This...
Quality of life in patients submitted to radical prostatectomy
Débora Moura Miranda Goluart; Mário Alfredo Silveira Miranzi; Paulo Eduardo Nunes Goulart
2014-01-01
A cross-sectional study with a descriptive analysis of 81 patients submitted to radical prostatectomy (RP). Our objective was to correlate quality of life (QL) according to the EORTC-QLQ C30 with age group and time after surgery. Mean age was 65.7 years. Most sought the care of urology, asymptomatic. Some referred former smoking (49.9%) and high blood pressure (53.1%). Mean preoperative SBP was 8.4 ng/ml. Most participants were in stages T2c to T3, Gleason ?6 and over a year after surgery. Er...
Zembylas, Michalinos
2017-01-01
This article takes up Arendt's "aporetic" framing of human rights as well as Rancière's critique and suggests that reading them together may offer a way to re-envision human rights and human rights education (HRE)--not only because they make visible the perplexities of human rights, but also in that they call for an agonistic…
A review of irradiation induced re-solution in oxide fuels
International Nuclear Information System (INIS)
Turnbull, J.A.
1980-01-01
The paper reviews the existing experimental evidence for irradiation induced re-solution and also possible explanations for the mechanism. The importance of re-solution is considered with regard to intragranular bubbles and the accumulation of gas on grain boundaries. It is concluded that re-solution is most effective at low temperatures and could account for the present concern over gas release in high burn-up water reactor fuel assemblies. (author)
Study on the pharmacal of 186,188Re-SZ39
International Nuclear Information System (INIS)
Zu Jianhua; Wu Yuanfang; Dong Mo; Li Huiyuan; ZhangYulong
2000-01-01
The stability, immunocompetence and cytotoxicity in tumor as well as tumor inhibiting rate of 186,188 Re-SZ39 are investigated. The results indicate that 186,188 Re-SZ39 is stable in vivo by imaging and the volume of tumor of nude mice reduced obviously. So 186,188 Re-SZ39 has a strong cytotoxicity effect against glioma cells and is of good prospect as immuno-radiotherapeutic agent
In vitro structure-activity relationship of Re-cyclized octreotide analogues
Energy Technology Data Exchange (ETDEWEB)
Dannoon, Shorouk F. [Department of Chemistry, University of Missouri, Columbia, MO 65211 (United States); Bigott-Hennkens, Heather M. [Department of Veterinary Medicine and Surgery, University of Missouri, Columbia, MO 65211 (United States); Ma Lixin [Department of Radiology, University of Missouri, Columbia, MO 65211 (United States); International Institute of Nano and Molecular Medicine, University of Missouri, Columbia, MO 65211 (United States); Nuclear Science and Engineering Institute, University of Missouri, Columbia, MO 65211 (United States); Research Service, Harry S. Truman Memorial Veterans' Hospital, Columbia, MO 65201 (United States); Gallazzi, Fabio [Structural Biology Core, University of Missouri, Columbia, MO 65211 (United States); Lewis, Michael R., E-mail: lewismic@missouri.ed [Department of Veterinary Medicine and Surgery, University of Missouri, Columbia, MO 65211 (United States); Department of Radiology, University of Missouri, Columbia, MO 65211 (United States); Nuclear Science and Engineering Institute, University of Missouri, Columbia, MO 65211 (United States); Research Service, Harry S. Truman Memorial Veterans' Hospital, Columbia, MO 65201 (United States); Jurisson, Silvia S., E-mail: jurissons@missouri.ed [Department of Chemistry, University of Missouri, Columbia, MO 65211 (United States); Department of Radiology, University of Missouri, Columbia, MO 65211 (United States); Nuclear Science and Engineering Institute, University of Missouri, Columbia, MO 65211 (United States)
2010-07-15
Introduction: Development of radiolabeled octreotide analogues is of interest for targeting somatostatin receptor (SSTR)-positive tumors for diagnostic and therapeutic purposes. We are investigating a direct labeling approach for incorporation of a Re ion into octreotide analogues, where the peptide sequences are cyclized via coordination to Re rather than through a disulfide bridge. Methods: Various octreotide analogue sequences and coordination systems (e.g., S{sub 2}N{sub 2} and S{sub 3}N) were synthesized and cyclized with nonradioactive Re. In vitro competitive binding assays with {sup 111}In-DOTA-Tyr{sup 3}-octreotide in AR42J rat pancreatic tumor cells yielded IC{sub 50} values as a measure of SSTR affinity of the Re-cyclized analogues. Three-dimensional structures of Re-cyclized Tyr{sup 3}-octreotate and its disulfide-bridged analogue were calculated from two-dimensional NMR experiments to visualize the effect of metal cyclization on the analogue's pharmacophore. Results: Only two of the 11 Re-cyclized analogues investigated showed moderate in vitro binding affinity toward somatostatin subtype 2 receptors. Three-dimensional molecular structures of Re- and disulfide-cyclized Tyr{sup 3}-octreotate were calculated, and both of their pharmacophore turns appear to be very similar with minor differences due to metal coordination to the amide nitrogen of one of the pharmacophore amino acids. Conclusions: Various Re-cyclized analogues were developed and analogue 4 had moderate affinity toward somatostatin subtype 2 receptors. In vitro stable studies that are in progress showed stable radiometal cyclization of octreotide analogues via NS{sub 3} and N{sub 2}S{sub 2} coordination forming five- and six-membered chelate rings. In vivo biodistribution studies are underway of {sup 99m}Tc-cyclized analogue 4.
Rattacaso, Raphael Mendes Bezerra; da Fonseca Roberti Garcia, Lucas; Aguilar, Fabiano Gamero; Consani, Simonides; de Carvalho Panzeri Pires-de-Souza, Fernanda
2011-04-01
The purpose of this study was to evaluate the bleaching agent action on color stability, surface roughness and microhardness of composites (Charisma, Filtek Supreme and Heliomolar - A2) submitted to accelerated artificial aging (AAA). A Teflon matrix (12 x 2 mm) was used to fabricate 18 specimens (n=6) which, after polishing (Sof-Lex), were submitted to initial color reading (ΔE), Knoop microhardness (KHN) (50 g/15 s load) and roughness (R(a)) (cut-off 0.25 mm) tests. Afterwards, the samples were submitted to AAA for 384 hours and new color, microhardness and roughness readings were performed. After this, the samples were submitted to daily application (4 weeks) of 16% Carbamide Peroxide (NiteWhite ACP) for 8 hours and kept in artificial saliva for 16 hours. New color, microhardness and roughness readings were made at the end of the cycle, and 15 days after bleaching. Comparison of the ΔE means (2-way ANOVA, Bonferroni, P<.05) indicated clinically unacceptable color alteration for all composites after AAA, but without significant difference. Statistically significant increase in the KHN values after AAA was observed, but without significant alterations 15 days after bleaching. For R(a) there was no statistically significant difference after AAA and 15 days after bleaching. The alterations promoted by the bleaching agent and AAA are material dependent.
Final Technical Report, reEnergize Program
Energy Technology Data Exchange (ETDEWEB)
Wamstad-Evans, Kristi [City of Omaha; Williams, Eric [City of Omaha; Kubicek, Jason [City of Omaha
2013-12-27
The reEnergize Program helped to build a market for residential and commercial energy evaluations and upgrades. The program provided incentives to encourage participants to save energy, save money, and make their homes and businesses more safe, healthy, and comfortable. As part of the Better Buildings Neighborhood Program (BBNP), the successful investment of this $10 million grant toward market development was the first grant funding collaboration between the cities of Omaha and Lincoln. Through more than three years of work, thousands of participants, contractors, and community members worked together to make the reEnergize Program a demonstration of how to “Build Energy Smart Communities.”
Phase relations and superconductivity in the binary Re-Si system
International Nuclear Information System (INIS)
Jorda, J.L.; Ishikawa, M.; Muller, J.
1982-01-01
The phase diagram of the Re-Si system was reinvestigated by means of high temperature methods of analysis. Several modifications were found to the existing diagram. An extended rhenium solid solution (up to 10 at.% Si) was established with a rapid quenching technique. Within this terminal solid solution, the superconducting transition temperature increased from 1.7 to 5.2 K. The phase corresponding to the Re 5 Si 3 compound was homogeneous at 33 at.% Si. The peritectically formed equiatomic compound decomposed eutectoidally at 1650 0 C and was superconducting at 1.5 K. The compound ReSi 2 was found to be off stoichiometric, occurring at the composition ReSisub(1.8). (Auth.)
Directory of Open Access Journals (Sweden)
Bozhidar Iv. Hadzhiev
2010-12-01
Full Text Available La globalización, el auge de la economía, el progreso de la e-net economía, y el gran dinamismo de las relaciones comerciales se están constituyendo como una función progresiva en constante crecimiento, predeterminando la utilización de unas pocas nuevas oportunidades para aumentar la eficacia de las empresas. Llegados a este punto, a través del prisma de los métodos de reingeniería en el presente artículo se muestran algunos problemas básicos y las oportunidades existentes para la Reingeniería del Marketing (RM.Globalization, the rise of the economy, the progress of the e-net economy, and the high dynamics of business relationships are developing as one of the permanently rising progressive functions, predetermining the use of a few new opportunities for increasing effectiveness of the industry companies. At this point, through the prism of Re-engineering methods, a few basic problems and opportunities for Re-engineering Marketing (RM are presented in this paper.
21 CFR 1.402 - What are the requirements for submitting an appeal?
2010-04-01
... 21 Food and Drugs 1 2010-04-01 2010-04-01 false What are the requirements for submitting an appeal? 1.402 Section 1.402 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL GENERAL ENFORCEMENT REGULATIONS Administrative Detention of Food for Human or Animal...
41 CFR 301-52.6 - How do I submit a travel claim?
2010-07-01
... 41 Public Contracts and Property Management 4 2010-07-01 2010-07-01 false How do I submit a travel claim? 301-52.6 Section 301-52.6 Public Contracts and Property Management Federal Travel Regulation System TEMPORARY DUTY (TDY) TRAVEL ALLOWANCES ARRANGING FOR TRAVEL SERVICES, PAYING TRAVEL EXPENSES, AND...
77 FR 5858 - Agency Forms Submitted for OMB Review, Request for Comments
2012-02-06
... Regulatory Affairs (OIRA), Office of Management and Budget (OMB). Our ICR describes the information we seek... requiring an applicant to submit documentary evidence of marriage are prescribed in 20 CFR 219.30. In the absence of documentary evidence, the RRB needs to determine if a valid marriage existed between a spouse...
78 FR 18633 - Agency Forms Submitted for OMB Review, Request for Comments
2013-03-27
... Affairs (OIRA), Office of Management and Budget (OMB). Our ICR describes the information we seek to... requiring an applicant to submit documentary evidence of marriage are prescribed in 20 CFR 219.30. In the absence of documentary evidence, the RRB needs to determine if a valid marriage existed between a spouse...
78 FR 6150 - Agency Forms Submitted for OMB Review, Request for Comments
2013-01-29
... home addresses of all employees hired within the last year (new-hires). Form BA-6a, Form BA-6 Address... RAILROAD RETIREMENT BOARD Agency Forms Submitted for OMB Review, Request for Comments Summary: In... collection techniques or other forms of information technology. Comments to the RRB or OIRA must contain the...
10 CFR 1014.4 - Administrative claims; evidence and information to be submitted.
2010-01-01
... between injury and death. (8) Any other evidence or information that may have a bearing on either the.... (a) Death. In support of a claim based on death, the claimant may be required to submit the following evidence or information: (1) An authenticated death certificate or other competent evidence showing the...
75 FR 382 - Proposed Data Collections Submitted for Public Comment and Recommendations
2010-01-05
... Clearance Officer, 1600 Clifton Road NE., MS-D74, Atlanta, Georgia 30333; comments may also be sent by e... voluntarily submit these reports to CDC at variable frequencies, either weekly or monthly. CDC then calculates... cost to respondents other than their time. Estimate of Annualized Burden Hours Average Number of Number...
75 FR 48346 - Proposed Data Collections Submitted for Public Comment and Recommendations
2010-08-10
... plans and instrument, call 404-639-5960 and send comments to Maryam I. Daneshvar, CDC Reports Clearance... voluntarily submit these reports to CDC at variable frequencies, either weekly or monthly. CDC then calculates... reported annually is different for each. There is no cost to respondents other than their time. Estimated...
20 CFR 668.710 - What planning documents must an INA grantee submit?
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false What planning documents must an INA grantee... Planning/Funding Process § 668.710 What planning documents must an INA grantee submit? Each grantee... participant services and expenditures covering the two-year planning cycle. We will, in consultation with the...
Performance Spread of Re-entrant System Structures
DEFF Research Database (Denmark)
Nielsen, Erland Hejn
2001-01-01
-to-day operations. It might well be the case that those badly behaving systems merely constitute a set with a measure of almost zero. The key parameters that determine whether a re-entrant system is one of the badly behaving ones are essentially flow-structure, processing times and rules of priority between...... satisfactory. They are all vulnerable to certain job flow patterns and process time settings to a significant degree. The LBFS priority policy therefore presents itself not only as a stable, but also the safe and robust choice par excellence in relation to the control of re-entrant systems....... different job-classes on specific machines. Let us therefore face a re-entrant flow-shop production set-up in an order-driven production system, by which I mean that the flow structure relative to each production-batch shows great variability and where the size of the individual batches is quite large. One...
Kanegelo ya Nimirode: Re lebelela diphihlelelo t�a gagwe ka lefsa
Directory of Open Access Journals (Sweden)
Elelwani B. Farisani
2011-03-01
Full Text Available Kanegelo ya Hama/Nimirode e �omi�it�we go gatelela Bathobaso ba Afrika-Borwa le ba Amerika. Taodi�wana ye e lekola Nimirode ka lefsa le go t�ea magato a go bu�et�a seriti sa gagwe le sa Bathobaso sekeng.Seo se tlo dirwa ka dikgato t�e tlhano ka mo tlase. Sa mathomo, re tlo lekola dimelo t�a bana ba Noage, go kwe�i�a Nimirode, yo e lego yena �edi ye kgolo ya taodi�wana ye. Sa bobedi re tlo lebelela ka fao bangwadi ba bangwe ba t�welet�ago seswant�ho sa go befa sa Nimirode. Sa boraro, re tlo sekaseka tiri�o ya kanegelo ya Hama/Nimirode go gatelela le go dira Bathobaso makgoba. Sa bone, re tlo sekaseka diphihlelelo le dikatlego t�a Nimirode. Mo re tlo tsepelela diphihlelelo t�a gagwe t�e tharo t�e kgolo bjalo ka go ba mmu�i wa maemo, motsomi yo maatla le moagi. Nepo ya karolo ye ke go ganet�ana le tshekatsheko ya go se be botse ye e nepilwego Nimirode nakong ya go feta. Re tlo tlalelet�a ka go fa tshekatsheko ye e tebilego ya thogako godimo ga Hama/Ku�e/Nimirode. Sa bohlano, ebile e le sa mafelelo, re tlo t�welet�a nyanyeng bohlokwa bja kanegelo ya Nimirode go bao ba bego ba gatelet�we le go ba makgoba ka baka la temana ye. Re tlo nepi�a Afrika-Borwa.
The re-identification risk of Canadians from longitudinal demographics
2011-01-01
Background The public is less willing to allow their personal health information to be disclosed for research purposes if they do not trust researchers and how researchers manage their data. However, the public is more comfortable with their data being used for research if the risk of re-identification is low. There are few studies on the risk of re-identification of Canadians from their basic demographics, and no studies on their risk from their longitudinal data. Our objective was to estimate the risk of re-identification from the basic cross-sectional and longitudinal demographics of Canadians. Methods Uniqueness is a common measure of re-identification risk. Demographic data on a 25% random sample of the population of Montreal were analyzed to estimate population uniqueness on postal code, date of birth, and gender as well as their generalizations, for periods ranging from 1 year to 11 years. Results Almost 98% of the population was unique on full postal code, date of birth and gender: these three variables are effectively a unique identifier for Montrealers. Uniqueness increased for longitudinal data. Considerable generalization was required to reach acceptably low uniqueness levels, especially for longitudinal data. Detailed guidelines and disclosure policies on how to ensure that the re-identification risk is low are provided. Conclusions A large percentage of Montreal residents are unique on basic demographics. For non-longitudinal data sets, the three character postal code, gender, and month/year of birth represent sufficiently low re-identification risk. Data custodians need to generalize their demographic information further for longitudinal data sets. PMID:21696636
Thermal decomposition of RE(C2H5CO2)3·H2O (RE = Dy, Tb, Gd, Eu and Sm)
DEFF Research Database (Denmark)
Grivel, Jean-Claude
2014-01-01
The thermal decomposition of Dy(III), Tb(III), Gd(III), Eu(III), and Sm(III) propionate monohydrates was studied in argon by means of simultaneous differential thermal analysis and thermogravimetry, infrared-spectroscopy, X-ray diffraction, and optical microscopy. After dehydration, which takes......, an intermediate stage involving a RE2O(C2H5CO2)4 composition was evidenced in the case of the Eu- and Sm-propionates. For all compounds, further decomposition of RE2O2CO3 into the corresponding sesquioxides (RE2O3) is accompanied by the release of CO2. The thermal decomposition of Dy- and Tb-propionates occurs...
Weak ferromagnetism in Re0.67Ca0.33FeO3 (Re=La, Sm, Gd) nanoparticles
International Nuclear Information System (INIS)
Li Jiangong; Kou Xinli; Qin Yong; He Haiying
2003-01-01
Perovskite-type complex ferrite Re 0.67 Ca 0.33 FeO 3 (Re=La, Sm, Gd) nanoparticles of nearly the same particle size were prepared using sol-gel method. The influence of rare-earth ions on weak ferromagnetism in the Re 0.67 Ca 0.33 FeO 3 nanoparticles has been studied. The spontaneous magnetization M s of the Sm 0.67 Ca 0.33 FeO 3 nanoparticles is greater than that of Gd 0.67 Ca 0.33 FeO 3 nanoparticles; and M s of Gd 0.67 Ca 0.33 FeO 3 nanoparticles is greater than that of La 0.67 Ca 0.33 FeO 3 nanoparticles. The ferromagnetic component arising from the Fe sublattice increases with the decreasing rare-earth ionic radii. The magnetization of the rare-earth ions in the Sm 0.67 Ca 0.33 FeO 3 nanoparticles is smaller than that in the Gd 0.67 Ca 0.33 FeO 3 nanoparticles. The influences of the geometric and intrinsic magnetic characters of rare-earth ions as well as the particle size of the nanoparticles on weak ferromagnetism are discussed
Pre and post operative facial angles in patients submitted to rhinoplasty
Directory of Open Access Journals (Sweden)
Soccol, Andréa T
2008-09-01
Full Text Available Introduction: Parameters used in facial aesthetic surgeries are currently based on POWELL and HUMPHREYS (1. These authors have formulated suitable relations between the face and the nose, and defined the face angles. Objective: To compare pre and pos-operative nasolabial, nasofrontal, nasomental and nasofacial angles in patients submitted to rhinoseptoplasty. Method: Prospective analysis of 37 patients submitted to rhinoplasty, with an average of 30±11 years of age, being 13 (36% men and 24 (64% women. The nasolabial, nasofrontal, nasomental and nasofacial angles were measured and compared, before and after the surgery, in profile pictures. Results: An average increase of 8.6o in the nasolabial angle was observed, of 8.5o in the nasofrontal and reduction of 2.3o in the nasofacial angle, and all the measures presented a statistically significant difference between the pre and pos-operative period. The nasomental angle increased, on average, 1.6o, a difference without statistical importance. Conclusions: The nasolabial and nasofrontal angles increase significantly after rhinoseptoplasty, while the nasofacial angle diminishes. There was no significant alteration in the nasomental angle with the accomplishment of the surgery.
Revision Total Hip Arthoplasty: Factors Associated with Re-Revision Surgery
Khatod, M; Cafri, G; Inacio, MCS; Schepps, AL; Paxton, EW; Bini, SA
2015-01-01
The survivorship of implants after revision total hip arthroplasty and risk factors associated with re-revision are not well defined. We evaluated the re-revision rate with use of the institutional total joint replacement registry. The purpose of this study was to determine patient, implant, and surgeon factors associated with re-revision total hip arthroplasty.A retrospective cohort study was conducted. The total joint replacement registry was used to identify patients who had undergone revi...
Re-Emergent Tremor of Parkinson's Disease Masquerading as Essential Tremor
Directory of Open Access Journals (Sweden)
Sarah Morgan
2016-03-01
Full Text Available Background: The re-emergent tremor of Parkinson’s disease (PD is generally recognized as a postural tremor. Phenomenology Shown: A PD patient with a re-emergent tremor occurring during a task (spiral drawing, which on the surface produced a tremor that resembled that of essential tremor (ET. Educational Value: Researchers and clinicians should be aware of features of this re-emergent tremor to help distinguish it from that of ET.
ions (RE = La, Pr, Nd, Sm, Gd and Dy)
Indian Academy of Sciences (India)
) zirconia), tendency of phase transformation (tetragonal to monoclinic () zirconia) and lattice strain were studied with mechanical property e.g. tensile strength of sol–gel derived ZrO2–2 mol% RE2O3 (RE = La, Pr, Nd, Sm, Gd and Dy) spun ...
'Fit or unfit': theorie en praktijk van re-integratie
Sol, C.C.A.M.; Kok, K.
2014-01-01
If the objective of creating a labour market with opportunity for unemployed is to be achieved through re-employment programmes, understanding the mechanisms and conditions at work is essential. Following ‘Realistic Evaluation’ the authors focus on theories in use behind re-employment programmes by
XPS investigations of tribolayers formed on TiN and (Ti,Re)N coatings
Energy Technology Data Exchange (ETDEWEB)
Oktay, Serkan; Kahraman, Zafer; Urgen, Mustafa; Kazmanli, Kursat, E-mail: kursat@itu.edu.tr
2015-02-15
Graphical abstract: - Highlights: • The (Ti,Re)N coating (8 ± 1.9 at.% Re) consisted of TiN and ReNx (x > 1.33) phases. • TiO{sub 2} provided low friction coefficient to TiN coating at 150 °C. • Re addition to TiN drastically dropped the friction coefficients to 0.17–0.22. • Re{sub 2}O{sub 7} provided very low friction coefficient to (Ti,Re)N coating. • Re addition to TiN improved the wear behavior. - Abstract: TiN and (Ti,Re)N coatings were deposited on high-speed-steel substrates by a hybrid coating system composed of cathodic arc PVD and magnetron sputtering techniques. In order to keep rhenium content low (8 ± 1.9 at.%) in the coating, magnetron sputtering technique was utilized to evaporate rhenium. The (Ti,Re)N coating consisted of TiN and ReN{sub x} (x > 1.33) phases. The hardness of TiN and (Ti,Re)N were 31 GPa and 29 GPa ( ± 2 GPa), respectively. Tribological behaviors of the samples were tested against Al{sub 2}O{sub 3} balls at 21 °C (RT) and 150 °C (HT) by reciprocating wear technique. The tribolayers were analyzed by XPS technique. Friction coefficients of TiN were 0.56, 0.35 for 21 °C and 150 °C tests, respectively. Rhenium addition to TiN drastically dropped the friction coefficients to 0.22 and 0.17 for RT and HT samples. Rhenium addition also improved the wear resistance of the coating at both test temperatures. For TiN, main oxide component of the tribolayers was Ti{sub 2}O{sub 3} for RT tests and TiO{sub 2} for HT tests. The oxide layer formed on (Ti,Re)N were the mixture of TiO{sub 2}, Ti−O−N, ReO{sub 2} and Re{sub 2}O{sub 7} for both test temperatures. Re{sub 2}O{sub 7} provided very low friction coefficient to (Ti,Re)N. The findings are consistent with the crystal chemistry approach.
Indian Academy of Sciences (India)
this title. The chapter on physics and experi- mental methods is perhaps the weakest and might have been better left out or re-written from a perspective that better serves the title and the aims of the rest of the book. There are problems with the proof reading e.g., titanium nitride described as TiC, phrases in sentences.
[Study on mercury re-emissions during fly ash utilization].
Meng, Yang; Wang, Shu-Xiao
2012-09-01
The amount of fly ash produced during coal combustion is around 400 million tons per year in China. About 65%-68% of fly ash is used in building material production, road construction, architecture and agriculture. Some of these utilization processes include high temperature procedures, which may lead to mercury re-emissions. In this study, experiments were designed to simulate the key process in cement production and steam-cured brick production. A temperature programmed desorption (TPD) method was used to study the mercury transformation in the major utilization processes. Mercury re-emission during the fly ash utilization in China was estimated based on the experimental results. It was found that mercury existed as HgCl2 (Hg2 Cl2), HgS and HgO in the fly ash. During the cement production process, more than 98% of the mercury in fly ash was re-emitted. In the steam-curing brick manufacturing process, the average mercury re-emission percentage was about 28%, which was dominated by the percentage of HgCl2 (Hg2 Cl2). It is estimated that the mercury re-emission during the fly ash utilization have increased from 4.07 t in 2002 to 9.18 t in 2008, of which cement industry contributes about 96.6%.
Pelvic re-irradiation using stereotactic ablative radiotherapy (SABR): A systematic review.
Murray, Louise Janet; Lilley, John; Hawkins, Maria A; Henry, Ann M; Dickinson, Peter; Sebag-Montefiore, David
2017-11-01
To perform a systematic review regarding the use of stereotactic ablative radiotherapy (SABR) for the re-irradiation of recurrent malignant disease within the pelvis, to guide the clinical implementation of this technique. A systematic search strategy was adopted using the MEDLINE, EMBASE and Cochrane Library databases. 195 articles were identified, of which 17 were appropriate for inclusion. Studies were small and data largely retrospective. In total, 205 patients are reported to have received pelvic SABR re-irradiation. Dose and fractionation schedules and re-irradiated volumes are highly variable. Little information is provided regarding organ at risk constraints adopted in the re-irradiation setting. Treatment appears well-tolerated overall, with nine grade 3 and six grade 4 toxicities amongst thirteen re-irradiated patients. Local control at one year ranged from 51% to 100%. Symptomatic improvements were also noted. For previously irradiated patients with recurrent pelvic disease, SABR re-irradiation could be a feasible intervention for those who otherwise have limited options. Evidence to support this technique is limited but shows initial promise. Based on the available literature, suggestions for a more formal SABR re-irradiation pathway are proposed. Prospective studies and a multidisciplinary approach are required to optimise future treatment. Copyright © 2017 Elsevier B.V. All rights reserved.
An Exploratory Study on the Re-finding Behavior on the Web
Directory of Open Access Journals (Sweden)
Hsiao-Tieh Pu
2010-06-01
Full Text Available It is common for users to relocate information previously found on the web. However, their search behaviors in initial finding and the subsequent re-finding may differ due to the dynamic nature and contextual diversity of the web. This study used experiment, observation, interview, and questionnaires to investigate the characteristics of re-finding behavior and compare users’ performance in finding and re-finding. Though not significantly different, the study participants used more search tools, combined various strategies to obtain contextual clues of finding process, utilized more complex search tactics, and had more interactions with search engines used. Findings also show that participants spent less time in re-finding than in finding, yet the cognitive loading and difficulties increased in re-finding. Participants were satisfied with the results obtained in re-finding, but they also claimed that the search performance would be better if the system offered more functions to support recall of previous search results. Participants’ satisfaction with search performance also varied by task type. Based on the findings, this study recommends that re-finding efficiency may be improved by enhancing recall functionalities in browsers and by using personal information management tools. [Article content in Chinese; Extended abstract in English
Energy Technology Data Exchange (ETDEWEB)
Dabre, K.V. [Department of Physics, Arts, Commerce and Science College, Koradi, Nagpur 441111 (India); Park, K. [Faculty of Nanotechnology and Advanced Materials Engineering, Sejong University, Seoul 143-747 (Korea, Republic of); Dhoble, S.J., E-mail: sjdhoble@rediffmail.com [Department of Physics, R.T.M. Nagpur University, Nagpur 440033 (India)
2014-12-25
Graphical abstract: CIE chromaticity coordinate diagram (1931) indicating different colors of Sr{sub 2}ZnWO{sub 6}:RE{sup 3+} (RE = Eu (a), Dy (b and c), Sm (d–f) and Pr (g and h)) phosphor under different excitation 466 nm (a), 312 nm (b), 454 nm (c), 313 nm (d), 408 nm (e), 482 nm (f), 315 nm (g) and 450 nm (h). - Highlights: • Microcrystalline Sr{sub 2}ZnWO{sub 6}:RE{sup 3+} (RE = Eu, Dy, Sm and Pr) phosphors were synthesized by solid state method. • Photoluminescence properties of phosphor were investigated. • Color of the phosphor for different excitation has been verified by chromaticity diagram. • The host absorption and energy transfer were investigated. - Abstract: The novel microcrystalline Sr{sub 2}ZnWO{sub 6}:RE{sup 3+} (RE = Eu, Dy, Sm and Pr) phosphors were synthesized by solid-state reaction method at 1250 °C and their photoluminescence properties were investigated. The Eu{sup 3+} and Dy{sup 3+} activated phosphors show intense red (616 nm) and yellow (574 nm) emission respectively; which indicate that the rare earth ions are substituted at non-centrosymmetric site in the host lattice. Near white (Dy{sup 3+}) and reddish-orange (Sm{sup 3+}) emissions of rare earth ions in the host lattice show strong host absorption and energy transfer from the host to activator ion. Pr{sup 3+} activated phosphor shows a series of emission peaks in the visible region with the most intense peak in the blue region at 491 and 499 nm.
Developments with melt spun RE-Fe-B powder for bonded magnets
International Nuclear Information System (INIS)
Brown, D.N.; Chen, Z.; Guschl, P.; Campbell, P.
2006-01-01
Rapidly quenched isotropic rare earth iron boride (RE-Fe-B) powders have found many applications throughout the electronics, automotive and white goods industries. The magnetic performance, thermal stability, corrosion resistance and processability of a powder are important factors when selecting a RE-Fe-B powder for a particular application. For electronic devices that operate at ambient temperatures, high remanence (B r ) tends to be a priority and RE 2 Fe 14 B/α-Fe nanocomposite powder magnets are favoured. Alternatively, automotive applications tend to require greater thermal stability and corrosion resistance, which are satisfied by single-phase RE 2 Fe 14 B powder magnets with higher intrinsic coercivity (H ci ). This article reviews the performance of commercially available rapidly solidified RE-Fe-B powders and recent developments made to address the demands of applications
Thermochemical Properties of the Complexes RE(HSal)3·2H2O (RE=La, Ce, Pr, Nd, Sm)
Institute of Scientific and Technical Information of China (English)
无
2006-01-01
Five solid rare earth salicylate complexes were synthesized by low hydrated lathanide chloride and salicylic acid. The complexes in this experiment were identified as the general formula RE(Hsal)3·2H2O(RE=La, Ce, Pr, Nd, Sm) by elemental analysis and EDTA volumetric analysis. IR spectra of the complexes show that carboxyl of salicylic acid coordinates to RE3+ ions. Electrochemical behaviors of the complexes on the glass-carbon electrode were researched with cyclic voltammetry (CV). It is indicated that the electrochemical process of the complexes is a one-electron redox process and the electrochemical reversibility of complexes is less than that of the lanthanide chlorides. The constant-volume combustion energies of complexes, ΔcU, were determined with a precise rotating-bomb calorimeter at 298.15 K. Their standard molar enthalpies of combustion, ΔcHθm, and standard molar enthalpies of formation, ΔfHθm, were calculated.
Inguinodynia in patients submitted to conventional inguinal hernioplasty.
Dias, Bruno Garcia; Santos, Marcelo Protásio Dos; Chaves, Ana Barbara DE Jesus; Willis, Mariana; Gomes, Marcio Couto; Andrade, Fernandes Tavares; Melo, Valdinaldo Aragão DE; Santos, Paulo Vicente Dos
2017-01-01
to evaluate the incidence of chronic pain and its impact on the quality of life of patients submitted to inguinal hernioplasty using the Lichtenstein technique. this was a descriptive, cross-sectional study of patients operated under spinal anesthesia from February 2013 to February 2015 and who had already completed six postoperative months. We questioned patients about the presence of chronic inguinal pain and, if confirmed, invited them to a consultation in which we assessed the pain and its impact on quality of life. out of 158 patients submitted to the procedure, we identified 7.6% as having inguinodynia. Of these, there was an impact on the quality of life in 25%. the incidence of inguinodynia after hernioplasty with repercussion in quality of life was similar to the one of found in the world literature. avaliar a incidência de dor crônica e o seu impacto na qualidade de vida de pacientes submetidos à hernioplastia inguinal pela técnica de Lichtenstein. trata-se de estudo transversal descritivo, de pacientes operados de hérnia inguinal pela técnica de Lichtenstein sob anestesia raquidiana, no período de fevereiro de 2013 a fevereiro de 2015, e que já haviam completado seis meses de pós-operatório. Os pacientes foram questionados sobre a presença de dor inguinal crônica e, caso confirmada, convidados a uma consulta na qual foi feita análise da qualidade da dor e seu impacto na qualidade de vida. do total de 158 pacientes submetidos ao procedimento, 7,6% foram identificados como portadores de inguinodinia. Destes, houve impacto na qualidade de vida em 25%. observou-se incidência de inguinodinia pós-hernioplastia com repercussão na qualidade de vida semelhante à literatura mundial.
Telling Parents You're Pregnant
... Putting your feelings into words takes plenty of maturity and it's not easy to do. Don't worry if the words don't come out perfectly or if you cry or get emotional as you're saying them. It can help ...
Tc and Re Behavior in Borosilicate Waste Glass Vapor Hydration Tests
International Nuclear Information System (INIS)
McKeown, David A.; Buechele, Andrew C.; Pegg, Ian L.; Lukens, Wayne W.; Shuh, David K.
2007-01-01
Technetium (Tc), found in some nuclear wastes, is of particular concern with regard to long-term storage, because of its long-lived radioactivity and high mobility in the environment. Tc and rhenium (Re), commonly used as a non-radioactive surrogate for Tc, were studied to assess their behavior in borosilicate glass under hydrothermal conditions in the Vapor Hydration Test (VHT). X-ray absorption spectroscopy (XAS) and scanning electron microscopy (SEM) measurements were made on the original Tc- and Re-containing glasses and their corresponding VHT samples, and show different behavior for Tc and Re under VHT conditions. XAS indicates that, despite starting with different Tc(IV) and Tc(VII) distributions in each glass, the VHT samples have 100% Tc(IV)O 6 environments. SEM shows complete alteration of the original glass, Tc enrichment near the sample surface, and Tc depletion in the center. Perrhenate (Re(VII)O 4 - ) is dominant in both Re-containing samples before and after the VHT, where Re is depleted near the VHT sample surface and more concentrated toward the center. (authors)
International Nuclear Information System (INIS)
Zeng, Wei; Wang, Yuhua; Han, Shaochun; Chen, Wenbo; Li, Gen
2014-01-01
CdSiO 3 : Tb 3+ , Re 3+ long-lasting phosphors were synthesized by the conventional high temperature solid-state method. A green-light phosphorescence phenomenon, which was associated with the 5 D 4 → 7 F J (J=6, 5, 4, 3) transitions of the Tb 3+ ion, was observed. Introduction of Re 3+ (Re 3+ =Gd 3+ , Y 3+ , La 3+ ) ions, which deepens the depth (E t ) or/and increases the density (n 0 ) of traps, greatly improved the afterglow properties of CdSiO 3 : Tb 3+ . Possible mechanism of CdSiO 3 : Tb 3+ , Re 3+ was discussed in this work. - Highlights: • CdSiO 3 : Tb 3+ , Re 3+ samples enrich the color of long-lasting afterglow phosphors in CdSiO 3 host. • Both the afterglow intensity and the lasting time are greatly enhanced for the co-doped samples, especially for Cd 0.96 SiO 3 : Tb 0.03 3+ , La 0.01 3+ . • Introduction of Re 3+ (Re 3+ =Gd 3+ , Y 3+ , La 3+ ) ions, which deepens the depth (E t ) or increase density(n 0 ) of traps, greatly improved the afterglow properties of CdSiO 3 : Tb 3+
Film grain synthesis and its application to re-graining
Schallauer, Peter; Mörzinger, Roland
2006-01-01
Digital film restoration and special effects compositing require more and more automatic procedures for movie regraining. Missing or inhomogeneous grain decreases perceived quality. For the purpose of grain synthesis an existing texture synthesis algorithm has been evaluated and optimized. We show that this algorithm can produce synthetic grain which is perceptually similar to a given grain template, which has high spatial and temporal variation and which can be applied to multi-spectral images. Furthermore a re-grain application framework is proposed, which synthesises based on an input grain template artificial grain and composites this together with the original image content. Due to its modular approach this framework supports manual as well as automatic re-graining applications. Two example applications are presented, one for re-graining an entire movie and one for fully automatic re-graining of image regions produced by restoration algorithms. Low computational cost of the proposed algorithms allows application in industrial grade software.
International Nuclear Information System (INIS)
Kim, Tae Hyeon; Jeong, Ji Hwan
2016-01-01
Highlights: • It is required to evaluate re-evolved iodine from sump water after LOCA. • Transport of iodine and chemicals influencing pH were analyzed using CFD. • Chemical conditions of the iodine-rich region suppress iodine re-evolution. • The current evaluation method for I 2 re-evolution is excessively conservative. - Abstract: Radioactive iodine that is released during a postulated loss of coolant accident is dissolved into the containment spray water and transported into the in-containment refueling water storage tank (IRWST). The re-evolution of iodine from the water is a safety concern. In this study, three-dimensional computational fluid dynamics (CFD) analyses are conducted in order to analyze the transport of chemical species including iodine in the IRWST and to calculate the amount of iodine that re-evolves from the IRWST water. The CFD analyses demonstrate that the pH of water is high where the iodine concentration is high. Considering that the creation rate of molecular iodine declines as the pH increases, it can be understood that the iodine re-evolution is not so strong in practical situations because the chemical conditions of the iodine-rich region suppress the re-evolution of the iodine. In addition, four different methods for evaluating the amount of re-evolved iodine are examined. The amount of re-evolved iodine calculated using the total-volume-average values, which are currently used for safety analyses, appear to be significantly higher than those determined using other methods. The amount of re-evolved iodine estimated using a realistic method with a conservative assumption of volatilization appears to be approximately one thousandth of that evaluated using the current method. This implies that the current method is very conservative.
A novel steel RE-borosulphurizing and mechanical properties of the produced RE-borosulfide layer
Wang, Dong; Li, Yun-dong; Zhang, Xiu-li
2013-07-01
In this study, 45# carbon steels were boronized, borosulphurized and RE-borosulphurized at 950 °C for 6 h, respectively. The samples were then characterized by scanning electron microscopy, X-ray diffraction, Auger electron spectroscopy, microhardness tester and ring-on-block wear tester. It has shown that the diffusion front (the interface between the diffusion layer and the substrate) of the boride layer (BL) and the boro-sulfide layer (BSL) is saw tooth shape, while the diffusion front of the RE-boro-sulfide layer (RBSL) is flat. Compared with BSL layer, RBSL layer has a smaller and more uniform grain size, and a flatter hardness gradient from the surface to the diffusion front. The RBSL layer, consisting of an outer layer (from surface to 30 μm) mainly composed of Fe-B and an inner layer (from 30 μm to the diffusion front) mainly composed of Fe-S, has the best wear resistance and the most sufficient adhesion among those three.