WorldWideScience

Sample records for hydrocarbon-degrading azoarcus spp

  1. Azoarcus sp. CIB, an anaerobic biodegrader of aromatic compounds shows an endophytic lifestyle.

    Directory of Open Access Journals (Sweden)

    Helga Fernández

    Full Text Available BACKGROUND: Endophytic bacteria that have plant growth promoting traits are of great interest in green biotechnology. The previous thought that the Azoarcus genus comprises bacteria that fit into one of two major eco-physiological groups, either free-living anaerobic biodegraders of aromatic compounds or obligate endophytes unable to degrade aromatics under anaerobic conditions, is revisited here. METHODOLOGY/PRINCIPAL FINDINGS: Light, confocal and electron microscopy reveal that Azoarcus sp. CIB, a facultative anaerobe β-proteobacterium able to degrade aromatic hydrocarbons under anoxic conditions, is also able to colonize the intercellular spaces of the rice roots. In addition, the strain CIB displays plant growth promoting traits such nitrogen fixation, uptake of insoluble phosphorus and production of indoleacetic acid. Therefore, this work demonstrates by the first time that a free-living bacterium able to degrade aromatic compounds under aerobic and anoxic conditions can share also an endophytic lifestyle. The phylogenetic analyses based on the 16S rDNA and nifH genes confirmed that obligate endophytes of the Azoarcus genus and facultative endophytes, such as Azoarcus sp. CIB, locate into different evolutionary branches. CONCLUSIONS/SIGNIFICANCE: This is the first report of a bacterium, Azoarcus sp. CIB, able to degrade anaerobically a significant number of aromatic compounds, some of them of great environmental concern, and to colonize the rice as a facultative endophyte. Thus, Azoarcus sp. CIB becomes a suitable candidate for a more sustainable agricultural practice and phytoremediation technology.

  2. Polyphasic analysis of an Azoarcus-Leptothrix-dominated bacterial biofilm developed on stainless steel surface in a gasoline-contaminated hypoxic groundwater.

    Science.gov (United States)

    Benedek, Tibor; Táncsics, András; Szabó, István; Farkas, Milán; Szoboszlay, Sándor; Fábián, Krisztina; Maróti, Gergely; Kriszt, Balázs

    2016-05-01

    Pump and treat systems are widely used for hydrocarbon-contaminated groundwater remediation. Although biofouling (formation of clogging biofilms on pump surfaces) is a common problem in these systems, scarce information is available regarding the phylogenetic and functional complexity of such biofilms. Extensive information about the taxa and species as well as metabolic potential of a bacterial biofilm developed on the stainless steel surface of a pump submerged in a gasoline-contaminated hypoxic groundwater is presented. Results shed light on a complex network of interconnected hydrocarbon-degrading chemoorganotrophic and chemolitotrophic bacteria. It was found that besides the well-known hydrocarbon-degrading aerobic/facultative anaerobic biofilm-forming organisms (e.g., Azoarcus, Leptothrix, Acidovorax, Thauera, Pseudomonas, etc.), representatives of Fe(2+)-and Mn(2+)-oxidizing (Thiobacillus, Sideroxydans, Gallionella, Rhodopseudomonas, etc.) as well as of Fe(3+)- and Mn(4+)-respiring (Rhodoferax, Geobacter, Magnetospirillum, Sulfurimonas, etc.) bacteria were present in the biofilm. The predominance of β-Proteobacteria within the biofilm bacterial community in phylogenetic and functional point of view was revealed. Investigation of meta-cleavage dioxygenase and benzylsuccinate synthase (bssA) genes indicated that within the biofilm, Azoarcus, Leptothrix, Zoogloea, and Thauera species are most probably involved in intrinsic biodegradation of aromatic hydrocarbons. Polyphasic analysis of the biofilm shed light on the fact that subsurface microbial accretions might be reservoirs of novel putatively hydrocarbon-degrading bacterial species. Moreover, clogging biofilms besides their detrimental effects might supplement the efficiency of pump and treat systems.

  3. Distribution of Anaerobic Hydrocarbon-Degrading Bacteria in Soils from King George Island, Maritime Antarctica.

    Science.gov (United States)

    Sampaio, Dayanna Souza; Almeida, Juliana Rodrigues Barboza; de Jesus, Hugo E; Rosado, Alexandre S; Seldin, Lucy; Jurelevicius, Diogo

    2017-11-01

    Anaerobic diesel fuel Arctic (DFA) degradation has already been demonstrated in Antarctic soils. However, studies comparing the distribution of anaerobic bacterial groups and of anaerobic hydrocarbon-degrading bacteria in Antarctic soils containing different concentrations of DFA are scarce. In this study, functional genes were used to study the diversity and distribution of anaerobic hydrocarbon-degrading bacteria (bamA, assA, and bssA) and of sulfate-reducing bacteria (SRB-apsR) in highly, intermediate, and non-DFA-contaminated soils collected during the summers of 2009, 2010, and 2011 from King George Island, Antarctica. Signatures of bamA genes were detected in all soils analyzed, whereas bssA and assA were found in only 4 of 10 soils. The concentration of DFA was the main factor influencing the distribution of bamA-containing bacteria and of SRB in the analyzed soils, as shown by PCR-DGGE results. bamA sequences related to genes previously described in Desulfuromonas, Lautropia, Magnetospirillum, Sulfuritalea, Rhodovolum, Rhodomicrobium, Azoarcus, Geobacter, Ramlibacter, and Gemmatimonas genera were dominant in King George Island soils. Although DFA modulated the distribution of bamA-hosting bacteria, DFA concentration was not related to bamA abundance in the soils studied here. This result suggests that King George Island soils show functional redundancy for aromatic hydrocarbon degradation. The results obtained in this study support the hypothesis that specialized anaerobic hydrocarbon-degrading bacteria have been selected by hydrocarbon concentrations present in King George Island soils.

  4. Biofuel components change the ecology of bacterial volatile petroleum hydrocarbon degradation in aerobic sandy soil

    International Nuclear Information System (INIS)

    Elazhari-Ali, Abdulmagid; Singh, Arvind K.; Davenport, Russell J.; Head, Ian M.; Werner, David

    2013-01-01

    We tested the hypothesis that the biodegradation of volatile petroleum hydrocarbons (VPHs) in aerobic sandy soil is affected by the blending with 10 percent ethanol (E10) or 20 percent biodiesel (B20). When inorganic nutrients were scarce, competition between biofuel and VPH degraders temporarily slowed monoaromatic hydrocarbon degradation. Ethanol had a bigger impact than biodiesel, reflecting the relative ease of ethanol compared to methyl ester biodegradation. Denaturing gradient gel electrophoresis (DGGE) of bacterial 16S rRNA genes revealed that each fuel mixture selected for a distinct bacterial community, each dominated by Pseudomonas spp. Despite lasting impacts on soil bacterial ecology, the overall effects on VHP biodegradation were minor, and average biomass yields were comparable between fuel types, ranging from 0.40 ± 0.16 to 0.51 ± 0.22 g of biomass carbon per gram of fuel carbon degraded. Inorganic nutrient availability had a greater impact on petroleum hydrocarbon biodegradation than fuel composition. Highlights: ► The effect of 10% ethanol or 20% biodiesel on the biodegradability of volatile petroleum hydrocarbons in soil was investigated. ► Competition for scarce inorganic nutrients between biofuel and VPH degraders slowed monoaromatic hydrocarbon degradation. ► Biofuel effects were transitional. ► Each fuel selected for a distinct predominant bacterial community. ► All bacterial communities were dominated by Pseudomonas spp. - Blending of petroleum with ethanol or biodiesel changes the fuel degrading soil bacterial community structure, but the long-term effects on fuel biodegradability are minor.

  5. Degradation of volatile hydrocarbons from steam-classified solid waste by a mixture of aromatic hydrocarbon-degrading bacteria.

    Science.gov (United States)

    Leahy, Joseph G; Tracy, Karen D; Eley, Michael H

    2003-03-01

    Steam classification is a process for treatment of solid waste that allows recovery of volatile organic compounds from the waste via steam condensate and off-gases. A mixed culture of aromatic hydrocarbon-degrading bacteria was used to degrade the contaminants in the condensate, which contained approx. 60 hydrocarbons, of which 38 were degraded within 4 d. Many of the hydrocarbons, including styrene, 1,2,4-trimethylbenzene, naphthalene, ethylbenzene, m-/p-xylene, chloroform, 1,3-dichloropropene, were completely or nearly completely degraded within one day, while trichloroethylene and 1,2,3-trichloropropane were degraded more slowly.

  6. Hydrocarbon-degrading sulfate-reducing bacteria in marine hydrocarbon seep sediments

    OpenAIRE

    Kleindienst, Sara

    2012-01-01

    Microorganisms are key players in our biosphere because of their ability to degrade various organic compounds including a wide range of hydrocarbons. At marine hydrocarbon seeps, more than 90% of sulfate reduction (SR) is potentially coupled to non-methane hydrocarbon oxidation. Several hydrocarbon-degrading sulfate-reducing bacteria (SRB) were enriched or isolated from marine sediments. However, in situ active SRB remained largely unknown. In the present thesis, the global distribution and a...

  7. Using microorganisms to aid in hydrocarbon degradation

    International Nuclear Information System (INIS)

    Black, W.; Zamora, J.

    1993-01-01

    Aliphatic hydrocarbons are threatening the potable water supply and the aquatic ecosystem. Given the right microbial inhabitant(s), a large portion of these aliphatic hydrocarbons could be biodegraded before reaching the water supply. The authors' purpose is to isolate possible oil-degrading organisms. Soil samples were taken from hydrocarbon-laden soils at petroleum terminals, a petroleum refinery waste-treatment facility, a sewage-treatment plant grease collector, a site of previous bioremediation, and various other places. Some isolates known to be good degraders were obtained from culture collection services. These samples were plated on a 10w-30 multigrade motor oil solid medium to screen for aliphatic hydrocarbon degraders. The degrading organisms were isolated, identified, and tested (CO 2 evolution, BOD, and COD) to determine the most efficient degrader(s). Thirty-seven organisms were tested, and the most efficient degraders were Serratia marcescens, Escherichia coli, and Enterobacter agglomerans

  8. Microbial consortia involved in the anaerobic degradation of hydrocarbons.

    Science.gov (United States)

    Zwolinski; Harris, R F; Hickey, W J

    2000-01-01

    In this review, we examine the energetics of well-characterized biodegradation pathways and explore the possibilities for these to support growth of multiple organisms interacting in consortia. The relevant phenotypic and/or phylogenetic characteristics of isolates and consortia mediating hydrocarbon degradation coupled with different terminal electron-accepting processes (TEAP) are also reviewed. While the information on metabolic pathways has been gained from the analysis of individual isolates, the energetic framework presented here demonstrates that microbial consortia could be readily postulated for hydrocarbon degradation coupled to any TEAP. Several specialized reactions occur within these pathways, and the organisms mediating these are likely to play a key role in defining the hydrocarbon degradation characteristics of the community under a given TEAP. Comparing these processes within and between TEAPs reveals biological unity in that divergent phylotypes display similar degradation mechanisms and biological diversity in that hydrocarbon-degraders closely related as phylotypes differ in the type and variety of hydrocarbon degradation pathways they possess. Analysis of microcosms and of field samples suggests that we have only begun to reveal the diversity of organisms mediating anaerobic hydrocarbon degradation. Advancements in the understanding of how hydrocarbon-degrading communities function will be significantly affected by the extent to which organisms mediating specialized reactions can be identified, and tools developed to allow their study in situ.

  9. Degradation of petroleum hydrocarbons in a laboratory aquifer column

    International Nuclear Information System (INIS)

    Billowits, M.; Whyte, L.; Greer, C.; Ramsay, J.

    1998-01-01

    One of the primary mechanisms for eliminating hydrocarbon pollutants from the environment is degradation of hydrocarbons by indigenous microorganisms. This report describes a study in which samples from a petroleum polluted shallow aquifer in the Yukon were used which contained a hundred times greater concentration of psychrotropic bacteria than mesophilic bacteria. Results showed a maximum degradation of 47 per cent of the total petroleum hydrocarbon in columns which simulated the aquifer conditions and to which nutrients were added. It was concluded that although in this case bioaugmentation of the columns with a psychrotropic hydrocarbon-degrading consortium increased microbial numbers, total petroleum hydrocarbon degradation was not much greater than could be achieved by remediation with nutrients alone

  10. Hydrocarbon-degradation by Isolate Pseudomonas lundensis UTAR FPE2

    Directory of Open Access Journals (Sweden)

    Adeline, S. Y. Ting

    2009-01-01

    Full Text Available In this study, the potential of isolate Pseudomonas lundensis UTAR FPE2 as a hydrocarbon degrader was established. Their biodegradation activity was first detected with the formation of clearing zones on Bushnell-Hass agar plates, with the largest diameter observed on plates supplemented with paraffin, followed by mineral oil and petrol. Utilization of hydrocarbon sources were again detected in broth cultures supplemented with similar hydrocarbon substrates, where the mean viable cell count recovered from hydrocarbon-supplemented broth cultures were higher than the initial inoculum except for napthalene. In both tests, the isolate showed higher degradability towards aliphatic hydrocarbon sources, and the least activity towards the aromatic hydrocarbon naphthalene. The isolate P. lundensis UTAR FPE2 (8 log10 cfu/mL also degraded crude diesel sample, with 69% degradation during the first three days. To conclude, this study suggests the potential use of this isolate for bioremediation of hydrocarbon-contaminated environments.

  11. Cultivation-dependent and cultivation-independent characterisation of hydrocarbon-degrading bacteria in Guaymas Basin sediments

    Directory of Open Access Journals (Sweden)

    Tony eGutierrez

    2015-07-01

    Full Text Available Marine hydrocarbon-degrading bacteria perform a fundamental role in the biodegradation of crude oil and its petrochemical derivatives in coastal and open ocean environments. However, there is a paucity of knowledge on the diversity and function of these organisms in deep-sea sediment. Here we used stable-isotope probing (SIP, a valuable tool to link the phylogeny and function of targeted microbial groups, to investigate polycyclic aromatic hydrocarbon (PAH-degrading bacteria under aerobic conditions in sediments from Guaymas Basin with uniformly labeled [13C]phenanthrene. The dominant sequences in clone libraries constructed from 13C-enriched bacterial DNA (from phenanthrene enrichments were identified to belong to the genus Cycloclasticus. We used quantitative PCR primers targeting the 16S rRNA gene of the SIP-identified Cycloclasticus to determine their abundance in sediment incubations amended with unlabeled phenanthrene and showed substantial increases in gene abundance during the experiments. We also isolated a strain, BG-2, representing the SIP-identified Cycloclasticus sequence (99.9% 16S rRNA gene sequence identity, and used this strain to provide direct evidence of phenanthrene degradation and mineralization. In addition, we isolated Halomonas, Thalassospira and Lutibacterium spp. with demonstrable phenanthrene-degrading capacity from Guaymas Basin sediment. This study demonstrates the value of coupling SIP with cultivation methods to identify and expand on the known diversity of PAH-degrading bacteria in the deep-sea.

  12. Degradation of tetraethyllead during the degradation of leaded gasoline hydrocarbons in soil

    International Nuclear Information System (INIS)

    Mulroy, P.T.; Ou, L.T.

    1998-01-01

    For over 50 years, leaded gasoline was the only fuel for automobiles, and tetraethyllead (TEL) was the major octane number enhancer used in leaded gasoline. Ample information is available on the fate and remediation of gasoline hydrocarbons in contaminated subsoils and groundwater. However, little is known regarding the fate of TEL in leaded gasoline-contaminated subsoils and groundwater. In soil not contaminated with gasoline, TEL was rapidly degraded and completely disappeared in 14 d. In gasoline-contaminated soil, TEL degradation was slower; after 77 d, 4 to 17% of the applied TEL still remained in the contaminated soil. Disappearance of total petroleum hydrocarbons (TPH) was initially rapid but slowed appreciably after 7 to 14 d. As a result, after 77 d, 33 to 51% of the applied gasoline still remained in soil. The retardation of TEL degradation in leaded gasoline-contaminated soil is due to the presence of gasoline hydrocarbons. As long as gasoline hydrocarbons remain in soil, TEL may also remain in soil, most likely in the gasoline hydrocarbon phase

  13. Hydrocarbon-degrading bacteria isolation and surfactant influence ...

    African Journals Online (AJOL)

    Hydrocarbons are substantially insoluble in water, often remaining partitioned in the non-aqueous phase liquid (NAPL). However, there had been little or no attempts to advance the bioavailability of hydrocarbons through the use of surfactants. This study was conducted based on the need to isolate hydrocarbon degrading ...

  14. In Situ Hydrocarbon Degradation by Indigenous Nearshore Bacterial Populations

    International Nuclear Information System (INIS)

    Cherrier, J.

    2005-01-01

    Potential episodic hydrocarbon inputs associated with oil mining and transportation together with chronic introduction of hydrocarbons via urban runoff into the relatively pristine coastal Florida waters poses a significant threat to Florida's fragile marine environment. It is therefore important to understand the extent to which indigenous bacterial populations are able to degrade hydrocarbon compounds and also determine factors that could potentially control and promote the rate at which these compounds are broken down in situ. Previous controlled laboratory experiments carried out by our research group demonstrated that separately both photo-oxidation and cometabolism stimulate bacterial hydrocarbon degradation by natural bacterial assemblages collected from a chronically petroleum contaminated site in Bayboro Bay, Florida. Additionally, we also demonstrated that stable carbon and radiocarbon abundances of respired CO 2 could be used to trace in situ hydrocarbon degradation by indigenous bacterial populations at this same site. This current proposal had two main objectives: (a) to evaluate the cumulative impact of cometabolism and photo-oxidation on hydrocarbon degradation by natural bacterial assemblages collected the same site in Bayboro Bay, Florida and (b) to determine if in situ hydrocarbon degradation by indigenous bacterial populations this site could be traced using natural radiocarbon and stable carbon abundances of assimilated bacterial carbon. Funds were used for 2 years of full support for one ESI Ph.D. student, April Croxton. To address our first objective a series of closed system bacterial incubations were carried out using photo-oxidized petroleum and pinfish (i.e. cometabolite). Bacterial production of CO 2 was used as the indicator of hydrocarbon degradation and (delta) 13 C analysis of the resultant CO 2 was used to evaluate the source of the respired CO 2 (i.e. petroleum hydrocarbons or the pinfish cometabolite). Results from these time

  15. Microbial characterization of toluene-degrading denitrifying consortia obtained from terrestrial and marine ecosystems.

    Science.gov (United States)

    An, Y-J; Joo, Y-H; Hong, I-Y; Ryu, H-W; Cho, K-S

    2004-10-01

    The degradation characteristics of toluene coupled to nitrate reduction were investigated in enrichment culture and the microbial communities of toluene-degrading denitrifying consortia were characterized by denaturing gradient gel electrophoresis (DGGE) technique. Anaerobic nitrate-reducing bacteria were enriched from oil-contaminated soil samples collected from terrestrial (rice field) and marine (tidal flat) ecosystems. Enriched consortia degraded toluene in the presence of nitrate as a terminal electron acceptor. The degradation rate of toluene was affected by the initial substrate concentration and co-existence of other hydrocarbons. The types of toluene-degrading denitrifying consortia depended on the type of ecosystem. The clone RS-7 obtained from the enriched consortium of the rice field was most closely related to a toluene-degrading and denitrifying bacterium, Azoarcus denitrificians (A. tolulyticus sp. nov.). The clone TS-11 detected in the tidal flat enriched consortium was affiliated to Thauera sp. strain S2 (T. aminoaromatica sp. nov.) that was able to degrade toluene under denitrifying conditions. This indicates that environmental factors greatly influence microbial communities obtained from terrestrial (rice field) and marine (tidal flat) ecosystems.

  16. Strong Impact on the Polycyclic Aromatic Hydrocarbon (PAH)-Degrading Community of a PAH-Polluted Soil but Marginal Effect on PAH Degradation when Priming with Bioremediated Soil Dominated by Mycobacteria

    DEFF Research Database (Denmark)

    Johnsen, Anders R.; Schmidt, Stine; Hybholdt, Trine K.

    2007-01-01

    Bioaugmentation of soil polluted with polycyclic aromatic hydrocarbons (PAHs) is often disappointing because of the low survival rate and low activity of the introduced degrader bacteria. We therefore investigated the possibility of priming PAH degradation in soil by adding 2% of bioremediated soil...... with a high capacity for PAH degradation. The culturable PAH-degrading community of the bioremediated primer soil was dominated by Mycobacterium spp. A microcosm containing pristine soil artificially polluted with PAHs and primed with bioremediated soil showed a fast, 100- to 1,000-fold increase in numbers...... of culturable phenanthrene-, pyrene-, and fluoranthene degraders and a 160-fold increase in copy numbers of the mycobacterial PAH dioxygenase gene pdo1. A nonpolluted microcosm primed with bioremediated soil showed a high rate of survival of the introduced degrader community during the 112 days of incubation...

  17. Radiolytic degradation of chlorinated hydrocarbons in water

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Xing-Zheng; Yamamoto, Takeshi [Fukui Univ., Faculty of Engineering, Dept. of Materials Science and Engineering, Fukui (Japan); Hatashita, Masanori [The Wakasa Wan Energy Research Center, Research Dept., Tsuruga, Fukui (Japan)

    2002-11-01

    Radiolytic degradation of chlorinated hydrocarbons (chloroform, trichloroethylene, and tetrachloroethylene) in water was carried out. Water solutions of the chlorinated hydrocarbons with different concentrations were irradiated with {gamma} rays. Concentrations of methane, ethane, CO, CO{sub 2}, H{sub 2}, and O{sub 2} after the irradiation were determined by gas chromatography. Concentration of chloride ion in the irradiated sample was determined by ion chromatography. Experimental results show that radiolytic degradation of the chlorinated hydrocarbon increased with the radiation dose. Methane, ethane, CO{sub 2}, H{sub 2}, and Cl{sup -} concentrations increased with the radiation dose and the sample concentration. On the other hand, O{sub 2} concentration decreased with the radiation dose and the sample concentration. When sample concentration was high, dissolved oxygen might be not enough for converting most of the C atoms in the sample into CO{sub 2}. This resulted in a low decomposition ratio. Addition of H{sub 2}O{sub 2} as an oxygen resource could increase the decomposition ratio greatly. Furthermore, gas chromatography-mass spectroscopy was applied to identify some intermediates of the radiolytic dehalogenation. Radiolytic degradation mechanisms are also discussed. (author)

  18. Identification of anthraquinone-degrading bacteria in soil contaminated with polycyclic aromatic hydrocarbons.

    Science.gov (United States)

    Rodgers-Vieira, Elyse A; Zhang, Zhenfa; Adrion, Alden C; Gold, Avram; Aitken, Michael D

    2015-06-01

    Quinones and other oxygenated polycyclic aromatic hydrocarbons (oxy-PAHs) are toxic and/or genotoxic compounds observed to be cocontaminants at PAH-contaminated sites, but their formation and fate in contaminated environmental systems have not been well studied. Anthracene-9,10-dione (anthraquinone) has been found in most PAH-contaminated soils and sediments that have been analyzed for oxy-PAHs. However, little is known about the biodegradation of oxy-PAHs, and no bacterial isolates have been described that are capable of growing on or degrading anthraquinone. PAH-degrading Mycobacterium spp. are the only organisms that have been investigated to date for metabolism of a PAH quinone, 4,5-pyrenequinone. We utilized DNA-based stable-isotope probing (SIP) with [U-(13)C]anthraquinone to identify bacteria associated with anthraquinone degradation in PAH-contaminated soil from a former manufactured-gas plant site both before and after treatment in a laboratory-scale bioreactor. SIP with [U-(13)C]anthracene was also performed to assess whether bacteria capable of growing on anthracene are the same as those identified to grow on anthraquinone. Organisms closely related to Sphingomonas were the most predominant among the organisms associated with anthraquinone degradation in bioreactor-treated soil, while organisms in the genus Phenylobacterium comprised the majority of anthraquinone degraders in the untreated soil. Bacteria associated with anthracene degradation differed from those responsible for anthraquinone degradation. These results suggest that Sphingomonas and Phenylobacterium species are associated with anthraquinone degradation and that anthracene-degrading organisms may not possess mechanisms to grow on anthraquinone. Copyright © 2015, American Society for Microbiology. All Rights Reserved.

  19. Dominant petroleum hydrocarbon-degrading bacteria in the Archipelago Sea in South-West Finland (Baltic Sea) belong to different taxonomic groups than hydrocarbon degraders in the oceans.

    Science.gov (United States)

    Reunamo, Anna; Riemann, Lasse; Leskinen, Piia; Jørgensen, Kirsten S

    2013-07-15

    The natural petroleum hydrocarbon degrading capacity of the Archipelago Sea water in S-W Finland was studied in a microcosm experiment. Pristine and previously oil exposed sites were examined. Bacterial community fingerprinting was performed using terminal restriction fragment length polymorphism (T-RFLP) and samples from selected microcosms were sequenced. The abundance of PAH degradation genes was measured by quantitative PCR. Bacterial communities in diesel exposed microcosms diverged from control microcosms during the experiment. Gram positive PAH degradation genes dominated at both sites in situ, whereas gram negative PAH degrading genes became enriched in diesel microcosms. The dominant bacterial groups after a 14 days of diesel exposure were different depending on the sampling site, belonging to the class Actinobacteria (32%) at a pristine site and Betaproteobacteria (52%) at a previously oil exposed site. The hydrocarbon degrading bacteria in the Baltic Sea differ from those in the oceans, where most hydrocarbon degraders belong to Gammaproteobacteria. Copyright © 2013 Elsevier Ltd. All rights reserved.

  20. Hydrocarbon degradation potential in reference soils and soils contaminated with jet fuel

    International Nuclear Information System (INIS)

    Lee, R.F.; Hoeppel, R.

    1991-01-01

    Petroleum degradation in surface and subsurface soils is affected by such factors as moisture content, pH, soil type, soil organics, temperature, and oxygen concentrations. In this paper, the authors determine the degradation rates of 14 C-labeled hydrocarbons added to soils collected from a contaminated surface site, contaminated subsurface sites, and a clean reference site. The radiolabeled hydrocarbons used include benzene, toluene, naphthalene, 1-methynaphthalene, phenanthrene, fluorene, anthracene, chrysene, and hexadecane. Microbial degradation rates were based on determination of mineralization rates (production of 14 CO 2 ) of hydrocarbons that were added to soil samples. Since water was added and oxygen was not limiting, the hydrocarbon rates determined are likely to be higher than those occurring in situ. Using radiolabeled hydrocarbons, information can be provided on differences in the degradation rates of various petroleum compounds in different types of soils at a site, on possible production of petroleum metabolites in the soil, and on the importance of anaerobic petroleum degradation and the effects of nutrient, water, and surfactant addition on biodegradation rates

  1. Microbial Hydrocarbon and ToxicPollutant Degradation Method

    Energy Technology Data Exchange (ETDEWEB)

    Schlueter, Dietrich [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Janabi, Mustafa [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); O' Neil, James [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Budinger, Thomas [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)

    2011-08-16

    The goal of this project is to determine optimum conditions for bacterial oxidation of hydrocarbons and long-chain alkanes that are representative of petroleum contamination of the environment. Polycyclic Aromatic Hydrocarbons (PAHs) are of concern because of their toxicity, low volatility, and resistance to microbial degradation, especially under anaerobic conditions. The uniqueness of our approach is to use carbon-11 in lieu of the traditional use of carbon-14.

  2. Comparative Genomics of the Ubiquitous, Hydrocarbon-degrading Genus Marinobacter

    Science.gov (United States)

    Singer, E.; Webb, E.; Edwards, K. J.

    2012-12-01

    The genus Marinobacter is amongst the most ubiquitous in the global oceans and strains have been isolated from a wide variety of marine environments, including offshore oil-well heads, coastal thermal springs, Antarctic sea water, saline soils and associations with diatoms and dinoflagellates. Many strains have been recognized to be important hydrocarbon degraders in various marine habitats presenting sometimes extreme pH or salinity conditions. Analysis of the genome of M. aquaeolei revealed enormous adaptation versatility with an assortment of strategies for carbon and energy acquisition, sensation, and defense. In an effort to elucidate the ecological and biogeochemical significance of the Marinobacters, seven Marinobacter strains from diverse environments were included in a comparative genomics study. Genomes were screened for metabolic and adaptation potential to elucidate the strategies responsible for the omnipresence of the Marinobacter genus and their remedial action potential in hydrocarbon-polluted waters. The core genome predominantly encodes for key genes involved in hydrocarbon degradation, biofilm-relevant processes, including utilization of external DNA, halotolerance, as well as defense mechanisms against heavy metals, antibiotics, and toxins. All Marinobacter strains were observed to degrade a wide spectrum of hydrocarbon species, including aliphatic, polycyclic aromatic as well as acyclic isoprenoid compounds. Various genes predicted to facilitate hydrocarbon degradation, e.g. alkane 1-monooxygenase, appear to have originated from lateral gene transfer as they are located on gene clusters of 10-20% lower GC-content compared to genome averages and are flanked by transposases. Top ortholog hits are found in other hydrocarbon degrading organisms, e.g. Alcanivorax borkumensis. Strategies for hydrocarbon uptake encoded by various Marinobacter strains include cell surface hydrophobicity adaptation via capsular polysaccharide biosynthesis and attachment

  3. Limitations of microbial hydrocarbon degradation at the Amon mud volcano (Nile deep-sea fan

    Directory of Open Access Journals (Sweden)

    J. Felden

    2013-05-01

    Full Text Available The Amon mud volcano (MV, located at 1250 m water depth on the Nile deep-sea fan, is known for its active emission of methane and non-methane hydrocarbons into the hydrosphere. Previous investigations showed a low efficiency of hydrocarbon-degrading anaerobic microbial communities inhabiting the Amon MV center in the presence of sulfate and hydrocarbons in the seeping subsurface fluids. By comparing spatial and temporal patterns of in situ biogeochemical fluxes, temperature gradients, pore water composition, and microbial activities over 3 yr, we investigated why the activity of anaerobic hydrocarbon degraders can be low despite high energy supplies. We found that the central dome of the Amon MV, as well as a lateral mud flow at its base, showed signs of recent exposure of hot subsurface muds lacking active hydrocarbon degrading communities. In these highly disturbed areas, anaerobic degradation of methane was less than 2% of the methane flux. Rather high oxygen consumption rates compared to low sulfide production suggest a faster development of more rapidly growing aerobic hydrocarbon degraders in highly disturbed areas. In contrast, the more stabilized muds surrounding the central gas and fluid conduits hosted active anaerobic hydrocarbon-degrading microbial communities. The low microbial activity in the hydrocarbon-vented areas of Amon MV is thus a consequence of kinetic limitations by heat and mud expulsion, whereas most of the outer MV area is limited by hydrocarbon transport.

  4. Bioremediation of hydrocarbon degradation in a petroleum-contaminated soil and microbial population and activity determination.

    Science.gov (United States)

    Wu, Manli; Li, Wei; Dick, Warren A; Ye, Xiqiong; Chen, Kaili; Kost, David; Chen, Liming

    2017-02-01

    Bioremediation of hydrocarbon degradation in petroleum-polluted soil is carried out by various microorganisms. However, little information is available for the relationships between hydrocarbon degradation rates in petroleum-contaminated soil and microbial population and activity in laboratory assay. In a microcosm study, degradation rate and efficiency of total petroleum hydrocarbons (TPH), alkanes, and polycyclic aromatic hydrocarbons (PAH) in a petroleum-contaminated soil were determined using an infrared photometer oil content analyzer and a gas chromatography mass spectrometry (GC-MS). Also, the populations of TPH, alkane, and PAH degraders were enumerated by a modified most probable number (MPN) procedure, and the hydrocarbon degrading activities of these degraders were determined by the Biolog (MT2) MicroPlates assay. Results showed linear correlations between the TPH and alkane degradation rates and the population and activity increases of TPH and alkane degraders, but no correlation was observed between the PAH degradation rates and the PAH population and activity increases. Petroleum hydrocarbon degrading microbial population measured by MPN was significantly correlated with metabolic activity in the Biolog assay. The results suggest that the MPN procedure and the Biolog assay are efficient methods for assessing the rates of TPH and alkane, but not PAH, bioremediation in oil-contaminated soil in laboratory. Copyright © 2016 Elsevier Ltd. All rights reserved.

  5. Selection of bacteria with hydrocarbon degrading capacity isolated from Colombian Caribbean sediments

    International Nuclear Information System (INIS)

    Narvaez Florez, Silvia; Gomez, Martha L; Martinez Maria M

    2008-01-01

    Thirty one bacterial isolations in minimal salts supplemented medium with hydrocarbons (ACPM or crude oil) as sole carbon source were isolated from sediment samples from the Colombian Caribbean. Bacterial strains underwent selection tests in different concentrations of hydrocarbons; 11 tolerant crude oil and ACPM strains in a range of 1-8%v/v were chosen. A mixed bacterial culture was created and assessed its ability to degrade hydrocarbons in a laboratory-scale test, with a concentration of 2% v/v of ACPM over a period of 21 days. Measurements of biomass in Colony Forming Units (CFU)/mL were used to develop the growth curve of the mixed culture. Hydrocarbons remotion was measured by mass chromatography. The mixed culture was able to degrade the 68.6% of aliphatic hydrocarbons in preference of long chain n- alkenes (C12- C31), reaching a maximum growth of 3.13 x 10 9 UFC / mL. Degradation of aromatic hydrocarbons was not evidenced under the observation time. Nine of the eleven strains were identified using the biochemical systems BBL and API 50 CHB/E; they belonged to the genus Klebsiella, Chromobacterium, Flavimonas, Enterobacter,Pseudomonas, and Bacillus. The evaluated strains have enzymatic potential to degrade hydrocarbons and it is necessary to characterize them at molecular level in order to develop and effective consortium for field application

  6. BioDegradation of Refined Petroleum Hydrocarbons in Soil | Obire ...

    African Journals Online (AJOL)

    Carbon-dioxide production and hydrocarbon degradation of refined petroleum hydrocarbon in soils treated with 5% gasoline, kerosene and diesel oil were investigated. Soil for study was bulked from around a car park in Port Harcourt. Soil samples were collected at weekly intervals for four weeks and subsequently at ...

  7. Succession of Hydrocarbon Degradation and Microbial Diversity during a Simulated Petroleum Seepage in Caspian Sea Sediments

    Science.gov (United States)

    Mishra, S.; Stagars, M.; Wefers, P.; Schmidt, M.; Knittel, K.; Krueger, M.; Leifer, I.; Treude, T.

    2016-02-01

    Microbial degradation of petroleum was investigated in intact sediment cores of Caspian Sea during a simulated petroleum seepage using a sediment-oil-flow-through (SOFT) system. Over the course of the SOFT experiment (190 days), distinct redox zones established and evolved in the sediment core. Methanogenesis and sulfate reduction were identified to be important processes in the anaerobic degradation of hydrocarbons. C1 to C6 n-alkanes were completely exhausted in the sulfate-reducing zone and some higher alkanes decreased during the upward migration of petroleum. A diversity of sulfate-reducing bacteria was identified by 16s rRNA phylogenetic studies, some of which are associated with marine seeps and petroleum degradation. The δ13C signal of produced methane decreased from -33.7‰ to -49.5‰ indicating crude oil degradation by methanogenesis, which was supported by enrichment culturing of methanogens with petroleum hydrocarbons and presence of methanogenic archaea. The SOFT system is, to the best of our knowledge, the first system that simulates an oil-seep like condition and enables live monitoring of biogeochemical changes within a sediment core during petroleum seepage. During our presentation we will compare the Caspian Sea data with other sediments we studied using the SOFT system from sites such as Santa Barbara (Pacific Ocean), the North Alex Mud Volcano (Mediterranean Sea) and the Eckernfoerde Bay (Baltic Sea). This research was funded by the Deutsche Forschungsgemeinschaft (SPP 1319) and DEA Deutsche Erdoel AG. Further support came from the Helmholtz and Max Planck Gesellschaft.

  8. Isolation and Characterization of Hydrocarbon-Degrading Bacteria ...

    African Journals Online (AJOL)

    ADOWIE PERE

    June 2017. Vol. 21 (4) 641-645. Full-text Available Online at www.ajol.info and ... ABSTRACT: The isolation of hydrocarbon-degrading bacteria in topsoil and subsoil samples of ... This process whereby microorganisms break down ..... Page 5 ...

  9. Degradation of polynuclear aromatic hydrocarbons by two strains of Pseudomonas.

    Science.gov (United States)

    Nwinyi, Obinna C; Ajayi, Oluseyi O; Amund, Olukayode O

    2016-01-01

    The goal of this investigation was to isolate competent polynuclear aromatic hydrocarbons degraders that can utilize polynuclear aromatic hydrocarbons of former industrial sites at McDoel Switchyard in Bloomington, Indiana. Using conventional enrichment method based on soil slurry, we isolated, screened and purified two bacterial species strains PB1 and PB2. Applying the ribotyping technique using the 16S rRNA gene analysis, the strains were assigned to the genus Pseudomonas (Pseudomonas plecoglossicida strain PB1 and Pseudomonas sp. PB2). Both isolates showed promising metabolic capacity on pyrene sprayed MS agar plates during the preliminary investigations. Using time course studies in the liquid cultures at calculated concentrations 123, 64, 97 and 94ppm for naphthalene, chrysene, fluroanthene and pyrene, P. plecoglossicida strain PB1 and Pseudomonas sp. PB2 showed partial utilization of the polynuclear aromatic hydrocarbons. Naphthalene was degraded between 26% and 40%, chrysene 14% and 16%, fluroanthene 5% and 7%; pyrene 8% and 13% by P. plecoglossicida strain PB1 and Pseudomonas sp. PB2 respectively. Based on their growth profile, we developed a model R(2)=1 to predict the degradation rate of slow polynuclear aromatic hydrocarbon-degraders where all the necessary parameters are constant. From this investigation, we confirm that the former industrial site soil microbial communities may be explored for the biorestoration of the industrial site. Copyright © 2016. Published by Elsevier Editora Ltda.

  10. Anaerobic Microbial Degradation of Hydrocarbons: From Enzymatic Reactions to the Environment.

    Science.gov (United States)

    Rabus, Ralf; Boll, Matthias; Heider, Johann; Meckenstock, Rainer U; Buckel, Wolfgang; Einsle, Oliver; Ermler, Ulrich; Golding, Bernard T; Gunsalus, Robert P; Kroneck, Peter M H; Krüger, Martin; Lueders, Tillmann; Martins, Berta M; Musat, Florin; Richnow, Hans H; Schink, Bernhard; Seifert, Jana; Szaleniec, Maciej; Treude, Tina; Ullmann, G Matthias; Vogt, Carsten; von Bergen, Martin; Wilkes, Heinz

    2016-01-01

    Hydrocarbons are abundant in anoxic environments and pose biochemical challenges to their anaerobic degradation by microorganisms. Within the framework of the Priority Program 1319, investigations funded by the Deutsche Forschungsgemeinschaft on the anaerobic microbial degradation of hydrocarbons ranged from isolation and enrichment of hitherto unknown hydrocarbon-degrading anaerobic microorganisms, discovery of novel reactions, detailed studies of enzyme mechanisms and structures to process-oriented in situ studies. Selected highlights from this program are collected in this synopsis, with more detailed information provided by theme-focused reviews of the special topic issue on 'Anaerobic biodegradation of hydrocarbons' [this issue, pp. 1-244]. The interdisciplinary character of the program, involving microbiologists, biochemists, organic chemists and environmental scientists, is best exemplified by the studies on alkyl-/arylalkylsuccinate synthases. Here, research topics ranged from in-depth mechanistic studies of archetypical toluene-activating benzylsuccinate synthase, substrate-specific phylogenetic clustering of alkyl-/arylalkylsuccinate synthases (toluene plus xylenes, p-cymene, p-cresol, 2-methylnaphthalene, n-alkanes), stereochemical and co-metabolic insights into n-alkane-activating (methylalkyl)succinate synthases to the discovery of bacterial groups previously unknown to possess alkyl-/arylalkylsuccinate synthases by means of functional gene markers and in situ field studies enabled by state-of-the-art stable isotope probing and fractionation approaches. Other topics are Mo-cofactor-dependent dehydrogenases performing O2-independent hydroxylation of hydrocarbons and alkyl side chains (ethylbenzene, p-cymene, cholesterol, n-hexadecane), degradation of p-alkylated benzoates and toluenes, glycyl radical-bearing 4-hydroxyphenylacetate decarboxylase, novel types of carboxylation reactions (for acetophenone, acetone, and potentially also benzene and

  11. In vitro degradation of dicyclopentadiene by microbial consortia isolated from hydrocarbon-contaminated soil

    International Nuclear Information System (INIS)

    Stehmeier, L.G.; Voordouw, G.

    1996-01-01

    The degradation of dicyclopentadiene (DCPD), an extremely odoriferous by-product of the production of hydrocarbon feed stocks in petrochemical plants, was discussed. A laboratory study was described in which DCPD was degraded to carbon dioxide and oxygenated intermediates were established. More than 100 isolated organisms and cultures were screened for DCPD degradation using BIOLOG TM MT plates incubated in an atmosphere containing the test hydrocarbon. No single colony isolate readily mineralized DCPD, but mixed cultures produced 14 CO 2 when incubated with [ 14 C]DCPD. For bioremediation purposes, the objective was to remove odor. In the presence of a hydrocarbon degradation medium, the complete degradation to CO 2 was achieved in less than 6 months. 15 refs., 3 tabs., 4 figs

  12. Calculating in situ degradation rates of hydrocarbon compounds in deep waters of the Gulf of Mexico.

    Science.gov (United States)

    Thessen, Anne E; North, Elizabeth W

    2017-09-15

    Biodegradation is an important process for hydrocarbon weathering that influences its fate and transport, yet little is known about in situ biodegradation rates of specific hydrocarbon compounds in the deep ocean. Using data collected in the Gulf of Mexico below 700m during and after the Deepwater Horizon oil spill, we calculated first-order degradation rate constants for 49 hydrocarbons and inferred degradation rate constants for an additional 5 data-deficient hydrocarbons. Resulting calculated (not inferred) half-lives of the hydrocarbons ranged from 0.4 to 36.5days. The fastest degrading hydrocarbons were toluene (k=-1.716), methylcyclohexane (k=-1.538), benzene (k=-1.333), and C1-naphthalene (k=-1.305). The slowest degrading hydrocarbons were the large straight-chain alkanes, C-26 through C-33 (k=-0.0494 through k=-0.007). Ratios of C-18 to phytane supported the hypothesis that the primary means of degradation in the subsurface was microbial biodegradation. These degradation rate constants can be used to improve models describing the fate and transport of hydrocarbons in the event of an accidental deep ocean oil spill. Copyright © 2017 Elsevier Ltd. All rights reserved.

  13. Exploration of hydrocarbon degrading bacteria on soils contaminated by crude oil from South Sumatera

    Directory of Open Access Journals (Sweden)

    A. Napoleon

    2014-07-01

    Full Text Available The goal of this research was to explore hydrocarbon degrading bacteria on crude oil contaminated soil with potential to degrade hydrocarbon in oil pollutant. The research started by early August 2013 till January 2014. Soil sampling for this research was taken on several places with contaminated soil location such as Benakat, Rimau, and Pengabuan all of it located in South Sumatera. Conclusion from this research Isolates obtained from three (3 sites of contaminated soil and treated using SBS medium were Bacillus cereus, Pseudomonas aeruginosa, Klebsiella pnumoniae, Streptococcus beta hemolisa, Proteus mirabilis, Staphylococcus epidermis and Acinotobacter calcoaceticus. Isolates that survived on 300 ppm of hydrocarbon concentration were Bacillus cereus, Pseudomonas aeruginosa and Acinetobacter cakciaceticus Selected isolates posses the ability to degrade hydrocarbon by breaking hydrocarbon substance as the energy source to support isolates existence up to 1,67 TPH level. Based on results accomplish by this research, we urge for further research involving the capacity of isolates to degrade wide variety of hydrocarbon substance and more to develop the potential of these bacteria for bioremediation.

  14. Methanogenic degradation of petroleum hydrocarbons in subsurface environments remediation, heavy oil formation, and energy recovery.

    Science.gov (United States)

    Gray, N D; Sherry, A; Hubert, C; Dolfing, J; Head, I M

    2010-01-01

    Hydrocarbons are common constituents of surface, shallow, and deep-subsurface environments. Under anaerobic conditions, hydrocarbons can be degraded to methane by methanogenic microbial consortia. This degradation process is widespread in the geosphere. In comparison with other anaerobic processes, methanogenic hydrocarbon degradation is more sustainable over geological time scales because replenishment of an exogenous electron acceptor is not required. As a consequence, this process has been responsible for the formation of the world's vast deposits of heavy oil, which far exceed conventional oil assets such as those found in the Middle East. Methanogenic degradation is also a potentially important component of attenuation in hydrocarbon contamination plumes. Studies of the organisms, syntrophic partnerships, mechanisms, and geochemical signatures associated with methanogenic hydrocarbon degradation have identified common themes and diagnostic markers for this process in the subsurface. These studies have also identified the potential to engineer methanogenic processes to enhance the recovery of energy assets as biogenic methane from residual oils stranded in petroleum systems. Copyright 2010 Elsevier Inc. All rights reserved.

  15. Distribution and activity of petroleum hydrocarbon degrading bacteria in the North Sea and Baltic Sea

    International Nuclear Information System (INIS)

    Bruns, K.; Dahlmann, G.; Gunkel, W.

    1993-01-01

    Data were collected in 1988 and 1989 on the distribution and activity of petroleum hydrocarbon degrading bacteria in the North Sea and Baltic Sea. Crude oil degrading bacteria and the number of bacteria which in particular degrade naphthalene were quantified using a modified dilution method (MPN). Crude oil degrading bacteria were present in all of about 100 water samples, with as many as 10 3 ml -1 in some samples. Numbers of naphthalene degrading bacteria were at least tenfold lower. There is obviously a greater connection between this bacteria group and petroleum hydrocarbon (PHC) contamination than between the more nonspecific group of crude oil degrading bacteria and PHC contamination. Data from the North Sea show an extremely high abundance of hydrocarbon degrading bacteria, even in winter, while in the southern Baltic Sea low numbers of bacteria were found and slower crude oil degradation was observed. (orig.)

  16. Microbial hydrocarbon degradation - bioremediation of oil spills

    Energy Technology Data Exchange (ETDEWEB)

    Atlas, R M [Louisville Univ., KY (United States). Dept. of Biology

    1991-01-01

    Bioremediation has become a major method employed in restoration of oil-polluted environments that makes use of natural microbial biodegradative activities. Bioremediation of petroleum pollutants overcomes the factors limiting rates of microbial hydrocarbon biodegradation. Often this involves using the enzymatic capabilities of the indigenous hydrocarbon-degrading microbial populations and modifying environmental factors, particularly concentrations of molecular oxygen, fixed forms of nitrogen and phosphate to achieve enhanced rates of hydrocarbon biodegradation. Biodegradation of oily sludges and bioremediation of oil-contaminated sites has been achieved by oxygen addition-e.g. by tilling soils in landfarming and by adding hydrogen peroxide or pumping oxygen into oiled aquifers along with addition of nitrogen- and phosphorous-containing fertilizers. The success of seeding oil spills with microbial preparations is ambiguous. Successful bioremediation of a major marine oil spill has been achieved based upon addition of nitrogen and phosphorus fertilizers. (author).

  17. Hydrocarbon degradation potentials of bacteria isolated from spent ...

    African Journals Online (AJOL)

    Hydrocarbon degradation potentials of bacteria isolated from spent lubricating oil contaminated soil. ... This study has shown that resident bacteria strains in lubricating oil contaminated soils have potential application in the bioremediation of oil polluted sites and enhance the possibility of developing models and strategies ...

  18. Hydrocarbon Degradation In Poultry Droppings And Cassava Peels ...

    African Journals Online (AJOL)

    This greenhouse study was aimed at determining the potentials of poultry droppings (PD) and cassava peels (CP) for nutrient-enhanced biodegradation of petroleum hydrocarbon (THC) in a well drained Typic Paleustults using the THC levels and degradation duration as remediation indices. The performance of the organic ...

  19. Aromatic hydrocarbon degradation in hydrogen peroxide- and nitrate-amended microcosms

    International Nuclear Information System (INIS)

    Christian, B.J.; Pugh, L.B.; Clarke, B.H.

    1995-01-01

    Fifty microcosms were constructed using aquifer materials from a former coal gasification site and divided into four groups: poisoned control, nutrient-free control, hydrogen peroxide-amended, and nitrate-amended microcosms. Each microcosm contained site soil and groundwater in a 1.2-L glass media bottle. When depleted, hydrogen peroxide and sodium nitrate were injected into the microcosms. Microcosms were periodically sacrificed for analysis of polycyclic aromatic hydrocarbons (PAHs); monocyclic aromatic hydrocarbons (benzene, toluene, ethylbenzene, and xylenes [BTEX]); total petroleum hydrocarbons (TPH); and heterotrophic plate counts (HPCs). BTEX and two- and three-ringed PAHs were degraded in microcosms receiving electron-acceptor additions compared to poisoned controls. Four-, five-, and six-ringed PAHs were not significantly degraded during this study. Except in poisoned controls, significant amounts of dissolved oxygen (DO) or nitrate were utilized, and microbial populations increased by 3 to 5 orders of magnitude compared to site soils used to assemble the microcosms (i.e., baseline samples)

  20. Isolation and application of hydrocarbon degradation of indigenous microbial from oil contaminated soil

    International Nuclear Information System (INIS)

    Dadang Sudrajat; Nana Mulyana; Tri Retno DL

    2015-01-01

    The aims of this research are to obtain indigenous potential microbes from bacterial and fungal groups which have capable of degrading hydrocarbon from crude oil contaminated soil. The research carried out were isolation, selection, and identification potential microbial isolates capable of degrading hydrocarbon from oil contaminated soil located at Cepu East Java. The isolates were tested for their growth and ability to degrades crude oil. Each isolate was inoculated unto minimum mineral salt medium (MSM) contained 1% crude oil. Viability and stability test of selected isolates were carried out on irradiated compost carrier materials contained 5% crude oil. The fours series microbial s consortium consists of microbial consortium I, II, III, and IV were tested for the in vitro biodegradability of hydrocarbon. The results shows there sixty two (62) isolates are obtained, among them 42 bacteria and 20 molds. From 42 bacterial isolates, only 8 strains were potent hydrocarbon degraders. Three of these isolates are identified Bacillus cereus (BMC2), Bacillus sp (BMC4), and Pseudomonas sp (BMC6). Whereas from 20 fungal isolates, only 4 strains were potent hydrocarbon degraders. Two of these isolates are identified Aspergillus fumigatus (FMC2) and Aspergillus niger (FMC6). All isolates show good growth in mineral salt medium contained crude oil with decrease in pH. The ability of decrease of TPH content by the bacterial and fungal isolates were 54, 61, 67, 74, and 78% respectively at day 30. The viability and stability of microbial isolates show considerable good viability on irradiated compost carrier materials after 14 days storage. From the fours series microbial consortium, the highest TPH degradation rates is found in microbial consortium III (BMC6, BMC2, and FMC6) with 89,1% in 5 weeks. (author)

  1. Degradation of Total Petroleum Hydrocarbon in Phytoremediation Using Terrestrial Plants

    Directory of Open Access Journals (Sweden)

    Mushrifah Idris

    2014-06-01

    Full Text Available This study focused on the total petroleum hydrocarbon (TPH degradation in phytoremediation of spiked diesel in sand. The diesel was added to the sand that was planted with terrestrial plants. Four selected terrestrial plants used were Paspalum vaginatum Sw, Paspalums crobiculatum L. varbispicatum Hack, Eragrotis atrovirens (Desf. Trin. ex Steud and Cayratia trifolia (L. Domin since all the plants could survive at a hydrocarbon petroleum contaminated site in Malaysia. The samplings were carried out on Day 0, 7, 14, 28, 42 and 72. The analysis of the TPH was conducted by extracting the spiked sand using ultrasonic extraction. The determination of the TPH concentration in the sand was performed using GC-FID. The degradation of TPH depends on the plant species and time of exposure. The highest percentage degradation by P. vaginatum, P. scrobiculatum, E. atrovirens and C. trifolia were 91.9, 74.0, 68.9 and 62.9%, respectively. In conclusion, the ability to degrade TPH by plants were P. vaginatum > P. scrobiculatum > E. atrovirens> C. trifolia.

  2. Microbial Degradation of Polycyclic Aromatic Hydrocarbons and Characterization of Bacteria

    Science.gov (United States)

    Tikilili, P. V.; Chirwa, E. M. N.

    2010-01-01

    Biodegradation of polycyclic aromatic hydrocarbons was studied. Naphthalene was used as a model compound to represent these compounds. Low initial concentrations of naphthalene in a range of 30-60 mg/L were completely degraded after incubation for 15 hrs by consortia from a landfill soil while consortia from minewater took more that 29 hrs to reach complete degradation.

  3. Aerobic TCE degradation by encapsulated toluene-oxidizing bacteria, Pseudomonas putida and Bacillus spp.

    Science.gov (United States)

    Kim, Seungjin; Bae, Wookeun; Hwang, Jungmin; Park, Jaewoo

    2010-01-01

    The degradation rates of toluene and trichloroethylene (TCE) by Pseudomonas putida and Bacillus spp. that were encapsulated in polyethylene glycol (PEG) polymers were evaluated in comparison with the results of exposure to suspended cultures. PEG monomers were polymerized together with TCE-degrading microorganisms, such that the cells were encapsulated in and protected by the matrices of the PEG polymers. TCE concentrations were varied from 0.1 to 1.5 mg/L. In the suspended cultures of P. putida, the TCE removal rate decreased as the initial TCE concentration increased, revealing TCE toxicity or a limitation of reducing power, or both. When the cells were encapsulated, an initial lag period of about 10-20 h was observed for toluene degradation. Once acclimated, the encapsulated P. putida cultures were more tolerant to TCE at an experimental range of 0.6-1.0 mg/L and gave higher transfer efficiencies (mass TCE transformed/mass toluene utilized). When the TCE concentration was low (e.g., 0.1 mg/L) the removal of TCE per unit mass of cells (specific removal) was significantly lower, probably due to a diffusion limitation into the PEG pellet. Encapsulated Bacillus spp. were able to degrade TCE cometabolically. The encapsulated Bacillus spp. gave significantly higher values than did P. putida in the specific removal and the transfer efficiency, particularly at relatively high TCE concentration of approximately 1.0±0.5 mg/L. The transfer efficiency by encapsulated Bacillus spp. in this study was 0.27 mgTCE/mgToluene, which was one to two orders of magnitude greater than the reported values.

  4. Hydrocarbon degradation, plant colonization and gene expression of alkane degradation genes by endophytic Enterobacter ludwigii strains

    International Nuclear Information System (INIS)

    Yousaf, Sohail; Afzal, Muhammad; Reichenauer, Thomas G.; Brady, Carrie L.; Sessitsch, Angela

    2011-01-01

    The genus Enterobacter comprises a range of beneficial plant-associated bacteria showing plant growth promotion. Enterobacter ludwigii belongs to the Enterobacter cloacae complex and has been reported to include human pathogens but also plant-associated strains with plant beneficial capacities. To assess the role of Enterobacter endophytes in hydrocarbon degradation, plant colonization, abundance and expression of CYP153 genes in different plant compartments, three plant species (Italian ryegrass, birdsfoot trefoil and alfalfa) were grown in sterile soil spiked with 1% diesel and inoculated with three endophytic E. ludwigii strains. Results showed that all strains were capable of hydrocarbon degradation and efficiently colonized the rhizosphere and plant interior. Two strains, ISI10-3 and BRI10-9, showed highest degradation rates of diesel fuel up to 68% and performed best in combination with Italian ryegrass and alfalfa. All strains expressed the CYP153 gene in all plant compartments, indicating an active role in degradation of diesel in association with plants. - Highlights: → E. ludwigii strains efficiently colonized plants in a non-sterile soil environment. → E. ludwigii strains efficiently expressed alkane degradation genes in plants. → E. ludwigii efficiently degraded alkane contaminations and promoted plant growth. → E. ludwigii interacted more effectively with Italian ryegrass than with other plants. → Degradation activity varied with plant and microbial genotype as well as with time. - Enterobacter ludwigii strains belonging to the E. cloacae complex are able to efficiently degrade alkanes when associated with plants and to promote plant growth.

  5. Hydrocarbon degradation, plant colonization and gene expression of alkane degradation genes by endophytic Enterobacter ludwigii strains

    Energy Technology Data Exchange (ETDEWEB)

    Yousaf, Sohail [AIT Austrian Institute of Technology GmbH, Bioresources Unit, A-2444 Seibersdorf (Austria); Afzal, Muhammad [AIT Austrian Institute of Technology GmbH, Bioresources Unit, A-2444 Seibersdorf (Austria); National Institute for Biotechnology and Genetic Engineering (NIBGE), Faisalabad (Pakistan); Reichenauer, Thomas G. [AIT Austrian Institute of Technology GmbH, Environmental Resources and Technologies Unit, A-2444 Seibersdorf (Austria); Brady, Carrie L. [Forestry and Agricultural Biotechnology Institute, Department of Microbiology and Plant Pathology, University of Pretoria, Pretoria (South Africa); Sessitsch, Angela, E-mail: angela.sessitsch@ait.ac.at [AIT Austrian Institute of Technology GmbH, Bioresources Unit, A-2444 Seibersdorf (Austria)

    2011-10-15

    The genus Enterobacter comprises a range of beneficial plant-associated bacteria showing plant growth promotion. Enterobacter ludwigii belongs to the Enterobacter cloacae complex and has been reported to include human pathogens but also plant-associated strains with plant beneficial capacities. To assess the role of Enterobacter endophytes in hydrocarbon degradation, plant colonization, abundance and expression of CYP153 genes in different plant compartments, three plant species (Italian ryegrass, birdsfoot trefoil and alfalfa) were grown in sterile soil spiked with 1% diesel and inoculated with three endophytic E. ludwigii strains. Results showed that all strains were capable of hydrocarbon degradation and efficiently colonized the rhizosphere and plant interior. Two strains, ISI10-3 and BRI10-9, showed highest degradation rates of diesel fuel up to 68% and performed best in combination with Italian ryegrass and alfalfa. All strains expressed the CYP153 gene in all plant compartments, indicating an active role in degradation of diesel in association with plants. - Highlights: > E. ludwigii strains efficiently colonized plants in a non-sterile soil environment. > E. ludwigii strains efficiently expressed alkane degradation genes in plants. > E. ludwigii efficiently degraded alkane contaminations and promoted plant growth. > E. ludwigii interacted more effectively with Italian ryegrass than with other plants. > Degradation activity varied with plant and microbial genotype as well as with time. - Enterobacter ludwigii strains belonging to the E. cloacae complex are able to efficiently degrade alkanes when associated with plants and to promote plant growth.

  6. [Predominant strains of polycyclic aromatic hydrocarbon-degrading consortia from deep sea of the Middle Atlantic Ridge].

    Science.gov (United States)

    Cui, Zhisong; Shao, Zongze

    2009-07-01

    In order to identify the predominant strains of polycyclic aromatic hydrocarbon (PAH)-degrading consortia harboring in sea water and surface sediment collected from deep sea of the Middle Atlantic Ridge. We employed enrichment method and spread-plate method to isolate cultivable bacteria and PAHs degraders from deep sea samples. Phylogenetic analysis was conducted by 16S rRNA gene sequencing of the bacteria. Then we analyzed the dominant bacteria in the PAHs-degrading consortia by denaturing gradient gel electrophoresis (DGGE) combined with DNA sequencing. Altogether 16 cultivable bacteria were obtained, including one PAHs degrader Novosphingobium sp. 4D. Phylogenetic analysis showed that strains closely related to Alcanivorax dieselolei NO1A (5/16) and Tistrella mobilis TISTR 1108T (5/16) constituted two biggest groups among the cultivable bacteria. DGGE analysis showed that strain 4L (also 4M and 4N, Alcanivorax dieselolei NO1A, 99.21%), 4D (Novosphingobium pentaromativorans US6-1(T), 97.07%) and 4B (also 4E, 4H and 4K, Tistrella mobilis TISTR 1108T, > 99%) dominated the consortium MC2D. While in consortium MC3CO, the predominant strains were strain 5C (also 5H, Alcanivorax dieselolei NO1A, > 99%), uncultivable strain represented by band 5-8 (Novosphingobium aromaticivorans DSM 12444T, 99.41%), 5J (Tistrella mobilis TISTR 1108T, 99.52%) and 5F (also 5G, Thalassospira lucentensis DSM 14000T, degrading consortia in sea water and surface sediment of Middle Atlantic Ridge deep sea, with Novosphingobium spp. as their main PAHs degraders.

  7. HYDROCARBON-DEGRADING BACTERIA AND SURFACTANT ACTIVITY

    Energy Technology Data Exchange (ETDEWEB)

    Brigmon, R; Topher Berry, T; Grazyna A. Plaza, G; jacek Wypych, j

    2006-08-15

    Fate of benzene ethylbenzene toluene xylenes (BTEX) compounds through biodegradation was investigated using two different bacteria, Ralstonia picketti (BP-20) and Alcaligenes piechaudii (CZOR L-1B). These bacteria were isolated from extremely polluted petroleum hydrocarbon contaminated soils. PCR and Fatty Acid Methyl Ester (FAME) were used to identify the isolates. Biodegradation was measured using each organism individually and in combination. Both bacteria were shown to degrade each of the BTEX compounds. Alcaligenes piechaudii biodegraded BTEXs more efficiently while mixed with BP-20 and individually. Biosurfactant production was observed by culture techniques. In addition 3-hydroxy fatty acids, important in biosurfactant production, was observed by FAME analysis. In the all experiments toluene and m+p- xylenes were better growth substrates for both bacteria than the other BTEX compounds. In addition, the test results indicate that the bacteria could contribute to bioremediation of aromatic hydrocarbons (BTEX) pollution increase biodegradation through the action by biosurfactants.

  8. Degradation of hydrocarbons in soil samples analyzed within accepted analytical holding times

    International Nuclear Information System (INIS)

    Jackson, J.; Thomey, N.; Dietlein, L.F.

    1992-01-01

    Samples which are collected in conjunction with subsurface investigations at leaking petroleum storage tank sites and petroleum refineries are routinely analyzed for benzene, toluene, ethylbenzene, xylenes (BTEX), and total petroleum hydrocarbons (TPH). Water samples are preserved by the addition of hydrochloric acid and maintained at four degrees centigrade prior to analysis. This is done to prevent bacterial degradation of hydrocarbons. Chemical preservation is not presently performed on soil samples. Instead, the samples are cooled and maintained at four degrees centigrade. This study was done to measure the degree of degradation of hydrocarbons in soil samples which are analyzed within accepted holding times. Soil samples were collected and representative subsamples were prepared from the initial sample. Subsamples were analyzed in triplicate for BTEX and TPH throughout the length of the approved holding times to measure the extent of sample constituent degradation prior to analysis. Findings imply that for sandy soils, BTEX and TPH concentrations can be highly dependent upon the length of time which elapses between sample collection and analysis

  9. New Hydrocarbon Degradation Pathways in the Microbial Metagenome from Brazilian Petroleum Reservoirs

    Science.gov (United States)

    Sierra-García, Isabel Natalia; Correa Alvarez, Javier; Pantaroto de Vasconcellos, Suzan; Pereira de Souza, Anete; dos Santos Neto, Eugenio Vaz; de Oliveira, Valéria Maia

    2014-01-01

    Current knowledge of the microbial diversity and metabolic pathways involved in hydrocarbon degradation in petroleum reservoirs is still limited, mostly due to the difficulty in recovering the complex community from such an extreme environment. Metagenomics is a valuable tool to investigate the genetic and functional diversity of previously uncultured microorganisms in natural environments. Using a function-driven metagenomic approach, we investigated the metabolic abilities of microbial communities in oil reservoirs. Here, we describe novel functional metabolic pathways involved in the biodegradation of aromatic compounds in a metagenomic library obtained from an oil reservoir. Although many of the deduced proteins shared homology with known enzymes of different well-described aerobic and anaerobic catabolic pathways, the metagenomic fragments did not contain the complete clusters known to be involved in hydrocarbon degradation. Instead, the metagenomic fragments comprised genes belonging to different pathways, showing novel gene arrangements. These results reinforce the potential of the metagenomic approach for the identification and elucidation of new genes and pathways in poorly studied environments and contribute to a broader perspective on the hydrocarbon degradation processes in petroleum reservoirs. PMID:24587220

  10. Microbial degradation of waste hydrocarbons in oily sludge from some Romanian oil fields

    International Nuclear Information System (INIS)

    Lazar, I.; Dobrota, S.; Voicu, A.; Stefanescu, M.; Sandulescu, L.; Petrisor, I.G.

    1999-01-01

    During oil production and processing activities, significant quantities of oily sludge are produced. The sludge represents not only an environmental pollution source but also occupies big spaces in storage tanks. Romania, an experienced European oil-producing and processing country, is faced with environmental problems generated by oily sludge accumulations. Many such accumulations are to be submitted to bioremediation processes based on the hydrocarbon degradation activity of naturally occurring, selectively isolated bacteria. In this paper the results concerning a laboratory screening of several natural bacterial consortia and laboratory tests to establish the performance in degradation of hydrocarbons contained in oily sludges from Otesti oil field area, are presented. As a result of the laboratory screening, we selected six natural bacterial consortia (BCSl-I 1 to BCSl-I 6 ) with high ability in degradation of hydrocarbons from paraffinic and non-paraffinic asphaltic oils (between 25.53%-64.30% for non-paraffinic asphaltic oil and between 50.25%-72.97% for paraffinic oil). The laboratory tests proved that microbial degradation of hydrocarbons contained in oily sludge from Otesti oil field area varied from 16.75% to 95.85% in moving conditions (Erlenmeyers of 750 ml on rotary shaker at 200 rpm) and from 16.85% to 51.85% in static conditions (Petri dishes Oe 10 cm or vessels of 500 ml)

  11. Characterization of Bacterial Hydrocarbon Degradation Potential in the Red Sea Through Metagenomic and Cultivation Methods

    KAUST Repository

    Bianchi, Patrick

    2018-01-01

    The focus of this thesis is on the characterization at the metagenomic level of the water column of the Red Sea and on the isolation and characterization of novel hydrocarbon-degrading species and genomes adapted to the unique environmental characteristics of the basin. The presence of metabolic genes responsible of both linear and aromatic hydrocarbon degradation has been evaluated from a metagenomic survey and a meta-analysis of already available datasets. In parallel, water column-based microcosms have been established with crude oil as the sole carbon source, with aim to isolate potential novel bacterial species and provide new genome-based insights on the hydrocarbon degradation potential available in the Red Sea.

  12. Characterization of Biosurfactant Produced during Degradation of Hydrocarbons Using Crude Oil As Sole Source of Carbon.

    Science.gov (United States)

    Patowary, Kaustuvmani; Patowary, Rupshikha; Kalita, Mohan C; Deka, Suresh

    2017-01-01

    Production and spillage of petroleum hydrocarbons which is the most versatile energy resource causes disastrous environmental pollution. Elevated oil degrading performance from microorganisms is demanded for successful microbial remediation of those toxic pollutants. The employment of biosurfactant-producing and hydrocarbon-utilizing microbes enhances the effectiveness of bioremediation as biosurfactant plays a key role by making hydrocarbons bio-available for degradation. The present study aimed the isolation of a potent biosurfactant producing indigenous bacteria which can be employed for crude oil remediation, along with the characterization of the biosurfactant produced during crude oil biodegradation. A potent bacterial strain Pseudomonas aeruginosa PG1 (identified by 16s rDNA sequencing) was isolated from hydrocarbon contaminated soil that could efficiently produce biosurfactant by utilizing crude oil components as the carbon source, thereby leading to the enhanced degradation of the petroleum hydrocarbons. Strain PG1 could degrade 81.8% of total petroleum hydrocarbons (TPH) after 5 weeks of culture when grown in mineral salt media (MSM) supplemented with 2% (v/v) crude oil as the sole carbon source. GCMS analysis of the treated crude oil samples revealed that P. aeruginosa PG1 could potentially degrade various hydrocarbon contents including various PAHs present in the crude oil. Biosurfactant produced by strain PG1 in the course of crude oil degradation, promotes the reduction of surface tension (ST) of the culture medium from 51.8 to 29.6 mN m -1 , with the critical micelle concentration (CMC) of 56 mg L -1 . FTIR, LC-MS, and SEM-EDS studies revealed that the biosurfactant is a rhamnolipid comprising of both mono and di rhamnolipid congeners. The biosurfactant did not exhibit any cytotoxic effect to mouse L292 fibroblastic cell line, however, strong antibiotic activity against some pathogenic bacteria and fungus was observed.

  13. Characterization of Biosurfactant Produced during Degradation of Hydrocarbons Using Crude Oil As Sole Source of Carbon

    Science.gov (United States)

    Patowary, Kaustuvmani; Patowary, Rupshikha; Kalita, Mohan C.; Deka, Suresh

    2017-01-01

    Production and spillage of petroleum hydrocarbons which is the most versatile energy resource causes disastrous environmental pollution. Elevated oil degrading performance from microorganisms is demanded for successful microbial remediation of those toxic pollutants. The employment of biosurfactant-producing and hydrocarbon-utilizing microbes enhances the effectiveness of bioremediation as biosurfactant plays a key role by making hydrocarbons bio-available for degradation. The present study aimed the isolation of a potent biosurfactant producing indigenous bacteria which can be employed for crude oil remediation, along with the characterization of the biosurfactant produced during crude oil biodegradation. A potent bacterial strain Pseudomonas aeruginosa PG1 (identified by 16s rDNA sequencing) was isolated from hydrocarbon contaminated soil that could efficiently produce biosurfactant by utilizing crude oil components as the carbon source, thereby leading to the enhanced degradation of the petroleum hydrocarbons. Strain PG1 could degrade 81.8% of total petroleum hydrocarbons (TPH) after 5 weeks of culture when grown in mineral salt media (MSM) supplemented with 2% (v/v) crude oil as the sole carbon source. GCMS analysis of the treated crude oil samples revealed that P. aeruginosa PG1 could potentially degrade various hydrocarbon contents including various PAHs present in the crude oil. Biosurfactant produced by strain PG1 in the course of crude oil degradation, promotes the reduction of surface tension (ST) of the culture medium from 51.8 to 29.6 mN m−1, with the critical micelle concentration (CMC) of 56 mg L−1. FTIR, LC-MS, and SEM-EDS studies revealed that the biosurfactant is a rhamnolipid comprising of both mono and di rhamnolipid congeners. The biosurfactant did not exhibit any cytotoxic effect to mouse L292 fibroblastic cell line, however, strong antibiotic activity against some pathogenic bacteria and fungus was observed. PMID:28275373

  14. Occurrence of hydrocarbon degrading bacteria in soil in Kukawa, Borno State

    Directory of Open Access Journals (Sweden)

    IA Allamin

    2014-05-01

    Full Text Available Soil samples were collected from five sites covering petroleum exploration station in Kukawa, Kukawa Local Government Area of Borno State, Nigeria between October, 2012 and February, 2013 at two different depths (0-10cm and 10-20cm to enumerate and identify hydrocarbon degrading bacteria in the soil. Total aerobic heterotrophic bacteria (TAHB were enumerated on Nutrient agar (NA, and Hydrocarbon utilizing bacteria (HUB enumerated on Oil agar (OA. The bacterial isolates were identified using morphological and biochemical tests. It was observed that the microorganisms (TAHB, and HUB were more densely populated at 10cm depth. (TAHB: 5.3×108 - 11.4×108cfu/g, and HUB: 2.4×105 - 5.3×105 cfu/g, than at 20 cm depth (TAHB: 3.0×108 - 5.7×108 cfu/g, and HUB: 2.1×105 - 4.8×105 cfu/g. The HUB was identified as species of Bacillus, Pseudomonas, Klebsiella, Lactobacillus, Micrococcus, Corynebacterium, and Actinomyces. Bacillus, and Pseudomonas species were more constantly isolated than other isolates and they constitute 100% of total bacterial isolates. The potential of hydrocarbon utilizing bacteria isolated to degrade hydrocarbon was studied. Nineteen (19 bacterial species was screened, Bacillus subtilis, Pseudomonas aeruginosa, Bacillus cereus, Klebsiella pneumoniae, Micrococcus leteus,and Lactobacillus casei, utilized and degrade crude oil at considerably high rates after 21 days of incubation. The degradation efficiency was confirmed by GC-MS analysis, which indicated that the bacterial isolates utilized most of the crude oil components particularly straight chain alkanes and cycloalkanes DOI: http://dx.doi.org/10.3126/ije.v3i2.10503 International Journal of the Environment Vol.3(2 2014: 36-47

  15. Hydrocarbon-degrading Capability of Bacteria isolated from a Maize ...

    African Journals Online (AJOL)

    Hydrocarbon-degrading Capability of Bacteria isolated from a Maize-Planted, Kerosene-contaminated Ilorin Alfisol. ... also revealed that some bacteria survive and even thrive in kerosene contaminated soil and hence have the potential to be used in biodegradation and/or bioremediation of oil contaminated soils and water.

  16. Isolation and Characterization of Hydrocarbon-Degrading Yeast Strains from Petroleum Contaminated Industrial Wastewater

    Science.gov (United States)

    Gargouri, Boutheina; Mhiri, Najla; Karray, Fatma; Aloui, Fathi; Sayadi, Sami

    2015-01-01

    Two yeast strains are enriched and isolated from industrial refinery wastewater. These strains were observed for their ability to utilize several classes of petroleum hydrocarbons substrates, such as n-alkanes and aromatic hydrocarbons as a sole carbon source. Phylogenetic analysis based on the D1/D2 variable domain and the ITS-region sequences indicated that strains HC1 and HC4 were members of the genera Candida and Trichosporon, respectively. The mechanism of hydrocarbon uptaking by yeast, Candida, and Trichosporon has been studied by means of the kinetic analysis of hydrocarbons-degrading yeasts growth and substrate assimilation. Biodegradation capacity and biomass quantity were daily measured during twelve days by gravimetric analysis and gas chromatography coupled with mass spectrometry techniques. Removal of n-alkanes indicated a strong ability of hydrocarbon biodegradation by the isolated yeast strains. These two strains grew on long-chain n-alkane, diesel oil, and crude oil but failed to grow on short-chain n-alkane and aromatic hydrocarbons. Growth measurement attributes of the isolates, using n-hexadecane, diesel oil, and crude oil as substrates, showed that strain HC1 had better degradation for hydrocarbon substrates than strain HC4. In conclusion, these yeast strains can be useful for the bioremediation process and decreasing petroleum pollution in wastewater contaminated with petroleum hydrocarbons. PMID:26339653

  17. Isolation and Characterization of Hydrocarbon-Degrading Yeast Strains from Petroleum Contaminated Industrial Wastewater

    Directory of Open Access Journals (Sweden)

    Boutheina Gargouri

    2015-01-01

    Full Text Available Two yeast strains are enriched and isolated from industrial refinery wastewater. These strains were observed for their ability to utilize several classes of petroleum hydrocarbons substrates, such as n-alkanes and aromatic hydrocarbons as a sole carbon source. Phylogenetic analysis based on the D1/D2 variable domain and the ITS-region sequences indicated that strains HC1 and HC4 were members of the genera Candida and Trichosporon, respectively. The mechanism of hydrocarbon uptaking by yeast, Candida, and Trichosporon has been studied by means of the kinetic analysis of hydrocarbons-degrading yeasts growth and substrate assimilation. Biodegradation capacity and biomass quantity were daily measured during twelve days by gravimetric analysis and gas chromatography coupled with mass spectrometry techniques. Removal of n-alkanes indicated a strong ability of hydrocarbon biodegradation by the isolated yeast strains. These two strains grew on long-chain n-alkane, diesel oil, and crude oil but failed to grow on short-chain n-alkane and aromatic hydrocarbons. Growth measurement attributes of the isolates, using n-hexadecane, diesel oil, and crude oil as substrates, showed that strain HC1 had better degradation for hydrocarbon substrates than strain HC4. In conclusion, these yeast strains can be useful for the bioremediation process and decreasing petroleum pollution in wastewater contaminated with petroleum hydrocarbons.

  18. Apparent Contradiction: Psychrotolerant Bacteria from Hydrocarbon-Contaminated Arctic Tundra Soils That Degrade Diterpenoids Synthesized by Trees

    Science.gov (United States)

    Yu, Zhongtang; Stewart, Gordon R.; Mohn, William W.

    2000-01-01

    Resin acids are tricyclic terpenoids occurring naturally in trees. We investigated the occurrence of resin acid-degrading bacteria on the Arctic tundra near the northern coast of Ellesmere Island (82°N, 62°W). According to most-probable-number assays, resin acid degraders were abundant (103 to 104 propagules/g of soil) in hydrocarbon-contaminated soils, but they were undetectable (soil) in pristine soils from the nearby tundra. Plate counts indicated that the contaminated and the pristine soils had similar populations of heterotrophs (106 to 107 propagules/g of soil). Eleven resin acid-degrading bacteria belonging to four phylogenetically distinct groups were enriched and isolated from the contaminated soils, and representative isolates of each group were further characterized. Strains DhA-91, IpA-92, and IpA-93 are members of the genus Pseudomonas. Strain DhA-95 is a member of the genus Sphingomonas. All four strains are psychrotolerant, with growth temperature ranges of 4°C to 30°C (DhA-91 and DhA-95) or 4°C to 22°C (IpA-92 and IpA-93) and with optimum temperatures of 15 to 22°C. Strains DhA-91 and DhA-95 grew on the abietanes, dehydroabietic and abietic acids, but not on the pimaranes, isopimaric and pimaric acids. Strains IpA-92 and IpA-93 grew on the pimaranes but not the abietanes. All four strains grew on either aliphatic or aromatic hydrocarbons, which is unusual for described resin acid degraders. Eleven mesophilic resin acid degraders did not use hydrocarbons, with the exception of two Mycobacterium sp. strains that used aliphatic hydrocarbons. We conclude that hydrocarbon contamination in Arctic tundra soil indirectly selected for resin acid degraders, selecting for hydrocarbon degraders that coincidentally use resin acids. Psychrotolerant resin acid degraders are likely important in the global carbon cycle and may have applications in biotreatment of pulp and paper mill effluents. PMID:11097882

  19. Characterization of Bacterial Hydrocarbon Degradation Potential in the Red Sea Through Metagenomic and Cultivation Methods

    KAUST Repository

    Bianchi, Patrick

    2018-02-01

    Prokaryotes are the main actors in biogeochemical cycles that are fundamental in global nutrient cycling. The characterization of microbial communities and isolates can enhance the comprehension of such cycles. Potentially novel biochemical processes can be discovered in particular environments with unique characteristics. The Red Sea can be considered as a unique natural laboratory due to its peculiar hydrology and physical features including temperature, salinity and water circulation. Moreover the Red Sea is subjected to hydrocarbon pollution by both anthropogenic and natural sources that select hydrocarbon degrading prokaryotes. Due to its unique features the Red Sea has the potential to host uncharacterized novel microorganisms with hydrocarbondegrading pathways. The focus of this thesis is on the characterization at the metagenomic level of the water column of the Red Sea and on the isolation and characterization of novel hydrocarbon-degrading species and genomes adapted to the unique environmental characteristics of the basin. The presence of metabolic genes responsible of both linear and aromatic hydrocarbon degradation has been evaluated from a metagenomic survey and a meta-analysis of already available datasets. In parallel, water column-based microcosms have been established with crude oil as the sole carbon source, with aim to isolate potential novel bacterial species and provide new genome-based insights on the hydrocarbon degradation potential available in the Red Sea.

  20. Enhanced degradation activity by endophytic bacteria of plants growing in hydrocarbon contaminated soil

    Energy Technology Data Exchange (ETDEWEB)

    Phillips, L.; Germida, J.J. [Saskatchewan Univ., Saskatoon, SK (Canada); Greer, C.W. [National Research Council of Canada, Montreal, PQ (Canada). Biotechnology Research Inst.

    2006-07-01

    The feasibility of using phytoremediation for cleaning soils contaminated with petroleum hydrocarbons was discussed. Petroleum hydrocarbons are problematic because of their toxicity, mobility and persistence in the environment. Appropriate clean-up methods are needed, given that 60 per cent of Canada's contaminated sites contain these compounds. Phytoremediation is an in situ biotechnology in which plants are used to facilitate contaminant removal. The approach relies on a synergistic relationship between plants and their root-associated microbial communities. Previous studies on phytoremediation have focussed on rhizosphere communities. However, it is believed that endophytic microbes may also play a vital role in organic contaminant degradation. This study investigated the structural and functional dynamics of both rhizosphere and endophytic microbial communities of plants from a phytoremediation field site in south-eastern Saskatchewan. The former flare pit contains up to 10,000 ppm of F3 to F4 hydrocarbon fractions. Root samples were collected from tall wheatgrass, wild rye, saltmeadow grass, perennial ryegrass, and alfalfa. Culture-based and culture-independent methods were used to evaluate the microbial communities associated with these roots. Most probable number assays showed that the rhizosphere communities contained more n-hexadecane, diesel fuel, and PAH degraders. However, mineralization assays with 14C labelled n-hexadecane, naphthalene, and phenanthrene showed that endophytic communities had more degradation activities per standardized initial degrader populations. Total community DNA samples taken from bulk, rhizosphere, and endophytic samples, were analyzed by denaturing gradient gel electrophoresis. It was shown that specific bacteria increased in endophytic communities compared to rhizosphere communities. It was suggested plants may possibly recruit specific bacteria in response to hydrocarbon contamination, thereby increasing degradation

  1. DEGRADATION OF POLYNUCLEAR AROMATIC HYDROCARBONS UNDER BENCH-SCALE COMPOST CONDITIONS

    Science.gov (United States)

    The relationship between biomass growth and degradation of polynuclear aromatic hydrocarbons (PAHs) in soil, and subsequent toxicity reduction, was evaluated in 10 in-vessel, bench-scale compost units. Field soil was aquired from the Reilly Tar and Chemical Company Superfund site...

  2. Exploration of Hydrocarbon Degrading Bacteria on Soils Contaminated by Crude Oil From South Sumatera

    OpenAIRE

    Napoleon, A; Probowati, D S

    2014-01-01

    The goal of this research was to explore hydrocarbon degrading bacteria on crude oil contaminated soil with potential to degrade hydrocarbon in oil pollutant. The research started by early August 2013 till January 2014. Soil sampling for this research was taken on several places with contaminated soil location such as Benakat, Rimau, and Pengabuan all of it located in South Sumatera. Conclusion from this research Isolates obtained from three (3) sites of contaminated soil and treated using SB...

  3. Degradation of Total Petroleum Hydrocarbon and BTEX Compounds in Produced Water

    Energy Technology Data Exchange (ETDEWEB)

    Jackson, Lorri

    2002-04-01

    Petroleum Environmental Technologies, LLC entered into a Cooperative Research and Development agreement with the Rocky Mountain Oilfield Testing Center to an in-situ pit treatment demonstration and produced water treatment demonstration. The purpose of the test is to demonstrate the degradation of petroleum hydrocarbon compounds in soil and aqueous matrices where ECOSAFE is applied to enhance the degradation of these contaminants.

  4. Polycyclic aromatic hydrocarbons degradation by marine-derived basidiomycetes: optimization of the degradation process.

    Science.gov (United States)

    Vieira, Gabriela A L; Magrini, Mariana Juventina; Bonugli-Santos, Rafaella C; Rodrigues, Marili V N; Sette, Lara D

    2018-05-03

    Pyrene and benzo[a]pyrene (BaP) are high molecular weight polycyclic aromatic hydrocarbons (PAHs) recalcitrant to microbial attack. Although studies related to the microbial degradation of PAHs have been carried out in the last decades, little is known about degradation of these environmental pollutants by fungi from marine origin. Therefore, this study aimed to select one PAHs degrader among three marine-derived basidiomycete fungi and to study its pyrene detoxification/degradation. Marasmiellus sp. CBMAI 1062 showed higher levels of pyrene and BaP degradation and was subjected to studies related to pyrene degradation optimization using experimental design, acute toxicity, organic carbon removal (TOC), and metabolite evaluation. The experimental design resulted in an efficient pyrene degradation, reducing the experiment time while the PAH concentration applied in the assays was increased. The selected fungus was able to degrade almost 100% of pyrene (0.08mgmL -1 ) after 48h of incubation under saline condition, without generating toxic compounds and with a TOC reduction of 17%. Intermediate metabolites of pyrene degradation were identified, suggesting that the fungus degraded the compound via the cytochrome P450 system and epoxide hydrolases. These results highlight the relevance of marine-derived fungi in the field of PAH bioremediation, adding value to the blue biotechnology. Copyright © 2018. Published by Elsevier Editora Ltda.

  5. Use of biolog methodology for optimizing the degradation of hydrocarbons by bacterial consortia.

    Science.gov (United States)

    Ambrosoli, R; Bardi, L; Minati, J L; Belviso, S; Ricci, R; Marzona, M

    2003-01-01

    Biolog methodology was used for the preliminary screening of different cultural conditions in order to detect the best combination/s of factors influencing the metabolic performance of bacterial consortia active in the degradation of hydrocarbons. Two microbial consortia were tested for their activity on 2 hydrocarbons (nonadecane and eicosane) in presence of the following cultural coadjuvants: vegetal oil, beta-cyclodextrine, sodium acetate, mineral solution. Tests were conducted in Biolog MT plates, where only the redox indicator of microbial growth (tetrazolium violet) and no carbon sources are provided. The microwells were filled with various combinations of hydrocarbons, microbial inoculum and coadjuvants. Blanks were prepared with the same combinations but without hydrocarbons. The results obtained show the suitability of the methodology developed to identify the most active consortium and the conditions for its best degradation performance. The efficacy of Biolog methodology (Biolog Inc., USA) for the characterization of microbial communities on the basis of the metabolic profiles obtained on specific carbon sources in the microwells of Elisa-type plates, is widely acknowledged (Garland, 1997; Pietikäinen et al., 2000; Dauber and Wolters, 2000). Due to its aptitude to simultaneously evaluate multiple microbial responses and directly organize the results, it can be adapted to meet specific study purposes (Gamo and Shji, 1999). In the present research Biolog methodology was fitted for the preliminary screening of different cultural conditions, in order to detect the best combination/s of factors influencing the metabolic performance of bacterial consortia active in the degradation of aliphatic hydrocarbons, in view of their utilization for the bioremediation of polluted sites.

  6. Hydrocarbon Degradation and Sulfate Reduction in a Coastal Marsh of North Florida

    Science.gov (United States)

    Hsieh, Y.; Bugna, G. C.; Robinson, L.

    2001-05-01

    Hydrocarbon contamination of coastal waters has been an environmental concern for sometime. Coastal wetlands, which are rich in organic matter and microbial activities, have been considered natural systems that could degrade hydrocarbon in contaminated coastal waters. This study was initiated to investigate the potential of hydrocarbon degradation in a coastal salt marsh of North Florida with special reference to sulfate reduction. Freshly collected surface marsh sediments (0-20 cm) were incubated in a laboratory at ambient temperature (23.2° C) with the treatments of: 1) Control (i.e., no treatment), 2) +(crude) oil, 3) +NO3-1+oil, and 4) +MoO4-2+oil. Carbon dioxide evolution from the incubation was collected and analyzed for the total amount and the 13C signature. The NO3-1 and MoO4-2 treatments were intended to block the sulfate reduction activity. The results show that the indigenous organic matter and the crude oil have distinct δ 13C values of -19.8 and -27.6 \\permil, respectively, relative to PDB. Evolved CO2 concentrations and δ 13C values also indicate that microbial populations can adapt to the presence of anthropogenic hydrocarbons. Blocking of sulfate reducers by MoO4-2 addition started to reduce the carbon dioxide evolution rates after a 4-d incubation. After a 48-d incubation, the carbon dioxide evolution of the MoO4-2-treated samples was reduced to only 23 % of the non-MoO4-2-treated samples, indicating the increased significant role of sulfate reducers in digesting older soil organic matter and the hydrocarbons. T-tests also indicated that in NO3-1 treatment, δ 13C values significantly depleted (p=0.1) while CO2 concentration remained relatively constant. These indicate that while denitrifiers played a role in the degradation, the microbial population is predominantly composed of sulfate reducers. Salt marshes would be a much more significant source of CH4 if SO4-2 is suppressed. All MoO4-2-treated samples produced significant amount of methane

  7. Isolation and identification of aromatic hydrocarbon degrading yeasts present in gasoline tanks of urbans vehicles

    Directory of Open Access Journals (Sweden)

    Nathalia Catalina Delgadillo-Ordoñez

    2017-07-01

    Full Text Available Yeast isolates were obtained from fuel tanks of vehicles in order to assess their potential use in the degradation of aromatic hydrocarbons. Growth assays were performed in minimum mineral medium using different aromatic hydrocarbons (benzene, toluene, naphthalene, phenanthrene, and pyrene as the sole carbon source. Isolates that showed growth in any of the tested polycyclic aromatic hydrocarbons were identified by Sanger sequencing of the ITS1 and ITS2 rDNA molecular markers. A total of 16 yeasts strains were isolated, and three showed remarkable growth in media with aromatic hydrocarbons as the sole carbon source. These strains belong to the genus Rhodotorula, and correspond to the species Rhodotorula calyptogenae (99,8% identity and Rhodotorula dairenensis (99,8% identity.  These strains grew in benzene, toluene, naphthalene, phenanthrene and pyrene. This study demonstrates for the first time that yeasts of the genus Rhodotorula inhabit pipelines and fuel tanks of vehicles and that remove   aromatic hydrocarbons that are environmental pollutants. Our results suggest that these yeasts are potential candidates for aromatic hydrocarbon degradation as part of bioremediation strategies.

  8. Microbial degradation of polycyclic aromatic hydrocarbons

    International Nuclear Information System (INIS)

    Volkering, F.; Breure, A.M.; Andel, J.G. van

    1992-01-01

    Polycyclic aromatic hydrocarbons (PAH) are hazardous compounds originating from oil, tar, creosote, or from incomplete combustion of fossil fuels. Application of biotechnological techniques for remediation of polluted soils from PAH demonstrated that the high molecular compounds are degraded very slowly, and that the residual concentration of PAH often is too high to permit application of the treated soil. Investigations were started to establish process parameters for optimal biodegradation of PAH. The aim is to achieve a relation between the physical properties of PAH and the biodegradation kinetics in different matrices, in order to identify applicability of biotechnological cleanup methods for waste streams and polluted soil. (orig.) [de

  9. Limitations of microbial hydrocarbon degradation at the Amon mud volcano (Nile deep-sea fan)

    NARCIS (Netherlands)

    Felden, J.; Lichtschlag, A.; Wenzhöfer, F.; de Beer, D.; Feseker, T.; Pop Ristova, P.; de Lange, G.; Boetius, A.

    2013-01-01

    The Amon mud volcano (MV), located at 1250m water depth on the Nile deep-sea fan, is known for its active emission of methane and non-methane hydrocarbons into the hydrosphere. Previous investigations showed a low efficiency of hydrocarbon-degrading anaerobic microbial communities inhabiting the

  10. Hydrocarbon-degrading bacteria enriched by the Deepwater Horizon oil spill identified by cultivation and DNA-SIP

    Science.gov (United States)

    Gutierrez, Tony; Singleton, David R; Berry, David; Yang, Tingting; Aitken, Michael D; Teske, Andreas

    2013-01-01

    The massive influx of crude oil into the Gulf of Mexico during the Deepwater Horizon (DWH) disaster triggered dramatic microbial community shifts in surface oil slick and deep plume waters. Previous work had shown several taxa, notably DWH Oceanospirillales, Cycloclasticus and Colwellia, were found to be enriched in these waters based on their dominance in conventional clone and pyrosequencing libraries and were thought to have had a significant role in the degradation of the oil. However, this type of community analysis data failed to provide direct evidence on the functional properties, such as hydrocarbon degradation of organisms. Using DNA-based stable-isotope probing with uniformly 13C-labelled hydrocarbons, we identified several aliphatic (Alcanivorax, Marinobacter)- and polycyclic aromatic hydrocarbon (Alteromonas, Cycloclasticus, Colwellia)-degrading bacteria. We also isolated several strains (Alcanivorax, Alteromonas, Cycloclasticus, Halomonas, Marinobacter and Pseudoalteromonas) with demonstrable hydrocarbon-degrading qualities from surface slick and plume water samples collected during the active phase of the spill. Some of these organisms accounted for the majority of sequence reads representing their respective taxa in a pyrosequencing data set constructed from the same and additional water column samples. Hitherto, Alcanivorax was not identified in any of the previous water column studies analysing the microbial response to the spill and we discuss its failure to respond to the oil. Collectively, our data provide unequivocal evidence on the hydrocarbon-degrading qualities for some of the dominant taxa enriched in surface and plume waters during the DWH oil spill, and a more complete understanding of their role in the fate of the oil. PMID:23788333

  11. Biodegradation aspects of Polycyclic Aromatic Hydrocarbons (PAHs): A review

    Energy Technology Data Exchange (ETDEWEB)

    Haritash, A.K., E-mail: akharitash@gmail.com [Department of Environmental Science and Engineering, Guru Jambheshwar University of Science and Technology, Hisar, Haryana (India); Kaushik, C.P. [Department of Environmental Science and Engineering, Guru Jambheshwar University of Science and Technology, Hisar, Haryana (India)

    2009-09-30

    PAHs are aromatic hydrocarbons with two or more fused benzene rings with natural as well as anthropogenic sources. They are widely distributed environmental contaminants that have detrimental biological effects, toxicity, mutagenecity and carcinogenicity. Due to their ubiquitous occurrence, recalcitrance, bioaccumulation potential and carcinogenic activity, the PAHs have gathered significant environmental concern. Although PAH may undergo adsorption, volatilization, photolysis, and chemical degradation, microbial degradation is the major degradation process. PAH degradation depends on the environmental conditions, number and type of the microorganisms, nature and chemical structure of the chemical compound being degraded. They are biodegraded/biotransformed into less complex metabolites, and through mineralization into inorganic minerals, H{sub 2}O, CO{sub 2} (aerobic) or CH{sub 4} (anaerobic) and rate of biodegradation depends on pH, temperature, oxygen, microbial population, degree of acclimation, accessibility of nutrients, chemical structure of the compound, cellular transport properties, and chemical partitioning in growth medium. A number of bacterial species are known to degrade PAHs and most of them are isolated from contaminated soil or sediments. Pseudomonas aeruginosa, Pseudomons fluoresens, Mycobacterium spp., Haemophilus spp., Rhodococcus spp., Paenibacillus spp. are some of the commonly studied PAH-degrading bacteria. Lignolytic fungi too have the property of PAH degradation. Phanerochaete chrysosporium, Bjerkandera adusta, and Pleurotus ostreatus are the common PAH-degrading fungi. Enzymes involved in the degradation of PAHs are oxygenase, dehydrogenase and lignolytic enzymes. Fungal lignolytic enzymes are lignin peroxidase, laccase, and manganese peroxidase. They are extracellular and catalyze radical formation by oxidation to destabilize bonds in a molecule. The biodegradation of PAHs has been observed under both aerobic and anaerobic conditions

  12. Biodegradation aspects of Polycyclic Aromatic Hydrocarbons (PAHs): A review

    International Nuclear Information System (INIS)

    Haritash, A.K.; Kaushik, C.P.

    2009-01-01

    PAHs are aromatic hydrocarbons with two or more fused benzene rings with natural as well as anthropogenic sources. They are widely distributed environmental contaminants that have detrimental biological effects, toxicity, mutagenecity and carcinogenicity. Due to their ubiquitous occurrence, recalcitrance, bioaccumulation potential and carcinogenic activity, the PAHs have gathered significant environmental concern. Although PAH may undergo adsorption, volatilization, photolysis, and chemical degradation, microbial degradation is the major degradation process. PAH degradation depends on the environmental conditions, number and type of the microorganisms, nature and chemical structure of the chemical compound being degraded. They are biodegraded/biotransformed into less complex metabolites, and through mineralization into inorganic minerals, H 2 O, CO 2 (aerobic) or CH 4 (anaerobic) and rate of biodegradation depends on pH, temperature, oxygen, microbial population, degree of acclimation, accessibility of nutrients, chemical structure of the compound, cellular transport properties, and chemical partitioning in growth medium. A number of bacterial species are known to degrade PAHs and most of them are isolated from contaminated soil or sediments. Pseudomonas aeruginosa, Pseudomons fluoresens, Mycobacterium spp., Haemophilus spp., Rhodococcus spp., Paenibacillus spp. are some of the commonly studied PAH-degrading bacteria. Lignolytic fungi too have the property of PAH degradation. Phanerochaete chrysosporium, Bjerkandera adusta, and Pleurotus ostreatus are the common PAH-degrading fungi. Enzymes involved in the degradation of PAHs are oxygenase, dehydrogenase and lignolytic enzymes. Fungal lignolytic enzymes are lignin peroxidase, laccase, and manganese peroxidase. They are extracellular and catalyze radical formation by oxidation to destabilize bonds in a molecule. The biodegradation of PAHs has been observed under both aerobic and anaerobic conditions and the rate can

  13. Proteogenomic Characterization of Monocyclic Aromatic Hydrocarbon Degradation Pathways in the Aniline-Degrading Bacterium Burkholderia sp. K24.

    Directory of Open Access Journals (Sweden)

    Sang-Yeop Lee

    Full Text Available Burkholderia sp. K24, formerly known as Acinetobacter lwoffii K24, is a soil bacterium capable of utilizing aniline as its sole carbon and nitrogen source. Genomic sequence analysis revealed that this bacterium possesses putative gene clusters for biodegradation of various monocyclic aromatic hydrocarbons (MAHs, including benzene, toluene, and xylene (BTX, as well as aniline. We verified the proposed MAH biodegradation pathways by dioxygenase activity assays, RT-PCR, and LC/MS-based quantitative proteomic analyses. This proteogenomic approach revealed four independent degradation pathways, all converging into the citric acid cycle. Aniline and p-hydroxybenzoate degradation pathways converged into the β-ketoadipate pathway. Benzoate and toluene were degraded through the benzoyl-CoA degradation pathway. The xylene isomers, i.e., o-, m-, and p-xylene, were degraded via the extradiol cleavage pathways. Salicylate was degraded through the gentisate degradation pathway. Our results show that Burkholderia sp. K24 possesses versatile biodegradation pathways, which may be employed for efficient bioremediation of aniline and BTX.

  14. Proteogenomic Characterization of Monocyclic Aromatic Hydrocarbon Degradation Pathways in the Aniline-Degrading Bacterium Burkholderia sp. K24

    Science.gov (United States)

    Yun, Sung Ho; Choi, Chi-Won; Yi, Yoon-Sun; Kim, Jonghyun; Chung, Young-Ho; Park, Edmond Changkyun; Kim, Seung Il

    2016-01-01

    Burkholderia sp. K24, formerly known as Acinetobacter lwoffii K24, is a soil bacterium capable of utilizing aniline as its sole carbon and nitrogen source. Genomic sequence analysis revealed that this bacterium possesses putative gene clusters for biodegradation of various monocyclic aromatic hydrocarbons (MAHs), including benzene, toluene, and xylene (BTX), as well as aniline. We verified the proposed MAH biodegradation pathways by dioxygenase activity assays, RT-PCR, and LC/MS-based quantitative proteomic analyses. This proteogenomic approach revealed four independent degradation pathways, all converging into the citric acid cycle. Aniline and p-hydroxybenzoate degradation pathways converged into the β-ketoadipate pathway. Benzoate and toluene were degraded through the benzoyl-CoA degradation pathway. The xylene isomers, i.e., o-, m-, and p-xylene, were degraded via the extradiol cleavage pathways. Salicylate was degraded through the gentisate degradation pathway. Our results show that Burkholderia sp. K24 possesses versatile biodegradation pathways, which may be employed for efficient bioremediation of aniline and BTX. PMID:27124467

  15. A test of plant-aided petroleum hydrocarbon degradation

    Energy Technology Data Exchange (ETDEWEB)

    Hosler, K R [Water Technology International Corp., Burlington, ON (Canada); Drake, E N [Exxon Research Engineering Co., Annandale, NJ (United States)

    1999-12-31

    A research program was established to develop environmental restoration technologies which apply to contaminated industrial sites. The program involved two separate but related parts. Part One involved a multi-year field study, Part Two a greenhouse potted plant study. This paper presents the results of the greenhouse-based phytoremediation experiment which assessed the potential impacts of three treatment factors on the degradation of total petroleum hydrocarbons (TPH) in contaminated soils for use in those cases where the use of plants for restoring contaminated environments might be a simple and cost-effective clean-up alternative. This study showed that biologically-aided contaminant degradation can be enhanced by various treatments such as adding nutrients in the form of inorganic fertilizers, adding oxygen or modifying soil conditions. The study also showed that contaminant degradation can be enhanced in the rhizosphere of various plant species and that remediation of some contaminants can be achieved by exploiting the unique symbiotic relationship between some fungal species and plant roots. 22 refs., 3 tabs., 1 fig.

  16. A test of plant-aided petroleum hydrocarbon degradation

    International Nuclear Information System (INIS)

    Hosler, K.R.; Drake, E.N.

    1998-01-01

    A research program was established to develop environmental restoration technologies which apply to contaminated industrial sites. The program involved two separate but related parts. Part One involved a multi-year field study, Part Two a greenhouse potted plant study. This paper presents the results of the greenhouse-based phytoremediation experiment which assessed the potential impacts of three treatment factors on the degradation of total petroleum hydrocarbons (TPH) in contaminated soils for use in those cases where the use of plants for restoring contaminated environments might be a simple and cost-effective clean-up alternative. This study showed that biologically-aided contaminant degradation can be enhanced by various treatments such as adding nutrients in the form of inorganic fertilizers, adding oxygen or modifying soil conditions. The study also showed that contaminant degradation can be enhanced in the rhizosphere of various plant species and that remediation of some contaminants can be achieved by exploiting the unique symbiotic relationship between some fungal species and plant roots. 22 refs., 3 tabs., 1 fig

  17. Isolation and characterization of Halomonas sp. strain C2SS100, a hydrocarbon-degrading bacterium under hypersaline conditions.

    Science.gov (United States)

    Mnif, S; Chamkha, M; Sayadi, S

    2009-09-01

    To isolate and characterize an efficient hydrocarbon-degrading bacterium under hypersaline conditions, from a Tunisian off-shore oil field. Production water collected from 'Sercina' petroleum reservoir, located near the Kerkennah island, Tunisia, was used for the screening of halotolerant or halophilic bacteria able to degrade crude oil. Bacterial strain C2SS100 was isolated after enrichment on crude oil, in the presence of 100 g l(-1) NaCl and at 37 degrees C. This strain was aerobic, Gram-negative, rod-shaped, motile, oxidase + and catalase +. Phenotypic characters and phylogenetic analysis based on the 16S rRNA gene of the isolate C2SS100 showed that it was related to members of the Halomonas genus. The degradation of several compounds present in crude oil was confirmed by GC-MS analysis. The use of refined petroleum products such as diesel fuel and lubricating oil as sole carbon source, under the same conditions of temperature and salinity, showed that significant amounts of these heterogenic compounds could be degraded. Strain C2SS100 was able to degrade hexadecane (C16). During growth on hexadecane, cells surface hydrophobicity and emulsifying activity increased indicating the production of biosurfactant by strain C2SS100. A halotolerant bacterial strain Halomonas sp. C2SS100 was isolated from production water of an oil field, after enrichment on crude oil. This strain is able to degrade hydrocarbons efficiently. The mode of hydrocarbon uptake is realized by the production of a biosurfactant which enhances the solubility of hydrocarbons and renders them more accessible for biodegradation. The biodegradation potential of the Halomonas sp. strain C2SS100 gives it an advantage for possibly application on bioremediation of water, hydrocarbon-contaminated sites under high-salinity level.

  18. Isolation of microorganisms with capability to degrade polycyclic aromatic hydrocarbons (PATH )

    International Nuclear Information System (INIS)

    Vargas, M.C; Ramirez, N.E; Rueda, S.M; Sanchez, F.N

    1996-01-01

    This paper summarizes a work conducted on the isolation of microorganisms of contaminated sediments with a high percentage of hydrocarbons aromatic polynuclear (Polynuclear Aromatic Hydrocarbons, PAHS) The methodology involved two selection systems called fast route and slow route in which exposure periods and contaminant concentrations are the key determinants. The microorganisms isolated through the slow route system are more likely to be successful in degrading high molecular weight PAH'S. The six strains obtained through the fast route system were able to grow on low molecular weight PAH's showing preference towards the first four compounds of the sixteen demanded by the EPA (Environmental Protection Agency)

  19. Variability of Biological Degradation of Phenolic Hydrocarbons in an Aerobic Aquifer Determined by Laboratory Batch Experiments

    DEFF Research Database (Denmark)

    Nielsen, Per Henning; Christensen, Thomas Højlund

    1994-01-01

    The biological aerobic degradation of 7 phenolic hydrocarbons (phenol, o-cresol, o-nitrophenol, p-nitrophenol, 2,6-dichlorophenol, 2,4-dichlorophenol, 4,6-o-dichlorocresol) and 1 aromatic hydrocarbon (nitrobenzene) was studied for 149 days in replicate laboratory batch microcosms with sediment...... and groundwater from 8 localities representing a 15 m × 30 m section of an aerobic aquifer. Three patterns of variation were found: (1) phenol, o-cresol and in most cases p-nitrophenol showed very fast degradation with no or only short lag phases and with very little variation among localities; (2) 2...

  20. Top-Down Control of Diesel-Degrading Prokaryotic Communities.

    Science.gov (United States)

    Sauret, Caroline; Böttjer, Daniela; Talarmin, Agathe; Guigue, Catherine; Conan, Pascal; Pujo-Pay, Mireille; Ghiglione, Jean-François

    2015-08-01

    Biostimulation through the addition of inorganic nutrients has been the most widely practiced bioremediation strategy in oil-polluted marine waters. However, little attention has so far been paid to the microbial food web and the impact of top-down control that directly or indirectly influences the success of the bioremediation. We designed a mesocosm experiment using pre-filtered (diesel fuel. Prokaryotes, HNF and VLP abundances showed a predator-prey succession, with a co-development of HNF and VLP. In the polluted system, we observed a stronger impact of viral lysis on prokaryotic abundances than in the control. Analysis of the diversity revealed that a bloom of Vibrio sp. occurred in the polluted mesocosm. That bloom was rapidly followed by a less abundant and more even community of predation-resistant bacteria, including known hydrocarbon degraders such as Oleispira spp. and Methylophaga spp. and opportunistic bacteria such as Percisivirga spp., Roseobacter spp. and Phaeobacter spp. The shift in prokaryotic dominance in response to viral lysis provided clear evidence of the 'killing the winner' model. Nevertheless, despite clear effects on prokaryotic abundance, activity and diversity, the diesel degradation was not impacted by top-down control. The present study investigates for the first time the functioning of a complex microbial network (including VLP) using a nutrient-based biostimulation strategy and highlights some key processes useful for tailoring bioremediation.

  1. Durability and degradation analysis of hydrocarbon ionomer membranes in polymer electrolyte fuel cells accelerated stress evaluation

    Science.gov (United States)

    Shimizu, Ryo; Tsuji, Junichi; Sato, Nobuyuki; Takano, Jun; Itami, Shunsuke; Kusakabe, Masato; Miyatake, Kenji; Iiyama, Akihiro; Uchida, Makoto

    2017-11-01

    The chemical durabilities of two proton-conducting hydrocarbon polymer electrolyte membranes, sulfonated benzophenone poly(arylene ether ketone) (SPK) semiblock copolymer and sulfonated phenylene poly(arylene ether ketone) (SPP) semiblock copolymer are evaluated under accelerated open circuit voltage (OCV) conditions in a polymer electrolyte fuel cell (PEFC). Post-test characterization of the membrane electrodes assemblies (MEAs) is carried out via gel permeation chromatography (GPC) and nuclear magnetic resonance (NMR) spectroscopy. These results are compared with those of the initial MEAs. The SPP cell shows the highest OCV at 1000 h, and, in the post-test analysis, the SPP membrane retains up to 80% of the original molecular weight, based on the GPC results, and 90% of the hydrophilic structure, based on the NMR results. The hydrophilic structure of the SPP membrane is more stable after the durability evaluation than that of the SPK. From these results, the SPP membrane, with its simple hydrophilic structure, which does not include ketone groups, is seen to be significantly more resistant to radical attack. This structure leads to high chemical durability and thus impedes the chemical decomposition of the membrane.

  2. Bioremediation of polyaromatic hydrocarbons (PAHs using rhizosphere technology

    Directory of Open Access Journals (Sweden)

    Sandeep Bisht

    2015-03-01

    Full Text Available The remediation of polluted sites has become a priority for society because of increase in quality of life standards and the awareness of environmental issues. Over the past few decades there has been avid interest in developing in situ strategies for remediation of environmental contaminants, because of the high economic cost of physicochemical strategies, the biological tools for remediation of these persistent pollutants is the better option. Major foci have been considered on persistent organic chemicals i.e.polyaromatic hydrocarbons (PAHs due to their ubiquitous occurrence, recalcitrance, bioaccumulation potential and carcinogenic activity. Rhizoremediation, a specific type of phytoremediation that involves both plants and their associated rhizospheric microbes is the creative biotechnological approach that has been explored in this review. Moreover, in this review we showed the significance of rhizoremediation of PAHs from other bioremediation strategies i.e. natural attenuation, bioaugmentation and phytoremediation and also analyze certain environmental factor that may influence the rhizoremediation technique. Numerous bacterial species were reported to degrade variety of PAHs and most of them are isolated from contaminated soil, however few reports are available from non contaminated soil. Pseudomonas aeruginosa, Pseudomons fluoresens, Mycobacterium spp., Haemophilus spp., Rhodococcus spp., Paenibacillus spp. are some of the commonly studied PAH-degrading bacteria. Finally, exploring the molecular communication between plants and microbes, and exploiting this communication to achieve better results in the elimination of contaminants, is a fascinating area of research for future perspective.

  3. Bioremediation of polyaromatic hydrocarbons (PAHs) using rhizosphere technology

    Science.gov (United States)

    Bisht, Sandeep; Pandey, Piyush; Bhargava, Bhavya; Sharma, Shivesh; Kumar, Vivek; Sharma, Krishan D.

    2015-01-01

    The remediation of polluted sites has become a priority for society because of increase in quality of life standards and the awareness of environmental issues. Over the past few decades there has been avid interest in developing in situ strategies for remediation of environmental contaminants, because of the high economic cost of physicochemical strategies, the biological tools for remediation of these persistent pollutants is the better option. Major foci have been considered on persistent organic chemicals i.e. polyaromatic hydrocarbons (PAHs) due to their ubiquitous occurrence, recalcitrance, bioaccumulation potential and carcinogenic activity. Rhizoremediation, a specific type of phytoremediation that involves both plants and their associated rhizospheric microbes is the creative biotechnological approach that has been explored in this review. Moreover, in this review we showed the significance of rhizoremediation of PAHs from other bioremediation strategies i.e. natural attenuation, bioaugmentation and phytoremediation and also analyze certain environmental factor that may influence the rhizoremediation technique. Numerous bacterial species were reported to degrade variety of PAHs and most of them are isolated from contaminated soil, however few reports are available from non contaminated soil. Pseudomonas aeruginosa , Pseudomons fluoresens , Mycobacterium spp., Haemophilus spp., Rhodococcus spp., Paenibacillus spp. are some of the commonly studied PAH-degrading bacteria. Finally, exploring the molecular communication between plants and microbes, and exploiting this communication to achieve better results in the elimination of contaminants, is a fascinating area of research for future perspective. PMID:26221084

  4. Anaerobic degradation of propane and butane by sulfate-reducing bacteria enriched from marine hydrocarbon cold seeps.

    Science.gov (United States)

    Jaekel, Ulrike; Musat, Niculina; Adam, Birgit; Kuypers, Marcel; Grundmann, Olav; Musat, Florin

    2013-05-01

    The short-chain, non-methane hydrocarbons propane and butane can contribute significantly to the carbon and sulfur cycles in marine environments affected by oil or natural gas seepage. In the present study, we enriched and identified novel propane and butane-degrading sulfate reducers from marine oil and gas cold seeps in the Gulf of Mexico and Hydrate Ridge. The enrichment cultures obtained were able to degrade simultaneously propane and butane, but not other gaseous alkanes. They were cold-adapted, showing highest sulfate-reduction rates between 16 and 20 °C. Analysis of 16S rRNA gene libraries, followed by whole-cell hybridizations with sequence-specific oligonucleotide probes showed that each enrichment culture was dominated by a unique phylotype affiliated with the Desulfosarcina-Desulfococcus cluster within the Deltaproteobacteria. These phylotypes formed a distinct phylogenetic cluster of propane and butane degraders, including sequences from environments associated with hydrocarbon seeps. Incubations with (13)C-labeled substrates, hybridizations with sequence-specific probes and nanoSIMS analyses showed that cells of the dominant phylotypes were the first to become enriched in (13)C, demonstrating that they were directly involved in hydrocarbon degradation. Furthermore, using the nanoSIMS data, carbon assimilation rates were calculated for the dominant cells in each enrichment culture.

  5. Effect of concentration gradients on biodegradation in bench-scale sand columns with HYDRUS modeling of hydrocarbon transport and degradation.

    Science.gov (United States)

    Horel, Agota; Schiewer, Silke; Misra, Debasmita

    2015-09-01

    The present research investigated to what extent results obtained in small microcosm experiments can be extrapolated to larger settings with non-uniform concentrations. Microbial hydrocarbon degradation in sandy sediments was compared for column experiments versus homogenized microcosms with varying concentrations of diesel, Syntroleum, and fish biodiesel as contaminants. Syntroleum and fish biodiesel had higher degradation rates than diesel fuel. Microcosms showed significantly higher overall hydrocarbon mineralization percentages (p transport and degradation of the investigated fuels in vadose zone conditions similar to those in laboratory column experiments. The numerical model was used to evaluate the impact of different degradation rate constants from microcosm versus column experiments.

  6. Draft Genome Sequence of Advenella kashmirensis Strain W13003, a Polycyclic Aromatic Hydrocarbon-Degrading Bacterium

    Science.gov (United States)

    Jin, Decai; Zhou, Lisha; Wu, Liang; An, Wei; Zhao, Lin

    2014-01-01

    Advenella kashmirensis strain W13003 is a polycyclic aromatic hydrocarbon (PAH)-degrading bacterium isolated from PAH-contaminated marine sediments. Here, we report the 4.8-Mb draft genome sequence of this strain, which will provide insights into the diversity of A. kashmirensis and the mechanism of PAH degradation in the marine environment. PMID:24482505

  7. Isolation and characterization of novel hydrocarbon-degrading euryhaline consortia from crude oil and mangrove sediments.

    Science.gov (United States)

    Piedad Díaz, M; Grigson, S J; Peppiatt, C J; Burgess, J G

    2000-11-01

    Two novel and versatile bacterial consortia were developed for the biodegradation of hydrocarbons. They were isolated from crude oil from the Cormorant Field in the North Sea (MPD-7) and from sediment associated with mangrove roots (MPD-M). The bacterial consortia were able to degrade both aliphatic and aromatic hydrocarbons in crude oils very effectively in seawater (35 g/L NaCl) and synthetic media containing 0 to 100 g/L NaCl (1.7 M). Salinities over twice that of normal seawater decreased the biodegradation rates. However, even at the highest salinity biodegradation was significant. Ratios of nC17 to pristane and nC18 to phytane were significantly lowered across the range of salinity. The lowest values were at 0 and 20 g/L (0.34 M). Phytane was degraded in preference to pristane. The degradation of these compounds was constant over the salinity range, with evidence of a slight increase for consortium MPD-M with increasing salinity. In general, the consortium isolated from mangrove root sediments was more efficient in metabolizing North Sea crude oil than the consortium isolated from Cormorant crude oil. The 5 strains that comprise MPD-M have been tentatively identified as species of the genera Marinobacter, Bacillus, and Erwinia. This is the first report of hydrocarbon-degrading consortia isolated from crude oil and mangrove sediments that are capable of treating oily wastes over such a wide range of salinity.

  8. Characterization of hydrocarbon-degrading and biosurfactant-producing Pseudomonas sp. P-1 strain as a potential tool for bioremediation of petroleum-contaminated soil.

    Science.gov (United States)

    Pacwa-Płociniczak, Magdalena; Płaza, Grażyna Anna; Poliwoda, Anna; Piotrowska-Seget, Zofia

    2014-01-01

    The Pseudomonas sp. P-1 strain, isolated from heavily petroleum hydrocarbon-contaminated soil, was investigated for its capability to degrade hydrocarbons and produce a biosurfactant. The strain degraded crude oil, fractions A5 and P3 of crude oil, and hexadecane (27, 39, 27 and 13% of hydrocarbons added to culture medium were degraded, respectively) but had no ability to degrade phenanthrene. Additionally, the presence of gene-encoding enzymes responsible for the degradation of alkanes and naphthalene in the genome of the P-1 strain was reported. Positive results of blood agar and methylene blue agar tests, as well as the presence of gene rhl, involved in the biosynthesis of rhamnolipid, confirmed the ability of P-1 for synthesis of glycolipid biosurfactant. 1H and 13C nuclear magnetic resonance, Fourier transform infrared spectrum and mass spectrum analyses indicated that the extracted biosurfactant was affiliated with rhamnolipid. The results of this study indicate that the P-1 and/or biosurfactant produced by this strain have the potential to be used in bioremediation of hydrocarbon-contaminated soils.

  9. Screening of ectomycorrhizal fungi for degradation of polycyclic aromatic hydrocarbons

    Energy Technology Data Exchange (ETDEWEB)

    Braun-Luellemann, A.; Huettermann, A.; Majcherczyk, A. [Goettingen Univ. (Germany). Inst. fuer Forstbotanik

    2000-07-01

    Ectomycorrhizal fungi belonging to 16 species (27 strains) were tested for their ability to degrade polycyclic aromatic hydrocarbons (PAHs): Phenanthrene, chrysene, pyrene and benzo[a]pyrene. Cultivated on a complex liquid medium, most of the fungi tested were able to metabolise these compounds. Approximately 50% of the benzo[a]pyrene was removed by strains of Amanita excelsa, Leccinum versipelle, Suillus grevillei, S. luteus, and S. variegatus during a 4-week incubation period. The same amount of phenanthrene was also metabolised by A. muscaria, Paxillus involutus, and S. grevillei. The degradation of the other two PAHs was, for the most part, less effective. Only S. grevillei was able to remove 50% of the pyrene, whereas Boletus edulis and A. muscaria removed 35% of the chrysene. (orig.)

  10. Simulation of Deepwater Horizon oil plume reveals substrate specialization within a complex community of hydrocarbon degraders.

    Science.gov (United States)

    Hu, Ping; Dubinsky, Eric A; Probst, Alexander J; Wang, Jian; Sieber, Christian M K; Tom, Lauren M; Gardinali, Piero R; Banfield, Jillian F; Atlas, Ronald M; Andersen, Gary L

    2017-07-11

    The Deepwater Horizon (DWH) accident released an estimated 4.1 million barrels of oil and 10 10 mol of natural gas into the Gulf of Mexico, forming deep-sea plumes of dispersed oil droplets and dissolved gases that were largely degraded by bacteria. During the course of this 3-mo disaster a series of different bacterial taxa were enriched in succession within deep plumes, but the metabolic capabilities of the different populations that controlled degradation rates of crude oil components are poorly understood. We experimentally reproduced dispersed plumes of fine oil droplets in Gulf of Mexico seawater and successfully replicated the enrichment and succession of the principal oil-degrading bacteria observed during the DWH event. We recovered near-complete genomes, whose phylogeny matched those of the principal biodegrading taxa observed in the field, including the DWH Oceanospirillales (now identified as a Bermanella species), multiple species of Colwellia , Cycloclasticus , and other members of Gammaproteobacteria, Flavobacteria, and Rhodobacteria. Metabolic pathway analysis, combined with hydrocarbon compositional analysis and species abundance data, revealed substrate specialization that explained the successional pattern of oil-degrading bacteria. The fastest-growing bacteria used short-chain alkanes. The analyses also uncovered potential cooperative and competitive relationships, even among close relatives. We conclude that patterns of microbial succession following deep ocean hydrocarbon blowouts are predictable and primarily driven by the availability of liquid petroleum hydrocarbons rather than natural gases.

  11. Degradation of hydrocarbons in arctic areas

    International Nuclear Information System (INIS)

    Hundahl Pedersen, M.; Grau-Hansen, B.; Watson Nielsen, T.; Jensen, L.

    1999-12-01

    The scope of this project is to examine the natural degradation of a hydrocarbon contamination by investigating a specific location. The investigated location is a former airfield at Marraq situated on the west coast of Greenland, approx. 90 km south of Nuuk. In Autumn 1942 the US Air force established a diversion airfield called 'Teague Airfield' - under the military code name Bluie West-4. However, the location was abandoned in 1948 and accordingly all facilities and equipment were left behind, among these were a large amount of oil barrels, which mainly contained gas oil. In relation to the present investigation a number of disposal sites were found each containing approx. 50-600 oil barrels of 200 litres each. Through the years these barrels have corroded causing a heavy gas oil contamination several places on the site. This contamination is estimated to have taken place for approx. 40-50 years ago. The contamination is of such a severe character that a heavy smell of oil can be determined on site. Furthermore, vegetation mortality was observed around the barrels in connection to disposal sites situated in places covered by plants. Marraq is a peninsula consisting of coarse fluviatile deposits. The geology is relatively homogeneous without permafrost, which combined with a range of local defined contaminations, provide a unique possibility to assess the controlling environmental factors of natural degradation of oil contamination in the Arctic. A conservative estimate of the complete amount of gas oil which has contaminated the location is estimated to approx. 120,000 litres or more. The investigation showed that the extent of the oil degradation was different at the individual deposit sites. Roughly estimated the contamination is degraded on the order of 15 to twice the original oil amount. Assumable the contamination has been degraded due to the weathering process (evaporation and wash-out) and microbial degradation. Complex processes are involved depending

  12. Anaerobic degradation of benzene by marine sulfate-reducing bacteria

    Science.gov (United States)

    Musat, Florin; Wilkes, Heinz; Musat, Niculina; Kuypers, Marcel; Widdel, Friedrich

    2010-05-01

    Benzene, the archetypal aromatic hydrocarbon is a common constituent of crude oil and oil-refined products. As such, it can enter the biosphere through natural oil seeps or as a consequence of exploitation of fossil fuel reservoirs. Benzene is chemically very stable, due to the stabilizing aromatic electron system and to the lack of functional groups. Although the anaerobic degradation of benzene has been reported under denitrifying, sulfate-reducing and methanogenic conditions, the microorganisms involved and the initial biochemical steps of degradation remain insufficiently understood. Using marine sediment from a Mediterranean lagoon a sulfate-reducing enrichment culture with benzene as the sole organic substrate was obtained. Application of 16S rRNA gene-based methods showed that the enrichment was dominated (more than 85% of total cells) by a distinct phylotype affiliated with a clade of Deltaproteobacteria that include degraders of other aromatic hydrocarbons, such as naphthalene, ethylbenzene and m-xylene. Using benzoate as a soluble substrate in agar dilution series, several pure cultures closely related to Desulfotignum spp. and Desulfosarcina spp. were isolated. None of these strains was able to utilize benzene as a substrate and hybridizations with specific oligonucleotide probes showed that they accounted for as much as 6% of the total cells. Incubations with 13C-labeled benzene followed by Halogen in situ Hybridization - Secondary Ion Mass Spectroscopy (HISH-SIMS) analysis showed that cells of the dominant phylotype were highly enriched in 13C, while the accompanying bacteria had little or no 13C incorporation. These results demonstrate that the dominant phylotype was indeed the apparent benzene degrader. Dense-cell suspensions of the enrichment culture did not show metabolic activity toward added phenol or toluene, suggesting that benzene degradation did not proceed through anaerobic hydroxylation or methylation. Instead, benzoate was identified in

  13. Impact of protists on a hydrocarbon-degrading bacterial community from deep-sea Gulf of Mexico sediments: A microcosm study

    Science.gov (United States)

    Beaudoin, David J.; Carmichael, Catherine A.; Nelson, Robert K.; Reddy, Christopher M.; Teske, Andreas P.; Edgcomb, Virginia P.

    2016-07-01

    In spite of significant advancements towards understanding the dynamics of petroleum hydrocarbon degrading microbial consortia, the impacts (direct or indirect via grazing activities) of bacterivorous protists remain largely unknown. Microcosm experiments were used to examine whether protistan grazing affects the petroleum hydrocarbon degradation capacity of a deep-sea sediment microbial community from an active Gulf of Mexico cold seep. Differences in n-alkane content between native sediment microcosms and those treated with inhibitors of eukaryotes were assessed by comprehensive two-dimensional gas chromatography following 30-90 day incubations and analysis of shifts in microbial community composition using small subunit ribosomal RNA gene clone libraries. More biodegradation was observed in microcosms supplemented with eukaryotic inhibitors. SSU rRNA gene clone libraries from oil-amended treatments revealed an increase in the number of proteobacterial clones (particularly γ-proteobacteria) after spiking sediments with diesel oil. Bacterial community composition shifted, and degradation rates increased, in treatments where protists were inhibited, suggesting protists affect the hydrocarbon degrading capacity of microbial communities in sediments collected at this Gulf of Mexico site.

  14. Alteration in cell surface properties of Burkholderia spp. during surfactant-aided biodegradation of petroleum hydrocarbons

    Energy Technology Data Exchange (ETDEWEB)

    Mohanty, Sagarika; Mukherji, Suparna [Indian Institute of Technology Bombay, Mumbai (India). Centre for Environmental Science and Engineering (CESE)

    2012-04-15

    Chemical surfactants may impact microbial cell surface properties, i.e., cell surface hydrophobicity (CSH) and cell surface charge, and may thus affect the uptake of components from non-aqueous phase liquids (NAPLs). This work explored the impact of Triton X-100, Igepal CA 630, and Tween 80 (at twice the critical micelle concentration, CMC) on the cell surface characteristics of Burkholderia cultures, Burkholderia cepacia (ES1, aliphatic degrader) and Burkholderia multivorans (NG1, aromatic degrader), when grown on a six-component model NAPL. In the presence of Triton X-100, NAPL biodegradation was enhanced from 21% to 60% in B. cepacia and from 18% to 53% in B. multivorans. CSH based on water contact angle (50-52 ) was in the same range for both strains while zeta potential at neutral pH was -38 and -31 mV for B. cepacia and B. multivorans, respectively. In the presence of Triton X-100, their CSH increased to greater than 75 and the zeta potential decreased. This induced a change in the mode of uptake and initiated aliphatic hydrocarbon degradation by B. multivorans and increased the rate of aliphatic hydrocarbon degradation in B. cepacia. Igepal CA 630 and Tween 80 also altered the cell surface properties. For B. cepacia grown in the presence of Triton X-100 at two and five times its CMC, CSH increased significantly in the log growth phase. Growth in the presence of the chemical surfactants also affected the abundance of chemical functional groups on the cell surface. Cell surface changes had maximum impact on NAPL degradation in the presence of emulsifying surfactants, Triton X-100 and Igepal CA630.

  15. Individually and Synergistic Degradation of Hydrocarbons by Biosurfactant Producing Bacteria

    Directory of Open Access Journals (Sweden)

    Amirarsalan Kavyanifard

    2016-02-01

    Full Text Available Background: Increasing worldwide contamination with hydrocarbons has urged environmental remediation using biological agents such as bacteria. Our goal here was to study the phylogenetic relationship of two crude oil degrader bacteria and investigation of their ability to degrade hydrocarbons. Materials and Methods: Phylogenetic relationship of isolates was determined using morphological and biochemical characteristics and 16S rDNA gene sequencing. Optimum conditions of each isolate for crude oil degradation were investigated using one factor in time method. The rate of crude oil degradation by individual and consortium bacteria was assayed via Gas chromatography–mass spectrometry (GC-MS analysis. Biosurfactant production was measured by Du Noüy ring method using Krüss-K6 tensiometer. Results: The isolates were identified as Dietzia cinnamea KA1 and Dietzia cinnamea AP and clustered separately, while both are closely related to each other and with other isolates of Dietzia cinnamea. The optimal conditions for D. cinnamea KA1 were 35°C, pH9.0, 510 mM NaCl, and minimal requirement of 46.5 mM NH4Cl and 2.10 mM NaH2PO4. In the case of D. cinnamea AP, the values were 30°C, pH8.0, 170 mM NaCl, and minimal requirement of 55.8 mM NH4Cl and 2.10 mM NaH2PO4, respectively. Gas chromatography – Mass Spectroscopy (GC-MS analysis showed that both isolates were able to utilize various crude oil compounds, but D. cinnamea KA1 was more efficient individually and consortium of isolates was the most. The isolates were able to grow and produce biosurfactant when cultured in MSM supplemented with crude oil and optimization of MSM conditions lead to increase in biosurfactant production. Conclusion: To the best of our knowledge this is the first report of synergistic relationship between two strains of D. cinnamea in biodegradation of crude oil components, including poisonous and carcinogenic compound in a short time.

  16. Bioassays with terrestrial and aquatic species as monitoring tools of hydrocarbon degradation.

    Science.gov (United States)

    Bori, Jaume; Vallès, Bettina; Ortega, Lina; Riva, Maria Carme

    2016-09-01

    In this study chemical analyses and ecotoxicity tests were applied for the assessment of a heavily hydrocarbon-contaminated soil prior and after the application of a remediation procedure that consisted in the stimulation of soil autochthonous populations of hydrocarbon degraders in static-ventilated biopiles. Terrestrial bioassays were applied in mixtures of test soils and artificial control soil and studied the survival and reproduction of Eisenia fetida and the avoidance response of E. fetida and Folsomia candida. Effects on aquatic organisms were studied by means of acute tests with Vibrio fischeri, Raphidocelis subcapitata, and Daphnia magna performed on aqueous elutriates from test soils. The bioremediation procedure led to a significant reduction in the concentration of hydrocarbons (from 34264 to 3074 mg kg(-1), i.e., 91 % decrease) and toxicity although bioassays were not able to report a percentage decrease of toxicity as high as the percentage reduction. Sublethal tests proved the most sensitive terrestrial bioassays and avoidance tests with earthworms and springtails showed potential as monitoring tools of hydrocarbon remediation due to their high sensitivity and short duration. The concentrations of hydrocarbons in water extracts from test soils were 130 and 100 μg L(-1) before and after remediation, respectively. Similarly to terrestrial tests, most aquatic bioassays detected a significant reduction in toxicity, which was almost negligible at the end of the treatment. D. magna survival was the most affected by soil elutriates although toxicity to the crustacean was associated to the salinity of the samples rather than to the concentration of hydrocarbons. Ecotoxicity tests with aqueous soil elutriates proved less relevant in the assessment of hydrocarbon-contaminated soils due to the low hydrosolubility of hydrocarbons and the influence of the physicochemical parameters of the aquatic medium.

  17. Candidates for the development of consortia capable of petroleum hydrocarbon degradation in marine environment

    Digital Repository Service at National Institute of Oceanography (India)

    David, J.; Gupta, R.; Mohandass, C.; Nair, S.; LokaBharathi, P.A.; Chandramohan, D.

    Bacteria and yeasts from different niches of the tropical Indian waters were screened for their hydrocarbon degrading potential using 1% w/v in artificial seawater over a period of 6 days. About 20% of the 75 bacterial and 24% of the 27 yeast...

  18. Repeated batch cultivation of the hydrocarbon-degrading, micro-algal strain Prototheca zopfii RND16 immobilized in polyurethane foam.

    Science.gov (United States)

    Ueno, Ryohei; Wada, Shun; Urano, Naoto

    2008-01-01

    This study reports on the stability of the cells of a heterotrophic green micro-algal strain Prototheca zopfii RND16 immobilized in polyurethane foam (PUF) cubes during degradation of mixed hydrocarbon substrate, which was composed of n-alkanes and polycyclic aromatic hydrocarbons (PAHs), in 5 successive cycles of repeated batch cultivation at 30 degrees C. Both RND16 cells and mixed hydrocarbon substrate components had been entrapped in PUF cubes through cultivation. PUF-immobilized RND16 degraded n-alkanes almost completely, whereas the strain hardly degraded PAHs in PUFs, rather they accumulated in the matrices. It is noteworthy that this result is strikingly different from that of the free-living cell culture, where RND16 reduced concentrations of both n-alkanes and PAHs. However, PAHs accumulation in the PUFs did not impair the performance of the immobilized alga to utilize n-alkanes. These results suggest that the PUFs harboring RND16 cells could be used repeatedly for selective retrieval of PAHs from oil-polluted waters after preferential biodegradation of n-alkanes by algae.

  19. Mature Biofilm Degradation by Potential Probiotics: Aggregatibacter actinomycetemcomitans versus Lactobacillus spp.

    Directory of Open Access Journals (Sweden)

    Norzawani Jaffar

    Full Text Available The biofilm degradation of Aggregatibacter actinomycetemcomitans is essential as a complete periodontal disease therapy, and here we show the effects of potential probiotic bacteria such as Lactobacillus spp. for the biofilm of several serotypes of A. actinomycetemcomitans strains. Eight of the 13 species showed the competent biofilm degradation of ≥ 90% reduction in biofilm values in A. actinomycetemcomitans Y4 (serotype b as well as four of the seven species for the biofilm of A. actinomycetemcomitans OMZ 534 (serotype e. In contrast, the probiotic bacteria did not have a big impact for the degradation of A. actinomycetemcomitans SUNY 75 (serotype a biofilm. The dispersed A. actinomycetemcomitans Y4 cells through the biofilm detachment were still viable and plausible factors for the biofilm degradation were not due to the lactic acid and low pH conditions. The three enzymes, protease, lipase, and amylase may be responsible for the biofilm degradation; in particular, lipase was the most effective enzyme for the biofilm degradation of A. actinomycetemcomitans Y4 along with the protease activity which should be also important for the other serotypes. Remarkable lipase enzyme activities were detected from some of the potential probiotics and a supporting result using a lipase inhibitor presented corroborating evidence that lipase activity is one of the contributing factors for biofilm degradation outside of the protease which is also another possible factor for the biofilm of the other serotype of A. actinomycetemcomitans strains. On the other hand, the biofilm of A. actinomycetemcomitans SUNY 75 (serotype a was not powerfully degraded by the lipase enzyme because the lipase inhibitor was slightly functional for only two of potential probiotics.

  20. Bioremediation Potential of Native Hydrocarbons Degrading Bacteria in Crude Oil Polluted Soil

    Directory of Open Access Journals (Sweden)

    Mariana MARINESCU

    2017-05-01

    Full Text Available Bioremediation of crude oil contaminated soil is an effective process to clean petroleum pollutants from the environment. Crude oil bioremediation of soils is limited by the bacteria activity in degrading the spills hydrocarbons. Native crude oil degrading bacteria were isolated from different crude oil polluted soils. The isolated bacteria belong to the genera Pseudomonas, Mycobacterium, Arthrobacter and Bacillus. A natural biodegradable product and bacterial inoculum were used for total petroleum hydrocarbon (TPH removal from an artificial polluted soil. For soil polluted with 5% crude oil, the bacterial top, including those placed in the soil by inoculation was 30 days after impact, respectively 7 days after inoculum application, while in soil polluted with 10% crude oil,  multiplication top of bacteria was observed in the determination made at 45 days after impact and 21 days after inoculum application, showing once again how necessary is for microorganisms habituation and adaptation to environment being a function of pollutant concentration. The microorganisms inoculated showed a slight adaptability in soil polluted with 5% crude oil, but complete inhibition in the first 30 days of experiment at 10% crude oil.

  1. Hydrous pyrolysis/oxidation process for in situ destruction of chlorinated hydrocarbon and fuel hydrocarbon contaminants in water and soil

    Science.gov (United States)

    Knauss, Kevin G.; Copenhaver, Sally C.; Aines, Roger D.

    2000-01-01

    In situ hydrous pyrolysis/oxidation process is useful for in situ degradation of hydrocarbon water and soil contaminants. Fuel hydrocarbons, chlorinated hydrocarbons, polycyclic aromatic hydrocarbons, petroleum distillates and other organic contaminants present in the soil and water are degraded by the process involving hydrous pyrolysis/oxidation into non-toxic products of the degradation. The process uses heat which is distributed through soils and water, optionally combined with oxygen and/or hydrocarbon degradation catalysts, and is particularly useful for remediation of solvent, fuel or other industrially contaminated sites.

  2. Evolution of Hydrocarbon-Degrading Microbial Communities in the Aftermath of the Deepwater Horizon Oil Well Blowout in the Gulf of Mexico

    Science.gov (United States)

    Andersen, G.; Dubinsky, E. A.; Chakraborty, R.; Hollibaugh, J. T.; Hazen, T. C.

    2012-12-01

    The Deepwater Horizon oil spill created large plumes of dispersed oil and gas that remained deep in the water column and stimulated growth of several deep-sea bacteria that can degrade hydrocarbons at cold temperatures. We tracked microbial community composition before, during and after the 83-day spill to determine relationships between microbial dynamics, and hydrocarbon and dissolved-oxygen concentrations. Dominant bacteria in plumes shifted drastically over time and were dependent on the concentration of hydrocarbons, and the relative quantities of insoluble and soluble oil fractions. Unmitigated flow from the wellhead early in the spill resulted in the highest concentrations of oil and relatively more n-alkanes suspended in the plume as small oil droplets. These conditions resulted in near complete dominance by alkane-degrading Oceanospirillales, Pseudomonas and Shewanella. Six-weeks into the spill overall hydrocarbon concentrations in the plume decreased and were almost entirely composed of BTEX after management actions reduced emissions into the water column. These conditions corresponded with the emergence of Colwellia, Pseudoalteromonas, Cycloclasticus and Halomonas that are capable of degrading aromatic compounds. After the well was contained dominant plume bacteria disappeared within two weeks after the spill and transitioned to an entirely different set of bacteria dominated by Flavobacteria, Methylophaga, Alteromonas and Rhodobacteraceae that were found in anomalous oxygen depressions throughout August and are prominent degraders of both high molecular weight organic matter as well as hydrocarbons. Bio-Sep beads amended with volatile hydrocarbons from MC-252 oil were used from August through September to create hydrocarbon-amended traps for attracting oil-degrading microbes in situ. Traps were placed at multiple depths on a drilling rig about 600-m from the original MC-252 oil spill site. Microbes were isolated on media using MC-252 oil as the sole

  3. Study and isolation of aerobic hydrocarbon-degrading bacteria from Cuban shorelines

    OpenAIRE

    Barrios-San Martín, Yaima; Acosta, Silvia; Sánchez, Ayixon; Toledo, Antonio; González, Francisca; García, Regla M

    2012-01-01

    The isolation of aerobic marine bacteria able to degrade hydrocarbons represents a promising alternative for the decontamination of oceanic and coastal environments. In the present work, twelve water and sediment samples from the Felton coastline in the Province of Holguín were collected and screened with Bushnell-Haas medium supplemented with light crude oil or with seawater supplemented with yeast extract and crude oil as a carbon source, obtaining twenty seven and six bacterial isolates re...

  4. Contrasting the Community Structure of Arbuscular Mycorrhizal Fungi from Hydrocarbon-Contaminated and Uncontaminated Soils following Willow (Salix spp. L.) Planting

    OpenAIRE

    Hassan, Saad El-Din; Bell, Terrence H.; Stefani, Franck O. P.; Denis, David; Hijri, Mohamed; St-Arnaud, Marc

    2014-01-01

    Phytoremediation is a potentially inexpensive alternative to chemical treatment of hydrocarbon-contaminated soils, but its success depends heavily on identifying factors that govern the success of root-associated microorganisms involved in hydrocarbon degradation and plant growth stimulation. Arbuscular mycorrhizal fungi (AMF) form symbioses with many terrestrial plants, and are known to stimulate plant growth, although both species identity and the environment influence this relationship. Al...

  5. Kinetics of Chlorinated Hydrocarbon Degradation by Methylosinus trichosporium OB3b and Toxicity of Trichloroethylene

    NARCIS (Netherlands)

    Oldenhuis, Roelof; Oedzes, Johannes Y.; Waarde, Jacob J. van der; Janssen, Dick B.

    The kinetics of the degradation of trichloroethylene (TCE) and seven other chlorinated aliphatic hydrocarbons by Methylosinus trichosporium OB3b were studied. All experiments were performed with cells grown under copper stress and thus expressing soluble methane monooxygenase. Compounds that were

  6. Degradation and utilization of polycyclic aromatic hydrocarbons by indigenous soil bacteria

    International Nuclear Information System (INIS)

    Stetzenbach, L.D.A.

    1986-01-01

    The persistence of industrially derived polycyclic aromatic hydrocarbons in the subsurface may be significantly affected by the metabolism of soil bacteria. This study was conducted to determine the ability of indigenous soil bacteria to decrease the concentration of four polycyclic aromatic hydrocarbons (naphthalene, fluorene, anthracene, and pyrene) and to utilize the compounds as a substrate for growth. Soil cores from petroleum contaminated and noncontaminated sites contained 10 5 -10 7 viable microorganisms per gram dryweight of soil. Gram negative rod-shaped bacteria predominated. Decreases in the concentration of the four polycyclic aromatic hydrocarbons were observed during incubation with bacterial isolates in aqueous suspension by the use of high performance liquid chromatography. Corresponding increases in bacterial numbers indicated utilization of the compounds as a carbon source. Soil samples from the contaminated sites contained greater numbers of bacteria utilizing anthracene and pyrene than soil samples from uncontaminated sites. Degradation rates of the four polycyclic aromatic hydrocarbons were related to the compound, its concentration, and the bacterium. Biodegradation of pyrene was positively correlated with the presence of oxygen. Pyrene was biodegraded by an Acinetobacter sp. under aerobic conditions but not under anaerobic or microaerophilic conditions. Studies with radiolabeled 14 C-anthracene demonstrated utilization of the labeled carbon as a source of carbon by viable bacterial cells in aqueous suspension. Incorporation of 14 C into cellular biomass however was not observed during incubation of 14 C-anthracene in soil

  7. Identification and biosynthesis of a novel xanthomonadin-dialkylresorcinol-hybrid from Azoarcus sp. BH72.

    Directory of Open Access Journals (Sweden)

    Tim A Schöner

    Full Text Available A novel xanthomonadin-dialkylresorcinol hybrid named arcuflavin was identified in Azoarcus sp. BH72 by a combination of feeding experiments, HPLC-MS and MALDI-MS and gene clusters encoding the biosynthesis of this non-isoprenoid aryl-polyene containing pigment are reported. A chorismate-utilizing enzyme from the XanB2-type producing 3- and 4-hydroxybenzoic acid and an AMP-ligase encoded by these gene clusters were characterized, that might perform the first two steps of the polyene biosynthesis. Furthermore, a detailed analysis of the already known or novel biosynthesis gene clusters involved in the biosynthesis of polyene containing pigments like arcuflavin, flexirubin and xanthomonadin revealed the presence of similar gene clusters in a wide range of bacterial taxa, suggesting that polyene and polyene-dialkylresorcinol pigments are more widespread than previously realized.

  8. Degradation of Polycyclic Aromatic Hydrocarbon Pyrene by Biosurfactant-Producing Bacteria Gordonia cholesterolivorans AMP 10

    Directory of Open Access Journals (Sweden)

    Tri Handayani Kurniati

    2016-12-01

    Full Text Available Pyrene degradation and biosurfactant activity by a new strain identified as Gordonia cholesterolivorans AMP 10 were studied. The strain grew well and produced effective biosurfactants in the presence of glucose, sucrose, and crude oil. The biosurfactants production was detected by the decreased surface tension of the medium and emulsification activity.  Analysis of microbial growth parameters showed that AMP10 grew best at 50 µg mL-1 pyrene concentration, leading to 96 % degradation of pyrene within 7 days. The result of nested PCR analysis revealed that this isolate possessed the nahAc gene which encodes dioxygenase enzyme for initial degradation of Polycyclic Aromatic Hydrocarbon (PAH. Observation of both tensio-active and emulsifying activities indicated that biosurfactants which produced by AMP 10 when grown on glucose could lower the surface tension of medium from 71.3 mN/m to 24.7 mN/m and formed a stable emulsion in used lubricant oil with an emulsification index (E24 of 74%. According to the results, it is suggested that the bacterial isolates G. cholesterolivorans AMP10 are suitable candidates for bioremediation of PAH-contaminated environments.How to CiteKurniati, T. H.,  Rusmana, I. Suryani, A. & Mubarik, N. R. (2016. Degradation of Polycyclic Aromatic Hydrocarbon Pyrene by Biosurfactant-Producing Bacteria Gordonia cholesterolivorans AMP 10. Biosaintifika: Journal of Biology & Biology Education, 8(3, 336-343. 

  9. The polycyclic aromatic hydrocarbon degradation potential of Gulf of Mexico coastal microbial communities after the Deepwater Horizon oil spill

    Directory of Open Access Journals (Sweden)

    Anthony D. Kappell

    2014-05-01

    Full Text Available The Deepwater Horizon (DWH blowout resulted in oil transport, including polycyclic aromatic hydrocarbons (PAHs to the Gulf of Mexico shoreline. The microbial communities of these shorelines are thought to be responsible for the intrinsic degradation of PAHs. To investigate the Gulf Coast beach microbial community response to hydrocarbon exposure, we examined the functional gene diversity, bacterial community composition, and PAH degradation capacity of a heavily oiled and non-oiled beach following the oil exposure. With a non-expression functional gene microarray targeting 539 gene families, we detected 28,748 coding sequences. Of these sequences, 10% were uniquely associated with the severely oil-contaminated beach and 6.0% with the non-oiled beach. There was little variation in the functional genes detected between the two beaches; however the relative abundance of functional genes involved in oil degradation pathways, including PAHs, were greater in the oiled beach. The microbial PAH degradation potentials of both beaches, were tested in mesocosms. Mesocosms were constructed in glass columns using sands with native microbial communities, circulated with artificial sea water and challenged with a mixture of PAHs. The low-molecular weight PAHs, fluorene and naphthalene, showed rapid depletion in all mesocosms while the high-molecular weight benzo[α]pyrene was not degraded by either microbial community. Both the heavily oiled and the non-impacted coastal communities showed little variation in their biodegradation ability for low molecular weight PAHs. Massively-parallel sequencing of 16S rRNA genes from mesocosm DNA showed that known PAH degraders and genera frequently associated with oil hydrocarbon degradation represented a major portion of the bacterial community. The observed similar response by microbial communities from beaches with a different recent history of oil exposure suggests that Gulf Coast beach communities are primed for PAH

  10. Microbial diversity and anaerobic hydrocarbon degradation potential in an oil-contaminated mangrove sediment.

    Science.gov (United States)

    Andrade, Luiza L; Leite, Deborah C A; Ferreira, Edir M; Ferreira, Lívia Q; Paula, Geraldo R; Maguire, Michael J; Hubert, Casey R J; Peixoto, Raquel S; Domingues, Regina M C P; Rosado, Alexandre S

    2012-08-30

    Mangrove forests are coastal wetlands that provide vital ecosystem services and serve as barriers against natural disasters like tsunamis, hurricanes and tropical storms. Mangroves harbour a large diversity of organisms, including microorganisms with important roles in nutrient cycling and availability. Due to tidal influence, mangroves are sites where crude oil from spills farther away can accumulate. The relationship between mangrove bacterial diversity and oil degradation in mangrove sediments remains poorly understood. Mangrove sediment was sampled from 0-5, 15-20 and 35-40 cm depth intervals from the Suruí River mangrove (Rio de Janeiro, Brazil), which has a history of oil contamination. DGGE fingerprinting for bamA, dsr and 16S rRNA encoding fragment genes, and qPCR analysis using dsr and 16S rRNA gene fragment revealed differences with sediment depth. Analysis of bacterial 16S rRNA gene diversity revealed changes with depth. DGGE for bamA and dsr genes shows that the anaerobic hydrocarbon-degrading community profile also changed between 5 and 15 cm depth, and is similar in the two deeper sediments, indicating that below 15 cm the anaerobic hydrocarbon-degrading community appears to be well established and homogeneous in this mangrove sediment. qPCR analysis revealed differences with sediment depth, with general bacterial abundance in the top layer (0-5 cm) being greater than in both deeper sediment layers (15-20 and 35-40 cm), which were similar to each other.

  11. Degradative capacities and bioaugmentation potential of an anaerobic benzene-degrading bacterium strain DN11

    Energy Technology Data Exchange (ETDEWEB)

    Yuki Kasai; Yumiko Kodama; Yoh Takahata; Toshihiro Hoaki; Kazuya Watanabe [Marine Biotechnology Institute, Kamaishi (Japan)

    2007-09-15

    Azoarcus sp. strain DN11 is a denitrifying bacterium capable of benzene degradation under anaerobic conditions. The present study evaluated strain DN11 for its application to bioaugmentation of benzene-contaminated underground aquifers. Strain DN11 could grow on benzene, toluene, m-xylene, and benzoate as the sole carbon and energy sources under nitrate-reducing conditions, although o- and p-xylenes were transformed in the presence of toluene. Phenol was not utilized under anaerobic conditions. Kinetic analysis of anaerobic benzene degradation estimated its apparent affinity and inhibition constants to be 0.82 and 11 {mu}M, respectively. Benzene-contaminated groundwater taken from a former coal-distillation plant site in Aichi, Japan was anaerobically incubated in laboratory bottles and supplemented with either inorganic nutrients (nitrogen, phosphorus, and nitrate) alone, or the nutrients plus strain DN11, showing that benzene was significantly degraded only when DN11 was introduced. Denaturing gradient gel electrophoresis of PCR-amplified 16S rRNA gene fragments, and quantitative PCR revealed that DN11 decreased after benzene was degraded. Following the decrease in DN11 16S rRNA gene fragments corresponding to bacteria related to Owenweeksia hongkongensis and Pelotomaculum isophthalicum, appeared as strong bands, suggesting possible metabolic interactions in anaerobic benzene degradation. Results suggest that DN11 is potentially useful for degrading benzene that contaminates underground aquifers at relatively low concentrations. 50 refs., 6 figs., 1 tab.

  12. Hydrocarbon degraders establish at the costs of microbial richness, abundance and keystone taxa after crude oil contamination in permafrost environments

    Science.gov (United States)

    Yang, Sizhong; Wen, Xi; Shi, Yulan; Liebner, Susanne; Jin, Huijun; Perfumo, Amedea

    2016-01-01

    Oil spills from pipeline ruptures are a major source of terrestrial petroleum pollution in cold regions. However, our knowledge of the bacterial response to crude oil contamination in cold regions remains to be further expanded, especially in terms of community shifts and potential development of hydrocarbon degraders. In this study we investigated changes of microbial diversity, population size and keystone taxa in permafrost soils at four different sites along the China-Russia crude oil pipeline prior to and after perturbation with crude oil. We found that crude oil caused a decrease of cell numbers together with a reduction of the species richness and shifts in the dominant phylotypes, while bacterial community diversity was highly site-specific after exposure to crude oil, reflecting different environmental conditions. Keystone taxa that strongly co-occurred were found to form networks based on trophic interactions, that is co-metabolism regarding degradation of hydrocarbons (in contaminated samples) or syntrophic carbon cycling (in uncontaminated samples). With this study we demonstrate that after severe crude oil contamination a rapid establishment of endemic hydrocarbon degrading communities takes place under favorable temperature conditions. Therefore, both endemism and trophic correlations of bacterial degraders need to be considered in order to develop effective cleanup strategies. PMID:27886221

  13. Mangrove microniches determine the structural and functional diversity of enriched petroleum hydrocarbon-degrading consortia.

    Science.gov (United States)

    Gomes, Newton C M; Flocco, Cecilia G; Costa, Rodrigo; Junca, Howard; Vilchez, Ramiro; Pieper, Dietmar H; Krögerrecklenfort, Ellen; Paranhos, Rodolfo; Mendonça-Hagler, Leda C S; Smalla, Kornelia

    2010-11-01

    In this study, the combination of culture enrichments and molecular tools was used to identify bacterial guilds, plasmids and functional genes potentially important in the process of petroleum hydrocarbon (PH) decontamination in mangrove microniches (rhizospheres and bulk sediment). In addition, we aimed to recover PH-degrading consortia (PHDC) for future use in remediation strategies. The PHDC were enriched with petroleum from rhizosphere and bulk sediment samples taken from a mangrove chronically polluted with oil hydrocarbons. Southern blot hybridization (SBH) assays of PCR amplicons from environmental DNA before enrichments resulted in weak positive signals for the functional gene types targeted, suggesting that PH-degrading genotypes and plasmids were in low abundance in the rhizosphere and bulk sediments. However, after enrichment, these genes were detected and strong microniche-dependent differences in the abundance and composition of hydrocarbonoclastic bacterial populations, plasmids (IncP-1α, IncP-1β, IncP-7 and IncP-9) and functional genes (naphthalene, extradiol and intradiol dioxygenases) were revealed by in-depth molecular analyses [PCR-denaturing gradient gel electrophoresis and hybridization (SBH and microarray)]. Our results suggest that, despite the low abundance of PH-degrading genes and plasmids in the environmental samples, the original bacterial composition of the mangrove microniches determined the structural and functional diversity of the PHDC enriched. © 2010 Federation of European Microbiological Societies. Published by Blackwell Publishing Ltd. All rights reserved.

  14. Earthworms (Eisenia fetida) demonstrate potential for use in soil bioremediation by increasing the degradation rates of heavy crude oil hydrocarbons.

    Science.gov (United States)

    Martinkosky, Luke; Barkley, Jaimie; Sabadell, Gabriel; Gough, Heidi; Davidson, Seana

    2017-02-15

    Crude oil contamination widely impacts soil as a result of release during oil and gas exploration and production activities. The success of bioremediation methods to meet remediation goals often depends on the composition of the crude oil, the soil, and microbial community. Earthworms may enhance bioremediation by mixing and aerating the soil, and exposing soil microorganisms to conditions in the earthworm gut that lead to increased activity. In this study, the common composting earthworm Eisenia fetida was tested for utility to improve remediation of oil-impacted soil. E. fetida survival in soil contaminated with two distinct crude oils was tested in an artificial (lab-mixed) sandy loam soil, and survival compared to that in the clean soil. Crude oil with a high fraction of light-weight hydrocarbons was more toxic to earthworms than the crude oil with a high proportion of heavy polyaromatic and aliphatic hydrocarbons. The heavier crude oil was added to soil to create a 30,000mg/kg crude oil impacted soil, and degradation in the presence of added earthworms and feed, feed alone, or no additions was monitored over time and compared. Earthworm feed was spread on top to test effectiveness of no mixing. TPH degradation rate for the earthworm treatments was ~90mg/day slowing by 200days to ~20mg/day, producing two phases of degradation. With feed alone, the rate was ~40mg/day, with signs of slowing after 500days. Both treatments reached the same end point concentrations, and exhibited faster degradation of aliphatic hydrocarbons C21, decreased. During these experiments, soils were moderately toxic during the first three months, then earthworms survived well, were active and reproduced with petroleum hydrocarbons present. This study demonstrated that earthworms accelerate bioremediation of crude oil in soils, including the degradation of the heaviest polyaromatic fractions. Copyright © 2016 Elsevier B.V. All rights reserved.

  15. Petroleum degradation by endophytic Streptomyces spp. isolated from plants grown in contaminated soil of southern Algeria.

    Science.gov (United States)

    Baoune, Hafida; Ould El Hadj-Khelil, Aminata; Pucci, Graciela; Sineli, Pedro; Loucif, Lotfi; Polti, Marta Alejandra

    2018-01-01

    Petroleum hydrocarbons are well known by their high toxicity and recalcitrant properties. Their increasing utilization around worldwide led to environmental contamination. Phytoremediation using plant-associated microbe is an interesting approach for petroleum degradation and actinobacteria have a great potential for that. For this purpose, our study aimed to isolate, characterize, and assess the ability of endophytic actinobacteria to degrade crude petroleum, as well as to produce plant growth promoting traits. Seventeen endophytic actinobacteria were isolated from roots of plants grown naturally in sandy contaminated soil. Among them, six isolates were selected on the basis of their tolerance to petroleum on solid minimal medium and characterized by 16S rDNA gene sequencing. All petroleum-tolerant isolates belonged to the Streptomyces genus. Determination by crude oil degradation by gas chromatorgraph-flame ionization detector revealed that five strains could use petroleum as sole carbon and energy source and the petroleum removal achieved up to 98% after 7 days of incubation. These isolates displayed an important role in the degradation of the n-alkanes (C 6 -C 30 ), aromatic and polycyclic aromatic hydrocarbons. All strains showed a wide range of plant growth promoting features such as siderophores, phosphate solubilization, 1-aminocyclopropane-1-carboxylate deaminase, nitrogen fixation and indole-3-acetic acid production as well as biosurfactant production. This is the first study highlighting the petroleum degradation ability and plant growth promoting attributes of endophytic Streptomyces. The finding suggests that the endophytic actinobacteria isolated are promising candidates for improving phytoremediation efficiency of petroleum contaminated soil. Copyright © 2017 Elsevier Inc. All rights reserved.

  16. The quantitative significance of Syntrophaceae and syntrophic partnerships in methanogenic degradation of crude oil alkanes.

    Science.gov (United States)

    Gray, N D; Sherry, A; Grant, R J; Rowan, A K; Hubert, C R J; Callbeck, C M; Aitken, C M; Jones, D M; Adams, J J; Larter, S R; Head, I M

    2011-11-01

    Libraries of 16S rRNA genes cloned from methanogenic oil degrading microcosms amended with North Sea crude oil and inoculated with estuarine sediment indicated that bacteria from the genera Smithella (Deltaproteobacteria, Syntrophaceace) and Marinobacter sp. (Gammaproteobacteria) were enriched during degradation. Growth yields and doubling times (36 days for both Smithella and Marinobacter) were determined using qPCR and quantitative data on alkanes, which were the predominant hydrocarbons degraded. The growth yield of the Smithella sp. [0.020 g(cell-C)/g(alkane-C)], assuming it utilized all alkanes removed was consistent with yields of bacteria that degrade hydrocarbons and other organic compounds in methanogenic consortia. Over 450 days of incubation predominance and exponential growth of Smithella was coincident with alkane removal and exponential accumulation of methane. This growth is consistent with Smithella's occurrence in near surface anoxic hydrocarbon degrading systems and their complete oxidation of crude oil alkanes to acetate and/or hydrogen in syntrophic partnership with methanogens in such systems. The calculated growth yield of the Marinobacter sp., assuming it grew on alkanes, was [0.0005 g(cell-C)/g(alkane-C)] suggesting that it played a minor role in alkane degradation. The dominant methanogens were hydrogenotrophs (Methanocalculus spp. from the Methanomicrobiales). Enrichment of hydrogen-oxidizing methanogens relative to acetoclastic methanogens was consistent with syntrophic acetate oxidation measured in methanogenic crude oil degrading enrichment cultures. qPCR of the Methanomicrobiales indicated growth characteristics consistent with measured rates of methane production and growth in partnership with Smithella. © 2011 Society for Applied Microbiology and Blackwell Publishing Ltd.

  17. Biodegradation of petroleum hydrocarbons in hypersaline environments

    Directory of Open Access Journals (Sweden)

    Luiz Fernando Martins

    2012-09-01

    Full Text Available Literature on hydrocarbon degradation in extreme hypersaline media presents studies that point to a negative effect of salinity increase on hydrocarbonoclastic activity, while several others report an opposite tendency. Based on information available in the literature, we present a discussion on the reasons that justify these contrary results. Despite the fact that microbial ability to metabolize hydrocarbons is found in extreme hypersaline media, indeed some factors are critical for the occurrence of hydrocarbon degradation in such environments. How these factors affect hydrocarbon degradation and their implications for the assessment of hydrocarbon biodegradation in hypersaline environments are presented in this review.

  18. Variability of Biological Degradation of Aromatic Hydrocarbons in an Aerobic Aquifer Determined by Laboratory Batch Experiments

    DEFF Research Database (Denmark)

    Nielsen, Per Henning; Christensen, Thomas Højlund

    1994-01-01

    The biological aerobic degradation of 7 aromatic hydrocarbons (benzene, toluene, o-xylene, p-dichlorobenzene, o-dichlorobenzene, naphthalene and biphenyl) was studied for 149 days in replicate laboratory batch experiments with groundwater and sediment from 8 localities representing a 15 m × 30 m...

  19. Fate and degradation of petroleum hydrocarbons in stormwater bioretention cells

    Science.gov (United States)

    LeFevre, Gregory Hallett

    This dissertation describes the investigation of the fate of hydrocarbons in stormwater bioretention areas and those mechanisms that affect hydrocarbon fate in such systems. Seventy-five samples from 58 bioretention areas were collected and analyzed to measure total petroleum hydrocarbon (TPH) residual and biodegradation functional genes. TPH residual in bioretention areas was greater than background sites but low overall (hydrocarbon biodegradation. Field soils were capable of mineralizing naphthalene, a polycyclic aromatic hydrocarbon (PAH) when incubated in the laboratory. In an additional laboratory investigation, a column study was initiated to comprehensively determine naphthalene fate in a simulated bioretention cell using a 14C-labeled tracer. Sorption to soil was the greatest sink of naphthalene in the columns, although biodegradation and vegetative uptake were also important loss mechanisms. Little leaching occurred following the first flush, and volatilization was insignificant. Significant enrichment of naphthalene degrading bacteria occurred over the course of the experiment as a result of naphthalene exposure. This was evident from enhanced naphthalene biodegradation kinetics (measured via batch tests), significant increases in naphthalene dioxygenase gene quantities, and a significant correlation observed between naphthalene residual and biodegradation functional genes. Vegetated columns outperformed the unplanted control column in terms of total naphthalene removal and biodegradation kinetics. As a result of these experiments, a final study focused on why planted systems outperform unplanted systems was conducted. Plant root exudates were harvested from hydroponic setups for three types of plants. Additionally, a solution of artificial root exudates (AREs) as prepared. Exudates were digested using soil bacteria to create metabolized exudates. Raw and metabolized exudates were characterized for dissolved organic carbon, specific UV absorbance

  20. Qualitative and quantitative analysis of light hydrocarbons produced by radiation degradation of N, N-dimethyl hydroxylamine

    International Nuclear Information System (INIS)

    Wang Jinhua; Bao Borong; Wu Minghong; Sun Xilian; Zhang Xianye; Hu Jingxin; Ye Guoan

    2004-01-01

    This paper reports the qualitative and quantitative analysis of light hydrocarbons produced by radiation degradation of N, N-dimethyl hydroxylamine. These analyses were performed on the gas chromatograph, in which porous layer open tubular column coated with aluminum oxide and flame-ionization detector are used. For the doses between 10 and 1000 kGy, the light hydrocarbons produced by radiation degradation of N,N-dimethyl hydroxylamine are methane, ethane, ethene, propane, propene and n-butane. When the concentration of N,N-dimethyl hydroxylamine is 0.2 mol/L, the volume fraction of methane is (9.996-247.5) x 10 -6 , the volume fraction of ethane, propane and n-butane is lower and that of ethene and propene is much lower. With the increase of dose the volume fraction of methane is increased but the volume fraction of ethane, ethene, propane, propene and n-butane is not obviously changed. (authors)

  1. Study on radiation degradation of hydroxylamine derivatives. Pt.2: The qualitative and quantitative analysis of light hydrocarbons produced by radiation degradation of N, N-diethyl hydroxylamine

    International Nuclear Information System (INIS)

    Wang Jinhua; Bao Borong; Wu Minghong; Sun Xilian

    2004-01-01

    The qualitative and quantitative analysis of light hydrocarbons produced by radiation degradation of N,N-diethyl hydroxylamine are reported. These analyses are performed on the gas chromatography in which a porous layer open tubular column coated with aluminum oxide and a flame-ionization detector are used. When the doses are between 10 and 1000 kGy, the main hydrocarbons produced by radiation degradation of N,N-diethyl hydroxylamine are methane, ethane, ethene, propane and n-butane. The volume fraction of methane, ethane, n-butane and propane are increased with the increase of dose. The volume fraction of ethene is also increased with the increase of dose at first, however, when the absorbed dose is higher than 500 kGy. The volume fraction of ethene is decreased with the increase of dose

  2. Isolation, identification and diesel-oil biodegradation capacities of indigenous hydrocarbon-degrading strains of Cellulosimicrobium cellulans and Acinetobacter baumannii from tarball at Terengganu beach, Malaysia.

    Science.gov (United States)

    Nkem, Bruno Martins; Halimoon, Normala; Yusoff, Fatimah Md; Johari, Wan Lufti Wan; Zakaria, Mohamad Pauzi; Medipally, Srikanth Reddy; Kannan, Narayanan

    2016-06-15

    In this study, we isolated two indigenous hydrocarbon-degrading bacteria from tarball found in Rhu Sepuluh beach, Terengganu, Malaysia. These bacteria were identified based on their physiological characteristic and 16S rRNA gene sequence analysis, and they showed 99% similarity with Cellulosimicrobium cellulans DSM 43879 and Acinetobacter baumannii ATCC 19606 respectively. Their hydrocarbon-degrading capabilities were tested using diesel-oil as sole carbon source. Results analysed using GC-MS, showed diesel-oil alkanes were degraded an average 64.4% by C. cellulans and 58.1% by A. baumannii with medium optical density reaching 0.967 (C. cellulans) and 1.515 (A. baumannii) in minimal salt media at 32°C for 10days. Individual diesel-oil alkanes were degraded between 10%-95.4% by C. cellulans and 0.2%-95.9% by A. baumannii. Both strains utilized diesel-oil for growth. The study suggests both strains are part of indigenous hydrocarbon-degrading bacteria in tarball with potential for bioremediation of oil-polluted marine environment. Copyright © 2016 Elsevier Ltd. All rights reserved.

  3. Microbial degradation of petroleum hydrocarbons in estuarine sediment of Tama River in Tokyo urban area

    International Nuclear Information System (INIS)

    Yamane, Akiko; Hosomi, Masaaki; Murakami, Akihiko; Sakakibara, Koji

    1997-01-01

    Aerobic and anaerobic biodegradation rates of petroleum hydrocarbons, i.e., hexadecane (HEX), phenanthrene (PHE), and anthracene (ANT), were determined in estuarine sediment of the Tama River in urban Tokyo, followed by estimating their respective degradation potential. While in a sediment slurry, the aerobic biodegradation rates of these petroleum hydrocarbons ranged from 40 to 70 μg.g -1 dry sediment:day -1 . The anaerobic biodegradation rate of HEX was found to be 5 -8 μg.g -1 dry sediment.day -1 , whereas that of PHE and ANT could not be detected following a 2-month incubation. Aerobic degradation of HEX was not affected by coexistence with either PHE or ANT, nor by the salinity level. The number of HEX-, PHE-, or ANT-utilizing bacteria ranged from 5 - 10% of the total number of aerobic heterotrophic bacteria. We calculated their biodegradation potentials using the biomass of naturally existing petroleum hydrocarbon utilizing bacteria present in the sampled sediment, with results for HEX, PHE, and ANT being 1.0 -3.5, 4.2 x 10 -2 , and 1.2 x 10 -2 -9.4 x 10 -1 μg.g -1 dry sediment day -1 , respectively. In the aerobic tidal sediment of the Tama River, the purification potentials of HEX, PHE, and ANT were assessed to be approximately equal to their accumulation potentials occurring at the normal water level. (Author)

  4. Thraustochytrid protists degrade hydrocarbons

    Digital Repository Service at National Institute of Oceanography (India)

    Raikar, M.T.; Raghukumar, S.; Vani, V.; David, J.J.; Chandramohan, D.

    isolation tubes with crude oil. Three isolates tested showed positive hydrophobicity of cell walls as judged by the Microbial Adhesion to Hydrocarbons (MATH) assay. Addition of Bombay High crude oil to nutrient broth slightly enhanced growth of the protists...

  5. Microbial diversity and anaerobic hydrocarbon degradation potential in an oil-contaminated mangrove sediment

    Directory of Open Access Journals (Sweden)

    Andrade Luiza L

    2012-08-01

    Full Text Available Abstract Background Mangrove forests are coastal wetlands that provide vital ecosystem services and serve as barriers against natural disasters like tsunamis, hurricanes and tropical storms. Mangroves harbour a large diversity of organisms, including microorganisms with important roles in nutrient cycling and availability. Due to tidal influence, mangroves are sites where crude oil from spills farther away can accumulate. The relationship between mangrove bacterial diversity and oil degradation in mangrove sediments remains poorly understood. Results Mangrove sediment was sampled from 0–5, 15–20 and 35–40 cm depth intervals from the Suruí River mangrove (Rio de Janeiro, Brazil, which has a history of oil contamination. DGGE fingerprinting for bamA, dsr and 16S rRNA encoding fragment genes, and qPCR analysis using dsr and 16S rRNA gene fragment revealed differences with sediment depth. Conclusions Analysis of bacterial 16S rRNA gene diversity revealed changes with depth. DGGE for bamA and dsr genes shows that the anaerobic hydrocarbon-degrading community profile also changed between 5 and 15 cm depth, and is similar in the two deeper sediments, indicating that below 15 cm the anaerobic hydrocarbon-degrading community appears to be well established and homogeneous in this mangrove sediment. qPCR analysis revealed differences with sediment depth, with general bacterial abundance in the top layer (0–5 cm being greater than in both deeper sediment layers (15–20 and 35–40 cm, which were similar to each other.

  6. Abundance and diversity of n-alkane-degrading bacteria in a forest soil co-contaminated with hydrocarbons and metals: a molecular study on alkB homologous genes.

    Science.gov (United States)

    Pérez-de-Mora, Alfredo; Engel, Marion; Schloter, Michael

    2011-11-01

    Unraveling functional genes related to biodegradation of organic compounds has profoundly improved our understanding of biological remediation processes, yet the ecology of such genes is only poorly understood. We used a culture-independent approach to assess the abundance and diversity of bacteria catalyzing the degradation of n-alkanes with a chain length between C(5) and C(16) at a forest site co-contaminated with mineral oil hydrocarbons and metals for nearly 60 years. The alkB gene coding for a rubredoxin-dependent alkane monooxygenase enzyme involved in the initial activation step of aerobic aliphatic hydrocarbon metabolism was used as biomarker. Within the area of study, four different zones were evaluated: one highly contaminated, two intermediately contaminated, and a noncontaminated zone. Contaminant concentrations, hydrocarbon profiles, and soil microbial respiration and biomass were studied. Abundance of n-alkane-degrading bacteria was quantified via real-time PCR of alkB, whereas genetic diversity was examined using molecular fingerprints (T-RFLP) and clone libraries. Along the contamination plume, hydrocarbon profiles and increased respiration rates suggested on-going natural attenuation at the site. Gene copy numbers of alkB were similar in contaminated and control areas. However, T-RFLP-based fingerprints suggested lower diversity and evenness of the n-alkane-degrading bacterial community in the highly contaminated zone compared to the other areas; both diversity and evenness were negatively correlated with metal and hydrocarbon concentrations. Phylogenetic analysis of alkB denoted a shift of the hydrocarbon-degrading bacterial community from Gram-positive bacteria in the control zone (most similar to Mycobacterium and Nocardia types) to Gram-negative genotypes in the contaminated zones (Acinetobacter and alkB sequences with little similarity to those of known bacteria). Our results underscore a qualitative rather than a quantitative response of

  7. Polycyclic aromatic hydrocarbon degradation by biosurfactant-producing Pseudomonas sp. IR1

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, M. [Unidad de Biotecnologia del Petroleo, Centro de Biotecnologia, Fundacion Inst. de Estudios Avanzados (IDEA), Caracas (Venezuela); Synthesis and Biotics Div., Indian Oil Corp., Research and Development Center, Haryana (India); Leon, V.; Materano, A.D.S.; Ilzins, O.A.; Galindo-Castro, I.; Fuenmayor, S.L. [Unidad de Biotecnologia del Petroleo, Centro de Biotecnologia, Fundacion Inst. de Estudios Avanzados (IDEA), Caracas (Venezuela)

    2006-03-15

    We characterized a newly isolated bacterium, designated as IR1, with respect to its ability to degrade polycyclic aromatic hydrocarbons (PAHs) and to produce biosurfactants. Isolated IR1 was identified as Pseudomonas putida by analysis of 16S rRNA sequences (99.6% homology). It was capable of utilizing two-, three- and four-ring PAHs but not hexadecane and octadecane as a sole carbon and energy source. PCR and DNA hybridization studies showed that enzymes involved in PAH metabolism were related to the naphthalene dioxygenase pathway. Observation of both tensio-active and emulsifying activities indicated that biosurfactants were produced by IR1 during growth on both water miscible and immiscible substrates. The biosurfactants lowered the surface tension of medium from 54.9 dN cm{sup -1} to 35.4 dN cm{sup -1} and formed a stable and compact emulsion with an emulsifying activity of 74% with diesel oil, when grown on dextrose. These findings indicate that this isolate may be useful for bioremediation of sites contaminated with aromatic hydrocarbons. (orig.)

  8. Occurrence of Hydrocarbon Degrading Genes in the Soils of the Republic of Tatarstan (Russia)

    Science.gov (United States)

    Biktasheva, L. R.; Shalyamova, R. P.; Guseva, U. A.; Galitskaya, P. Yu

    2018-01-01

    Oil pollution is one of the most serious environmental problems nowadays. The ability of soils for self-restoration is important, when choosing the strategy of pollution control. This ability depends on the pull of microbes able to decompose hydrocarbons that were present in the nonpolluted soil prior to pollution. In this study, the occurrence of alkane degrading genes in the soils of the Republic of Tatarstan being one of the oil processing regions in Russia, was investigated. It was found that alkane degrading genes belonging to group I were present in 20 of the 25 soil samples, and their abundances ranged between 0.01 and 0.07%. Alkane degrading genes belonging to group II were not detected in the samples investigated, and those belonging to group III were present in all the samples, and their abundances ranged between 0.06 and 7.25%. No correlation between the alkane degrading gene copy numbers and pH and organic carbon content in soils was revealed.

  9. Synergistic degradation of chlorinated hydrocarbons with microorganisms and zero valent iron

    Science.gov (United States)

    Schöftner, Philipp; Summer, Dorothea; Leitner, Simon; Watzinger, Andrea; Wimmer, Bernhard; Reichenauer, Thomas

    2016-04-01

    Sites contaminated with chlorinated hydrocarbons (CHC) are located mainly within build-up regions. Therefore in most cases only in-situ technologies without excavation of soil material can be used for remediation. This project examines a novel in-situ remediation method, in which the biotic degradation via bacteria is combined with abiotic degradation via zero-valent iron particles (ZVI). ZVI particles are injected into the aquifer where CHC-molecules are reductively dechlorinated. However Fe0 is also oxidized by reaction with water leading to generation of H2 without any CHC degradation. To achieve biotic degradation often strictly anaerobic strains of the bacteria Dehalococcoides are used. These bacteria can dechlorinate CHC by utilizing H2. By combining these processes the H2, produced during the anaerobic corrosion of Fe0, could be used by bacteria for further CHC degradation. Therefore the amount of used Fe0 and as a consequence also remediation costs could be reduced. Additionally the continuous supply of H2 could make the bacterial degradation more controllable. Different Fe0 particles (nano- and micro-scale) were tested for their perchloroethene (PCE) degradation rate and H2 production rate in microcosms. PCE-degradation rate by different bacterial cultures was investigated in the same microcosm system. In course of these experiments the 13C enrichment factors of the PCE degradation of the different particles and cultures were determined to enable the differentiation of biotic and abiotic degradation. Preliminary results showed, that the nano-scale particles reacted faster with PCE and water than their micro-scaled counterparts. The PCE degradation via micro-scaled particles lead to 13C enrichment factors in the range of -3,6 ‰ ± 0,6 to -9,5 ‰ ± 0,2. With one of the examined bacterial cultures a fast reduction of PCE to ethene was observed. Although PCE and TCE were completely degraded by this culture the metabolites DCE and VC could still be detected

  10. Bioremediation of crude oil polluted seawater by a hydrocarbon-degrading bacterial strain immobilized on chitin and chitosan flakes

    International Nuclear Information System (INIS)

    Gentili, A.R.; Cubitto, M.A.; Ferrero, M.; Rodriguez, M.S.

    2006-01-01

    In this laboratory-scale study, we examined the potential of chitin and chitosan flakes obtained from shrimp wastes as carrier material for a hydrocarbon-degrading bacterial strain. Flakes decontamination, immobilization conditions and the survival of the immobilized bacterial strain under different storage temperatures were evaluated. The potential of immobilized hydrocarbon-degrading bacterial strain for crude oil polluted seawater bioremediation was tested in seawater microcosms. In terms of removal percentage of crude oil after 15 days, the microcosms treated with the immobilized inoculants proved to be the most successful. The inoculants formulated with chitin and chitosan as carrier materials improved the survival and the activity of the immobilized strain. It is important to emphasize that the inoculants formulated with chitin showed the best performance during storage and seawater bioremediation. (author)

  11. High frequency of Thermodesulfovibrio spp. and Anaerolineaceae in association with Methanoculleus spp. in a long-term incubation of n-alkanes-degrading methanogenic enrichment culture

    Directory of Open Access Journals (Sweden)

    Bo Liang

    2016-09-01

    Full Text Available In the present study, the microbial community and functional gene composition of a long-term active alkane-degrading methanogenic culture was established after two successive enrichment culture transfers and incubated for a total period of 1750 days. Molecular analysis was conducted after the second transfer (incubated for 750 days for both the active alkanes-degrading methanogenic enrichment cultures (T2-AE and the background control (T2-BC. A net increase of methane as the end product was detected in the headspace of the enrichment cultures amended with long-chain n-alkanes and intermediate metabolites, including octadecanoate, hexadecanoate, isocaprylate, butyrate, isobutyrate, propionate, acetate and formate were measured in the liquid cultures. The composition of microbial community shifted through the successive transfers over time of incubation. Sequences of bacterial and archaeal 16S rRNA gene (16S rDNA and mcrA functional gene indicated that bacterial sequences affiliated to Thermodesulfovibrio spp. and Anaerolineaceae and archaeal sequences falling within the genus Methanoculleus were the most frequently encountered and thus represented the dominant members performing the anaerobic degradation of long-chain n-alkanes and methanogenesis. In addition, the presence of assA functional genes encoding the alkylsuccinate synthase α subunit indicated that fumarate addition mechanism could be considered as a possible initial activation step of n-alkanes in the present study. The succession pattern of microbial communities indicates that Thermodesulfovibrio spp. could be a generalist participating in the metabolism of intermediates, while Anaerolineaceae plays a key role in the initial activation of long-chain n-alkane biodegradation.

  12. Development of specific oligonucleotide probes for the identification and in situ detection of hydrocarbon-degrading Alcanivorax strains.

    Science.gov (United States)

    Syutsubo, K; Kishira, H; Harayama, S

    2001-06-01

    The genus Alcanivorax comprises diverse hydrocarbon-degrading marine bacteria. Novel 16S rRNA-targeted oligonucleotide DNA probes (ALV735 and ALV735-b) were developed to quantify two subgroups of the Alcanivorax/Fundibacter group by fluorescence in situ hybridization (FISH), and the conditions for the single-mismatch discrimination of the probes were optimized. The specificity of the probes was improved further using a singly mismatched oligonucleotide as a competitor. The growth of Alcanivorax cells in crude oil-contaminated sea water under the biostimulation condition was investigated by FISH with the probe ALV735, which targeted the main cluster of the Alcanivorax/Fundibacter group. The size of the Alcanivorax population increased with increasing incubation time and accounted for 91% of the 4',6-diamidino-2-phenylindole (DAPI) count after incubation for 2 weeks. The probes developed in this study are useful for detecting Alcanivorax populations in petroleum hydrocarbon-degrading microbial consortia.

  13. Isolation and Identification of Pyrene Mineralizing Mycobacterium spp. from Contaminated and Uncontaminated Sources

    International Nuclear Information System (INIS)

    Lease, C.W.M; Bentham, R.H; Gaskin, S.E; Juhasz, A.L

    2011-01-01

    Mycobacterium isolates obtained from PAH-contaminated and uncontaminated matrices were evaluated for their ability to degrade three-, four- and five-ring PAHs. PAH enrichment studies were prepared using pyrene and inocula obtained from manufacturing gas plant (MGP) soil, uncontaminated agricultural soil, and faeces from Macropus fuliginosus (Western Grey Kangaroo). Three pyrene-degrading microorganisms isolated from the corresponding enrichment cultures had broad substrate ranges, however, isolates could be differentiated based on surfactant, phenol, hydrocarbon and PAH utilisation. 16S rRNA analysis identified all three isolates as Mycobacterium sp. The Mycobacterium spp. could rapidly degrade phenanthrene and pyrene, however, no strain had the capacity to utilise fluorene or benzo[a]pyrene. When pyrene mineralisation experiments were performed, 70-79% of added 14 C was evolved as 14 CO 2 after 10 days. The present study demonstrates that PAH degrading microorganisms may be isolated from a diverse range of environmental matrices. The present study demonstrates that prior exposure to PAHs was not a prerequisite for PAH catabolic activity for two of these Mycobacterium isolates.

  14. An endoglucanase is involved in infection of rice roots by the not-cellulose-metabolizing endophyte Azoarcus sp. strain BH72.

    Science.gov (United States)

    Reinhold-Hurek, Barbara; Maes, Tamara; Gemmer, Sabrina; Van Montagu, Marc; Hurek, Thomas

    2006-02-01

    The nitrogen-fixing endophyte Azoarcus sp. strain BH72 infects roots of Kallar grass and rice inter- and intra-cellularly and can spread systemically into shoots without causing symptoms of plant disease. Although cellulose or its breakdown products do not support growth, this strain expresses an endoglucanase, which might be involved in infection. Sequence analysis of eglA places the secreted 34-kDa protein into the glycosyl hydrolases family 5, with highest relatedness (40% identity) to endoglucanases of the phytopathogenic bacteria Xanthomonas campestris and Ralstonia solanacearum. Transcriptional regulation studied by eglA:: gusA fusion was not significantly affected by cellulose or its breakdown products or by microaerobiosis. Strongest induction (threefold) was obtained in bacteria grown in close vicinity to rice roots. Visible sites of expression were the emergence points of lateral roots and root tips, which are the primary regions of ingress into the root. To study the role in endophytic colonization, eglA was inactivated by transposon mutagenesis. Systemic spreading of the eglA mutant and of a pilAB mutant into the rice shoot could no longer be detected by polymerase chain reaction. Microscopic inspection of infection revealed that the intracellular colonization of root epidermis cells was significantly reduced in the eglA- mutant BHE6 compared with the wild type and partially restored in the complementation mutant BHRE2 expressing eglA. This provides evidence that Azoarcus sp. endoglucanase is an important determinant for successful endophytic colonization of rice roots, suggesting an active bacterial colonization process.

  15. Bioremediation: Technology for treating hydrocarbon-contaminated wastewater

    Energy Technology Data Exchange (ETDEWEB)

    Towprayoon, S.; Kuntrangwattana, S. [King Mongkut`s Institute of Technology, Bangkok (Thailand)

    1996-12-31

    Cutting oil wastewater from an iron and steel factory was applied to the soil windrow. Self-remediation was then compared with remediation with acclimatized indigenous microbes. The incremental reduction rate of the microorganisms and hydrocarbon-degradable microbes was slower in self-remediation than in the latter treatment. Within 30 days, when the acclimatized indigenous microbes were used, there was a significant reduction of the contaminated hydrocarbons, while self-remediation took longer to reduce to the same concentration. Various nitrogen sources were applied to the soil pile, namely, organic compost, chemical fertilizer, ammonium sulfate, and urea. The organic compost induced a high yield of hydrocarbon-degradable microorganisms, but the rate at which the cutting oil in the soil decreased was slower than when other nitrogen sources were used. The results of cutting oil degradation studied by gas chromatography showed the absence of some important hydrocarbons. The increment of the hydrocarbon-degradable microbes in the land treatment ecosystem does not necessarily correspond to the hydrocarbon reduction efficiency. 3 refs., 3 figs.

  16. Biodegradation of petroleum hydrocarbons at low temperatures

    International Nuclear Information System (INIS)

    Whyte, L. G.; Greer, C W.

    1999-01-01

    Bioremediation of contaminated Arctic sites has been proposed as the logistically and economically most favorable solution despite the known technical difficulties. The difficulties involve the inhibition of pollutants removal by biodegradation below freezing temperatures and the relative slowness of the process to remove enough hydrocarbon pollutants during the above-freezing summer months. Despite these formidable drawbacks, biodegradation of hydrocarbon contaminants is possible even in below-zero temperatures, especially if indigenous psychrophilic and psychrotropic micro-organism are used. This paper reports results of a study involving several hydrocarbon-degrading psychrotropic bacteria and suggests bioaugmentation with specific cold-adapted organisms and/or biostimulation with commercial fertilizers for enhancing degradation of specific contaminants in soils from northern Canada. An evaluation of the biodegradation potential of hydrocarbon contaminated soils in the high Arctic suggested that the contaminated soils contained sufficient numbers of cold-adapted hydrocarbon-degrading bacteria and that the addition of fertilizer was sufficient to enhance the level of hydrocarbon degradation at low ambient summer temperatures. 9 refs., 2 tabs., 3 figs

  17. High bacterial biodiversity increases degradation performance of hydrocarbons during bioremediation of contaminated harbor marine sediments

    International Nuclear Information System (INIS)

    Dell'Anno, Antonio; Beolchini, Francesca; Rocchetti, Laura; Luna, Gian Marco; Danovaro, Roberto

    2012-01-01

    We investigated changes of bacterial abundance and biodiversity during bioremediation experiments carried out on oxic and anoxic marine harbor sediments contaminated with hydrocarbons. Oxic sediments, supplied with inorganic nutrients, were incubated in aerobic conditions at 20 °C and 35 °C for 30 days, whereas anoxic sediments, amended with organic substrates, were incubated in anaerobic conditions at the same temperatures for 60 days. Results reported here indicate that temperature exerted the main effect on bacterial abundance, diversity and assemblage composition. At higher temperature bacterial diversity and evenness increased significantly in aerobic conditions, whilst decreased in anaerobic conditions. In both aerobic and anaerobic conditions, biodegradation efficiencies of hydrocarbons were significantly and positively related with bacterial richness and evenness. Overall results presented here suggest that bioremediation strategies, which can sustain high levels of bacterial diversity rather than the selection of specific taxa, may significantly increase the efficiency of hydrocarbon degradation in contaminated marine sediments. - Highlights: ► Bioremediation performance was investigated on hydrocarbon contaminated sediments. ► Major changes in bacterial diversity and assemblage composition were observed. ► Temperature exerted the major effect on bacterial assemblages. ► High bacterial diversity increased significantly biodegradation performance. ► This should be considered for sediment remediation by bio-treatments. - Bioremediation strategies which can sustain high levels of bacterial diversity may significantly increase the biodegradation of hydrocarbons in contaminated marine sediments.

  18. Bacterial diversity in the active stage of a bioremediation system for mineral oil hydrocarbon-contaminated soils.

    Science.gov (United States)

    Popp, Nicole; Schlömann, Michael; Mau, Margit

    2006-11-01

    Soils contaminated with mineral oil hydrocarbons are often cleaned in off-site bioremediation systems. In order to find out which bacteria are active during the degradation phase in such systems, the diversity of the active microflora in a degrading soil remediation system was investigated by small-subunit (SSU) rRNA analysis. Two sequential RNA extracts from one soil sample were generated by a procedure incorporating bead beating. Both extracts were analysed separately by generating individual SSU rDNA clone libraries from cDNA of the two extracts. The sequencing results showed moderate diversity. The two clone libraries were dominated by Gammaproteobacteria, especially Pseudomonas spp. Alphaproteobacteria and Betaproteobacteria were two other large groups in the clone libraries. Actinobacteria, Firmicutes, Bacteroidetes and Epsilonproteobacteria were detected in lower numbers. The obtained sequences were predominantly related to genera for which cultivated representatives have been described, but were often clustered together in the phylogenetic tree, and the sequences that were most similar were originally obtained from soils and not from pure cultures. Most of the dominant genera in the clone libraries, e.g. Pseudomonas, Acinetobacter, Sphingomonas, Acidovorax and Thiobacillus, had already been detected in (mineral oil hydrocarbon) contaminated environmental samples. The occurrence of the genera Zymomonas and Rhodoferax was novel in mineral oil hydrocarbon-contaminated soil.

  19. EDTA addition enhances bacterial respiration activities and hydrocarbon degradation in bioaugmented and non-bioaugmented oil-contaminated desert soils.

    Science.gov (United States)

    Al Kharusi, Samiha; Abed, Raeid M M; Dobretsov, Sergey

    2016-03-01

    The low number and activity of hydrocarbon-degrading bacteria and the low solubility and availability of hydrocarbons hamper bioremediation of oil-contaminated soils in arid deserts, thus bioremediation treatments that circumvent these limitations are required. We tested the effect of Ethylenediaminetetraacetic acid (EDTA) addition, at different concentrations (i.e. 0.1, 1 and 10 mM), on bacterial respiration and biodegradation of Arabian light oil in bioaugmented (i.e. with the addition of exogenous alkane-degrading consortium) and non-bioaugmented oil-contaminated desert soils. Post-treatment shifts in the soils' bacterial community structure were monitored using MiSeq sequencing. Bacterial respiration, indicated by the amount of evolved CO2, was highest at 10 mM EDTA in bioaugmented and non-bioaugmented soils, reaching an amount of 2.2 ± 0.08 and 1.6 ± 0.02 mg-CO2 g(-1) after 14 days of incubation, respectively. GC-MS revealed that 91.5% of the C14-C30 alkanes were degraded after 42 days when 10 mM EDTA and the bacterial consortium were added together. MiSeq sequencing showed that 78-91% of retrieved sequences in the original soil belonged to Deinococci, Alphaproteobacteria, Gammaproteobacteia and Bacilli. The same bacterial classes were detected in the 10 mM EDTA-treated soils, however with slight differences in their relative abundances. In the bioaugmented soils, only Alcanivorax sp. MH3 and Parvibaculum sp. MH21 from the exogenous bacterial consortium could survive until the end of the experiment. We conclude that the addition of EDTA at appropriate concentrations could facilitate biodegradation processes by increasing hydrocarbon availability to microbes. The addition of exogenous oil-degrading bacteria along with EDTA could serve as an ideal solution for the decontamination of oil-contaminated desert soils. Copyright © 2016 Elsevier Ltd. All rights reserved.

  20. Thermophilic slurry-phase treatment of petroleum hydrocarbon waste sludges

    International Nuclear Information System (INIS)

    Castaldi, F.J.; Bombaugh, K.J.; McFarland, B.

    1995-01-01

    Chemoheterotrophic thermophilic bacteria were used to achieve enhanced hydrocarbon degradation during slurry-phase treatment of oily waste sludges from petroleum refinery operations. Aerobic and anaerobic bacterial cultures were examined under thermophilic conditions to assess the effects of mode of metabolism on the potential for petroleum hydrocarbon degradation. The study determined that both aerobic and anaerobic thermophilic bacteria are capable of growth on petroleum hydrocarbons. Thermophilic methanogenesis is feasible during the degradation of hydrocarbons when a strict anaerobic condition is achieved in a slurry bioreactor. Aerobic thermophilic bacteria achieved the largest apparent reduction in chemical oxygen demand, freon extractable oil, total and volatile solid,s and polycyclic aromatic hydrocarbons (PAHs) when treating oily waste sludges. The observed shift with time in the molecular weight distribution of hydrocarbon material was more pronounced under aerobic metabolic conditions than under strict anaerobic conditions. The changes in the hydrocarbon molecular weight distribution, infrared spectra, and PAH concentrations during slurry-phase treatment indicate that the aerobic thermophilic bioslurry achieved a higher degree of hydrocarbon degradation than the anaerobic thermophilic bioslurry during the same time period

  1. Hydrocarbon degradation and plant colonization of selected bacterial strains isolated from the rhizsophere and plant interior of Italian ryegrass and Birdsfoot trefoil

    Science.gov (United States)

    Sohail, Y.; Andria, V.; Reichenauer, T. G.; Sessitsch, A.

    2009-04-01

    Hydrocarbon-degrading strains were isolated from the rhizosphere, root and shoot interior of Italian ryegrass (Lolium multiflorum var. Taurus), Birdsfoot trefoil (Lotus corniculatus var. Leo) grown in a soil contaminated with petroleum oil. Strains were tested regarding their phylogeny and their degradation efficiency. The most efficient strains were tested regarding their suitability to be applied for phytoremediation of diesel oils. Sterilized and non-sterilized agricultural soil, with and with out compost, were spiked with diesel and used for planting Italian ryegrass and birdsfoot trefoil. Four selected strains with high degradation activities, derived from the rhizosphere and plant interior, were selected for individual inoculation. Plants were harvested at flowering stage and plant biomass and hydrocarbon degradation was determined. Furthermore, it was investigated to which extent the inoculant strains were able to survive and colonize plants. Microbial community structures were analysed by 16S rRNA and alkB gene analysis. Results showed efficient colonization by the inoculant strains and improved degradation by the application of compost combined with inoculation as well as on microbial community structures will be presented.

  2. Hydrocarbon degradation potential and plant growth-promoting activity of culturable endophytic bacteria of Lotus corniculatus and Oenothera biennis from a long-term polluted site.

    Science.gov (United States)

    Pawlik, Małgorzata; Cania, Barbara; Thijs, Sofie; Vangronsveld, Jaco; Piotrowska-Seget, Zofia

    2017-08-01

    Many endophytic bacteria exert beneficial effects on their host, but still little is known about the bacteria associated with plants growing in areas heavily polluted by hydrocarbons. The aim of the study was characterization of culturable hydrocarbon-degrading endophytic bacteria associated with Lotus corniculatus L. and Oenothera biennis L. collected in long-term petroleum hydrocarbon-polluted site using culture-dependent and molecular approaches. A total of 26 hydrocarbon-degrading endophytes from these plants were isolated. Phylogenetic analyses classified the isolates into the phyla Proteobacteria and Actinobacteria. The majority of strains belonged to the genera Rhizobium, Pseudomonas, Stenotrophomonas, and Rhodococcus. More than 90% of the isolates could grow on medium with diesel oil, approximately 20% could use n-hexadecane as a sole carbon and energy source. PCR analysis revealed that 40% of the isolates possessed the P450 gene encoding for cytochrome P450-type alkane hydroxylase (CYP153). In in vitro tests, all endophytic strains demonstrated a wide range of plant growth-promoting traits such as production of indole-3-acetic acid, hydrogen cyanide, siderophores, and phosphate solubilization. More than 40% of the bacteria carried the gene encoding for the 1-aminocyclopropane-1-carboxylic acid deaminase (acdS). Our study shows that the diversity of endophytic bacterial communities in tested plants was different. The results revealed also that the investigated plants were colonized by endophytic bacteria possessing plant growth-promoting features and a clear potential to degrade hydrocarbons. The properties of isolated endophytes indicate that they have the high potential to improve phytoremediation of petroleum hydrocarbon-polluted soils.

  3. DNA-based and culture-based characterization of a hydrocarbon-degrading consortium enriched from Arctic soil

    Energy Technology Data Exchange (ETDEWEB)

    Thomassin-Lacroix, E. J. M.; Reimer, K. J. [Royal Military College, Dept. of Chemistry and Chemical Engineering, Kingston, On (Canada); Yu, Z.; Mohn, W. W. [British Columbia Univ., Dept. of Microbiology and Immunology, Vancouver, BC (Canada); Eriksson, M. [Royal Inst. of Technology, Dept. of Biotechnology, Stockholm (Sweden)

    2001-12-01

    Oil spills are fairly common in polar tundra regions, including remote locations, and are a threat to the relatively fragile ecosystem. Remediation must be done economically and with minimum additional damage. Bioremediation is considered to be the appropriate technology, although its application in polar tundra regions is not well documented. Most studies of hydrocarbon remediation in polar regions have concerned marine oil spills, while a few studies have demonstrated on-site polar tundra soil remediation. A few of these demonstrated the presence of psychrotolerant hydrocarbon-degrading bacteria in polar tundra soils. Because fuels are complex mixtures of hydrocarbons, microbial consortia rather than pure cultures may be the most effective agents in degrading fuels. Despite their potential advantages for bioaugmentation applications, consortia are difficult to characterize and monitor. Molecular methods based on DNA analysis partially address these difficulties. One such approach is to randomly clone rRNA gene (rDNA) fragments and to sequence as a set of clones. The relative abundance of individual sequences in the clone library is related to the relative abundance of the corresponding organism in the community. In this study a psychrotolerant, fuel-degrading consortium was enriched with Arctic tundra soil. The enrichment substrate for the consortium was Jet A-1 fuel, which is very similar to Arctic diesel fuel, a common contaminant in the region. The objectives of the study were to (1) characterize thr consortium by DNA- and culture-based methods, (2) develop quantitative polymerase chain reaction assays for populations of predominant consortium members, and (3) determine the dynamics of those populations during incubation of the consortium. Result showed that is possible to quantitatively monitor members of a microbial consortium, with potential application for bioremediation of Arctic tundra soil. The relative abundance of consortium members was found to vary

  4. Hydrocarbon phytoremediation in the family Fabaceae--a review.

    Science.gov (United States)

    Hall, Jessica; Soole, Kathleen; Bentham, Richard

    2011-04-01

    Currently, studies often focus on the use of Poaceae species (grasses) for phytoremediation of hydrocarbon-contaminated soils. Research into the use of Fabaceae species (legumes) to remediate hydrocarbons in soils has been conducted, but these plants are commonly overlooked due to slower recorded rates of degradation compared with many grass species. Evidence in the literature suggests that in some cases Fabaceae species may increase total degradation of hydrocarbons and stimulate degradative capacity of the soil microbial community, particularly for contaminants which are normally more recalcitrant to degradation. As many recalcitrant hydrocarbons have negative impacts on human and ecosystem health, development of remediation options is crucial. Reconsideration of Fabaceae species for removal of such contaminants may lead to environmentally and economically sustainable technologies for remediation of contaminated sites.

  5. Direct immunofluorescence and enzyme-linked immunosorbent assays for evaluating chlorinated hydrocarbon degrading bacteria

    Energy Technology Data Exchange (ETDEWEB)

    Brigmon, R.L.; Franck, M.M.; Brey, J.; Fliermans, C.B. [Westinghouse Savannah River, Aiken, SC (United States). Environmental Biotechnology Section; Scott, D.; Lanclos, K. [Medical Coll. of Georgia, Augusta, GA (United States)

    1997-06-01

    Immunological procedures were developed to enumerate chlorinated hydrocarbon degrading bacteria. Polyclonal antibodies (Pabs) were produced by immunizing New Zealand white rabbits against 18 contaminant-degrading bacteria. These included methanotrophic and chlorobenzene (CB) degrading species. An enzyme-linked immunosorbent assay (ELISA) was used to test for specificity and sensitivity of the Pabs. Direct fluorescent antibodies (DFAs) were developed with these Pabs against select methanotrophic bacteria isolated from a trichloroethylene (TCE) contaminated landfill at the Savannah River Site (SRS) and cultures from the American Type Culture Collection (ATCC). Analysis of cross reactivity testing data showed some of the Pabs to be group specific while others were species specific. The threshold of sensitivity for the ELISA is 105 bacteria cells/ml. The DFA can detect as few as one bacterium per ml after concentration. Results from the DFA and ELISA techniques for enumeration of methanotrophic bacteria in groundwater were higher but not significantly different (P < 0.05) compared to indirect microbiological techniques such as MPN. These methods provide useful information on in situ community structure and function for bioremediation applications within 1--4 hours of sampling.

  6. Biodegradation of petroleum hydrocarbons in seawater at low temperatures (0-5 degrees C) and bacterial communities associated with degradation.

    Science.gov (United States)

    Brakstad, Odd G; Bonaunet, Kristin

    2006-02-01

    In this study biodegradation of hydrocarbons in thin oil films was investigated in seawater at low temperatures, 0 and 5 degrees C. Heterotrophic (HM) or oil-degrading (ODM) microorganisms enriched at the two temperatures showed 16S rRNA sequence similarities to several bacteria of Arctic or Antarctic origin. Biodegradation experiments were conducted with a crude mineral oil immobilized as thin films on hydrophobic Fluortex adsorbents in nutrient-enriched or sterile seawater. Chemical and respirometric analysis of hydrocarbon depletion showed that naphthalene and other small aromatic hydrocarbons (HCs) were primarily biodegraded after dissolution to the water phase, while biodegradation of larger polyaromatic hydrocarbons (PAH) and C(10)-C(36) n-alkanes, including n-hexadecane, was associated primarily with the oil films. Biodegradation of PAH and n-alkanes was significant at both 0 and 5 degrees C, but was decreased for several compounds at the lower temperature. n-Hexadecane biodegradation at the two temperatures was comparable at the end of the experiments, but was delayed at 0 degree C. Investigations of bacterial communities in seawater and on adsorbents by PCR amplification of 16S rRNA gene fragments and DGGE analysis indicated that predominant bacteria in the seawater gradually adhered to the oil-coated adsorbents during biodegradation at both temperatures. Sequence analysis of most DGGE bands aligned to members of the phyla Proteobacteria (Gammaproteobacteria) or Bacteroidetes. Most sequences from experiments at 0 degree C revealed affiliations to members of Arctic or Antarctic consortia, while no such homology was detected for sequences from degradation experiment run at 5 degrees C. In conclusion, marine microbial communities from cold seawater have potentials for oil film HC degradation at temperatures < or =5 degrees C, and psychrotrophic or psychrophilic bacteria may play an important role during oil HC biodegradation in seawater close to freezing

  7. Biodegradation of hydrocarbon mixtures in surface waters at environmentally relevant levels - Effect of inoculum origin on kinetics and sequence of degradation.

    Science.gov (United States)

    Birch, Heidi; Hammershøj, Rikke; Comber, Mike; Mayer, Philipp

    2017-10-01

    Biodegradation is a dominant removal process for many organic pollutants, and biodegradation tests serve as tools for assessing their environmental fate within regulatory risk assessment. In simulation tests, the inoculum is not standardized, varying in microbial quantity and quality, thereby potentially impacting the observed biodegradation kinetics. In this study we investigated the effect of inoculum origin on the biodegradation kinetics of hydrocarbons for five inocula from surface waters varying in urbanization and thus expected pre-exposure to petroleum hydrocarbons. A new biodegradation method for testing mixtures of hydrophobic chemicals at trace concentrations was demonstrated: Aqueous solutions containing 9 hydrocarbons were generated by passive dosing and diluted with surface water resulting in test systems containing native microorganisms exposed to test substances at ng-μg/L levels. Automated Headspace Solid Phase Microextraction coupled to GC-MS was applied directly to these test systems to determine substrate depletion relative to abiotic controls. Lag phases were generally less than 8 days. First order rate constants were within one order of magnitude for each hydrocarbon in four of the five waters but lower in water from a rural lake. The sequence of degradation between the 9 hydrocarbons showed similar patterns in the five waters indicating the potential for using selected hydrocarbons for benchmarking between biodegradation tests. Degradation half-times were shorter than or within one order of magnitude of BioHCwin predictions for 8 of 9 hydrocarbons. These results showed that location choice is important for biodegradation kinetics and can provide a relevant input to aquatic exposure and fate models. Copyright © 2017 Elsevier Ltd. All rights reserved.

  8. Effect in laboratory of addition of inorganic fertilizers made in degradation of hydrocarbon on contaminated soil by oil

    International Nuclear Information System (INIS)

    Pardo Castro, Jenny Liliana; Perdomo Rojas, Maria Carolina; Benavides Lopez de Mesa, Joaquin L

    2004-01-01

    At present one of the most important environmental problems is contamination of soil ecosystem by hydrocarbon spilling mainly of oil and its derivates, which occurs when oil is explored or transported. Furthermore in Colombia it occurs due to violent assaults made by men outside of law against petroleum infrastructure. To solve this problem there are treatment methods to recover contaminated soil as Land farming technique, adding organic nutrients. In this research this technique was evaluated in vitro, through a design of six experimental units (EU) which contained contaminated soil with crude oil; three EU were treated with Triple 15 inorganic fertilizer and the other three were taken as biotic control. Land farming effectiveness was determined by pH analysis, humidity percent, temperature, count of total heterotrophic microorganisms, and probable number of I degrades microorganisms, nutrients and total hydrocarbons for a four month experimental period At the d of that period, in Land farming treatment with nutrients added was achieved a high remotion percentage TPH up to 91 %, getting final TPH concentration of 2028 ppm comparing biotic control in which the remotion percentage achieved up to 65% and a TPH final concentration was 8049 ppm thus, it could demonstrate that nutrient addition optimizes the degrading hydrocarbon process in soil

  9. Assessing the hydrocarbon degrading potential of indigenous bacteria isolated from crude oil tank bottom sludge and hydrocarbon-contaminated soil of Azzawiya oil refinery, Libya.

    Science.gov (United States)

    Mansur, Abdulatif A; Adetutu, Eric M; Kadali, Krishna K; Morrison, Paul D; Nurulita, Yuana; Ball, Andrew S

    2014-09-01

    The disposal of hazardous crude oil tank bottom sludge (COTBS) represents a significant waste management burden for South Mediterranean countries. Currently, the application of biological systems (bioremediation) for the treatment of COTBS is not widely practiced in these countries. Therefore, this study aims to develop the potential for bioremediation in this region through assessment of the abilities of indigenous hydrocarbonoclastic microorganisms from Libyan Hamada COTBS for the biotreatment of Libyan COTBS-contaminated environments. Bacteria were isolated from COTBS, COTBS-contaminated soil, treated COTBS-contaminated soil, and uncontaminated soil using Bushnell Hass medium amended with Hamada crude oil (1 %) as the main carbon source. Overall, 49 bacterial phenotypes were detected, and their individual abilities to degrade Hamada crude and selected COBTS fractions (naphthalene, phenanthrene, eicosane, octadecane and hexane) were evaluated using MT2 Biolog plates. Analyses using average well colour development showed that ~90 % of bacterial isolates were capable of utilizing representative aromatic fractions compared to 51 % utilization of representative aliphatics. Interestingly, more hydrocarbonoclastic isolates were obtained from treated contaminated soils (42.9 %) than from COTBS (26.5 %) or COTBS-contaminated (30.6 %) and control (0 %) soils. Hierarchical cluster analysis (HCA) separated the isolates into two clusters with microorganisms in cluster 2 being 1.7- to 5-fold better at hydrocarbon degradation than those in cluster 1. Cluster 2 isolates belonged to the putative hydrocarbon-degrading genera; Pseudomonas, Bacillus, Arthrobacter and Brevundimonas with 57 % of these isolates being obtained from treated COTBS-contaminated soil. Overall, this study demonstrates that the potential for PAH degradation exists for the bioremediation of Hamada COTBS-contaminated environments in Libya. This represents the first report on the isolation of

  10. Effects of soil organic matter on the development of the microbial polycyclic aromatic hydrocarbons (PAHs) degradation potentials

    International Nuclear Information System (INIS)

    Yang, Y.; Zhang, N.; Xue, M.; Lu, S.T.; Tao, S.

    2011-01-01

    The microbial activity in soils was a critical factor governing the degradation of organic micro-pollutants. The present study was conducted to analyze the effects of soil organic matter on the development of degradation potentials for polycyclic aromatic hydrocarbons (PAHs). Most of the degradation kinetics for PAHs by the indigenous microorganisms developed in soils can be fitted with the Logistic growth models. The microbial activities were relatively lower in the soils with the lowest and highest organic matter content, which were likely due to the nutrition limit and PAH sequestration. The microbial activities developed in humic acid (HA) were much higher than those developed in humin, which was demonstrated to be able to sequester organic pollutants stronger. The results suggested that the nutrition support and sequestration were the two major mechanisms, that soil organic matter influenced the development of microbial PAHs degradation potentials. - Research highlights: → PAH degradation kinetics obey Logistic model. → Degradation potentials depend on soil organic carbon content. → Humin inhibits the development of PAH degradation activity. → Nutrition support and sequestration regulate microbial degradation capacity. - Soil organic matter regulated PAH degradation potentials through nutrition support and sequestration.

  11. Microbial degradation of street dust polycyclic aromatic hydrocarbons in microcosms simulating diffuse pollution of urban soil

    DEFF Research Database (Denmark)

    Johnsen, Anders R; de Lipthay, Julia R; Sørensen, Søren J

    2006-01-01

    Diffuse pollution with polycyclic aromatic hydrocarbons (PAHs) of topsoil in urban regions has caused increasing concerns in recent years. We simulated diffuse pollution of soil in microcosms by spiking sandy topsoil (A-horizon) and coarse, mineral subsoil (C-horizon) with street dust (PM63...... for the persistence and low bioaccessibility of 5- and 6-ring PAHs in diffusely polluted soil.......) isolated from municipal street sweepings from central Copenhagen. The microbial communities adapted to PAH degradation in microcosms spiked with street dust in both A-horizon and C-horizon soils, in spite of low PAH-concentrations. The increased potential for PAH degradation was demonstrated on several...

  12. Anaerobic degradation of cyclohexane by sulfate-reducing bacteria from hydrocarbon-contaminated marine sediments

    Directory of Open Access Journals (Sweden)

    Ulrike eJaekel

    2015-02-01

    Full Text Available The fate of cyclohexane, often used as a model compound for the biodegradation of cyclic alkanes due to its abundance in crude oils, in anoxic marine sediments has been poorly investigated. In the present study, we obtained an enrichment culture of cyclohexane-degrading sulfate-reducing bacteria from hydrocarbon-contaminated intertidal marine sediments. Microscopic analyses showed an apparent dominance by oval cells of 1.5×0.8 m. Analysis of a 16S rRNA gene library, followed by whole-cell hybridization with group- and sequence-specific oligonucleotide probes showed that these cells belonged to a single phylotype, and were accounting for more than 80% of the total cell number. The dominant phylotype, affiliated with the Desulfosarcina-Desulfococcus cluster of the Deltaproteobacteria, is proposed to be responsible for the degradation of cyclohexane. Quantitative growth experiments showed that cyclohexane degradation was coupled with the stoichiometric reduction of sulfate to sulfide. Substrate response tests corroborated with hybridization with a sequence-specific oligonucleotide probe suggested that the dominant phylotype apparently was able to degrade other cyclic and n-alkanes, including the gaseous alkanes propane and n-butane. Based on GC-MS analyses of culture extracts cyclohexylsuccinate was identified as a metabolite, indicating an activation of cyclohexane by addition to fumarate. Other metabolites detected were 3-cyclohexylpropionate and cyclohexanecarboxylate providing evidence that the overall degradation pathway of cyclohexane under anoxic conditions is analogous to that of n-alkanes.

  13. Monitoring in situ biodegradation of hydrocarbons by using stable carbon isotopes

    International Nuclear Information System (INIS)

    Aggarwal, P.K.; Hinchee, R.E.

    1991-01-01

    Spilled or leaked nonhalogenated petroleum hydrocarbons in the soil can generally be metabolized by indigenous, aerobic bacteria. In situ biological degradation of hydrocarbons may be accelerated by supplying inorganic nutrients and/or oxygen. Approaches to monitoring and verifying enhanced in situ biodegradation have included measurements of changes over time in the (a) concentration of hydrocarbons, (b) temperature, (c) number of hydrocarbon-degrading microorganisms, (d) ratio of fast-degrading hydrocarbons (e.g., pristanes or phytanes), and (e) metabolic intermediates. Measurements of oxygen consumption over time and elevated carbon dioxide concentrations in soil gas also have been used as indicators of hydrocarbon degradation. An alternative approach that may help substantiate biodegradation is to measure stable carbon isotope ratios in soil gas CO 2 . Stable carbon isotope ratio analysis is inexpensive and commercially available at many laboratories. Carbon dioxide produced by hydrocarbon degradation may be distinguished from that produced by other processes based on the carbon isotopic compositions characteristic of the source material and/or fractionation accompanying microbial metabolism. Here the authors demonstrate the applicability of the stable isotope technique for monitoring enhanced. aerobic biodegradation of hydrocarbons using data from three locations in the United States

  14. Mineralisation of target hydrocarbons in three contaminated soils from former refinery facilities.

    Science.gov (United States)

    Towell, Marcie G; Bellarby, Jessica; Paton, Graeme I; Coulon, Frédéric; Pollard, Simon J T; Semple, Kirk T

    2011-02-01

    This study investigated the microbial degradation of (14)C-labelled hexadecane, octacosane, phenanthrene and pyrene and considered how degradation might be optimised in three genuinely hydrocarbon-contaminated soils from former petroleum refinery sites. Hydrocarbon mineralisation by the indigenous microbial community was monitored over 23 d. Hydrocarbon mineralisation enhancement by nutrient amendment (biostimulation), hydrocarbon degrader addition (bioaugmentation) and combined nutrient and degrader amendment, was also explored. The ability of indigenous soil microflora to mineralise (14)C-target hydrocarbons was appreciable; ≥ 16% mineralised in all soils. Generally, addition of nutrients or degraders increased the rates and extents of mineralisation of (14)C-hydrocarbons. However, the addition of nutrients and degraders in combination had a negative effect upon (14)C-octacosane mineralisation and resulted in lower extents of mineralisation in the three soils. In general, the rates and extents of mineralisation will be dependent upon treatment type, nature of the contamination and adaptation of the ingenious microbial community. Copyright © 2010 Elsevier Ltd. All rights reserved.

  15. Ecodynamics of oil-degrading bacteria and significance of marine mixed populations in the degradation of petroleum compounds

    International Nuclear Information System (INIS)

    Venkateswaran, Kasthuri; Tanaka, Hiroki; Komukai, Shyoko

    1993-01-01

    Ecological studies, screening of hydrocarbon-degrading bacteria, and studies of the potentials of various single and mixed bacterial populations in the utilization of petroleum compounds were carried out to understand the microbial hydrocarbon degradation process in marine ecosystems. Populations of hydrocarbon utilizers were larger in coastal regions than in pelagic environments. Ecological observations indicated that oil-degrading bacteria were ubiquitously distributed in both temperate and tropical environments, irrespective of oil-polluted and unpolluted ecosystem. Bacteria were grown with n-tet-radecane, pristane, propylbenzene, phenanthrene, and crude oil as the sole carbon source; and substrate specificities of the purified strains were characterized. Based on the assimilation characteristics of the isolated strains, an artificial mixed-culture system was constructed. Biodegradation of crude oil by the natural mixed population was found to be higher than by the artificial mixed population. However, when some of the substrate-specific degraders were artificially mixed with natural microflora, the degradation of hard-to-degrade aromatic hydrocarbon fractions of crude oil was enhanced

  16. Isolation and Identification of Pyrene-degrading Bacteria from Soils around Landfills in Shiraz and Their Growth Kinetic Assay

    Directory of Open Access Journals (Sweden)

    Farshid Kafilzadeh

    2011-12-01

    Full Text Available Background & Objectives: Pyrene is a kind of carcinogen hydrocarbon in environment and one of the top 129 pollutants as ranked by the U.S.Environmental Pretection Agency (USEPA. Today's commodious method that is considered by many researchers is the use of microorganisms to degrade these compounds from the environment. The goal of this research is separation and identification of the indigenous bacterias which are effective in decomposition of Pyrene hydrocarbon from soils around Shiraz Landfills. Isolated bacteria growth in the presence of different concentrations of the aforesaid organic pollutant was evaluated. Materials & Methods: Taking samples from Landfills were done after transportation them to the laboratory. The numbers of the bacterias were counted in a medium including Pyrene 0.6 g/l and in another medium without Pyrene. The isolated bacterias were separated by the enriched medium of hydrocarbon Pyrene and were recognized accordance with standards methods (specialty of colony, microscopic properties, fermentation of sugars and biochemical test.The kinetic growth of the separated bacterias was evaluated every 12 hours during 7 successive days. Results: It was reported that the numbers of the bacterias in the medium without Pyrene is more than those with Pyrene (cfu/g. The separated bacterias were included Bacillus spp., Pseudomonas spp., Micrococcus spp., Mycobacterium spp. These four isolated bacterias showed the best growth with Pyrene 0.6 g/l during third and fourth days. Conclusion: The separating bacterias, effecting in decomposition of PAH, make this possibility that the modern methods with more efficiency to be created for removing the carcinogen organic polluters from the environment. Moreover, the separated bacterias (relating to this research can be applied to develop the microbial population in the areas that polluted with Pyrene.

  17. Isolation and study of Biodegradiation Potential of Phenanthrene degrading bacteria

    Directory of Open Access Journals (Sweden)

    nafise Nourieh

    2009-11-01

    Full Text Available Polycyclic Aromatic Hydrocarbons (PAHs are among of potentially hazardous chemicals for environment and cause health concern. These compounds exhibit carcinogenic and/or mutagenic properties and are listed by the United States Environmental Protection Agency (USEPA as priority pollutants. Polycyclic Aromatic Hydrocarbons are hardly degraded and therefore bioremediation is often considered as a desirable and cost effective remediation technique for soil. contaminated with them. Materials and Methods: In this research Phenanthrene (C14H10, a three-benzene ring PAHs, was selected as a PAH representative compound and two different concentrations of Phenanthrene (100mg/kg and 500mg/kg were studied. First, PAH-degrading microorganisms were separated and after adaptation and enrichment PAH-degrading bacteria were identified. Results: The results showed that removal efficiency of Phenanthrene in the samples containing pseudomonas was more than other specified bacteria. Also the most removal efficiency of Phenanthrene occurred in first 45 days of biotreatment and then decreasing trend slowed down. Other finding was that the bioremediation of the lower concentration of Phenanthrene takes shorter time compared with the higher concentration and also the comparison of Phenanthrene bioremediation by pure bacteria and Consertium indicated that, at the beginning of the process, the pace of eliminating Phenanthrene by Consertium is more than other bacteria. Conclusion: Microbial analysis, based on cinfirmation tests and analytical profile index (api 20E kit tests, showed that Pseudomonas. SPP, Bacillus, Pseudomonas aeruginosa and Acinetobacter were the bacteria, responsible for Phenanthrene degradation. Extraction was conducted by ultra sonic method and Phenanthrene concentration was measured by (HPLC.

  18. Oil characterisation: assessment of composition, risks, degradation and remediation potential of total petroleum hydrocarbons in soil

    International Nuclear Information System (INIS)

    Lookman, R.; Vanermen, G.; Van De Weghe, H.; Gemoets, J.; Van der Sterren, G.; Alphenaar, A.

    2005-01-01

    Several methods are available for the characterization of petroleum hydrocarbons. The TPHCWG (Total Petroleum Hydrocarbon Criteria Working Group) developed a method based on a silica column separation of aromatics and aliphatics and a GC-FID subdivision into equivalent-carbon fractions (EC) ('TPH-method'). This method was mainly developed for assessing human risks of oil compounds. Within NOBIS (Dutch Research program Biological In-situ Remediation), another method was developed based upon an equilibrium-experiment of the oil-polluted soil with water (column recirculation), which was further developed by TTE ('TTE-method'). This method uses measured water solubilities of individual oil components and GC-retention times yielding a subdivision of the hydrocarbons into compound classes that are relevant for assessing the remediation potential of the specific oil pollution. In this paper we present results of a research project in which we developed a new method, the 'OK-method' that combines these two procedures and allows a complete characterisation of the oil in terms of composition, (human) risks, volatility, solubility, plume behaviour (migration velocities of the soluble components) and aerobic degradation potential. (authors)

  19. Studies on hydrocarbon degradation by the bacterial isolate ...

    African Journals Online (AJOL)

    The hydrocarbon utilizing capability of Stenotrophomonas rhizophila (PM-1), isolated from oil contaminated soil composts from Western Ghats region of Karnataka was analyzed. In the bioremediation experiment, ONGC heavy crude oil and poly aromatic hydrocarbons (PAHs) utilization by the bacterial isolate was studied.

  20. Total petroleum hydrocarbon degradation by hybrid electrobiochemical reactor in oilfield produced water

    International Nuclear Information System (INIS)

    Mousa, Ibrahim E.

    2016-01-01

    The crude oil drilling and extraction operations are aimed to maximize the production may be counterbalanced by the huge production of contaminated produced water (PW). PW is conventionally treated through different physical, chemical, and biological technologies. The efficiency of suggested hybrid electrobiochemical (EBC) methods for the simultaneous removal of total petroleum hydrocarbon (TPH) and sulfate from PW generated by petroleum industry is studied. Also, the factors that affect the stability of PW quality are investigated. The results indicated that the effect of biological treatment is very important to keep control of the electrochemical by-products and more TPH removal in the EBC system. The maximum TPH and sulfate removal efficiency was achieved 75% and 25.3%, respectively when the detention time was about 5.1 min and the energy consumption was 32.6 mA/cm 2 . However, a slight increasing in total bacterial count was observed when the EBC compact unit worked at a flow rate of average 20 L/h. Pseudo steady state was achieved after 30 min of current application in the solution. Also, the results of the study indicate that when the current intensity was increased above optimum level, no significant results occurred due to the release of gases. - Highlights: • The hybrid electrolytic biological cell was used for degradation of oilfield produced water. • Decomposition of Total Petroleum Hydrocarbon with or without the biofilter. • High saline water with the high chloride and sulfate ions content treatment. • The removal of electrochemical by-products is a phase change technique that requires the maintenance the biofilm on the filter media, which is sensitive and a complex operation. • Biofilter is efficient for the degradation of PW bye products, the critical drawback to their utility in full-scale operations is high TDS water content and detention time of treatment.

  1. Improvement of Pure Poly aromatic Hydrocarbon Degrading Bacteria Using Gamma Irradiation

    International Nuclear Information System (INIS)

    Abd El-Daem, G.A.N.A.; Tarrad, M.M.

    2013-01-01

    The main goal of this study is to obtain a potent polycyclic aromatic hydrocarbons (PAHs) biodegrading bacteria to be used for bio augmentation purpose which is considered a promising strategy for the cleanup of contaminated sites. Among 10 selected potent PAHs degrading bacteria isolated from Suez Gulf water (after enrichments on phenanthrene as a sole source of carbon and energy). Isolate HD20 was selected due to its fast and remarkable abilities to breakdown phenanthrene . In a trial to improve the biodegradation potentials of the most potent isolate (Had) identified as Stenotrophomonas maltophilia, low doses of gamma irradiation were used to activate the organism. To determine the radiation response of S. maltophilia, 24 hours culture was exposed in saline solution in a triplicate glass vials separately to increasing doses of gamma irradiation, 0.25, 0.5, 1.0, 1.5, 2.0 and 2.5 kGy. The dose response curve revealed the linear death of bacterial cells with increasing irradiation dose, The D10 value of S. maltophilia was found to be 0.3 kGy. For PAHs biodegradation enhancement, the organism was irradiated at low doses of gamma irradiation, 0.2, 0.4, 0.5, 0.6 and 0.7 kGy. The grown colonies exhibited a morphological differences from the non irradiated Stenotrophomonas maltophilia on Tryptone-glucose-yeast extract (TGY) plates. All of them showed a creamy rough appearance and a loss of the known yellow colour of the original isolate. The single selected irradiated colonies as well as the whole irradiated mixture of cells irradiated at different doses were tested separately in fertilized marine microcosms containing 200 ppm of phenanthrene as a model of PAH and the degradation rates of polyaromatic hydrocarbons were monitored by the determination of the residual phenanthrene up to one week . The biodegradation potentials of irradiated and non irradiated S. maltophilia was compared with that of the natural Suez Gulf microbial communities. The irradiated culture of S

  2. Biotransformation of monoaromatic hydrocarbons under anoxic conditions

    International Nuclear Information System (INIS)

    Ball, H.A.; Reinhard, M.; McCarty, P.L.

    1991-01-01

    Aromatic hydrocarbons contained in gasoline are environmental pollutants of particular concern since they are relatively soluble in water, many are toxic, and some are confirmed carcinogens, (e.g., benzene). Although most gasoline constituents are readily degraded in aerobic surface water systems, the groundwater environment associated with hydrocarbon spills is typically anaerobic, thus precluding aerobic degradation pathways. In the absence of oxygen, degradation of gasoline components can take place only with the utilization of alternate electron acceptors such as nitrate, sulfate, carbon dioxide, and possibly ferric iron or other metal oxides. Benzene, toluene, and xylene isomers were completely degraded by aquifer- or sewage sludge-derived microorganisms under dentrifying and methanogenic conditions. Recently, a pure culture was found to degrade toluene and m-xylene nitrate or nitrous oxide as an electron acceptor. This paper presents initial results of ongoing study to develop and characterize microbial consortia capable of transforming aromatic hydrocarbons under nitrate-reducing conditions, and understand the effect of environmental factors on the biotransformation processes

  3. Assessing impediments to hydrocarbon biodegradation in weathered contaminated soils.

    Science.gov (United States)

    Adetutu, Eric; Weber, John; Aleer, Sam; Dandie, Catherine E; Aburto-Medina, Arturo; Ball, Andrew S; Juhasz, Albert L

    2013-10-15

    In this study, impediments to hydrocarbon biodegradation in contaminated soils were assessed using chemical and molecular methodologies. Two long-term hydrocarbon contaminated soils were utilised which were similar in physico-chemical properties but differed in the extent of hydrocarbon (C10-C40) contamination (S1: 16.5 g kg(-1); S2: 68.9 g kg(-1)). Under enhanced natural attenuation (ENA) conditions, hydrocarbon biodegradation was observed in S1 microcosms (26.4% reduction in C10-C40 hydrocarbons), however, ENA was unable to stimulate degradation in S2. Although eubacterial communities (PCR-DGGE analysis) were similar for both soils, the alkB bacterial community was less diverse in S2 presumably due to impacts associated with elevated hydrocarbons. When hydrocarbon bioaccessibility was assessed using HP-β-CD extraction, large residual concentrations remained in the soil following the extraction procedure. However, when linear regression models were used to predict the endpoints of hydrocarbon degradation, there was no significant difference (P>0.05) between HP-β-CD predicted and microcosm measured biodegradation endpoints. This data suggested that the lack of hydrocarbon degradation in S2 resulted primarily from limited hydrocarbon bioavailability. Copyright © 2013 Elsevier B.V. All rights reserved.

  4. Degradation of polycyclic aromatic hydrocarbons by microbial consortia enriched from three soils using two different culture media.

    Science.gov (United States)

    Wu, Manli; Chen, Liming; Tian, Yongqiang; Ding, Yi; Dick, Warren A

    2013-07-01

    A consortium composed of many different bacterial species is required to efficiently degrade polycyclic aromatic hydrocarbons (PAH) in oil-contaminated soil. We obtained six PAH-degrading microbial consortia from three oil-contaminated soils using two different isolation culture media. Denaturing gradient gel electrophoresis (DGGE) and sequence analyses of amplified 16s rRNA genes confirmed the bacterial community was greatly affected by both the culture medium and the soil from which the consortia were enriched. Three bacterial consortia enriched using malt yeast extract (MYE) medium showed higher degradation rates of PAHs than consortia enriched using Luria broth (LB) medium. Consortia obtained from a soil and then added back to that same soil was more effective in degrading PAHs than adding, to the same soil, consortia isolated from other, unrelated soils. This suggests that inoculum used for bioremediation should be from the same, or very similar nearby soils, as the soil that is actually being bioremediated. Copyright © 2013 Elsevier Ltd. All rights reserved.

  5. Aromatic Hydrocarbons: Degrading Bacteria in the Desert Soil of Kuwait

    International Nuclear Information System (INIS)

    Al-Gounaim, M.; Diab, A.; Al-Hilali, A.; Abu-Shady, A. Sattar

    2005-01-01

    investigated. The three Pseudomonas spp were able to degrade more (PAHs) than the Bacillus spp. On the other hand the mixed culture showed high biodegradation activities (88.6%) as compared to the pure individual cultures. (author)

  6. Metagenomic Analysis of Subtidal Sediments from Polar and Subpolar Coastal Environments Highlights the Relevance of Anaerobic Hydrocarbon Degradation Processes

    Energy Technology Data Exchange (ETDEWEB)

    Espinola, Fernando J.; Dionisi, Hebe M.; Borglin, Sharon; Brislawn, Colin J.; Jansson, Janet K.; Mac Cormack, Walter P.; Carroll, Jolynn; Sjoling, Sara; Lozada , Mariana

    2018-01-02

    In this work, we analyzed the community structure and metabolic potential of sediment microbial communities in high-latitude coastal environments subjected to low to moderate levels of chronic pollution. Subtidal sediments from four low-energy inlets located in polar and subpolar regions from both Hemispheres were analyzed using large-scale 16S rRNA gene and metagenomic sequencing. Communities showed high diversity (Shannon’s index 6.8 to 10.2), with distinct phylogenetic structures (<40% shared taxa at the Phylum level among regions) but similar metabolic potential in terms of sequences assigned to KOs. Environmental factors (mainly salinity, temperature, and in less extent organic pollution) were drivers of both phylogenetic and functional traits. Bacterial taxa correlating with hydrocarbon pollution included families of anaerobic or facultative anaerobic lifestyle, such as Desulfuromonadaceae, Geobacteraceae, and Rhodocyclaceae. In accordance, biomarker genes for anaerobic hydrocarbon degradation (bamA, ebdA, bcrA, and bssA) were prevalent, only outnumbered by alkB, and their sequences were taxonomically binned to the same bacterial groups. BssA-assigned metagenomic sequences showed an extremely wide diversity distributed all along the phylogeny known for this gene, including bssA sensu stricto, nmsA, assA, and other clusters from poorly or not yet described variants. This work increases our understanding of microbial community patterns in cold coastal sediments, and highlights the relevance of anaerobic hydrocarbon degradation processes in subtidal environments.

  7. Current state of knowledge in microbial degradation of polycyclic aromatic hydrocarbons (PAHs: a review

    Directory of Open Access Journals (Sweden)

    Debajyoti Ghosal

    2016-08-01

    Full Text Available Polycyclic aromatic hydrocarbons (PAHs include a group of organic priority pollutants of critical environmental and public health concern due to their toxic, genotoxic, mutagenic and/or carcinogenic properties and their ubiquitous occurrence as well as recalcitrance. The increased awareness of their various adverse effects on ecosystem and human health has led to a dramatic increase in research aimed towards removing PAHs from the environment. PAHs may undergo adsorption, volatilization, photolysis, and chemical oxidation, although transformation by microorganisms is the major neutralization process of PAH-contaminated sites in an ecologically accepted manner. Microbial degradation of PAHs depends on various environmental conditions, such as nutrients, number and kind of the microorganisms, nature as well as chemical property of the PAH being degraded. A wide variety of bacterial, fungal and algal species have the potential to degrade/transform PAHs, among which bacteria and fungi mediated degradation has been studied most extensively. In last few decades microbial community analysis, biochemical pathway for PAHs degradation, gene organization, enzyme system, genetic regulation for PAH degradation have been explored in great detail. Although, xenobiotic-degrading microorganisms have incredible potential to restore contaminated environments inexpensively yet effectively, but new advancements are required to make such microbes effective and more powerful in removing those compounds, which were once thought to be recalcitrant. Recent analytical chemistry and genetic engineering tools might help to improve the efficiency of degradation of PAHs by microorganisms, and minimize uncertainties of successful bioremediation. However, appropriate implementation of the potential of naturally occurring microorganisms for field bioremediation could be considerably enhanced by optimizing certain factors such as bioavailability, adsorption and mass transfer of

  8. Current State of Knowledge in Microbial Degradation of Polycyclic Aromatic Hydrocarbons (PAHs): A Review

    Science.gov (United States)

    Ghosal, Debajyoti; Ghosh, Shreya; Dutta, Tapan K.; Ahn, Youngho

    2016-01-01

    Polycyclic aromatic hydrocarbons (PAHs) include a group of organic priority pollutants of critical environmental and public health concern due to their toxic, genotoxic, mutagenic and/or carcinogenic properties and their ubiquitous occurrence as well as recalcitrance. The increased awareness of their various adverse effects on ecosystem and human health has led to a dramatic increase in research aimed toward removing PAHs from the environment. PAHs may undergo adsorption, volatilization, photolysis, and chemical oxidation, although transformation by microorganisms is the major neutralization process of PAH-contaminated sites in an ecologically accepted manner. Microbial degradation of PAHs depends on various environmental conditions, such as nutrients, number and kind of the microorganisms, nature as well as chemical property of the PAH being degraded. A wide variety of bacterial, fungal and algal species have the potential to degrade/transform PAHs, among which bacteria and fungi mediated degradation has been studied most extensively. In last few decades microbial community analysis, biochemical pathway for PAHs degradation, gene organization, enzyme system, genetic regulation for PAH degradation have been explored in great detail. Although, xenobiotic-degrading microorganisms have incredible potential to restore contaminated environments inexpensively yet effectively, but new advancements are required to make such microbes effective and more powerful in removing those compounds, which were once thought to be recalcitrant. Recent analytical chemistry and genetic engineering tools might help to improve the efficiency of degradation of PAHs by microorganisms, and minimize uncertainties of successful bioremediation. However, appropriate implementation of the potential of naturally occurring microorganisms for field bioremediation could be considerably enhanced by optimizing certain factors such as bioavailability, adsorption and mass transfer of PAHs. The main

  9. Isolation and characterization of a novel hydrocarbon-degrading bacterium Achromobacter sp. HZ01 from the crude oil-contaminated seawater at the Daya Bay, southern China

    International Nuclear Information System (INIS)

    Deng, Mao-Cheng; Li, Jing; Liang, Fu-Rui; Yi, Meisheng; Xu, Xiao-Ming; Yuan, Jian-Ping; Peng, Juan; Wu, Chou-Fei; Wang, Jiang-Hai

    2014-01-01

    Graphical abstract: Morphological properties of the colonies and cells of strain HZ01. (A) Colonies of strain HZ01 on the LB solid plate; (B) Gram-negative bacterium of strain HZ01 (20 × 100); (C) Scanning electron microscopy (SEM) photograph of strain HZ01 (×15,000); and (D) Transmission electronic microscopy (TEM) photograph of strain HZ01 (×5000). - Highlights: • A novel petroleum degrading bacterium HZ01 was obtained from the crude oil-contaminated seawater. • Strain HZ01 had been identified as Achromobacter sp. • Strain HZ01 could degrade the evaporated diesel oil with the degradability of 96.6%. • Strain HZ01 could effectively degrade anthracene, phenanthrene and pyrence. • Strain HZ01 may be employed to remove hydrocarbon contaminants. - Abstract: Microorganisms play an important role in the biodegradation of petroleum contaminants, which have attracted great concern due to their persistent toxicity and difficult biodegradation. In this paper, a novel hydrocarbon-degrading bacterium HZ01 was isolated from the crude oil-contaminated seawater at the Daya Bay, South China Sea, and identified as Achromobacter sp. Under the conditions of pH 7.0, NaCl 3% (w/v), temperature 28 °C and rotary speed 150 rpm, its degradability of the total n-alkanes reached up to 96.6% after 10 days of incubation for the evaporated diesel oil. Furthermore, Achromobacter sp. HZ01 could effectively utilize polycyclic aromatic hydrocarbons (PAHs) as its sole carbon source, and could remove anthracene, phenanthrene and pyrence about 29.8%, 50.6% and 38.4% respectively after 30 days of incubation. Therefore, Achromobacter sp. HZ01 may employed as an excellent degrader to develop one cost-effective and eco-friendly method for the bioremediation of marine environments polluted by crude oil

  10. Syntrophic biodegradation of hydrocarbon contaminants.

    Science.gov (United States)

    Gieg, Lisa M; Fowler, S Jane; Berdugo-Clavijo, Carolina

    2014-06-01

    Anaerobic environments are crucial to global carbon cycling wherein the microbial metabolism of organic matter occurs under a variety of redox conditions. In many anaerobic ecosystems, syntrophy plays a key role wherein microbial species must cooperate, essentially as a single catalytic unit, to metabolize substrates in a mutually beneficial manner. Hydrocarbon-contaminated environments such as groundwater aquifers are typically anaerobic, and often methanogenic. Syntrophic processes are needed to biodegrade hydrocarbons to methane, and recent studies suggest that syntrophic hydrocarbon metabolism can also occur in the presence of electron acceptors. The elucidation of key features of syntrophic processes in defined co-cultures has benefited greatly from advances in 'omics' based tools. Such tools, along with approaches like stable isotope probing, are now being used to monitor carbon flow within an increasing number of hydrocarbon-degrading consortia to pinpoint the key microbial players involved in the degradative pathways. The metagenomic sequencing of hydrocarbon-utilizing consortia should help to further identify key syntrophic features and define microbial interactions in these complex communities. Copyright © 2013 Elsevier Ltd. All rights reserved.

  11. Oil characterisation: assessment of composition, risks, degradation and remediation potential of total petroleum hydrocarbons in soil

    Energy Technology Data Exchange (ETDEWEB)

    Lookman, R.; Vanermen, G.; Van De Weghe, H.; Gemoets, J. [Vito, Mol (Belgium); Van der Sterren, G.; Alphenaar, A. [TTE, Deventer (Netherlands)

    2005-07-01

    Several methods are available for the characterization of petroleum hydrocarbons. The TPHCWG (Total Petroleum Hydrocarbon Criteria Working Group) developed a method based on a silica column separation of aromatics and aliphatics and a GC-FID subdivision into equivalent-carbon fractions (EC) ('TPH-method'). This method was mainly developed for assessing human risks of oil compounds. Within NOBIS (Dutch Research program Biological In-situ Remediation), another method was developed based upon an equilibrium-experiment of the oil-polluted soil with water (column recirculation), which was further developed by TTE ('TTE-method'). This method uses measured water solubilities of individual oil components and GC-retention times yielding a subdivision of the hydrocarbons into compound classes that are relevant for assessing the remediation potential of the specific oil pollution. In this paper we present results of a research project in which we developed a new method, the 'OK-method' that combines these two procedures and allows a complete characterisation of the oil in terms of composition, (human) risks, volatility, solubility, plume behaviour (migration velocities of the soluble components) and aerobic degradation potential. (authors)

  12. Comparison of Paraffin and Diesel Oil as Cultivation Medium Supplements for Preparing a Hydrocarbon-Degrading Bacterial Biomass

    Directory of Open Access Journals (Sweden)

    Dokukins Eduards

    2016-05-01

    Full Text Available The effect of liquid paraffin and diesel oil as nutrient amendments for hydrocarbon-degrading bacteria was compared. Different parameters were analyzed - optical density of bacterial suspension, oxygen consumption by biomass, morphology of bacteria, etc. In some experiments the paraffin was more preferable for microorganisms, but in other tests the results for both substances were similar. The influence of the comparable substances strongly depends on cultivation conditions.

  13. Biosurfactant production from marine hydrocarbon-degrading consortia and pure bacterial strains using crude oil as carbon source

    OpenAIRE

    Antoniou, Eleftheria; Fodelianakis, Stilianos; Korkakaki, Emmanouela; Kalogerakis, Nicolas

    2015-01-01

    Biosurfactants (BS) are green amphiphilic molecules produced by microorganisms during biodegradation, increasing the bioavailability of organic pollutants. In this work, the BS production yield of marine hydrocarbon degraders isolated from Elefsina bay in Eastern Mediterranean Sea has been investigated. The drop collapse test was used as a preliminary screening test to confirm biosurfactant producing strains or mixed consortia. The community structure of the best consortia based on the drop c...

  14. Isolation and identification of aerobic polychlorinated biphenyls degrading bacteria

    Directory of Open Access Journals (Sweden)

    Bibi Fatemeh Nabavi

    2013-01-01

    Full Text Available Aims: The purpose of this study was to isolate and identify aerobic polychlorinated biphenyls (PCBs degrading bacteria. Materials and Methods: This study was performed in lab scale aerobic sequencing batch biofilm reactor. Polyurethane foams were used as bio-carrier and synthetic wastewater was prepared with PCBs in transformer oil as the main substrate (20-700 μg/l and acetone as a solvent for PCBs as well as microelements. After achieving to adequate microbial population and acclimation of microorganisms to PCB compounds with high efficiency of PCB removal, identification of degrading microbial species was performed by 16s rRNA gene sequencing of isolated bacteria. Results: Gene sequencing results of the isolated bacteria showed that Rhodococcus spp., Pseudomonas spp., Pseudoxanthomonas spp., Agromyces spp., and Brevibacillus spp. were dominant PCB-degrading bacteria. Conclusion: PCB compounds can be degraded by some microorganisms under aerobic or anaerobic conditions or at least be reduced to low chlorinated congeners, despite their chemical stability and toxicity. Based on the results of the study, five bacterial species capable of degrading PCBs in transformer oil have been identified.

  15. Petroleum degrading potentials of single and mixed microbial ...

    African Journals Online (AJOL)

    The ability of three bacterial isolates (Bacillus spp, Micrococcus spp and Proteus spp.) and some fungal species (Penicillin spp., Aspergillus spp. and Rhizopus spp.) isolated from two rivers and refinery effluent to degrade two Nigerian Crude oils was studied. The results showed changes in pH, optical density and total ...

  16. Degradation of phenolics, nitrogen-heterocyclics and polynuclear aromatic hydrocarbons in a rotating biological contactor.

    Science.gov (United States)

    Jeswani, Hansa; Mukherji, Suparna

    2012-05-01

    The degradation of phenolics, heterocyclics and polynuclear aromatic hydrocarbons (PAHs) in a synthetic biomass gasifier wastewater with average COD of 1388 mg/L was studied in a three stage rotating biological contactor (RBC) using the pyrene degrader, Exiguobacterium aurantiacum and activated sludge consortia (1:3 v/v). As the organic loading rate (OLR) was varied from 3.3 to 14 g/m(2)/d, the COD removal ranged from 63.3% to 92.6%. Complete removal of all the constituents was observed at the lowest OLR of 3.3g/m(2)/d. At 24h hydraulic retention time (HRT) and OLR of 6.6g/m(2)/d complete removal of pyridine, quinoline and benzene and 85-96% removal of phenol, naphthalene, phenanthrene, fluoranthene and pyrene was observed. E. aurantiacum was found to be the dominant bacteria in the biofilm. Clark's model provided good fits to data for all the three stages of the RBC. Copyright © 2012 Elsevier Ltd. All rights reserved.

  17. In-Field Spatial Variability in the Degradation of the Phenyl-Urea Herbicide Isoproturon Is the Result of Interactions between Degradative Sphingomonas spp. and Soil pH

    Science.gov (United States)

    Bending, Gary D.; Lincoln, Suzanne D.; Sørensen, Sebastian R.; Morgan, J. Alun W.; Aamand, Jens; Walker, Allan

    2003-01-01

    Substantial spatial variability in the degradation rate of the phenyl-urea herbicide isoproturon (IPU) [3-(4-isopropylphenyl)-1,1-dimethylurea] has been shown to occur within agricultural fields, with implications for the longevity of the compound in the soil, and its movement to ground- and surface water. The microbial mechanisms underlying such spatial variability in degradation rate were investigated at Deep Slade field in Warwickshire, United Kingdom. Most-probable-number analysis showed that rapid degradation of IPU was associated with proliferation of IPU-degrading organisms. Slow degradation of IPU was linked to either a delay in the proliferation of IPU-degrading organisms or apparent cometabolic degradation. Using enrichment techniques, an IPU-degrading bacterial culture (designated strain F35) was isolated from fast-degrading soil, and partial 16S rRNA sequencing placed it within the Sphingomonas group. Denaturing gradient gel electrophoresis (DGGE) of PCR-amplified bacterial community 16S rRNA revealed two bands that increased in intensity in soil during growth-linked metabolism of IPU, and sequencing of the excised bands showed high sequence homology to the Sphingomonas group. However, while F35 was not closely related to either DGGE band, one of the DGGE bands showed 100% partial 16S rRNA sequence homology to an IPU-degrading Sphingomonas sp. (strain SRS2) isolated from Deep Slade field in an earlier study. Experiments with strains SRS2 and F35 in soil and liquid culture showed that the isolates had a narrow pH optimum (7 to 7.5) for metabolism of IPU. The pH requirements of IPU-degrading strains of Sphingomonas spp. could largely account for the spatial variation of IPU degradation rates across the field. PMID:12571001

  18. ACCUMULATION OF POLY-B-HYDROXYBUTYRATE IN A METHANE- ENRICHED, HALOGENATED, HYDROCARBON-DEGRADING SOIL COLUMN: IMPLICATIONS FOR MICROBIAL COMMUNITY STRUCTURE AND NUTRITIONAL STATUS

    Science.gov (United States)

    The prokarotic, endogenous storage polymer poly--hydroxybutyrate (PHB) accumulated in soil from a methane-enriched, halogenated hydrocarbon-degrading soil column. Based on phospholipid ester-linked fatty acid (PLFA) profiles, this mocrocosm has been previously reported to be sign...

  19. Assessment of degradation potential of aliphatic hydrocarbons by autochthonous filamentous fungi from a historically polluted clay soil.

    Science.gov (United States)

    Covino, Stefano; D'Annibale, Alessandro; Stazi, Silvia Rita; Cajthaml, Tomas; Čvančarová, Monika; Stella, Tatiana; Petruccioli, Maurizio

    2015-02-01

    The present work was aimed at isolating and identifying the main members of the mycobiota of a clay soil historically contaminated by mid- and long-chain aliphatic hydrocarbons (AH) and to subsequently assess their hydrocarbon-degrading ability. All the isolates were Ascomycetes and, among them, the most interesting was Pseudoallescheria sp. 18A, which displayed both the ability to use AH as the sole carbon source and to profusely colonize a wheat straw:poplar wood chip (70:30, w/w) lignocellulosic mixture (LM) selected as the amendment for subsequent soil remediation microcosms. After a 60 d mycoaugmentation with Pseudoallescheria sp. of the aforementioned soil, mixed with the sterile LM (5:1 mass ratio), a 79.7% AH reduction and a significant detoxification, inferred by a drop in mortality of Folsomia candida from 90 to 24%, were observed. However, similar degradation and detoxification outcomes were found in the non-inoculated incubation control soil that had been amended with the sterile LM. This was due to the biostimulation exerted by the amendment on the resident microbiota, fungi in particular, the activity and density of which were low, instead, in the non-amended incubation control soil. Copyright © 2014 Elsevier B.V. All rights reserved.

  20. Bioremediation of coastal areas 5 years after the Nakhodka oil spill in the Sea of Japan: isolation and characterization of hydrocarbon-degrading bacteria

    International Nuclear Information System (INIS)

    Chaerun, S. Khodijah; Tazaki, Kazue; Asada, Ryuji; Kogure, Kazuhiro

    2004-01-01

    Five years after the 1997 Nakhodka oil spill in the Sea of Japan, seven bacterial strains capable of utilizing the heavy oil spilled from the Nakhodka Russian oil tanker were isolated from three coastal areas (namely Katano Seashore of Fukui Prefecture, Osawa and Atake seashores of Ishikawa Prefecture) and the Nakhodka Russian oil tanker after a 5-year bioremediation process. All bacterial strains isolated could utilize long-chain-length alkanes efficiently, but not aromatic, and all of them were able to grow well on heavy oil. Using 16S rDNA sequencing, most of the strains were affiliated to Pseudomonas aeruginosa. Comparing between the year 1997 (at the beginning of bioremediation process) and the year 2001 (after 5 years of bioremediation), there was no significant change in morphology and size of hydrocarbon-degrading bacteria during the 5-year bioremediation. Scanning and transmission electron microscopic observations revealed that a large number of hydrocarbon- degrading bacteria still existed in the sites consisting of a variety of morphological forms of bacteria, such as coccus (Streptococcus and Staphylococcus) and bacillus (Streptobacillus). On the application of bioremediation processes on the laboratory-scale, laboratory microcosm experiments (containing seawater, beach sand, and heavy oil) under aerobic condition by two different treatments (i.e., placed inside the building and outside the building) were established for bioremediation of heavy oil to investigate the significance of the role of hydrocarbon-degrading bacteria on them. There was no significant bacterial activity differentiation in the two treatments, and removal of heavy oil by hydrocarbon degrading bacteria in the outside building was slightly greater than that in the inside building. The values of pH, Eh, EC, and dissolved oxygen (DO) in two treatments indicated that the bioremediation process took place under aerobic conditions (DO: 1-6 mg/l; Eh: 12-300 mV) and neutral

  1. Hydrogen degradation of the 26H2MF alloy steel in H2SO4 and hydrocarbon environments

    International Nuclear Information System (INIS)

    Zielinski, A.; Swieczko-Zurek, B.; Michaliak, P.

    2004-01-01

    The Polish 26H2M alloy steel has been subjected to different heat treatment resulting in different microstructure and fracture appearance. The slow strain rate tests have been made on smooth round specimens in diluted sulphuric acid, boiler fuel and used mineral machine oil. The 26H2MF steel has become relatively immune in neutral boiler fuel and mineral oil and been heavily suffered from hydrogen degradation in acidic environment. The results demonstrate that the 26H2MF steel is highly susceptible to hydrogen degradation but in absence of stress raisers the increased hydrogen absorption in hydrocarbons can cause only small loss of its plasticity. (author) >>>

  2. Culture-dependent characterization of hydrocarbon utilizing bacteria ...

    African Journals Online (AJOL)

    EARNEST

    Hydrocarbons interact with the environment and micro- organisms determining the .... it is pertinent to study the community dynamics of hydrocarbon degrading bacteria ... Chikere CB (2013). Application of molecular microbiology techniques in.

  3. Dynamics of indigenous bacterial communities associated with crude oil degradation in soil microcosms during nutrient-enhanced bioremediation.

    Science.gov (United States)

    Chikere, Chioma B; Surridge, Karen; Okpokwasili, Gideon C; Cloete, Thomas E

    2012-03-01

    Bacterial population dynamics were examined during bioremediation of an African soil contaminated with Arabian light crude oil and nutrient enrichment (biostimulation). Polymerase chain reaction followed by denaturing gradient gel electrophoresis (DGGE) were used to generate bacterial community fingerprints of the different treatments employing the 16S ribosomal ribonucleic acid (rRNA) gene as molecular marker. The DGGE patterns of the nutrient-amended soils indicated the presence of distinguishable bands corresponding to the oil-contaminated-nutrient-enriched soils, which were not present in the oil-contaminated and pristine control soils. Further characterization of the dominant DGGE bands after excision, reamplification and sequencing revealed that Corynebacterium spp., Dietzia spp., Rhodococcus erythropolis sp., Nocardioides sp., Low G+C (guanine plus cytosine) Gram positive bacterial clones and several uncultured bacterial clones were the dominant bacterial groups after biostimulation. Prominent Corynebacterium sp. IC10 sequence was detected across all nutrient-amended soils but not in oil-contaminated control soil. Total heterotrophic and hydrocarbon utilizing bacterial counts increased significantly in the nutrient-amended soils 2 weeks post contamination whereas oil-contaminated and pristine control soils remained fairly stable throughout the experimental period. Gas chromatographic analysis of residual hydrocarbons in biostimulated soils showed marked attenuation of contaminants starting from the second to the sixth week after contamination whereas no significant reduction in hydrocarbon peaks were seen in the oil-contaminated control soil throughout the 6-week experimental period. Results obtained indicated that nutrient amendment of oil-contaminated soil selected and enriched the bacterial communities mainly of the Actinobacteria phylogenetic group capable of surviving in toxic contamination with concomitant biodegradation of the hydrocarbons. The

  4. Microbial Degradation of Phenols and Aromatic Hydrocarbons in Creosote-contaminated Groundwater Under Nitrate-reducing Conditions

    DEFF Research Database (Denmark)

    Flyvbjerg, John; Arvin, Erik; Jensen, Bjørn K.

    1993-01-01

    of toluene, 2,4-DMP, 3,4-DMP and p-cresol depended on nitrate or nitrite as electron acceptors. 40–80% of the nitrate consumed during degradation of the aromatic compounds was recovered as nitrite, and the consumption of nitrate was accompanied by a production of ATP. Stoichiometric calculations indicated......Batch experiments were carried out to investigate the biodegradation of phenols and aromatic hydrocarbons under anaerobic, nitrate-reducing conditions in groundwater from a creosote-contaminated site at Fredensborg, Denmark. The bacteria in the creosote-contaminated groundwater degraded a mixture...... that in addition to the phenols are toluene other carbon sources present in the groundwater contributed to the consumption of nitrate. If the groundwater was incubated under anaerobic conditions without nitrate, sulphate-reducing conditions evolved after ∼ 1 month at 20°C and ∼2 months at 10°C. In the sulphate...

  5. Determination of the hydrocarbon-degrading metabolic capabilities of tropical bacterial isolates

    Energy Technology Data Exchange (ETDEWEB)

    Marquez-Rocha, F.J.; Olmos-Soto, J. [Centro de Investigacion Cientifica y de Educacion Superior de Ensenada, San Diego, CA (United States). Departamento de Biotecnologia Marina; Rosano-Hernandez, M.A.; Muriel-Garcia, M. [Instituto Mexicano del Petroleo, CD Carmen Camp (Mexico). Zona Marina/Tecnologia Ambiental

    2005-01-01

    Of more than 20 bacteria isolated from a tropical soil using minimal medium supplemented with hydrocarbons, 11 grew well on diesel as sole carbon source, and another 11 grew in the presence of polynuclear aromatic hydrocarbons (PAHs). Ten isolates were identified phenotypically as Pseudomonas sp. and eight as Bacillus sp. Gene sequences representing the catabolic genes (alkM, todM, ndoM, and xylM) and 16S rRNA gene sequences characteristic for Pseudomona and Bacillus were amplified by PCR, using DNA recovered from the supernatant of hydrocarbon-contaminated soil suspensions. Based on their rapid growth characteristics in the presence of hydrocarbons and the formation of PCR products for the catabolic genes alkM and ndoM six isolates were selected for biodegradation assays. After 30 days a mixed culture of two isolates achieved close to 70% hydrocarbon removal and apparent mineralization of 16% of the hydrocarbons present in the soil. Biodegradation rates varied from 275 to 387 mg hydrocarbon kg{sup -1} day{sup -1}. Several bacterial isolates obtained in this study have catabolic capabilities for the biodegradation of alkanes and aromatic hydrocarbons including PAHs. (author)

  6. Hydrocarbon Degradation and Lead Solubility in a Soil Polluted with Lead and Used Motor Oil Treated by Composting and Phytoremediation.

    Science.gov (United States)

    Escobar-Alvarado, L F; Vaca-Mier, M; López, R; Rojas-Valencia, M N

    2018-02-01

    Used lubricant oils and metals can be common soil pollutants in abandoned sites. When soil is contaminated with various hazardous wastes, the efficiency of biological treatments could be affected. The purpose of this work was to investigate the effect of combining phytoremediation and composting on the efficiency of hydrocarbon degradation and lead solubility in a soil contaminated with 31,823 mg/kg of total petroleum hydrocarbon (TPH) from used motor oil and 8260 mg/kg of lead. Mexican cactus (Opuntia ficus indica) and yard trimmings were added in the composting process, and lucerne (Medicago sativa) was used in the phytoremediation process. After a 9 week composting process, only 13% of the initial TPH concentration was removed. The following 20 week phytoremediation process removed 48% of TPH. The highest TPH degradation percentage (66%), was observed in the experiment with phytoremediation only. This work demonstrates sustainable technologies, such as biological treatments, represent low-cost options for remediation; however, they are not frequently used because they require long periods of time for success.

  7. Contrasting the community structure of arbuscular mycorrhizal fungi from hydrocarbon-contaminated and uncontaminated soils following willow (Salix spp. L. planting.

    Directory of Open Access Journals (Sweden)

    Saad El-Din Hassan

    Full Text Available Phytoremediation is a potentially inexpensive alternative to chemical treatment of hydrocarbon-contaminated soils, but its success depends heavily on identifying factors that govern the success of root-associated microorganisms involved in hydrocarbon degradation and plant growth stimulation. Arbuscular mycorrhizal fungi (AMF form symbioses with many terrestrial plants, and are known to stimulate plant growth, although both species identity and the environment influence this relationship. Although AMF are suspected to play a role in plant adaptation to hydrocarbon contamination, their distribution in hydrocarbon-contaminated soils is not well known. In this study, we examined how AMF communities were structured within the rhizosphere of 11 introduced willow cultivars as well as unplanted controls across uncontaminated and hydrocarbon-contaminated soils at the site of a former petrochemical plant. We obtained 69 282 AMF-specific 18S rDNA sequences using 454-pyrosequencing, representing 27 OTUs. Contaminant concentration was the major influence on AMF community structure, with different AMF families dominating at each contaminant level. The most abundant operational taxonomic unit in each sample represented a large proportion of the total community, and this proportion was positively associated with increasing contamination, and seemingly, by planting as well. The most contaminated soils were dominated by three phylotypes closely related to Rhizophagus irregularis, while these OTUs represented only a small proportion of sequences in uncontaminated and moderately contaminated soils. These results suggest that in situ inoculation of AMF strains could be an important component of phytoremediation treatments, but that strains should be selected from the narrow group that is both adapted to contaminant toxicity and able to compete with indigenous AMF species.

  8. Contrasting the community structure of arbuscular mycorrhizal fungi from hydrocarbon-contaminated and uncontaminated soils following willow (Salix spp. L.) planting.

    Science.gov (United States)

    Hassan, Saad El-Din; Bell, Terrence H; Stefani, Franck O P; Denis, David; Hijri, Mohamed; St-Arnaud, Marc

    2014-01-01

    Phytoremediation is a potentially inexpensive alternative to chemical treatment of hydrocarbon-contaminated soils, but its success depends heavily on identifying factors that govern the success of root-associated microorganisms involved in hydrocarbon degradation and plant growth stimulation. Arbuscular mycorrhizal fungi (AMF) form symbioses with many terrestrial plants, and are known to stimulate plant growth, although both species identity and the environment influence this relationship. Although AMF are suspected to play a role in plant adaptation to hydrocarbon contamination, their distribution in hydrocarbon-contaminated soils is not well known. In this study, we examined how AMF communities were structured within the rhizosphere of 11 introduced willow cultivars as well as unplanted controls across uncontaminated and hydrocarbon-contaminated soils at the site of a former petrochemical plant. We obtained 69 282 AMF-specific 18S rDNA sequences using 454-pyrosequencing, representing 27 OTUs. Contaminant concentration was the major influence on AMF community structure, with different AMF families dominating at each contaminant level. The most abundant operational taxonomic unit in each sample represented a large proportion of the total community, and this proportion was positively associated with increasing contamination, and seemingly, by planting as well. The most contaminated soils were dominated by three phylotypes closely related to Rhizophagus irregularis, while these OTUs represented only a small proportion of sequences in uncontaminated and moderately contaminated soils. These results suggest that in situ inoculation of AMF strains could be an important component of phytoremediation treatments, but that strains should be selected from the narrow group that is both adapted to contaminant toxicity and able to compete with indigenous AMF species.

  9. Application of Fenton's reagent as a pretreatment step in biological degradation of polyaromatic hydrocarbons

    International Nuclear Information System (INIS)

    Kelley, R.L.; Gauger, W.K.; Srivastava, V.J.

    1991-01-01

    Fenton's reagent (H 2 O 2 and Fe ++ ) has been used for chemical oxidation of numerous organic compounds in water treatment schemes. In this study, the Institute of Gas Technology (IGT) applied Fenton's treatment to polynuclear aromatic hydrocarbons (PAHs) and PAH-contaminated soils. Fenton's treatment was very reactive with PAHs, causing rapid modification of the parental compounds to oxidized products and complete degradation to CO 2 . This treatment was more effective on chemically reactive PAHs, such as benzo(a)pyrene and phenanthrene. Important parameters and conditions for Fenton's treatment of PAHs in solution and soil matrices have been identified. As much as 99% of the PAHs on soil matrices can be removed by treatment with Fenton's reagent

  10. Method of removing deterioration product in hydrocarbon type solvent

    International Nuclear Information System (INIS)

    Ito, Yoshifumi; Takashina, Toru; Murasawa, Kenji.

    1988-01-01

    Purpose: To remarkably reduce radioactive wastes by bringing adsorbents comprising titanium oxide and/or zirconium oxide into contact with hydrocarbon type solvents. Method: In a nuclear fuel re-processing step, an appropriate processing is applied to extraction solvents suffering from radioactive degradation, to separate the hydrocarbon solvents and store them in a solvent tank. Then, titanium oxide and/or zirconium oxide adsorbents are continuously mixed and agitated therewith to adsorb degradation products on the adsorbents. Then, they are introduced with adsorbent separators to recover purified hydrocarbon type solvents. Meanwhile, the separated adsorbents are discharged from pipeways. This enables to regenerate the hydrocarbon type solvents for reuse, as well as remarkably reduce the radioactive wastes. (Takahashi, M.)

  11. Biosurfactant and Degradative Enzymes Mediated Crude Oil Degradation by Bacterium Bacillus subtilis A1

    Science.gov (United States)

    Parthipan, Punniyakotti; Preetham, Elumalai; Machuca, Laura L.; Rahman, Pattanathu K. S. M.; Murugan, Kadarkarai; Rajasekar, Aruliah

    2017-01-01

    In this work, the biodegradation of the crude oil by the potential biosurfactant producing Bacillus subtilis A1 was investigated. The isolate had the ability to synthesize degradative enzymes such as alkane hydroxylase and alcohol dehydrogenase at the time of biodegradation of hydrocarbon. The biosurfactant producing conditions were optimized as pH 7.0, temperature 40°C, 2% sucrose and 3% of yeast extract as best carbon and nitrogen sources for maximum production of biosurfactant (4.85 g l-1). Specifically, the low molecular weight compounds, i.e., C10–C14 were completely degraded, while C15–C19 were degraded up to 97% from the total hydrocarbon pools. Overall crude oil degradation efficiency of the strain A1 was about 87% within a short period of time (7 days). The accumulated biosurfactant from the biodegradation medium was characterized to be lipopeptide in nature. The strain A1 was found to be more robust than other reported biosurfactant producing bacteria in degradation efficiency of crude oil due to their enzyme production capability and therefore can be used to remove the hydrocarbon pollutants from contaminated environment. PMID:28232826

  12. Predictable bacterial composition and hydrocarbon degradation in Arctic soils following diesel and nutrient disturbance

    Science.gov (United States)

    Bell, Terrence H; Yergeau, Etienne; Maynard, Christine; Juck, David; Whyte, Lyle G; Greer, Charles W

    2013-01-01

    Increased exploration and exploitation of resources in the Arctic is leading to a higher risk of petroleum contamination. A number of Arctic microorganisms can use petroleum for growth-supporting carbon and energy, but traditional approaches for stimulating these microorganisms (for example, nutrient addition) have varied in effectiveness between sites. Consistent environmental controls on microbial community response to disturbance from petroleum contaminants and nutrient amendments across Arctic soils have not been identified, nor is it known whether specific taxa are universally associated with efficient bioremediation. In this study, we contaminated 18 Arctic soils with diesel and treated subsamples of each with monoammonium phosphate (MAP), which has successfully stimulated degradation in some contaminated Arctic soils. Bacterial community composition of uncontaminated, diesel-contaminated and diesel+MAP soils was assessed through multiplexed 16S (ribosomal RNA) rRNA gene sequencing on an Ion Torrent Personal Genome Machine, while hydrocarbon degradation was measured by gas chromatography analysis. Diversity of 16S rRNA gene sequences was reduced by diesel, and more so by the combination of diesel and MAP. Actinobacteria dominated uncontaminated soils with soils, and this pattern was exaggerated following disturbance. Degradation with and without MAP was predictable by initial bacterial diversity and the abundance of specific assemblages of Betaproteobacteria, respectively. High Betaproteobacteria abundance was positively correlated with high diesel degradation in MAP-treated soils, suggesting this may be an important group to stimulate. The predictability with which bacterial communities respond to these disturbances suggests that costly and time-consuming contaminated site assessments may not be necessary in the future. PMID:23389106

  13. Predictable bacterial composition and hydrocarbon degradation in Arctic soils following diesel and nutrient disturbance.

    Science.gov (United States)

    Bell, Terrence H; Yergeau, Etienne; Maynard, Christine; Juck, David; Whyte, Lyle G; Greer, Charles W

    2013-06-01

    Increased exploration and exploitation of resources in the Arctic is leading to a higher risk of petroleum contamination. A number of Arctic microorganisms can use petroleum for growth-supporting carbon and energy, but traditional approaches for stimulating these microorganisms (for example, nutrient addition) have varied in effectiveness between sites. Consistent environmental controls on microbial community response to disturbance from petroleum contaminants and nutrient amendments across Arctic soils have not been identified, nor is it known whether specific taxa are universally associated with efficient bioremediation. In this study, we contaminated 18 Arctic soils with diesel and treated subsamples of each with monoammonium phosphate (MAP), which has successfully stimulated degradation in some contaminated Arctic soils. Bacterial community composition of uncontaminated, diesel-contaminated and diesel+MAP soils was assessed through multiplexed 16S (ribosomal RNA) rRNA gene sequencing on an Ion Torrent Personal Genome Machine, while hydrocarbon degradation was measured by gas chromatography analysis. Diversity of 16S rRNA gene sequences was reduced by diesel, and more so by the combination of diesel and MAP. Actinobacteria dominated uncontaminated soils with diesel degradation in MAP-treated soils, suggesting this may be an important group to stimulate. The predictability with which bacterial communities respond to these disturbances suggests that costly and time-consuming contaminated site assessments may not be necessary in the future.

  14. Draft Genome Sequence of the Hydrocarbon-Degrading Bacterium Alcanivorax dieselolei KS-293 Isolated from Surface Seawater in the Eastern Mediterranean Sea

    KAUST Repository

    Barbato, Marta

    2015-12-10

    We report here the draft genome sequence of Alcanivorax dieselolei KS-293, a hydrocarbonoclastic bacterium isolated from the Mediterranean Sea, by supplying diesel oil as the sole carbon source. This strain contains multiple putative genes associated with hydrocarbon degradation pathways and that are highly similar to those described in A. dieselolei type strain B5.

  15. Draft Genome Sequence of the Hydrocarbon-Degrading Bacterium Alcanivorax dieselolei KS-293 Isolated from Surface Seawater in the Eastern Mediterranean Sea

    KAUST Repository

    Barbato, Marta; Mapelli, Francesca; Chouaia, Bessem; Crotti, Elena; Daffonchio, Daniele; Borin, Sara

    2015-01-01

    We report here the draft genome sequence of Alcanivorax dieselolei KS-293, a hydrocarbonoclastic bacterium isolated from the Mediterranean Sea, by supplying diesel oil as the sole carbon source. This strain contains multiple putative genes associated with hydrocarbon degradation pathways and that are highly similar to those described in A. dieselolei type strain B5.

  16. Remediation of saline soils contaminated with crude oil using the halophyte Salicornia persica in conjunction with hydrocarbon-degrading bacteria.

    Science.gov (United States)

    Ebadi, Ali; Khoshkholgh Sima, Nayer Azam; Olamaee, Mohsen; Hashemi, Maryam; Ghorbani Nasrabadi, Reza

    2018-05-08

    The negative impact of salinity on plant growth and the survival of rhizosphere biota complicates the application of bioremediation to crude oil-contaminated saline soils. Here, a comparison was made between the remedial effect of treating the soil with Pseudomonas aeruginosa, a salinity tolerant hydrocarbon-degrading consortium in conjunction with either the halophyte Salicornia persica or the non-halophyte Festuca arundinacea. The effect of the various treatments on salinized soils was measured by assessing the extent of total petroleum hydrocarbon (TPH) degradation, the soil's dehydrogenase activity, the abundance of the bacteria and the level of phytotoxicity as measured by a bioassay. When a non-salinized soil was assessed after a treatment period of 120 days, the ranking for effectiveness with respect to TPH removal was F. arundinacea > P. aeruginosa > S. persica > no treatment control, while in the presence of salinity, the ranking changed to S. persica > P. aeruginosa > F. arundinacea > no treatment control. Combining the planting of S. persica or F. arundinacea with P. aeruginosa inoculation ("bioaugmentation") boosted the degradation of TPH up to 5-17%. Analyses of the residual oil contamination revealed that long chain alkanes (above C20) were particularly strongly degraded following the bioaugmentation treatments. The induced increase in dehydrogenase activity and the abundance of the bacteria (3.5 and 10 fold respectively) achieved in the bioaugmentation/S. persica treatment resulted in 46-76% reduction in soil phytotoxicity in a saline soil. The indication was that bioaugmentation of halophyte can help to mitigate the adverse effects on the effectiveness of bioremediation in a crude oil-contaminated saline soil. Copyright © 2018 Elsevier Ltd. All rights reserved.

  17. Characterization of Petroleum Hydrocarbon Decomposing Fungi Isolated from Mangrove Rhizosphere

    Directory of Open Access Journals (Sweden)

    Nuni Gofar

    2011-01-01

    Full Text Available The research was done to obtain the isolates of soil borne fungi isolated from mangrove rhizosphere which were capable of degrading petroleum hydrocarbon compounds. The soil samples were collected from South Sumatra mangrove forest which was contaminated by petroleum. The isolates obtained were selected based on their ability to survive, to grow and to degrade polycyclic aromatic hydrocarbons in medium containing petroleum residue. There were 3 isolates of soil borne hydrocarbonoclastic fungi which were able to degrade petroleum in vitro. The 3 isolates were identified as Aspergillus fumigates, A. parasiticus, and Chrysonilia sitophila. C. sitophila was the best isolate to decrease total petroleum hydrocarbon (TPH from medium containing 5-20% petroleum residue.

  18. Reduction of petroleum hydrocarbons and toxicity in refinery wastewater by bioremediation.

    Science.gov (United States)

    Płaza, Grazyna A; Jangid, Kamlesh; Lukasik, Krystyna; Nałecz-Jawecki, Grzegorz; Berry, Christopher J; Brigmon, Robin L

    2008-10-01

    The aim of the study was to investigate petroleum waste remediation and toxicity reduction by five bacterial strains: Ralstonia picketti SRS (BP-20), Alcaligenes piechaudii SRS (CZOR L-1B), Bacillus subtilis (I'-1a), Bacillus sp. (T-1), and Bacillus sp. (T'-1), previously isolated from petroleum-contaminated soils. Petroleum hydrocarbons were significantly degraded (91%) by the mixed bacterial cultures in 30 days (reaching up to 29% in the first 72 h). Similarly, the toxicity of the biodegraded petroleum waste decreased 3-fold after 30 days. This work shows the influence of bacteria on hydrocarbon degradation and associated toxicity, and its dependence on the specific microorganisms present. The ability of these mixed cultures to degrade hydrocarbons and reduce toxicity makes them candidates for environmental restoration applications at other hydrocarbon-contaminated environments.

  19. Microbial diversity in methanogenic hydrocarbon-degrading enrichment cultures isolated from a water-flooded oil reservoir (Dagang oil field, China)

    Science.gov (United States)

    Jiménez, Núria; Cai, Minmin; Straaten, Nontje; Yao, Jun; Richnow, Hans H.; Krüger, Martin

    2015-04-01

    Microbial transformation of oil to methane is one of the main degradation processes taking place in oil reservoirs, and it has important consequences as it negatively affects the quality and economic value of the oil. Nevertheless, methane could constitute a recovery method of carbon from exhausted reservoirs. Previous studies combining geochemical and isotopic analysis with molecular methods showed evidence for in situ methanogenic oil degradation in the Dagang oil field, China (Jiménez et al., 2012). However, the main key microbial players and the underlying mechanisms are still relatively unknown. In order to better characterize these processes and identify the main microorganisms involved, laboratory biodegradation experiments under methanogenic conditions were performed. Microcosms were inoculated with production and injection waters from the reservoir, and oil or 13C-labelled single hydrocarbons (e.g. n-hexadecane or 2-methylnaphthalene) were added as sole substrates. Indigenous microbiota were able to extensively degrade oil within months, depleting most of the n-alkanes in 200 days, and producing methane at a rate of 76 ± 6 µmol day-1 g-1 oil added. They could also produce heavy methane from 13C-labeled 2-methylnaphthalene, suggesting that further methanogenesis may occur from the aromatic and polyaromatic fractions of Dagang reservoir fluids. Microbial communities from oil and 2-methyl-naphthalene enrichment cultures were slightly different. Although, in both cases Deltaproteobacteria, mainly belonging to Syntrophobacterales (e.g. Syntrophobacter, Smithella or Syntrophus) and Clostridia, mostly Clostridiales, were among the most represented taxa, Gammaproteobacteria could be only identified in oil-degrading cultures. The proportion of Chloroflexi, exclusively belonging to Anaerolineales (e.g. Leptolinea, Bellilinea) was considerably higher in 2-methyl-naphthalene degrading cultures. Archaeal communities consisted almost exclusively of representatives of

  20. Degradation kinetics of chlorinated aliphatic hydrocarbons by methane oxidizers naturally-associated with wetland plant roots

    Science.gov (United States)

    Powell, C. L.; Goltz, M. N.; Agrawal, A.

    2014-12-01

    Chlorinated aliphatic hydrocarbons (CAHs) are common groundwater contaminants that can be removed from the environment by natural attenuation processes. CAH biodegradation can occur in wetland environments by reductive dechlorination as well as oxidation pathways. In particular, CAH oxidation may occur in vegetated wetlands, by microorganisms that are naturally associated with the roots of wetland plants. The main objective of this study was to evaluate the cometabolic degradation kinetics of the CAHs, cis-1,2-dichloroethene (cisDCE), trichloroethene (TCE), and 1,1,1-trichloroethane (1,1,1TCA), by methane-oxidizing bacteria associated with the roots of a typical wetland plant in soil-free system. Laboratory microcosms with washed live roots investigated aerobic, cometabolic degradation of CAHs by the root-associated methane-oxidizing bacteria at initial aqueous [CH4] ~ 1.9 mg L- 1, and initial aqueous [CAH] ~ 150 μg L- 1; cisDCE and TCE (in the presence of 1,1,1TCA) degraded significantly, with a removal efficiency of approximately 90% and 46%, respectively. 1,1,1TCA degradation was not observed in the presence of active methane oxidizers. The pseudo first-order degradation rate-constants of TCE and cisDCE were 0.12 ± 0.01 and 0.59 ± 0.07 d- 1, respectively, which are comparable to published values. However, their biomass-normalized degradation rate constants obtained in this study were significantly smaller than pure-culture studies, yet they were comparable to values reported for biofilm systems. The study suggests that CAH removal in wetland plant roots may be comparable to processes within biofilms. This has led us to speculate that the active biomass may be on the root surface as a biofilm. The cisDCE and TCE mass losses due to methane oxidizers in this study offer insight into the role of shallow, vegetated wetlands as an environmental sink for such xenobiotic compounds.

  1. Enhanced hydrocarbon biodegradation by a newly isolated bacillus subtilis strain

    International Nuclear Information System (INIS)

    Christova, N.; Tuleva, B.; Nikolova-Damyanova, B.

    2004-01-01

    The relation between hydrocarbon degradation and biosurfactant (rhamnolipid) production by a new bacillus subtilis 22BN strain was investigated. The strain was isolated for its capacity to utilize n-hexadecane and naphthalene and at the same time to produce surface-active compound at high concentrations (1.5 - 2.0 g l -1 ). Biosurfactant production was detected by surface tension lowering and emulsifying activity. The strain is a good degrader of both hydrocarbons used with degradability of 98.3 ± 1% and 75 ± 2% for n-hexadecane and naphthalene, respectively. Measurement of cell hydrophobicity showed that the combination of slightly soluble substrate and rhamnolipid developed higher hydrophobicity correlated with increased utilization of both hydrocarbon substrates. To our knowledge, this is the first report of bacillus subtilis strain that degrades hydrophobic compounds and at the same time produces rhamnolipid biosurfactant. (orig.)

  2. Degradation of polycyclic aromatic hydrocarbons by microbial consortia enriched from three soils using two different culture media

    International Nuclear Information System (INIS)

    Wu, Manli; Chen, Liming; Tian, Yongqiang; Ding, Yi; Dick, Warren A.

    2013-01-01

    A consortium composed of many different bacterial species is required to efficiently degrade polycyclic aromatic hydrocarbons (PAH) in oil-contaminated soil. We obtained six PAH-degrading microbial consortia from three oil-contaminated soils using two different isolation culture media. Denaturing gradient gel electrophoresis (DGGE) and sequence analyses of amplified 16s rRNA genes confirmed the bacterial community was greatly affected by both the culture medium and the soil from which the consortia were enriched. Three bacterial consortia enriched using malt yeast extract (MYE) medium showed higher degradation rates of PAHs than consortia enriched using Luria broth (LB) medium. Consortia obtained from a soil and then added back to that same soil was more effective in degrading PAHs than adding, to the same soil, consortia isolated from other, unrelated soils. This suggests that inoculum used for bioremediation should be from the same, or very similar nearby soils, as the soil that is actually being bioremediated. -- Highlights: •Six PAH-degrading microbial consortia were isolated from three oil-contaminated soils. •The bacterial community by 16s rRNA genes was affected by culture media and source soil. •Inoculum should be from the same or similar soil as the soil being bioremediated. -- Bioremediation of oil-contaminated soils was most effective when using inoculum of microbial consortia from the same or similar soil as the soil being bioremediated

  3. Inhibition of hydrocarbon bioremediation by lead in a crude oil-contaminated soil

    Energy Technology Data Exchange (ETDEWEB)

    Al-Saleh, E.S.; Obuekwe, C. [Kuwait University (Kuwait). Department of Biological Sciences, Microbiology Program

    2005-07-01

    Analyses of soil samples revealed that the level of lead (total or bioavailable) was three-fold greater in crude oil contaminated than in uncontaminated Kuwaiti soils. Investigation of the possible inhibitory effect of lead on hydrocarbon degradation by the soil microbiota showed that the number of hydrocarbon-degrading bacteria decreased with increased levels of lead nitrate added to soil samples, whether oil polluted or not. At 1.0 mg lead nitrate g{sup -1} dry soil, the number of degraders of hexadecane, naphthalene and crude oil declined by 14%, 23% and 53%, respectively. In a similar manner, the degradation and mineralization of different hydrocarbons decreased with increased lead content in cultures, although the decreases were not significantly different (P>0.05). The dehydrogenase activities of soil samples containing hydrocarbons as substrates also declined with an increase in the lead content of soil samples. (author)

  4. Hydrocarbon Degradation in Caspian Sea Sediment Cores Subjected to Simulated Petroleum Seepage in a Newly Designed Sediment-Oil-Flow-Through System

    Directory of Open Access Journals (Sweden)

    Tina Treude

    2017-04-01

    Full Text Available The microbial community response to petroleum seepage was investigated in a whole round sediment core (16 cm length collected nearby natural hydrocarbon seepage structures in the Caspian Sea, using a newly developed Sediment-Oil-Flow-Through (SOFT system. Distinct redox zones established and migrated vertically in the core during the 190 days-long simulated petroleum seepage. Methanogenic petroleum degradation was indicated by an increase in methane concentration from 8 μM in an untreated core compared to 2300 μM in the lower sulfate-free zone of the SOFT core at the end of the experiment, accompanied by a respective decrease in the δ13C signal of methane from -33.7 to -49.5‰. The involvement of methanogens in petroleum degradation was further confirmed by methane production in enrichment cultures from SOFT sediment after the addition of hexadecane, methylnapthalene, toluene, and ethylbenzene. Petroleum degradation coupled to sulfate reduction was indicated by the increase of integrated sulfate reduction rates from 2.8 SO42-m-2 day-1 in untreated cores to 5.7 mmol SO42-m-2 day-1 in the SOFT core at the end of the experiment, accompanied by a respective accumulation of sulfide from 30 to 447 μM. Volatile hydrocarbons (C2–C6 n-alkanes passed through the methanogenic zone mostly unchanged and were depleted within the sulfate-reducing zone. The amount of heavier n-alkanes (C10–C38 decreased step-wise toward the top of the sediment core and a preferential degradation of shorter (C30 was seen during the seepage. This study illustrates, to the best of our knowledge, for the first time the development of methanogenic petroleum degradation and the succession of benthic microbial processes during petroleum passage in a whole round sediment core.

  5. Hydrocarbon Degradation in Caspian Sea Sediment Cores Subjected to Simulated Petroleum Seepage in a Newly Designed Sediment-Oil-Flow-Through System.

    Science.gov (United States)

    Mishra, Sonakshi; Wefers, Peggy; Schmidt, Mark; Knittel, Katrin; Krüger, Martin; Stagars, Marion H; Treude, Tina

    2017-01-01

    The microbial community response to petroleum seepage was investigated in a whole round sediment core (16 cm length) collected nearby natural hydrocarbon seepage structures in the Caspian Sea, using a newly developed Sediment-Oil-Flow-Through (SOFT) system. Distinct redox zones established and migrated vertically in the core during the 190 days-long simulated petroleum seepage. Methanogenic petroleum degradation was indicated by an increase in methane concentration from 8 μM in an untreated core compared to 2300 μM in the lower sulfate-free zone of the SOFT core at the end of the experiment, accompanied by a respective decrease in the δ 13 C signal of methane from -33.7 to -49.5‰. The involvement of methanogens in petroleum degradation was further confirmed by methane production in enrichment cultures from SOFT sediment after the addition of hexadecane, methylnapthalene, toluene, and ethylbenzene. Petroleum degradation coupled to sulfate reduction was indicated by the increase of integrated sulfate reduction rates from 2.8 SO 4 2- m -2 day -1 in untreated cores to 5.7 mmol SO 4 2- m -2 day -1 in the SOFT core at the end of the experiment, accompanied by a respective accumulation of sulfide from 30 to 447 μM. Volatile hydrocarbons (C2-C6 n -alkanes) passed through the methanogenic zone mostly unchanged and were depleted within the sulfate-reducing zone. The amount of heavier n -alkanes (C10-C38) decreased step-wise toward the top of the sediment core and a preferential degradation of shorter (C30) was seen during the seepage. This study illustrates, to the best of our knowledge, for the first time the development of methanogenic petroleum degradation and the succession of benthic microbial processes during petroleum passage in a whole round sediment core.

  6. Screening and Optimization of Bio surfactant Production by the Hydrocarbon-Degrading Bacteria

    International Nuclear Information System (INIS)

    Ainon Hamzah; Noramiza Sabturani; Shahidan Radiman

    2013-01-01

    Bio surfactants are amphiphilic compounds produced by microorganisms as secondary metabolite. The unique properties of bio surfactants make them possible to replace or to be added to synthetic surfactants which are mainly used in food, cosmetics and pharmaceutical industries and in environmental applications. In this study twenty hydrocarbon-degrading bacteria were screened for bio surfactant production. All of the bacterial isolates were grown in mineral salt medium (MSM) with addition of 1 % (v/v) Tapis crude oil as carbon source. The presence of bio surfactant was determined by the drop-collapse test, microplate analysis, oil spreading technique, emulsification index (%EI24) and surface tension measurement. Only one isolate, Pseudomonas aeruginosa UKMP14T, was found to be positive for all the qualitative tests and reducing the surface tension of the medium to 49.5 dynes/ with emulsification index of 25.29 %. This isolate produced bio surfactant optimally at pH 9.0 and incubation temperature of 37 degree Celsius. Furthermore, P. aeruginosa UKMP14T when grown in MSM with addition of 1 % (v/v) glycerol and 1.3 g/ L ammonium sulphate with C/N ratio 14:1 produced bio surfactant with percentage of surface tension reduction at 55 % or 30.6 dynes/ cm with %EI24 of 43 %. This percentage of surface tension reduction represents an increasing reduction in surface tension of medium by 39 % over the value before optimization. This study showed that P. aeruginosa UKMP14T has the ability to biodegrade hydrocarbon and concurrently produce bio surfactant. (author)

  7. Relating BTEX degradation to the biogeochemistry of an anaerobic aquifer

    International Nuclear Information System (INIS)

    Toze, S.G.; Power, T.R.; Davis, G.B.

    1995-01-01

    Trends in chemical and microbiological parameters in a petroleum hydrocarbon plume within anaerobic groundwater have been studied. Previously, microbial degradation of the hydrocarbon compounds had been substantiated by the use of deuterated hydrocarbons to determine natural (intrinsic) degradation rates within the contaminant plume. Here, sulfate concentration decreases, Eh decreases, and hydrogen sulfide and bicarbonate concentration increases are shown to be associated with the contaminant plume. These trends indicate microbial degradation of the benzene, toluene, ethylbenzene, and xylene (BTEX) compounds by sulfate-reducing bacteria. Stoichiometry indicates that other consortia of bacteria play a role in the degradation of the hydrocarbons. Total microbial cell numbers were higher within the plume than in the uncontaminated groundwater. There is, however, no direct correlation between total microbial cell numbers, and BTEX, sulfate, bicarbonate, and hydrogen sulfide concentrations within the plume

  8. Growth and biosurfactant synthesis by Nigerian hydrocarbon-degrading estuarine bacteria

    Directory of Open Access Journals (Sweden)

    Sunday A Adebusoye

    2008-12-01

    Full Text Available The ability of microorganisms to degrade petroleum hydrocarbons is important for finding an environmentally-friendly method to restoring contaminated environmental matrices. Screening of hydrocarbon-utilizing and biosurfactant-producing abilities of organisms from an estuarine ecosystem in Nigeria, Africa, resulted in the isolation of five microbial strains identified as Corynebacterium sp. DDv1, Flavobacterium sp. DDv2, Micrococcus roseus DDv3, Pseudomonas aeruginosa DDv4 and Saccharomyces cerevisae DDv5. These isolates grew readily on several hydrocarbons including hexadecane, dodecane, crude oil and petroleum fractions. Axenic cultures of the organisms utilized diesel oil (1.0 % v/v with generation times that ranged significantly (t-test, P La capacidad de los microorganismos para degradar hidrocarburos del petróleo es de gran importancia para hallar un método aceptable y ambientalmente amigable para la restauración de terrenos ambientalmente contaminados. Al investigar las capacidades de los organismos de un ecosistema de estuario que utilizan hidrocarburos y producen biosurfactantes, se produjo como resultado el aislamiento de cinco cepas microbianas identificadas como Corynebacterium sp. DDv1, Flavobacterium sp. DDv2, Micrococcus roseus DDv3, Pseudomonas aeruginosa y DDv4 Saccharomyces cerevisiae DDv5. Estas cepas crecieron fácilmente en varios hidrocarburos incluyendo hexadecanos, dodecanos, petróleo crudo y fracciones de petróleo. Los cultivos axénicos de organismos utilizaron diesel (1.0% v/v con períodos por generación con ámbitos significativos (t-test, P <0.05 de entre 3.25 y 3.88 días, con la consiguiente producción de bio-surfactantes. La cinética del crecimiento indica que la síntesis de bio-surfactante se produjo principalmente durante la fase de crecimiento exponencial, lo que sugiere que las moléculas bioactivas son metabolitos primarios. Las cepas DDv1 y DDv4 fueron evidentemente las más metab

  9. Influence of growth medium on cometabolic degradation of polycyclic aromatic hydrocarbons by Sphingomonas sp. strain PheB4

    Energy Technology Data Exchange (ETDEWEB)

    Zhong Yin; Wang Xiaowei [Sun Yat-Sen Univ., Guangzhou (China). State Key Lab. of Biocontrol; Futian-CityU Mangrove Research and Development Centre, Shenzhen (China). Futian National Nature Reserve; Luan Tiangang; Lan Chongyu [Sun Yat-Sen Univ., Guangzhou (China). State Key Lab. of Biocontrol; Tam, N.F.Y. [Futian-CityU Mangrove Research and Development Centre, Shenzhen (China). Futian National Nature Reserve; City Univ. of Hong Kong, Kowloon (China). Dept. of Biology and Chemistry

    2007-05-15

    The influence of growth medium on cometabolic degradation of polycyclic aromatic hydrocarbons (PAHs) was investigated when Sphingomonas sp. strain PheB4 isolated from surface mangrove sediments was grown in either phenanthrene-containing mineral salts medium (PMSM) or nutrient broth (NB). The NB-grown culture exhibited a more rapid cometabolic degradation of single and mixed non-growth substrate PAHs compared to the PMSM-grown culture. The concentrations of PAH metabolites were also lower in NB-grown culture than in PMSM-grown culture, suggesting that NB-grown culture removed metabolites at a faster rate, particularly, for metabolites produced from cometabolic degradation of a binary mixture of PAHs. Cometabolic pathways of single PAH (anthracene, fluorene, or fluoranthene) in NB-grown culture showed similarity to that in PMSM-grown culture. However, cometabolic pathways of mixed PAHs were more diverse in NB-grown culture than that in PMSM-grown culture. These results indicated that nutrient rich medium was effective in enhancing cometabolic degradation of mixed PAHs concomitant with a rapid removal of metabolites, which could be useful for the bioremediation of mixed PAHs contaminated sites using Sphingomonas sp. strain PheB4. (orig.)

  10. Petroleum-hydrocarbons biodegradation by Pseudomonas strains ...

    African Journals Online (AJOL)

    The capability of these isolates to degrade petroleum was performed by measuring the optical density, colony forming unit counts (CFU/ml) and concentration of total petroleum hydrocarbons (TPH). Degradation of Isomerate by these isolates was analyzed by gas chromatography with flame ionization detector (FID). Results ...

  11. Identification and Characterisation of Major Hydrocarbons in ...

    African Journals Online (AJOL)

    Identification and Characterisation of Major Hydrocarbons in Thermally Degraded Low Density Polyethylene Films. ... There were alkanes, alkenes, halogenated alkanes, and very few aromatics in the liquid product and, the hydrocarbons were observed to range between C10 - C27. The FTIR and GC-MS results show the ...

  12. Degradation of hydrocarbons in crude oil by the ascomycete Pseudallescheria boydii (Microascaceae)

    International Nuclear Information System (INIS)

    April, T. M.; Abbott, S. P.; Foght, J. M.; Currah, R. S.

    1998-01-01

    Four strains of Pseudallescheria boydii were isolated from oil-soaked soils in British Columbia and Alberta and compared with strains from cattle dung and raw sewage. Variations in morphology, colony appearance, colony diameter and temperature tolerance were found among the strains. Three of the strains isolated from oil-contaminated soils and the strain from sewage were tested for their ability to utilize hydrocarbons as the sole carbon source. Gas chromatographic analysis of the residual oil revealed that the strains isolated from the oil-contaminated soil degraded the linear aliphatics. The strain derived from sewage utilized volatile n-alkenes (ethane, propane, butane) but did not utilize the liquid saturate compounds. Since certain strains of Pseudallescheria boydii are known to be pathogenic, cautious handling of these fungi was recommended. However, under properly controlled conditions, selected non-pathogenic strains of the fungi may be used as an integral and effective part of intrinsic bioremediation processes. 39 refs., 3 tabs., 7 figs

  13. Degradation of some representative polycyclic aromatic hydrocarbons by the water-soluble protein extracts from Zea mays L. cv PR32-B10.

    Science.gov (United States)

    Barone, Roberto; de Biasi, Margherita-Gabriella; Piccialli, Vincenzo; de Napoli, Lorenzo; Oliviero, Giorgia; Borbone, Nicola; Piccialli, Gennaro

    2016-10-01

    The ability of the water-soluble protein extracts from Zea mais L. cv. PR32-B10 to degrade some representative polycyclic aromatic hydrocarbons (PAHs), has been evaluated. Surface sterilized seeds of corn (Zea mais L. Pioneer cv. PR32-B10) were hydroponically cultivated in a growth chamber under no-stressful conditions. The water-soluble protein extracts isolated from maize tissues showed peroxidase, polyphenol oxidase and catalase activities. Incubation of the extracts with naphthalene, fluorene, phenanthrene and pyrene, led to formation of oxidized and/or degradation products. GC-MS and TLC monitoring of the processes showed that naphthalene, phenanthrene, fluorene and pyrene underwent 100%, 78%, 92% and 65% oxidative degradation, respectively, after 120 min. The chemical structure of the degradation products were determined by (1)H NMR and ESI-MS spectrometry. Copyright © 2016 Elsevier Ltd. All rights reserved.

  14. Occurrence and growth potentials of hydrocarbon degrading ...

    African Journals Online (AJOL)

    The surface of leaf samples from ten tropical plants, Anthocleista, Sarcophrynium, Canna, Colocassia, Musa, Cola, Citrus, Mangifera, Terminalia and Annona were cultured for the estimation of total heterotrophic and hydrocarbon utilizing bacteria. The total heterotrophic bacteria ranged from 0.75 x 107 to 0.98 x 107 ...

  15. [Influence of Mirabilis jalapa Linn. Growth on the Microbial Community and Petroleum Hydrocarbon Degradation in Petroleum Contaminated Saline-alkali Soil].

    Science.gov (United States)

    Jiao, Hai-hua; Cui, Bing-jian; Wu, Shang-hua; Bai, Zhi-hui; Huang, Zhan-bin

    2015-09-01

    In order to explore the effect of Mirabilis jalapa Linn. growth on the structure characteristics of the microbial community and the degradation of petroleum hydrocarbon (TPH) in the petroleum-contaminated saline-alkali soil, Microbial biomass and species in the rhizosphere soils of Mirabilis jalapa Linn. in the contaminated saline soil were studied with the technology of phospholipid fatty acids (PLFAs) analysis. The results showed that comparing to CK soils without Mirabilis jalapa Linn., the ratio of PLFAs species varied were 71. 4%, 69. 2% and 33. 3% in the spring, summer and autumn season, respectively. In addition, there was distinct difference of the biomasses of the microbial community between the CK and rhizosphere soils and among the difference seasons of growth of Mirabilis jalapa Linn.. Compare to CK soil, the degradation rates of total petroleum hydrocarbon (TPH) was increased by 47. 6%, 28. 3%, and 18. 9% in spring, summer, and autumn rhizosphere soils, respectively. Correlation analysis was used to determine the correlation between TPH degradation and the soil microbial community. 77. 8% of the total soil microbial PLFAs species showed positive correlation to the TPH degradation (the correlation coefficient r > 0), among which, 55. 6% of PLFAs species showed high positive correlation(the correlation coefficient was r≥0. 8). In addition, the relative content of SAT and MONO had high correlation with TPH degradation in the CK sample soils, the corelation coefficient were 0. 92 and 0. 60 respectively; However, the percent of positive correlation was 42. 1% in the rhizosphere soils with 21. 1% of them had high positive correlation. The relative content of TBSAT, MONO and CYCLO had moderate or low correlation in rhizosphere soils, and the correlation coefficient were 0. 56, 0. 50, and 0. 07 respectively. Our study showed that the growth of mirabilis Mirabilis jalapa Linn. had a higher influence on the species and biomass of microbial community in the

  16. Method of degrading pollutants in soil

    Science.gov (United States)

    Hazen, Terry C.; Lopez-De-Victoria, Geralyne

    1994-01-01

    A method and system for enhancing the motility of microorganisms by placing an effective amount of chlorinated hydrocarbons, preferably chlorinated alkenes, and most preferably trichloroethylene in spaced relation to the microbes so that the surprisingly strong, monomodal, chemotactic response of the chlorinated hydrocarbon on subsurface microbes can draw the microbes away from or towards and into a substance, as desired. In remediation of groundwater pollution, for example, TCE can be injected into the plume to increase the population of microbes at the plume whereby the plume can be more quickly degraded. A TCE-degrading microbe, such as Welchia alkenophilia, can be used to degrade the TCE following the degradation of the original pollutant.

  17. Sand amendment enhances bioelectrochemical remediation of petroleum hydrocarbon contaminated soil.

    Science.gov (United States)

    Li, Xiaojing; Wang, Xin; Ren, Zhiyong Jason; Zhang, Yueyong; Li, Nan; Zhou, Qixing

    2015-12-01

    Bioelectrochemical system is an emerging technology for the remediation of soils contaminated by petroleum hydrocarbons. However, performance of such systems can be limited by the inefficient mass transport in soil. Here we report a new method of sand amendment, which significantly increases both oxygen and proton transports, resulting to increased soil porosity (from 44.5% to 51.3%), decreased Ohmic resistance (by 46%), and increased charge output (from 2.5 to 3.5Cg(-1)soil). The degradation rates of petroleum hydrocarbons increased by up to 268% in 135d. The degradation of n-alkanes and polycyclic aromatic hydrocarbons with high molecular weight was accelerated, and denaturing gradient gel electrophoresis showed that the microbial community close to the air-cathode was substantially stimulated by the induced current, especially the hydrocarbon degrading bacteria Alcanivorax. The bioelectrochemical stimulation imposed a selective pressure on the microbial community of anodes, including that far from the cathode. These results suggested that sand amendment can be an effective approach for soil conditioning that will enhances the bioelectrochemical removal of hydrocarbons in contaminated soils. Copyright © 2015 Elsevier Ltd. All rights reserved.

  18. Deep Sequencing of Myxilla (Ectyomyxilla) methanophila, an Epibiotic Sponge on Cold-Seep Tubeworms, Reveals Methylotrophic, Thiotrophic, and Putative Hydrocarbon-Degrading Microbial Associations

    KAUST Repository

    Arellano, Shawn M.

    2012-10-11

    The encrusting sponge Myxilla (Ectyomyxilla) methanophila (Poecilosclerida: Myxillidae) is an epibiont on vestimentiferan tubeworms at hydrocarbon seeps on the upper Louisiana slope of the Gulf of Mexico. It has long been suggested that this sponge harbors methylotrophic bacteria due to its low δ13C value and high methanol dehydrogenase activity, yet the full community of microbial associations in M. methanophila remained uncharacterized. In this study, we sequenced 16S rRNA genes representing the microbial community in M. methanophila collected from two hydrocarbon-seep sites (GC234 and Bush Hill) using both Sanger sequencing and next-generation 454 pyrosequencing technologies. Additionally, we compared the microbial community in M. methanophila to that of the biofilm collected from the associated tubeworm. Our results revealed that the microbial diversity in the sponges from both sites was low but the community structure was largely similar, showing a high proportion of methylotrophic bacteria of the genus Methylohalomonas and polycyclic aromatic hydrocarbon (PAH)-degrading bacteria of the genera Cycloclasticus and Neptunomonas. Furthermore, the sponge microbial clone library revealed the dominance of thioautotrophic gammaproteobacterial symbionts in M. methanophila. In contrast, the biofilm communities on the tubeworms were more diverse and dominated by the chemoorganotrophic Moritella at GC234 and methylotrophic Methylomonas and Methylohalomonas at Bush Hill. Overall, our study provides evidence to support previous suggestion that M. methanophila harbors methylotrophic symbionts and also reveals the association of PAH-degrading and thioautotrophic microbes in the sponge. © 2012 Springer Science+Business Media New York.

  19. Deep sequencing of Myxilla (Ectyomyxilla) methanophila, an epibiotic sponge on cold-seep tubeworms, reveals methylotrophic, thiotrophic, and putative hydrocarbon-degrading microbial associations.

    Science.gov (United States)

    Arellano, Shawn M; Lee, On On; Lafi, Feras F; Yang, Jiangke; Wang, Yong; Young, Craig M; Qian, Pei-Yuan

    2013-02-01

    The encrusting sponge Myxilla (Ectyomyxilla) methanophila (Poecilosclerida: Myxillidae) is an epibiont on vestimentiferan tubeworms at hydrocarbon seeps on the upper Louisiana slope of the Gulf of Mexico. It has long been suggested that this sponge harbors methylotrophic bacteria due to its low δ(13)C value and high methanol dehydrogenase activity, yet the full community of microbial associations in M. methanophila remained uncharacterized. In this study, we sequenced 16S rRNA genes representing the microbial community in M. methanophila collected from two hydrocarbon-seep sites (GC234 and Bush Hill) using both Sanger sequencing and next-generation 454 pyrosequencing technologies. Additionally, we compared the microbial community in M. methanophila to that of the biofilm collected from the associated tubeworm. Our results revealed that the microbial diversity in the sponges from both sites was low but the community structure was largely similar, showing a high proportion of methylotrophic bacteria of the genus Methylohalomonas and polycyclic aromatic hydrocarbon (PAH)-degrading bacteria of the genera Cycloclasticus and Neptunomonas. Furthermore, the sponge microbial clone library revealed the dominance of thioautotrophic gammaproteobacterial symbionts in M. methanophila. In contrast, the biofilm communities on the tubeworms were more diverse and dominated by the chemoorganotrophic Moritella at GC234 and methylotrophic Methylomonas and Methylohalomonas at Bush Hill. Overall, our study provides evidence to support previous suggestion that M. methanophila harbors methylotrophic symbionts and also reveals the association of PAH-degrading and thioautotrophic microbes in the sponge.

  20. Evaluating robustness of a diesel-degrading bacterial consortium isolated from contaminated soil

    DEFF Research Database (Denmark)

    Sydow, Mateusz; Owsianiak, Mikolaj; Szczepaniak, Zuzanna

    2016-01-01

    It is not known whether diesel-degrading bacterial communities are structurally and functionally robust when exposed to different hydrocarbon types. Here, we exposed a diesel-degrading consortium to model either alkanes, cycloalkanes or aromatic hydrocarbons as carbon sources to study its...... structural resistance. The structural resistance was low, with changes in relative abundances of up to four orders of magnitude, depending on hydrocarbon type and bacterial taxon. This low resistance is explained by the presence of hydrocarbon-degrading specialists in the consortium and differences in growth...... kinetics on individual hydrocarbons. However, despite this low resistance, structural and functional resilience were high, as verified by re-exposing the hydrocarbon-perturbed consortium to diesel fuel. The high resilience is either due to the short exposure time, insufficient for permanent changes...

  1. Polycyclovorans algicola gen. nov., sp. nov., an aromatic-hydrocarbon-degrading marine bacterium found associated with laboratory cultures of marine phytoplankton.

    Science.gov (United States)

    Gutierrez, Tony; Green, David H; Nichols, Peter D; Whitman, William B; Semple, Kirk T; Aitken, Michael D

    2013-01-01

    A strictly aerobic, halotolerant, rod-shaped bacterium, designated strain TG408, was isolated from a laboratory culture of the marine diatom Skeletonema costatum (CCAP1077/1C) by enrichment with polycyclic aromatic hydrocarbons (PAHs) as the sole carbon source. 16S rRNA gene sequence analysis placed this organism within the order Xanthomonadales of the class Gammaproteobacteria. Its closest relatives included representatives of the Hydrocarboniphaga-Nevskia-Sinobacter clade (compounds and small organic acids. Notably, it displayed versatility in degrading two- and three-ring PAHs. Moreover, catechol 2,3-dioxygenase activity was detected in lysates, indicating that this strain utilizes the meta-cleavage pathway for aromatic compound degradation. Cells produced surface blebs and contained a single polar flagellum. The predominant isoprenoid quinone of strain TG408 was Q-8, and the dominant fatty acids were C(16:0), C(16:1) ω7c, and C(18:1) ω7c. The G+C content of the isolate's DNA was 64.3 mol% ± 0.34 mol%. On the basis of distinct phenotypic and genotypic characteristics, strain TG408 represents a novel genus and species in the class Gammaproteobacteria for which the name Polycyclovorans algicola gen. nov., sp. nov., is proposed. Quantitative PCR primers targeting the 16S rRNA gene of this strain were developed and used to show that this organism is found associated with other species of marine phytoplankton. Phytoplankton may be a natural biotope in the ocean where new species of hydrocarbon-degrading bacteria await discovery and which contribute significantly to natural remediation processes.

  2. The microbial degradation of polycyclic aromatic hydrocarbons in soils and sediments. Der mikrobielle Abbau polyzyklischer aromatischer Kohlenwasserstoffe (PAK) in Boeden und Sedimenten: Mineralisierung, Metabolitenbildung und Entstehung gebundener Rueckstaende

    Energy Technology Data Exchange (ETDEWEB)

    Mahro, B; Kaestner, M [Technische Univ. Hamburg-Harburg (Germany). Arbeitsbereich Biotechnologie 2

    1993-02-01

    The microbial degradation of polycylic aromatic hydrocarbons in soils and sediments: mineralization, metabolite excretion and the formation of bound residues microorganisms degrade polycyclic aromatic hydrocarbons (PAH) via three different metabolic pathways: mineralization, cometabolic oxidation or an unspecific triggering of radical reactions. As a result of these microbial transformation processes PAH may be converted to CO[sub 2] and biomass or partially oxidized metabolites. The possible fate of these presumed metabolites in the soil matrix is analyzed. It is pointed out that the formation of humus bound residues, stimulated by microbial exoenzyme activities, may contribute to significant extent to the disappearance of PAHs in soils and sediments. The relevance of this fact for the biological remediation of contaminated soils is discussed. (orig.).

  3. Isolation of four hydrocarbon effluent-degrading Bacillaceae species ...

    African Journals Online (AJOL)

    percentage decreases in total hydrocarbon concentration within 18 days: 98% with Bacillus licheniformis STK08, 87% with Geobacillus stearothermophilus STM04, 80% with Lysinibacillus sphaericus STZ75 and 72% with Bacillus firmus STS84.

  4. Method of degrading pollutants in soil

    Science.gov (United States)

    Hazen, T.C.; Lopez-De-Victoria, G.

    1994-07-05

    Disclosed are a method and system for enhancing the motility of microorganisms. This is accomplished by placing an effective amount of chlorinated hydrocarbons, preferably chlorinated alkenes, and most preferably trichloroethylene in spaced relation to the microbes so that the surprisingly strong, monomodal, chemotactic response of the chlorinated hydrocarbon on subsurface microbes can draw the microbes away from or towards and into a substance, as desired. In remediation of groundwater pollution, for example, TCE can be injected into the plume to increase the population of microbes at the plume whereby the plume can be more quickly degraded. A TCE-degrading microbe, such as Welchia alkenophilia, can be used to degrade the TCE following the degradation of the original pollutant. 5 figures.

  5. Soil bioremediation approaches for petroleum hydrocarbon polluted environments

    Directory of Open Access Journals (Sweden)

    Eman Koshlaf

    2017-01-01

    Full Text Available Increasing industrialisation, continued population growth and heavy demand and reliance on petrochemical products have led to unprecedented economic growth and development. However, inevitably this dependence on fossil fuels has resulted in serious environmental issues over recent decades. The eco-toxicity and the potential health implications that petroleum hydrocarbons pose for both environmental and human health have led to increased interest in developing environmental biotechnology-based methodologies to detoxify environments impacted by petrogenic compounds. Different approaches have been applied for remediating polluted sites with petroleum derivatives. Bioremediation represents an environmentally sustainable and economical emerging technology for maximizing the metabolism of organic pollutants and minimizing the ecological effects of oil spills. Bioremediation relies on microbial metabolic activities in the presence of optimal ecological factors and necessary nutrients to transform organic pollutants such as petrogenic hydrocarbons. Although, biodegradation often takes longer than traditional remediation methods, the complete degradation of the contaminant is often accomplished. Hydrocarbon biodegradation in soil is determined by a number of environmental and biological factors varying from site to site such as the pH of the soil, temperature, oxygen availability and nutrient content, the growth and survival of hydrocarbon-degrading microbes and bioavailability of pollutants to microbial attack. In this review we have attempted to broaden the perspectives of scientists working in bioremediation. We focus on the most common bioremediation technologies currently used for soil remediation and the mechanisms underlying the degradation of petrogenic hydrocarbons by microorganisms.

  6. Hydrocarbon Degradation Potentials of Bacteria Isolated from Spent ...

    African Journals Online (AJOL)

    ADOWIE PERE

    chemical nature of the compounds within the petroleum mixture and ... are toxic, mutagenic, and carcinogenic (Clemente et al., 2001). ... Hydrocarbon utilizing bacteria in the soil sample ... paper (Whatman No.1) saturated with sterile spent oil.

  7. Biogeographical distribution analysis of hydrocarbon degrading and biosurfactant producing genes suggests that near-equatorial biomes have higher abundance of genes with potential for bioremediation.

    Science.gov (United States)

    Oliveira, Jorge S; Araújo, Wydemberg J; Figueiredo, Ricardo M; Silva-Portela, Rita C B; de Brito Guerra, Alaine; da Silva Araújo, Sinara Carla; Minnicelli, Carolina; Carlos, Aline Cardoso; de Vasconcelos, Ana Tereza Ribeiro; Freitas, Ana Teresa; Agnez-Lima, Lucymara F

    2017-07-27

    Bacterial and Archaeal communities have a complex, symbiotic role in crude oil bioremediation. Their biosurfactants and degradation enzymes have been in the spotlight, mainly due to the awareness of ecosystem pollution caused by crude oil accidents and their use. Initially, the scientific community studied the role of individual microbial species by characterizing and optimizing their biosurfactant and oil degradation genes, studying their individual distribution. However, with the advances in genomics, in particular with the use of New-Generation-Sequencing and Metagenomics, it is now possible to have a macro view of the complex pathways related to the symbiotic degradation of hydrocarbons and surfactant production. It is now possible, although more challenging, to obtain the DNA information of an entire microbial community before automatically characterizing it. By characterizing and understanding the interconnected role of microorganisms and the role of degradation and biosurfactant genes in an ecosystem, it becomes possible to develop new biotechnological approaches for bioremediation use. This paper analyzes 46 different metagenome samples, spanning 20 biomes from different geographies obtained from different research projects. A metagenomics bioinformatics pipeline, focused on the biodegradation and biosurfactant-production pathways, genes and organisms, was applied. Our main results show that: (1) surfactation and degradation are correlated events, and therefore should be studied together; (2) terrestrial biomes present more degradation genes, especially cyclic compounds, and less surfactation genes, when compared to water biomes; and (3) latitude has a significant influence on the diversity of genes involved in biodegradation and biosurfactant production. This suggests that microbiomes found near the equator are richer in genes that have a role in these processes and thus have a higher biotechnological potential. In this work we have focused on the

  8. Tolerance of Antarctic soil fungi to hydrocarbons

    Energy Technology Data Exchange (ETDEWEB)

    Hughes, Kevin A.; Bridge, Paul; Clark, Melody S. [British Antarctic Survey, Natural Environment Research Council, High Cross, Madingley Road, Cambridge CB3 0ET (United Kingdom)

    2007-01-01

    Little is known about the effects of hydrocarbons and fuel oil on Antarctic filamentous fungi in the terrestrial Antarctic environment. Growth of fungi and bacteria from soils around Rothera Research Station (Adelaide Island, Antarctic Peninsula) was assessed in the presence of ten separate aromatic and aliphatic hydrocarbons [marine gas oil (MGO), dodecane, hexadecane, benzoic acid, p-hydroxybenzoic acid, toluene, phenol, biphenyl, naphthalene and m- and p-xylenes with ethylbenzene]. Aromatic hydrocarbons inhibited soil microbial growth more than aliphatic hydrocarbons. Soil microorganisms from a moss patch, where little previous impact or hydrocarbon contamination had occurred, were less tolerant of hydrocarbons than those from high impact sites. Fungal growth rates of Mollisia sp., Penicillium commune, Mortierella sp., Trichoderma koningii, Trichoderma sp. and Phoma herbarum were assessed in the presence of hydrocarbons. Generally, aromatic hydrocarbons inhibited or stopped hyphal extension, though growth rates increased with some aliphatic hydrocarbons. Hyphal dry weight measurements suggested that Mortierella sp. may be able to use dodecane as sole carbon and energy source. Hydrocarbon-degrading Antarctic fungi may have use in future hydrocarbon spill bioremediation. (author)

  9. Yield of maize (Manoma spp) affected by automobile oil waste and ...

    African Journals Online (AJOL)

    SAM

    2014-03-12

    Mar 12, 2014 ... waste polluted soils, and on the yield parameters (plant height, leave surface and dry matter weight) of maize (Manoma spp). ... 40 cm) were examined for chemical and physical properties, including poly aromatic hydrocarbons. Polluted soils were ... Particularly, bioremediation of oil polluted soils using ...

  10. Potential sources of hydrocarbons and their microbial degradation in sediments from the deep geothermal Lusi site, Indonesia

    Science.gov (United States)

    Krueger, Martin; Mazzini, Adriano; Scheeder, Georg; Blumenberg, Martin

    2017-04-01

    The Lusi eruption represents one of the largest ongoing sedimentary hosted geothermal systems, which started in 2006 following an earthquake on Java Island. Since then it has been continuously producing hot and hydrocarbon rich mud from a central crater with peaks reaching 180.000 m3 per day. Numerous investigations focused on the study of microbial communities which thrive at offshore methane and oil seeps and mud volcanoes, however very little has been done on onshore seeping structures. Lusi represents a unique opportunity to complete a comprehensive study of onshore microbial communities fed by the seepage of CH4 as well as of liquid hydrocarbons originating from one or more km below the surface. While the source of the methane at Lusi is unambiuous, the origin of the seeping oil is still discussed. Both, source and maturity estimates from biomarkers, are in favor of a type II/III organic matter source. Likely the oils were formed from the studied black shales (deeper Ngimbang Fm.) which contained a Type III component in the Type II predominated organic matter. In all samples large numbers of active microorganisms were present. Rates for aerobic methane oxidation were high, as was the potential of the microbial communities to degrade different hydrocarbons. The data suggests a transition of microbial populations from an anaerobic, hydrocarbon-driven metabolism in fresher samples from center or from small seeps to more generalistic, aerobic microbial communities in older, more consolidated sediments. Ongoing microbial activity in crater sediment samples under high temperatures (80-95C) indicate a deep origin of the involved microorganisms. First results of molecular analyses of the microbial community compositions confirm the above findings. This study represents an initial step to better understand onshore seepage systems and provides an ideal analogue for comparison with the better investigated offshore structures.

  11. Biosurfactant production from marine hydrocarbon-degrading consortia and pure bacterial strains using crude oil as carbon source.

    Science.gov (United States)

    Antoniou, Eleftheria; Fodelianakis, Stilianos; Korkakaki, Emmanouela; Kalogerakis, Nicolas

    2015-01-01

    Biosurfactants (BSs) are "green" amphiphilic molecules produced by microorganisms during biodegradation, increasing the bioavailability of organic pollutants. In this work, the BS production yield of marine hydrocarbon degraders isolated from Elefsina bay in Eastern Mediterranean Sea has been investigated. The drop collapse test was used as a preliminary screening test to confirm BS producing strains or mixed consortia. The community structure of the best consortia based on the drop collapse test was determined by 16S-rDNA pyrotag screening. Subsequently, the effect of incubation time, temperature, substrate and supplementation with inorganic nutrients, on BS production, was examined. Two types of BS - lipid mixtures were extracted from the culture broth; the low molecular weight BS Rhamnolipids and Sophorolipids. Crude extracts were purified by silica gel column chromatography and then identified by thin layer chromatography and Fourier transform infrared spectroscopy. Results indicate that BS production yield remains constant and low while it is independent of the total culture biomass, carbon source, and temperature. A constant BS concentration in a culture broth with continuous degradation of crude oil (CO) implies that the BS producing microbes generate no more than the required amount of BSs that enables biodegradation of the CO. Isolated pure strains were found to have higher specific production yields than the complex microbial marine community-consortia. The heavy oil fraction of CO has emerged as a promising substrate for BS production (by marine BS producers) with fewer impurities in the final product. Furthermore, a particular strain isolated from sediments, Paracoccus marcusii, may be an optimal choice for bioremediation purposes as its biomass remains trapped in the hydrocarbon phase, not suffering from potential dilution effects by sea currents.

  12. The Effect of Hydrostatic Pressure on Enrichments of Hydrocarbon Degrading Microbes From the Gulf of Mexico Following the Deepwater Horizon Oil Spill.

    Science.gov (United States)

    Marietou, Angeliki; Chastain, Roger; Beulig, Felix; Scoma, Alberto; Hazen, Terry C; Bartlett, Douglas H

    2018-01-01

    The Deepwater Horizon oil spill was one of the largest and deepest oil spills recorded. The wellhead was located at approximately 1500 m below the sea where low temperature and high pressure are key environmental characteristics. Using cells collected 4 months following the Deepwater Horizon oil spill at the Gulf of Mexico, we set up Macondo crude oil enrichments at wellhead temperature and different pressures to determine the effect of increasing depth/pressure to the in situ microbial community and their ability to degrade oil. We observed oil degradation under all pressure conditions tested [0.1, 15, and 30 megapascals (MPa)], although oil degradation profiles, cell numbers, and hydrocarbon degradation gene abundances indicated greatest activity at atmospheric pressure. Under all incubations the growth of psychrophilic bacteria was promoted. Bacteria closely related to Oleispira antarctica RB-8 dominated the communities at all pressures. At 30 MPa we observed a shift toward Photobacterium , a genus that includes piezophiles. Alphaproteobacterial members of the Sulfitobacter , previously associated with oil-degradation, were also highly abundant at 0.1 MPa. Our results suggest that pressure acts synergistically with low temperature to slow microbial growth and thus oil degradation in deep-sea environments.

  13. [Oil degradation by basidiomycetes in soil and peat at low temperatures].

    Science.gov (United States)

    Kulikova, N A; Klein, O I; Pivchenko, D V; Landesman, E O; Pozdnyakova, N N; Turkovskaya, O V; Zaichik, B Ts; Ruzhitskii, A O; Koroleva, O V

    2016-01-01

    A total of 17 basidiomycete strains causing white rot and growing on oil-contaminated substrates have been screened. Three strains with high (Steccherinum murashkinskyi), average (Trametes maxima), and low (Pleurotus ostreatus) capacities for the colonization of oil-contaminated substrates have been selected. The potential for degrading crude oil hydrocarbons has been assessed with the use of fungi grown on nonsterile soil and peat at low temperatures. Candida sp. and Rhodococcus sp. commercial strains have been used as reference organisms with oil-degrading ability. All microorganisms introduced in oil-contaminated soil have proved to be ineffective, whereas the inoculation of peat with basidiomycetes and oil-degrading microorganisms accelerated the destruction of oil hydrocarbons. The greatest degradation potential of oil-aliphatic hydrocarbons has been found in S. murashlinskyi. T. maxima turned out to be the most successful in degrading aromatic hydrocarbons. It has been suggested that aboriginal microflora contributes importantly to the effectiveness of oil-destructing microorganisms. T. maxima and S. murashkinskyi strains are promising for further study as oil-oxidizing agents during bioremediation of oil-contaminated peat soil under conditions of low temperatures.

  14. MICROORGANISMS’ SURFACE ACTIVE SUBSTANCES ROLE IN HYDROCARBONS BIODEGRADATION

    Directory of Open Access Journals (Sweden)

    Оlga Vasylchenko

    2012-09-01

    Full Text Available  Existing data and publications regarding oil, hydrocarbon biodegradation, metabolism, and bioremediation were analyzed. Search of hydrocarbon degrading bacteria which are producers of biosurfactants was provided, types of microbial surfactants and their physiological role were analyzed and ordered. The study of factors affecting the surface active properties of producers’ cultures was done.

  15. Degradation and mineralization of high-molecular-weight polycyclic aromatic hydrocarbons by defined fungal-bacterial cocultures

    International Nuclear Information System (INIS)

    Boonchan, S.; Britz, M.L.; Stanley, G.A.

    2000-01-01

    This study investigated the biodegradation of high-molecular-weight polycyclic aromatic hydrocarbons (PAHs) in liquid media and soil by bacteria (Stenotrophomonas maltophilia VUN 10,010 and bacterial consortium VUN 10,009) and a fungus (Penicillium janthinellum VUO 10,201) that were isolated from separate creosote- and manufactured-gas plant-contaminated soils. The bacteria could use pyrene as their sole carbon and energy source in a basal salts medium (BSM) and mineralized significant amounts of benzo[a]pyrene cometabolically when pyrene was also present in BSM. P. janthinellum VUO 10,201 could not utilize any high-molecular-weight PAH as sole carbon and energy source but could partially degrade these if cultured in a nutrient broth. Although small amounts of chrysene, benz[a]pyrene, and dibenz[a,h]anthracene were degraded by axenic cultures of these isolates in BSM containing a single PAH, such conditions did not support significant microbial growth or PAH mineralization. However, significant degradation of, and microbial growth on, pyrene, chrysene, benz[a]anthracene, benzo[a]pyrene, and dibenz[a,h]anthracene, each as a single PAH in BSM, occurred when P. janthinellum VUO 10,201 and either bacterial consortium VUN 10,009 or S. maltophilia VUN 10,010 were combined in the one culture, i.e., fungal-bacterial cocultures: 25% of the benzo[a]pyrene was mineralized to CO 2 by these cocultures over 49 days, accompanied by transient accumulation and disappearance of intermediates detected by high-pressure liquid chromatography. Inoculation of fungal-bacterial cocultures into PAH-contaminated soil resulted in significantly improved degradation of high-molecular-weight PAHs, benzo[a]pyrene mineralization, and reduction in the mutagenicity of organic soil extracts, compared with the indigenous microbes and soil amended with only axenic inocula

  16. Advanced multivariate analysis to assess remediation of hydrocarbons in soils.

    Science.gov (United States)

    Lin, Deborah S; Taylor, Peter; Tibbett, Mark

    2014-10-01

    Accurate monitoring of degradation levels in soils is essential in order to understand and achieve complete degradation of petroleum hydrocarbons in contaminated soils. We aimed to develop the use of multivariate methods for the monitoring of biodegradation of diesel in soils and to determine if diesel contaminated soils could be remediated to a chemical composition similar to that of an uncontaminated soil. An incubation experiment was set up with three contrasting soil types. Each soil was exposed to diesel at varying stages of degradation and then analysed for key hydrocarbons throughout 161 days of incubation. Hydrocarbon distributions were analysed by Principal Coordinate Analysis and similar samples grouped by cluster analysis. Variation and differences between samples were determined using permutational multivariate analysis of variance. It was found that all soils followed trajectories approaching the chemical composition of the unpolluted soil. Some contaminated soils were no longer significantly different to that of uncontaminated soil after 161 days of incubation. The use of cluster analysis allows the assignment of a percentage chemical similarity of a diesel contaminated soil to an uncontaminated soil sample. This will aid in the monitoring of hydrocarbon contaminated sites and the establishment of potential endpoints for successful remediation.

  17. Selection of biosurfactan/bioemulsifier-producing bacteria from hydrocarbon-contaminated soil

    Directory of Open Access Journals (Sweden)

    Sabina Viramontes-Ramos

    2010-10-01

    Full Text Available Petroleum-derived hydrocarbons are among the most persistent soil contaminants, and some hydrocarbon-degrading microorganisms can produce biosurfactants to increase bioavailability and degradation. The aim of this work was to identify biosurfactant-producing bacterial strains isolated from hydrocarbon-contaminated sites, and to evaluate their biosurfactant properties. The drop-collapse method and minimal agar added with a layer of combustoleo were used for screening, and positive strains were grown in liquid medium, and surface tension and emulsification index were determined in cell-free supernantant and cell suspension. A total of 324 bacterial strains were tested, and 17 were positive for the drop-collapse and hydrocarbon-layer agar methods. Most of the strains were Pseudomonas, except for three strains (Acinetobacter, Bacillus, Rhodococcus. Surface tension was similar in cell-free and cell suspension measurements, with values in the range of 58 to 26 (mN/m, and all formed stable emulsions with motor oil (76-93% E24. Considering the variety of molecular structures among microbial biosurfactants, they have different chemical properties that can be exploited commercially, for applications as diverse as bioremediation or degradable detergents.

  18. Crude oil polycyclic aromatic hydrocarbons removal via clay-microbe-oil interactions: Effect of acid activated clay minerals.

    Science.gov (United States)

    Ugochukwu, Uzochukwu C; Fialips, Claire I

    2017-07-01

    Acid treatment of clay minerals is known to modify their properties such as increase their surface area and surface acidity, making them suitable as catalysts in many chemical processes. However, the role of these surface properties during biodegradation processes of polycyclic aromatic hydrocarbons (PAHs) is only known for mild acid (0.5 M Hydrochloric acid) treated clays. Four different clay minerals were used for this study: a montmorillonite, a saponite, a palygorskite and a kaolinite. They were treated with 3 M hydrochloric acid to produce acid activated clay minerals. The role of the acid activated montmorillonite, saponite, palygorskite and kaolinite in comparison with the unmodified clay minerals in the removal of PAHs during biodegradation was investigated in microcosm experiments. The microcosm experiments contained micro-organisms, oil, and clays in aqueous medium with a hydrocarbon degrading microorganism community predominantly composed of Alcanivorax spp. Obtained results indicated that acid activated clays and unmodified kaolinite did not enhance the biodegradation of the PAHs whereas unmodified montmorillonite, palygorskite and saponite enhanced their biodegradation. In addition, unmodified palygorskite adsorbed the PAHs significantly due to its unique channel structure. Copyright © 2017 Elsevier Ltd. All rights reserved.

  19. Molecular application for identification of polycyclic aromatic hydrocarbons degrading bacteria (PAHD) species isolated from oil polluted soil in Dammam, Saud Arabia.

    Science.gov (United States)

    Ibrahim, Mohamed M; Al-Turki, Ameena; Al-Sewedi, Dona; Arif, Ibrahim A; El-Gaaly, Gehan A

    2015-09-01

    Soil contamination with petroleum hydrocarbon products such as diesel and engine oil is becoming one of the major environmental problems. This study describes hydrocarbons degrading bacteria (PHAD) isolated from long-standing petrol polluted soil from the eastern region, Dammam, Saudi Arabia. The isolated strains were firstly categorized by accessible shape detection, physiological and biochemistry tests. Thereafter, a technique established on the sequence analysis of a 16S rDNA gene was used. Isolation of DNA from the bacterial strains was performed, on which the PCR reaction was carried out. Strains were identified based on 16S rDNA sequence analysis, As follows amplified samples were spontaneously sequenced automatically and the attained results were matched to open databases. Among the isolated bacterial strains, S1 was identified as Staphylococcus aureus and strain S1 as Corynebacterium amycolatum.

  20. Development of an efficient bacterial consortium for the potential remediation of hydrocarbons from contaminated sites

    Directory of Open Access Journals (Sweden)

    Kaustuvmani Patowary

    2016-07-01

    Full Text Available The intrinsic biodegradability of hydrocarbons and the distribution of proficient degrading microorganisms in the environment are very crucial for the implementation of bioremediation practices. Among others, one of the most favorable methods that can enhance the effectiveness of bioremediation of hydrocarbon-contaminated environment is the application of biosurfactant producing microbes. In the present study, the biodegradation capacities of native bacterial consortia towards total petroleum hydrocarbons (TPH with special emphasis to poly aromatic hydrocarbons (PAHs were determined. The purpose of the study was to isolate TPH degrading bacterial strains from various petroleum contaminated soil of Assam, India and develop a robust bacterial consortium for bioremediation of crude oil of this native land. From a total of 23 bacterial isolates obtained from three different hydrocarbons contaminated samples 5 isolates, namely KS2, PG1, PG5, R1 and R2 were selected as efficient crude oil degraders with respect to their growth on crude oil enriched samples. Isolates KS2, PG1 and R2 are biosurfactant producers and PG5, R1 are non-producers. Fourteen different consortia were designed involving both biosurfactant producing and non-producing isolates. Consortium 10, which comprises two Bacillus strains namely, Bacillus pumilus KS2 and Bacillus cereus R2 (identified by 16s rRNA sequencing has shown the best result in the desired degradation of crude oil. The consortium showed degradation up to 84.15% of total petroleum hydrocarbon (TPH after five weeks of incubation, as revealed from gravimetric analysis. FTIR (Fourier transform infrared and GCMS (Gas chromatography-mass spectrometer analyses were correlated with gravimetric data which reveals that the consortium has removed a wide range of petroleum hydrocarbons in comparison with abiotic control including different aliphatic and aromatic hydrocarbons.

  1. Degradation of Total Petroleum Hydrocarbon (TPH) in Contaminated Soil Using Bacillus pumilus MVSV3.

    Science.gov (United States)

    Varma, Surendra Sheeba; Lakshmi, Mahalingam Brinda; Rajagopal, Perumalsam; Velan, Manickam

    2017-01-01

     A study on bioremediation of soil contaminated with petroleum sludge was performed using Bacillus pumilus/MVSV3 (Accession number JN089707). In this study, 5 kg of agricultural soil was mixed well with 5% oil sludge and fertilizers containing nitrogen, phosphorus and potassium (N:P:K). The treatment resulted in 97% removal of total petroleum hydrocarbon (TPH) in 122 d in bacteria mixed contaminated soil when compared to 12% removal of TPH in uninoculated contaminated soil. The population of the microorganism remained stable after introduced into the oil environment. The physical and chemical parameters of the soil mixed with sludge showed variation indicating improvement and the pH level decreased during the experiment period. Elemental analysis and Gas Chromatography-Mass Spectroscopy (GC-MS) analysis revealed the bacterial ability to degrade oil sludge components. Growth experiments with Trigonellafoenumgraecum (Fenugreek) showed the applicability of bioremediated soil for the production.

  2. Biodegradation of hydrocarbon remnants by biological activators in the presence of INIPOL EAP 22

    Energy Technology Data Exchange (ETDEWEB)

    Bergueiro, J. R.; Luengo, M. C.; Socias, S.; Perez, F.; Laseca, D. [Universidad de las Islas Baleares, Palma de Mallorca (Spain); Perez-Navarro, A.; Morales, N. [Universidad Alfonso X El Sabio, Madrid (Spain)

    1997-10-01

    Degradation of highly weathered hydrocarbon mixtures resulting from an accidental spill in an oil refinery was studied, using BIOLEN IG 30 as the degradation agent microorganism, and INIPOL EAP 22 as the biodegradation accelerator. Results show that BIOLEN IG 30 is able to degrade highly weathered hydrocarbons at 20 degrees C, in the presence of INIPOL EAP 22. BIOLEN IG 30 is also able to degrade the total ionic and anionic dispersants in FINASOL OSR 51 (a dispersant), even in the absence of a biodegradation accelerator. 10 refs., 7 tabs., 3 figs.

  3. Biodegradation of hydrocarbon remnants by biological activators in the presence of INIPOL EAP 22

    International Nuclear Information System (INIS)

    Bergueiro, J. R.; Luengo, M. C.; Socias, S.; Perez, F.; Laseca, D.; Perez-Navarro, A.; Morales, N.

    1997-01-01

    Degradation of highly weathered hydrocarbon mixtures resulting from an accidental spill in an oil refinery was studied, using BIOLEN IG 30 as the degradation agent microorganism, and INIPOL EAP 22 as the biodegradation accelerator. Results show that BIOLEN IG 30 is able to degrade highly weathered hydrocarbons at 20 degrees C, in the presence of INIPOL EAP 22. BIOLEN IG 30 is also able to degrade the total ionic and anionic dispersants in FINASOL OSR 51 (a dispersant), even in the absence of a biodegradation accelerator. 10 refs., 7 tabs., 3 figs

  4. Assessment of microbial communities associated with fermentative-methanogenic biodegradation of aromatic hydrocarbons in groundwater contaminated with a biodiesel blend (B20).

    Science.gov (United States)

    Ramos, Débora Toledo; da Silva, Márcio Luís Busi; Nossa, Carlos Wolfgang; Alvarez, Pedro J J; Corseuil, Henry Xavier

    2014-09-01

    A controlled field experiment was conducted to assess the potential for fermentative-methanogenic biostimulation (by ammonium-acetate injection) to enhance biodegradation of benzene, toluene, ethylbenzene and xylenes (BTEX) as well as polycyclic aromatic hydrocarbons (PAHs) in groundwater contaminated with biodiesel B20 (20:80 v/v soybean biodiesel and diesel). Changes in microbial community structure were assessed by pyrosequencing 16S rRNA analyses. BTEX and PAH removal began 0.7 year following the release, concomitantly with the increase in the relative abundance of Desulfitobacterium and Geobacter spp. (from 5 to 52.7 % and 15.8 to 37.3 % of total Bacteria 16S rRNA, respectively), which are known to anaerobically degrade hydrocarbons. The accumulation of anaerobic metabolites acetate and hydrogen that could hinder the thermodynamic feasibility of BTEX and PAH biotransformations under fermentative/methanogenic conditions was apparently alleviated by the growing predominance of Methanosarcina. This suggests the importance of microbial population shifts that enrich microorganisms capable of interacting syntrophically to enhance the feasibility of fermentative-methanogenic bioremediation of biodiesel blend releases.

  5. Enhancement of in situ Remediation of Hydrocarbon Contaminated Soil

    Energy Technology Data Exchange (ETDEWEB)

    Palmroth, M.

    2006-07-01

    Approximately 750 000 sites of contaminated land exist across Europe. The harmful chemicals found in Finnish soils include heavy metals, oil products, polyaromatic hydrocarbons (PAHs), polychlorinated biphenyls (PCBs), chlorophenols, and pesticides. Petroleum and petroleum products enter soil from ruptured oil pipelines, land disposal of refinery products, leaking storage tanks and through accidents. PAH contamination is caused by the spills of coal tar and creosote from coal gasification and wood treatment sites in addition to oil spills. Cleanup of soil by bioremediation is cheaper than by chemical and physical processes. However, the cleaning capacity of natural attenuation and in situ bioremediation is limited. The purpose of this thesis was to find feasible options to enhance in situ remediation of hydrocarbon contaminants. The aims were to increase the bioavailability of the contaminants and microbial activity at the subsurface in order to achieve higher contaminant removal efficiency than by intrinsic biodegradation alone. Enhancement of microbial activity and decrease of soil toxicity during remediation were estimated by using several biological assays. The performance of these assays was compared in order to find suitable indicators to follow the progress of remediation. Phytoremediation and chemical oxidation are promising in situ techniques to increase the degradation of hydrocarbons in soil. Phytoremediation is plant-enhanced decontamination of soil and water. Degradation of hydrocarbons is enhanced in the root zone by increased microbial activity and through the detoxifying enzymes of plants themselves. Chemical oxidation of contaminants by Fenton's reaction can produce degradation products which are more biodegradable than the parent compounds. Fenton's reaction and its modifications apply solutions of hydrogen peroxide and iron for the oxidation of organic chemicals. The cost of oxidation can be reduced by aiming at partial instead of full

  6. Biosurfactant production from marine hydrocarbon-degrading consortia and pure bacterial strains using crude oil as carbon source

    Directory of Open Access Journals (Sweden)

    Eleftheria eAntoniou

    2015-04-01

    Full Text Available Biosurfactants (BS are green amphiphilic molecules produced by microorganisms during biodegradation, increasing the bioavailability of organic pollutants. In this work, the BS production yield of marine hydrocarbon degraders isolated from Elefsina bay in Eastern Mediterranean Sea has been investigated. The drop collapse test was used as a preliminary screening test to confirm biosurfactant producing strains or mixed consortia. The community structure of the best consortia based on the drop collapse test was determined by 16S-rDNA pyrotag screening. Subsequently, the effect of incubation time, temperature, substrate and supplementation with inorganic nutrients, on biosurfactant production, was examined. Two types of BS - lipid mixtures were extracted from the culture broth; the low molecular weight BS Rhamnolipids and Sophorolipids. Crude extracts were purified by silica gel column chromatography and then identified by thin layer chromatography (TLC and Fourier transform infrared spectroscopy (FT-IR. Results indicate that biosurfactant production yield remains constant and low while it is independent of the total culture biomass, carbon source, and temperature. A constant BS concentration in a culture broth with continuous degradation of crude oil implies that the BS producing microbes generate no more than the required amount of biosurfactants that enables biodegradation of the crude oil. Isolated pure strains were found to have higher specific production yields than the complex microbial marine community-consortia. The heavy oil fraction of crude oil has emerged as a promising substrate for BS production (by marine BS producers with fewer impurities in the final product. Furthermore, a particular strain isolated from sediments, Paracoccus marcusii, may be an optimal choice for bioremediation purposes as its biomass remains trapped in the hydrocarbon phase, not suffering from potential dilution effects by sea currents.

  7. Biosurfactant production from marine hydrocarbon-degrading consortia and pure bacterial strains using crude oil as carbon source

    Science.gov (United States)

    Antoniou, Eleftheria; Fodelianakis, Stilianos; Korkakaki, Emmanouela; Kalogerakis, Nicolas

    2015-01-01

    Biosurfactants (BSs) are “green” amphiphilic molecules produced by microorganisms during biodegradation, increasing the bioavailability of organic pollutants. In this work, the BS production yield of marine hydrocarbon degraders isolated from Elefsina bay in Eastern Mediterranean Sea has been investigated. The drop collapse test was used as a preliminary screening test to confirm BS producing strains or mixed consortia. The community structure of the best consortia based on the drop collapse test was determined by 16S-rDNA pyrotag screening. Subsequently, the effect of incubation time, temperature, substrate and supplementation with inorganic nutrients, on BS production, was examined. Two types of BS – lipid mixtures were extracted from the culture broth; the low molecular weight BS Rhamnolipids and Sophorolipids. Crude extracts were purified by silica gel column chromatography and then identified by thin layer chromatography and Fourier transform infrared spectroscopy. Results indicate that BS production yield remains constant and low while it is independent of the total culture biomass, carbon source, and temperature. A constant BS concentration in a culture broth with continuous degradation of crude oil (CO) implies that the BS producing microbes generate no more than the required amount of BSs that enables biodegradation of the CO. Isolated pure strains were found to have higher specific production yields than the complex microbial marine community-consortia. The heavy oil fraction of CO has emerged as a promising substrate for BS production (by marine BS producers) with fewer impurities in the final product. Furthermore, a particular strain isolated from sediments, Paracoccus marcusii, may be an optimal choice for bioremediation purposes as its biomass remains trapped in the hydrocarbon phase, not suffering from potential dilution effects by sea currents. PMID:25904907

  8. Fate of petroleum hydrocarbons and toxic organics in Louisiana coastal environments

    International Nuclear Information System (INIS)

    DeLaune, R.D.; Gambrell, R.P.; Pardue, J.H.; Patrick, W.H. Jr.

    1991-01-01

    Numerous potentially toxic compounds are entering Louisiana's inshore and nearshore coastal environments. To a large degree there is insufficient information for predicting the fate and effect of these materials in aquatic environments. Studies documenting the impact of petroleum hydrocarbons entering Louisiana coastal wetlands are summarized. Also included are research findings on factors affecting the persistence of petroleum hydrocarbons and other toxic organics (pentachlorophenol (PCP), 2,4-dichlorophenoxyacetic acid (2,4-D), creosote, etc.) in sediment-water systems. Sediment pH and redox conditions have been found to play an important role in the microbial degradation of toxic organics. Most of the hydrocarbons investigated degrade more rapidly under high redox (aerobic) conditions although there are exceptions (e.g., 1,1,1-trichloro-2,2-bis(4-chlorophenyl)(DDT) and polychlorobiphenyls (PCBs)). Some of these compounds, due to their slow degradation in anaerobic sediment, may persist in the system for decades

  9. Studies on degradation of chlorinated aromatic hydrocarbon by ...

    African Journals Online (AJOL)

    SERVER

    2007-06-04

    Jun 4, 2007 ... chlorobenzene to study the kinetics of degradation of chlorobenzene. The rate of decomposition of ... hydraulic fluids, biocides, herbicides, plastics, degree- ..... degradation by bacteria isolated from contaminated groundwater.

  10. Pseudomonads Rule Degradation of Polyaromatic Hydrocarbons in Aerated Sediment

    Czech Academy of Sciences Publication Activity Database

    Wald, J.; Hroudová, Miluše; Jansa, Jan; Vrchotová, B.; Macek, T.; Uhlík, O.

    2015-01-01

    Roč. 6, č. 1268 (2015) ISSN 1664-302X Institutional support: RVO:68378050 ; RVO:61388971 Keywords : biodegradation * polyaromatic hydrocarbons * stable isotope probing Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.165, year: 2015

  11. Development of an Efficient Bacterial Consortium for the Potential Remediation of Hydrocarbons from Contaminated Sites.

    Science.gov (United States)

    Patowary, Kaustuvmani; Patowary, Rupshikha; Kalita, Mohan C; Deka, Suresh

    2016-01-01

    The intrinsic biodegradability of hydrocarbons and the distribution of proficient degrading microorganisms in the environment are very crucial for the implementation of bioremediation practices. Among others, one of the most favorable methods that can enhance the effectiveness of bioremediation of hydrocarbon-contaminated environment is the application of biosurfactant producing microbes. In the present study, the biodegradation capacities of native bacterial consortia toward total petroleum hydrocarbons (TPH) with special emphasis to poly aromatic hydrocarbons were determined. The purpose of the study was to isolate TPH degrading bacterial strains from various petroleum contaminated soil of Assam, India and develop a robust bacterial consortium for bioremediation of crude oil of this native land. From a total of 23 bacterial isolates obtained from three different hydrocarbons contaminated samples five isolates, namely KS2, PG1, PG5, R1, and R2 were selected as efficient crude oil degraders with respect to their growth on crude oil enriched samples. Isolates KS2, PG1, and R2 are biosurfactant producers and PG5, R1 are non-producers. Fourteen different consortia were designed involving both biosurfactant producing and non-producing isolates. Consortium 10, which comprises two Bacillus strains namely, Bacillus pumilus KS2 and B. cereus R2 (identified by 16s rRNA sequencing) has shown the best result in the desired degradation of crude oil. The consortium showed degradation up to 84.15% of TPH after 5 weeks of incubation, as revealed from gravimetric analysis. FTIR (Fourier transform infrared) and GCMS (Gas chromatography-mass spectrometer) analyses were correlated with gravimetric data which reveals that the consortium has removed a wide range of petroleum hydrocarbons in comparison with abiotic control including different aliphatic and aromatic hydrocarbons.

  12. Bacterial diversity exploration in hydrocarbon polluted soil: metabolic potential and degrader community evolution revealed by isotope labeling

    International Nuclear Information System (INIS)

    Martin, F.

    2011-01-01

    Polycyclic aromatic hydrocarbons (PAHs) are ubiquitous compounds produced by incomplete combustion of organic matter. They are a source of environmental pollution, especially associated to oil product exploitation, and represent a threat for living organisms including human beings because of their toxicity. Many bacteria capable of degrading PAHs have been isolated and studied. However, since less than 5% of soil bacteria can be cultivated in the laboratory, bacterial species able to degrade PAHs in situ have been poorly studied. The first goal of this study was to identify bacteria that degrade PAHs in soil using culture-independent molecular methods. To this end, a strategy known a stable isotope probing has been implemented based on the use of phenanthrene, a three rings PAH, in which the natural isotope of carbon was replaced by 13 C. This molecule has been introduced as a tracer in microcosms containing soil from a constructed wetlands collecting contaminated water from highway runoff. Bacteria having incorporated the 13 C were then identified by 16 S rRNA gene sequence analysis after PCR amplification from labeled genomic DNA extracted from soil. The results show that so far little studied Betaproteobacteria, belonging to the genera Acidovorax, Rhodoferax, Hydrogenophaga and Thiobacillus, as well as Rhodocyclaceae, were the key players in phenanthrene degradation. Predominance of Betaproteobacteries was established thanks to quantitative PCR measurements. A dynamic analysis of bacterial diversity also showed that the community structure of degraders depended on phenanthrene bioavailability. In addition, the phylogenetic diversity of ring-hydroxylating di-oxygenases, enzymes involved in the first step of PAH degradation, has been explored. We detected new sequences, mostly related to di-oxygenases from Sphingomonadales and Burkholderiales. For the first time, we were able to associate a catalytic activity for oxidation of PAHs to partial gene sequences

  13. DNA-SIP identifies sulfate-reducing Clostridia as important toluene degraders in tar-oil-contaminated aquifer sediment

    Energy Technology Data Exchange (ETDEWEB)

    Winderl, C.; Penning, H.; von Netzer, F.; Meckenstock, R.U.; Lueders, T. [Helmholtz Zentrum Munchen, Neuherberg (Germany)

    2010-10-15

    Global groundwater resources are constantly challenged by a multitude of contaminants such as aromatic hydrocarbons. Especially in anaerobic habitats, a large diversity of unrecognized microbial populations may be responsible for their degradation. Still, our present understanding of the respective microbiota and their ecophysiology is almost exclusively based on a small number of cultured organisms, mostly within the Proteobacteria. Here, by DNA-based stable isotope probing (SIP), we directly identified the most active sulfate-reducing toluene degraders in a diverse sedimentary microbial community originating from a tar-oil-contaminated aquifer at a former coal gasification plant. On incubation of fresh sediments with {sup 13}C{sub 7}-toluene, the production of both sulfide and (CS{sub 2}){sup 13}CO{sub 2} was clearly coupled to the {sup 13}Clabeling of DNA of microbes related to Desulfosporosinus spp. within the Peptococcaceae (Clostridia). The screening of labeled DNA fractions also suggested a novel benzylsuccinate synthase alpha-subunit (bssA) sequence type previously only detected in the environment to be tentatively affiliated with these degraders. However, carbon flow from the contaminant into degrader DNA was only similar to 50%, pointing toward high ratios of heterotrophic CS{sub 2}-fixation during assimilation of acetyl-CoA originating from the contaminant by these degraders. These findings demonstrate that the importance of non-proteobacterial populations in anaerobic aromatics degradation, as well as their specific ecophysiology in the subsurface may still be largely ungrasped.

  14. Treatment of hydrocarbon-rich wastewater using oil degrading bacteria and phototrophic microorganisms in rotating biological contactor: Effect of N:P ratio

    International Nuclear Information System (INIS)

    Chavan, Anal; Mukherji, Suparna

    2008-01-01

    Treatment of hydrocarbon-rich industrial wastewater in bioreactors using heterotrophic microorganisms is often associated with various operational problems. In this study, a consortium of phototrophic microorganisms and a bacterium is developed on the discs of a rotating biological contactor (RBC) for treatment of wastewater containing diesel oil. The reactor was fed with oil degrading bacterium, Burkholderia cepacia and oil tolerant phototrophic microorganisms. After biofilm formation and acclimatization to 0.6% (v/v) diesel, continuous-mode operation was initiated at 21 h hydraulic retention time (HRT). Residual diesel in the effluent was 0.003%. Advantages of this system include good total petroleum hydrocarbon (TPH) removal, no soluble carbon source requirement and good settleability of biosolids. Biofilm observations revealed the predominance of B. cepacia and cyanobacteria (Phormidium, Oscillatoria and Chroococcus). The N:P ratio affected the relative dominance of the phototrophic microorganisms and bacterial culture. This ratio was a critical factor in determining the performance efficiency of the reactor. At 21 h HRT and organic loading of 27.33 g TPH/m 2 d, the N:P ratio 28.5:1 and 38:1 both yielded high and almost comparable TPH and COD removal efficiencies. This study presents a feasible technology for the treatment of hydrocarbon-rich wastewater from petrochemical industries and petroleum refineries

  15. Enrichment and characterization of hydrocarbon-degrading bacteria from petroleum refinery waste as potent bioaugmentation agent for in situ bioremediation.

    Science.gov (United States)

    Sarkar, Poulomi; Roy, Ajoy; Pal, Siddhartha; Mohapatra, Balaram; Kazy, Sufia K; Maiti, Mrinal K; Sar, Pinaki

    2017-10-01

    Intrinsic biodegradation potential of bacteria from petroleum refinery waste was investigated through isolation of cultivable strains and their characterization. Pseudomonas and Bacillus spp. populated the normal cultivable taxa while prolonged enrichment with hydrocarbons and crude oil yielded hydrocarbonoclastic bacteria of genera Burkholderia, Enterobacter, Kocuria, Pandoraea, etc. Strains isolated through enrichment showed assemblages of superior metabolic properties: utilization of aliphatic (C6-C22) and polyaromatic compounds, anaerobic growth with multiple terminal electron acceptors and higher biosurfactant production. Biodegradation of dodecane was studied thoroughly by GC-MS along with detection of gene encoding alkane hydroxylase (alkB). Microcosms bioaugmented with Enterobacter, Pandoraea and Burkholderia strains showed efficient biodegradation (98% TPH removal) well fitted in first order kinetic model with low rate constants and decreased half-life. This study proves that catabolically efficient bacteria resides naturally in complex petroleum refinery wastes and those can be useful for bioaugmentation based bioremediation. Copyright © 2017 Elsevier Ltd. All rights reserved.

  16. Combined use of alkane-degrading and plant growth-promoting bacteria enhanced phytoremediation of diesel contaminated soil.

    Science.gov (United States)

    Tara, Nain; Afzal, Muhammad; Ansari, Tariq M; Tahseen, Razia; Iqbal, Samina; Khan, Qaiser M

    2014-01-01

    Inoculation of plants with pollutant-degrading and plant growth-promoting microorganisms is a simple strategy to enhance phytoremediation activity. The objective of this study was to determine the effect of inoculation of different bacterial strains, possessing alkane-degradation and 1-amino-cyclopropane-1 -carboxylic acid (ACC) deaminase activity, on plant growth and phytoremediation activity. Carpet grass (Axonopus affinis) was planted in soil spiked with diesel (1% w/w) for 90 days and inoculated with different bacterial strains, Pseudomonas sp. ITRH25, Pantoea sp. BTRH79 and Burkholderia sp. PsJN, individually and in combination. Generally, bacterial application increased total numbers of culturable hydrocarbon-degrading bacteria in the rhizosphere ofcarpet grass, plant biomass production, hydrocarbon degradation and reduced genotoxicity. Bacterial strains possessing different beneficial traits affect plant growth and phytoremediation activity in different ways. Maximum bacterial population, plant biomass production and hydrocarbon degradation were achieved when carpet grass was inoculated with a consortium of three strains. Enhanced plant biomass production and hydrocarbon degradation were associated with increased numbers of culturable hydrocarbon-degrading bacteria in the rhizosphere of carpet grass. The present study revealed that the combined use of different bacterial strains, exhibiting different beneficial traits, is a highly effective strategy to improve plant growth and phytoremediation activity.

  17. Isolation and characterization of bacteria capable of degrading polycyclic aromatic hydrocarbons (PAHs) and organophosphorus pesticides from PAH-contaminated soil in Hilo, Hawaii.

    Science.gov (United States)

    Seo, Jong-Su; Keum, Young-Soo; Harada, Renee M; Li, Qing X

    2007-07-11

    Nineteen bacterial strains were isolated from petroleum-contaminated soil in Hilo, HI, and characterized by two different spray-plated methods, turbidity test in liquid medium, and 16S rRNA gene sequence analysis. Analysis of the soil showed 13 polycyclic aromatic hydrocarbons (PAHs) in a range from 0.6 to 30 mg/kg of dry weight each and 12 PAH metabolites. Five distinct bacterial strains (C3, C4, P1-1, JS14, and JS19b1) selected from preliminary plating and turbidity tests were further tested for PAH degradation through single PAH degradation assay. Strains C3, C4, and P1-1 degraded phenanthrene (40 mg/L) completely during 7 days of incubation. Strain JS14 degraded fluoranthene (40 mg/L) completely during 10 days of incubation. Strain JS19b1 degraded 100% of phenanthrene (40 mg/L) in 7 days, 77% of fluorene (40 mg/L) in 14 days, 97% of fluoranthene (40 mg/L) in 10 days, and 100% of pyrene (40 mg/L) in 14 days. Turbidity tests showed that strains P1-1, JS14, and JS19b1 utilized several organophosphorus pesticides as growth substrate. P1-1 can degrade carbofenothion, chlorfenvinphos, diazinon, fonofos, and pirimiphos-methyl. JS14 can transform chlorfenvinphos and diazinon. JS19b1 can break down diazinon, pirimiphos-methyl, and temephos.

  18. Endophytic Bacteria Associated with Hieracium piloselloides: Their Potential for Hydrocarbon-Utilizing and Plant Growth-Promotion.

    Science.gov (United States)

    Pawlik, Małgorzata; Piotrowska-Seget, Zofia

    2015-01-01

    The aim of this study was to assess the potential of 18 crude-oil-degrading endophytic bacteria for removal of hydrocarbons and promotion of plant growth. Strains were isolated from Hieracium piloselloides (tall hawkweed), which grows in soil heavily polluted with petroleum hydrocarbons. Bacteria from the genus Pseudomonas were abundant among the isolates. The potential for hydrocarbon degradation was evaluated by polymerase chain reaction (PCR) analyses of the genes alkB, alkH, C23O, P450, and pah. It was found that 88.89% of the endophytic bacteria contained gene-encoding polycyclic aromatic hydrocarbon (PAH) initial dioxygenase, 61% possessed the 2,3-catechol dioxygenase gene, and 39% of strains that were tested had the cytochrome P-450 hydroxylase gene. All isolates were capable of producing indole-3-acetic acid (1.8-76.4 μg/ml). Only 17% of them were able to produce siderophores, excrete cellulase, and solubilize phosphate. Hydrogen cyanide synthesis occurred in 33% of endophytic bacteria. The 1-aminocyclopropane-1-carboxylate deaminase activity in isolates that were screened was in the range of 2.6 to 74.1 μmol α-ketobutyrate/mg/h. This feature of the bacteria indicated that isolates may enhance the phytoremediation process. Data suggest that crude-oil-degrading endophytic bacteria possess potential to be promising candidates for enhancement of phytoremediation of hydrocarbon-contaminated soil. Further evaluation of these bacteria is needed in order to assess the role played in the degradation of petroleum hydrocarbons.

  19. Identification and characterization of epoxide hydrolase activity of polycyclic aromatic hydrocarbon-degrading bacteria for biocatalytic resolution of racemic styrene oxide and styrene oxide derivatives.

    Science.gov (United States)

    Woo, Jung-Hee; Kwon, Tae-Hyung; Kim, Jun-Tae; Kim, Choong-Gon; Lee, Eun Yeol

    2013-04-01

    A novel epoxide hydrolase (EHase) from polycyclic aromatic hydrocarbon (PAH)-degrading bacteria was identified and characterized. EHase activity was identified in four strains of PAH-degrading bacteria isolated from commercial gasoline and oil-contaminated sediment based on their growth on styrene oxide and its derivatives, such as 2,3- and 4-chlorostyrene oxides, as a sole carbon source. Gordonia sp. H37 exhibited high enantioselective hydrolysis activity for 4-chlorostyrene oxide with an enantiomeric ratio of 27. Gordonia sp. H37 preferentially hydrolyzed the (R)-enantiomer of styrene oxide derivatives resulting in the preparation of a (S)-enantiomer with enantiomeric excess greater than 99.9 %. The enantioselective EHase activity was identified and characterized in various PAH-degrading bacteria, and whole cell Gordonia sp. H37 was employed as a biocatalyst for preparing enantiopure (S)-styrene oxide derivatives.

  20. Metabolic and phylogenetic analysis of microbial communities during phytoremediation of soil contaminated with weathered hydrocarbons and heavy metals.

    Science.gov (United States)

    Palmroth, Marja R T; Koskinen, Perttu E P; Kaksonen, Anna H; Münster, Uwe; Pichtel, John; Puhakka, Jaakko A

    2007-12-01

    In the current study, the microbial ecology of weathered hydrocarbon and heavy metal contaminated soil undergoing phytoremediation was studied. The relationship of functional diversity, measured as carbon source utilisation in Biolog plates and extracellular enzymatic activities, and genetic diversity of bacteria was evaluated. Denaturing gradient gel electrophoresis was used for community analyses at the species level. Bulk soil and rhizosphere soil from pine and poplar plantations were analysed separately to determine if the plant rhizosphere impacted hydrocarbon degradation. Prevailing microbial communities in the field site were both genetically and metabolically diverse. Furthermore, both tree rhizosphere and fertilisation affected the compositions of these communities and increased activities of extracellular aminopeptidases. In addition, the abundance of alkane hydroxylase and naphthalene dioxygenase genes in the communities was low, but the prevalence of these genes was increased by the addition of bioavailable hydrocarbons. Tree rhizosphere communities had greater hydrocarbon degradation potential than those of bulk soil. Hydrocarbon utilising communities were dominated generally by the species Ralstonia eutropha and bacteria belonging to the genus Burkholderia. Despite the presence of viable hydrocarbon-degrading microbiota, decomposition of hydrocarbons from weathered hydrocarbon contaminated soil over four years, regardless of the presence of vegetation, was low in unfertilised soil. Compost addition enhanced the removal of hydrocarbons.

  1. Enhanced biodegradation of polyaromatic hydrocarbons in manufactured gas plant wastes

    International Nuclear Information System (INIS)

    Gauger, W.K.; Srivastava, V.J.; Hayes, T.D.; Linz, D.G.

    1991-01-01

    Scientists at the Institute of Gas Technology (IGT) have focused on enhancing destruction of polyaromatic hydrocarbons (PAHs) present as pollutants in manufactured gas plant (MGP) soils. The factor that bears the most restrictive influence on successful biological PAH degradation is low pollutant transfer from soil into an aqueous environment where biotreatment processes can take place. Physical and chemical enhancements were used in conjunction with biological processes. Physical enhancements overcame the mass transfer problem and made possible the biological destruction of aromatic hydrocarbons. One- to three-ring aromatic hydrocarbons were readily biodegraded in liquid, soil slurry, and - to a lesser degree - composted soil systems. Four- to six-ring PAHs remained persistent but were effectively destroyed when chemical co-treatments were used. Combined biological/chemical/physical processes are currently being tested to achieve the most extensive PAH degradation possible for MGP soils

  2. Process for in-situ biodegradation of hydrocarbon contaminated soil

    International Nuclear Information System (INIS)

    Ely, D.L.; Heffner, D.A.

    1991-01-01

    This patent describes an in situ process for biodegrading hydrocarbons by drawing oxygen into an undisturbed hydrocarbon contaminated zone in a fluid permeable soil. It comprises: establishing a borehole extending from the earth's surface through a hydrocarbon contaminated zone having hydrocarbon degrading microbes therein; lining the borehole with a fluid impermeable liner coaxially spaced and sealingly connected to the inside surface of the borehole and extending from the earth's surface to the hydrocarbon-contaminated zone; the liner including a fluid permeable portion extending from the lower end thereof and through at least a portion of the hydrocarbon contaminated zone, fluidly connecting a source of negative pressure to the fluid impermeable line; evacuating gas from the borehole through the fluid permeable portion of the liner at a rate sufficient to draw air from the earth's surface into the hydrocarbon containing zone; and adjusting the flow rate of the evacuated gas so that the amount of hydrocarbon biodegradation therein is within 50% of the maximum hydrocarbon biodegradation rate as detected by the volume of carbon dioxide in the evacuated gas

  3. Bioremediation of high molecular weight polyaromatic hydrocarbons co-contaminated with metals in liquid and soil slurries by metal tolerant PAHs degrading bacterial consortium.

    Science.gov (United States)

    Thavamani, Palanisami; Megharaj, Mallavarapu; Naidu, Ravi

    2012-11-01

    Bioremediation of polyaromatic hydrocarbons (PAH) contaminated soils in the presence of heavy metals have proved to be difficult and often challenging due to the ability of toxic metals to inhibit PAH degradation by bacteria. In this study, a mixed bacterial culture designated as consortium-5 was isolated from a former manufactured gas plant (MGP) site. The ability of this consortium to utilise HMW PAHs such as pyrene and BaP as a sole carbon source in the presence of toxic metal Cd was demonstrated. Furthermore, this consortium has proven to be effective in degradation of HMW PAHs even from the real long term contaminated MGP soil. Thus, the results of this study demonstrate the great potential of this consortium for field scale bioremediation of PAHs in long term mix contaminated soils such as MGP sites. To our knowledge this is the first study to isolate and characterize metal tolerant HMW PAH degrading bacterial consortium which shows great potential in bioremediation of mixed contaminated soils such as MGP.

  4. Hydrocarbon pollutants shape bacterial community assembly of harbor sediments

    KAUST Repository

    Barbato, Marta

    2016-02-02

    Petroleum pollution results in co-contamination by different classes of molecules, entailing the occurrence of marine sediments difficult to remediate, as in the case of the Ancona harbor (Mediterranean Sea, Italy). Autochthonous bioaugmentation (ABA), by exploiting the indigenous microbes of the environment to be treated, could represent a successful bioremediation strategy. In this perspective we aimed to i) identify the main drivers of the bacterial communities\\' richness in the sediments, ii) establish enrichment cultures with different hydrocarbon pollutants evaluating their effects on the bacterial communities\\' composition, and iii) obtain a collection of hydrocarbon degrading bacteria potentially exploitable in ABA. The correlation between the selection of different specialized bacterial populations and the type of pollutants was demonstrated by culture-independent analyses, and by establishing a collection of bacteria with different hydrocarbon degradation traits. Our observations indicate that pollution dictates the diversity of sediment bacterial communities and shapes the ABA potential in harbor sediments.

  5. Enhanced biodegradation of alkane hydrocarbons and crude oil by mixed strains and bacterial community analysis.

    Science.gov (United States)

    Chen, Yu; Li, Chen; Zhou, Zhengxi; Wen, Jianping; You, Xueyi; Mao, Youzhi; Lu, Chunzhe; Huo, Guangxin; Jia, Xiaoqiang

    2014-04-01

    In this study, two strains, Acinetobacter sp. XM-02 and Pseudomonas sp. XM-01, were isolated from soil samples polluted by crude oil at Bohai offshore. The former one could degrade alkane hydrocarbons (crude oil and diesel, 1:4 (v/v)) and crude oil efficiently; the latter one failed to grow on alkane hydrocarbons but could produce rhamnolipid (a biosurfactant) with glycerol as sole carbon source. Compared with pure culture, mixed culture of the two strains showed higher capability in degrading alkane hydrocarbons and crude oil of which degradation rate were increased from 89.35 and 74.32 ± 4.09 to 97.41 and 87.29 ± 2.41 %, respectively. In the mixed culture, Acinetobacter sp. XM-02 grew fast with sufficient carbon source and produced intermediates which were subsequently utilized for the growth of Pseudomonas sp. XM-01 and then, rhamnolipid was produced by Pseudomonas sp. XM-01. Till the end of the process, Acinetobacter sp. XM-02 was inhibited by the rapid growth of Pseudomonas sp. XM-01. In addition, alkane hydrocarbon degradation rate of the mixed culture increased by 8.06 to 97.41 % compared with 87.29 % of the pure culture. The surface tension of medium dropping from 73.2 × 10(-3) to 28.6 × 10(-3) N/m. Based on newly found cooperation between the degrader and the coworking strain, rational investigations and optimal strategies to alkane hydrocarbons biodegradation were utilized for enhancing crude oil biodegradation.

  6. Considering the Specific Impact of Harsh Conditions and Oil Weathering on Diversity, Adaptation, and Activity of Hydrocarbon-Degrading Bacteria in Strategies of Bioremediation of Harsh Oily-Polluted Soils

    Science.gov (United States)

    Al Disi, Zulfa; Jaoua, Samir; Al-Thani, Dhabia; Al-Meer, Saeed

    2017-01-01

    Weathering processes change properties and composition of spilled oil, representing the main reason of failure of bioaugmentation strategies. Our purpose was to investigate the metabolic adaptation of hydrocarbon-degrading bacteria at harsh conditions to be considered to overcome the limitations of bioaugmentation strategies at harsh conditions. Polluted soils, exposed for prolonged periods to weathered oil in harsh soils and weather conditions, were used. Two types of enrichment cultures were employed using 5% and 10% oil or diesel as sole carbon sources with varying the mineral nitrogen sources and C/N ratios. The most effective isolates were obtained based on growth, tolerance to toxicity, and removal efficiency of diesel hydrocarbons. Activities of the newly isolated bacteria, in relation to the microenvironment from where they were isoalted and their interaction with the weathered oil, showed individual specific ability to adapt when exposed to such factors, to acquire metabolic potentialities. Among 39 isolates, ten identified ones by 16S rDNA genes similarities, including special two Pseudomonas isolates and one Citrobacter isolate, showed particularity of shifting hydrocarbon-degrading ability from short chain n-alkanes (n-C12–n-C16) to longer chain n-alkanes (n-C21–n-C25) and vice versa by alternating nitrogen source compositions and C/N ratios. This is shown for the first time. PMID:28243605

  7. Considering the Specific Impact of Harsh Conditions and Oil Weathering on Diversity, Adaptation, and Activity of Hydrocarbon-Degrading Bacteria in Strategies of Bioremediation of Harsh Oily-Polluted Soils

    Directory of Open Access Journals (Sweden)

    Zulfa Al Disi

    2017-01-01

    Full Text Available Weathering processes change properties and composition of spilled oil, representing the main reason of failure of bioaugmentation strategies. Our purpose was to investigate the metabolic adaptation of hydrocarbon-degrading bacteria at harsh conditions to be considered to overcome the limitations of bioaugmentation strategies at harsh conditions. Polluted soils, exposed for prolonged periods to weathered oil in harsh soils and weather conditions, were used. Two types of enrichment cultures were employed using 5% and 10% oil or diesel as sole carbon sources with varying the mineral nitrogen sources and C/N ratios. The most effective isolates were obtained based on growth, tolerance to toxicity, and removal efficiency of diesel hydrocarbons. Activities of the newly isolated bacteria, in relation to the microenvironment from where they were isoalted and their interaction with the weathered oil, showed individual specific ability to adapt when exposed to such factors, to acquire metabolic potentialities. Among 39 isolates, ten identified ones by 16S rDNA genes similarities, including special two Pseudomonas isolates and one Citrobacter isolate, showed particularity of shifting hydrocarbon-degrading ability from short chain n-alkanes (n-C12–n-C16 to longer chain n-alkanes (n-C21–n-C25 and vice versa by alternating nitrogen source compositions and C/N ratios. This is shown for the first time.

  8. Degradation of tetraethyllead in leaded gasoline contaminated and uncontaminated soils

    International Nuclear Information System (INIS)

    Ou, L.; Jing, W.; Thomas, J.; Mulroy, P.

    1995-01-01

    For over 50 years, since its introduction in 1923 by General Motors, tetraethyllead (TEL) was the major antiknock agent used in leaded gasoline. Since the middle of 1970, use of leaded gasoline in automobiles was gradually phased out. The main objective of this study is to determine the degradation rates and metabolites of TEL in gasoline contaminated and uncontaminated soils. TEL in uncontaminated soils disappeared rapidly. Ionic triethyllead (TREL) was the major organolead metabolite in these soils, with ionic diethyllead (DEL) being the minor product. Nonsterile soils, but not autoclaved soils, had limited capacity to mineralize 14 C-TEL to 14 CO 2 , H 2 0, and Pb 2+ . Unlike TEL in uncontaminated soils, petroleum hydrocarbons protected TEL in leaded gasoline contaminated soils from being degraded. Both disappearance and mineralization rates of TEL in leaded gasoline contaminated soils decreased with the increase in gasoline concentration. It appears that TEL in leaded gasoline contaminated soils is relatively stable until the level of petroleum hydrocarbons falls below a critical value. TEL is then rapidly degraded. Hydrocarbon degrading microorganisms may be involved, to some extent, in the degradation of TEL

  9. Enhanced biodegradation of polyaromatic hydrocarbons in manufactured gas plant wastes

    International Nuclear Information System (INIS)

    Gauger, W.K.; Srivastava, V.J.; Hayes, T.D.; Linz, D.G.

    1990-01-01

    Scientists at the Institute of Gas Technology (IGT) have focused on enhancing destruction of polyaromatic hydrocarbons (PAHs) present as pollutants in manufactured gas plant (MGP) soils. The factor that bears the most restrictive influence on successful biological PAH degradation is low pollutant transfer from soil into an aqueous environment where biotreatment processes can take place. Physical and chemical enhancements were used in conjunction with biological processes. Physical enhancements overcame the mass transfer problem and made possible the biological destruction of aromatic hydrocarbons. One- to three-ring aromatic hydrocarbons were readily biodegraded in liquid, soil slurry, and -- to a lesser degree -- composted soil systems. Four- to six-ring PAHs remained persistent but were effectively destroyed when chemical co-treatments were used. Combined biological/chemical/physical processes are currently being tested to achieve the most extensive PAH degradation possible for MGP soils. 8 refs., 9 figs., 2 tabs

  10. In situ and laboratory determined first-order degradation rate constants of specific organic compounds in an aerobic aquifer

    DEFF Research Database (Denmark)

    Nielsen, P.H.; Bjerg, P.L.; Nielsen, P.

    1996-01-01

    In situ microcosms (ISM) and laboratory batch microcosms (LBM) were used for determination of the first-order degradation rate constants of benzene, toluene, o-xylene, nitrobenzene, naphthalene, biphenyl, o- and p-dichlorobenzene, 1,1,1 -trichloroethane, tetrachlorometane, trichloroethene......, tetrachloroethene, phenol, o-cresol, 2,4- and 2,6-dichlorophenol, 4,6-o-dichlorocresol, and o- and p-nitrophenol in an aerobic aquifer, All aromatic hydrocarbons were degraded in ISM and LBM experiments. The phenolic hydrocarbons were ail degraded in ISM experiments, but some failed to degrade in LBM experiments....... Chlorinated aliphatic hydrocarbons were degraded neither in ISM nor LBM experiments. Degradation rate constants were determined by a model accounting for kinetic sorption (bicontinuum model), lag phases, and first-order degradation. With a few exceptions, lag phases were less than 2 weeks in both ISM and LBM...

  11. Fast co-pyrolysis of waste newspaper with high-density polyethylene for high yields of alcohols and hydrocarbons.

    Science.gov (United States)

    Chen, Weimin; Shi, Shukai; Chen, Minzhi; Zhou, Xiaoyan

    2017-09-01

    Waste newspaper (WP) was first co-pyrolyzed with high-density polyethylene (HDPE) using pyrolysis-gas chromatography/mass spectrometry (Py-GC/MS) to enhance the yields of alcohols and hydrocarbons. The effects of WP: HDPE feed ratio (100:0, 75:25, 50:50, 25:75, 0:100) and temperature (500-800°C) on products distribution were investigated and the interaction mechanism during co-pyrolysis was also proposed. Maximum yields of alcohols and hydrocarbons reached 85.88% (feed ratio 50:50wt.%, 600°C). Hydrogen supplements and deoxidation by HDPE and subsequently fragments recombination result in the conversion of aldehydes and ketones into branched hydrocarbons. Radicals from WP degradation favor the secondary crack for HDPE products resulting in the formation of linear hydrocarbons with low carbon number. Hydrocarbons with activated radical site from HDPE degradation were interacted with hydroxyl from WP degradation promoting the formation of linear long chain alcohols. Moreover, co-pyrolysis significantly enhanced condensable oil qualities, which were close to commercial diesel No. 0. Copyright © 2017 Elsevier Ltd. All rights reserved.

  12. Degradation of polycyclic aromatic hydrocarbons (PAHs) in an aged coal tar contaminated soil under in-vessel composting conditions

    International Nuclear Information System (INIS)

    Antizar-Ladislao, Blanca; Lopez-Real, Joe; Beck, Angus James

    2006-01-01

    In-vessel composting of polycyclic aromatic hydrocarbons (PAHs) present in contaminated soil from a manufactured gas plant site was investigated over 98 days using laboratory-scale in-vessel composting reactors. The composting reactors were operated at 18 different operational conditions using a 3-factor factorial design with three temperatures (T, 38 deg. C, 55 deg. C and 70 deg. C), four soil to green waste ratios (S:GW, 0.6:1, 0.7:1, 0.8:1 and 0.9:1 on a dry weight basis) and three moisture contents (MC, 40%, 60% and 80%). PAH losses followed first order kinetics reaching 0.015 day -1 at optimal operational conditions. A factor analysis of the 18 different operational conditions under investigation indicated that the optimal operational conditions for degradation of PAHs occurred at MC 60%, S:GW 0.8:1 and T 38 deg. C. Thus, it is recommended to maintain operational conditions during in-vessel composting of PAH-solid waste close to these values. - Maximum degradation of PAHs in an aged coal tar contaminated soil can be achieved using optimal operational conditions during composting

  13. Keratin Production by Decomposing Feather Waste Using Some Local Bacillus spp. Isolated from Poultry Soil

    Directory of Open Access Journals (Sweden)

    Mojtaba Salouti

    2016-12-01

    Full Text Available Background: Feather waste is generated in large amounts as a by-product of commercial poultry processing. The main component of feather is keratin. The main purpose of this study was to identify Bacillus spp. (the keratinolytic bacteria that are able to degrade the feather for producing keratin. Methods: Bacillus spp. Were isolated from the waste of poultries located in Miyaneh city. The bacteria were grown on basal medium containing 1% hen feather as the sole source of carbon ,nitrogen, sulfur and energy at 27ºC for 7 days. Then,the isolates capable of feather degrading were identified. The Bradford method was used to assay the production of keratin in the feather samples. Different pH and temperatures were studied to determine the best conditions for production of keratinase enzyme. Results: Seven Bacillus spp. including: B. pumilis, B. subtilis, B. firmus, B. macerance, B. popilliae, B. lentimorbus and B. larvae were found to be able to degrade the feather with different abilities. Conclusion: B. subtilis was found to be most productive isolate for keratinase enzyme production.

  14. Plant-bacteria partnership: phytoremediation of hydrocarbons contaminated soil and expression of catabolic genes

    Directory of Open Access Journals (Sweden)

    Hamna Saleem

    2016-01-01

    Full Text Available Petroleum hydrocarbons are harmful to living organisms when they are exposed in natural environment. Once they come in contact, it is not an easy to remove them because many of their constituents are persistent in nature. To achieve this target, different approaches have been exploited by using plants, bacteria, and plant-bacteria together. Among them, combined use of plants and bacteria has gained tremendous attention as bacteria possess set of catabolic genes which produce catabolic enzymes to decontaminate hydrocarbons. In return, plant ooze out root exudates containing nutrients and necessary metabolites which facilitate the microbial colonization in plant rhizosphere. This results into high gene abundance and gene expression in the rhizosphere and, thus, leads to enhanced degradation. Moreover, high proportions of beneficial bacteria helps plant to gain more biomass due to their plant growth promoting activities and production of phytohromones. This review focuses functioning and mechanisms of catabolic genes responsible for degradation of straight chain and aromatic hydrocarbons with their potential of degradation in bioremediation. With the understanding of expression mechanisms, rate of degradation can be enhanced by adjusting environmental factors and acclimatizing plant associated bacteria in plant rhizosphere.

  15. Plasma-Based Degradation of Mycotoxins Produced by Fusarium, Aspergillus and Alternaria Species

    Directory of Open Access Journals (Sweden)

    Lars ten Bosch

    2017-03-01

    Full Text Available The efficacy of cold atmospheric pressure plasma (CAPP with ambient air as working gas for the degradation of selected mycotoxins was studied. Deoxynivalenol, zearalenone, enniatins, fumonisin B1, and T2 toxin produced by Fusarium spp., sterigmatocystin produced by Aspergillus spp. and AAL toxin produced by Alternaria alternata were used. The kinetics of the decay of mycotoxins exposed to plasma discharge was monitored. All pure mycotoxins exposed to CAPP were degraded almost completely within 60 s. Degradation rates varied with mycotoxin structure: fumonisin B1 and structurally related AAL toxin were degraded most rapidly while sterigmatocystin exhibited the highest resistance to degradation. As compared to pure compounds, the degradation rates of mycotoxins embedded in extracts of fungal cultures on rice were reduced to a varying extent. Our results show that CAPP efficiently degrades pure mycotoxins, the degradation rates vary with mycotoxin structure, and the presence of matrix slows down yet does not prevent the degradation. CAPP appears promising for the decontamination of food commodities with mycotoxins confined to or enriched on surfaces such as cereal grains.

  16. Interaction between Carbon Nanotubes and Aromatic Hydrocarbon-degrading Microbes and its Effect on Carbon Nanotubes Transformation

    Science.gov (United States)

    You, Y.; Wang, L.; Poulson, S.; Wang, X.; Xing, B.; Yang, Y.

    2015-12-01

    Due to their unique electrical, optical and mechanical properties, carbon nanotubes (CNTs) have been substantially produced and widely applied during the past decades, leading to their increased probability of entering the environment. Some estimation suggests that CNTs are accumulated in agricultural systems with their soil concentration increasing by 0.4-157 ng/kg/year. This has raised concerns about environmental impacts of these emerging contaminants including their ecotoxicity. Meanwhile, transformation of CNTs in the environment can significantly affect their transport, bioavailability and thereby ecotoxicity. So far, environmental biodegradation of CNTs remains obscure. Given the high diversity of soil microorganisms and their metabolic potentials, it is important to investigate microbial biodegradation of CNTs under various environmental conditions. This study focuses on an aromatic hydrocarbon-degrading bacterium, Mycobacterium vanbaalenii PYR-1, as a model microorganism capable of ring cleavage. We hypothesize that bacterial activities could transform CNTs to more hydrophilic forms, increasing their aqueous stability and environmental reactivity. We incubated M. vanbaalenii PYR-1 with 13C-labeded multiwall carbon nanotubes (MWCNTs) for 30 days, monitored δ13C in the system, characterized MWCNTs before and after the reaction, and compared the results with culture-negative controls. To investigate effects of various environmental conditions, including the presence of extracellular oxidative enzymes from white-rot fungi, additional experiments will be conducted and results compared will be compared among different setups. Moreover, we will measure adverse impacts of CNTs on the metabolic activities of M. vanbaalenii PYR-1, particularly its biodegradation of polycyclic aromatic hydrocarbons.

  17. Degradation of benzene and other aromatic hydrocarbons by anaerobic bacteria

    NARCIS (Netherlands)

    Weelink, S.A.B.

    2008-01-01

    Accidental spills, industrial discharges and gasoline leakage from underground storage tanks have resulted in serious pollution of the environment with monoaromatic hydrocarbons, such as benzene, toluene, ethylbenzene and xylene (so-called BTEX). High concentrations of BTEX have been detected in

  18. Biodiversity of polycyclic aromatic hydrocarbon-degrading bacteria from deep sea sediments of the Middle Atlantic Ridge.

    Science.gov (United States)

    Cui, Zhisong; Lai, Qiliang; Dong, Chunming; Shao, Zongze

    2008-08-01

    The bacteria involved in the biodegradation of polycyclic aromatic hydrocarbons (PAHs) in deep sea subsurface environments are largely unknown. In order to reveal their biodiversity, sediments from 2.2 m under the bottom surface at a water depth of 3542 m were sampled on the Middle Atlantic Ridge with a gravity column sampler. The sediments were promptly enriched with either crude oil or a mixture of PAHs (naphthalene, phenanthrene and pyrene) as the sole carbon source, and further enriched with the PAH mixture mentioned above in the lab. The resulting consortia were named C2CO and C2PPN respectively. Their bacterial composition was analysed with plate cultivation, PCR-DGGE and 16S rDNA library analysis. On plates, isolates belonging to Pseudoalteromonas, Halomonas, Marinobacter, Thalassospira and Tistrella dominated the culturable populations. With PCR-DGGE, five major bands closely related to Cycloclasticus, Alteromonas, Thalassospira, Alcanivorax and Rhodospirillaceae were detected in consortium C2CO, while only one major band of Cycloclasticus was detected in consortium C2PPN. In addition, the dynamics of community structure in response to aromatic substrate alterations were examined. As a result, three ribotypes of Cycloclasticus were detected by 16S rDNA library analysis, one which played a key role in phenanthrene degradation; two Alteromonas bacteria dominated the naphthalene reselected consortium. Although bacteria of the two genera grew as the main members of the communities, none of them were isolated, probably owing to their poor cultivability. These results confirm that bacteria of Cycloclasticus are important obligate PAH degraders in marine environments, and coexist with other degrading bacteria that inhabit the deep subsurface sediment of the Atlantic. This supports the view that PAH accumulation and bioattenuation occur in remote areas consistently and continuously.

  19. Phytoremediation of hydrocarbon-contaminated soil using plants adapted to western Canadian climate

    International Nuclear Information System (INIS)

    Robson, D.B.

    2003-01-01

    Phytoremediation relies on the use of plants for in-situ treatment of hydrocarbon contaminated soils. It is based on relationships between plants, microorganisms and the environment. The advantages of the process are its low cost and minimal soil disturbance. Phytoremediation has not been widely implemented in Canada because only a few native or non-native plant species have been tested for hydrocarbon tolerance or degradation ability. More studies are needed to fully understand why some plants are more tolerant of hydrocarbons than others, and whether tolerant species increase hydrocarbon degradation. In this study, several field and growth chamber experiments were conducted to examine hydrocarbon tolerance in plants. Hydrocarbon contaminated field plots had higher soil pH, carbon to nitrogen ratio and bare ground, lower total nitrogen, available phosphorous and litter cover. The mean diversity at the uncontaminated sites was 0.52. It was 0.45 at the contaminated sites. Mean species similarity between contaminated and uncontaminated sites was 31.1 per cent and cover similarity was 22.2 per cent. The common plants in the contaminated field included kochia, wild barley, salt grass, bluegrass, and wheatgrass. The plants that formed most plant cover on contaminated plots were non-mycorrhizal, self-pollinating, and large seeded. The species with the highest survival after 5 weeks in hydrocarbon contaminated soils included one native and 4 non-native grasses, 2 native and 3 non-native legumes and 2 native forbs. All plants (with the exception of Indian breadroot) grown in hydrocarbon contaminated potting soil had lower total biomass and lower growth rates compared to the control

  20. Phytoremediation of hydrocarbon-contaminated soil using plants adapted to western Canadian climate

    Energy Technology Data Exchange (ETDEWEB)

    Robson, D.B.

    2003-07-01

    Phytoremediation relies on the use of plants for in-situ treatment of hydrocarbon contaminated soils. It is based on relationships between plants, microorganisms and the environment. The advantages of the process are its low cost and minimal soil disturbance. Phytoremediation has not been widely implemented in Canada because only a few native or non-native plant species have been tested for hydrocarbon tolerance or degradation ability. More studies are needed to fully understand why some plants are more tolerant of hydrocarbons than others, and whether tolerant species increase hydrocarbon degradation. In this study, several field and growth chamber experiments were conducted to examine hydrocarbon tolerance in plants. Hydrocarbon contaminated field plots had higher soil pH, carbon to nitrogen ratio and bare ground, lower total nitrogen, available phosphorous and litter cover. The mean diversity at the uncontaminated sites was 0.52. It was 0.45 at the contaminated sites. Mean species similarity between contaminated and uncontaminated sites was 31.1 per cent and cover similarity was 22.2 per cent. The common plants in the contaminated field included kochia, wild barley, salt grass, bluegrass, and wheatgrass. The plants that formed most plant cover on contaminated plots were non-mycorrhizal, self-pollinating, and large seeded. The species with the highest survival after 5 weeks in hydrocarbon contaminated soils included one native and 4 non-native grasses, 2 native and 3 non-native legumes and 2 native forbs. All plants (with the exception of Indian breadroot) grown in hydrocarbon contaminated potting soil had lower total biomass and lower growth rates compared to the control.

  1. Polycyclic aromatic hydrocarbons (PAHs) degradation by laccase ...

    African Journals Online (AJOL)

    PRECIOUS

    2009-11-02

    Nov 2, 2009 ... Full Length Research Paper. Polycyclic aromatic ... production of paper, feeds, chemicals and fuels there is ... microbes with the production of lignin-modifying enzymes ... enable white rot fungi to degrade a variety of toxic.

  2. Microbial degradation of total petroleum hydrocarbons in crude oil: a field-scale study at the low-land rainforest of Ecuador.

    Science.gov (United States)

    Maddela, Naga Raju; Scalvenzi, Laura; Venkateswarlu, Kadiyala

    2017-10-01

    A field-level feasibility study was conducted to determine total petroleum hydrocarbon (TPH)-degrading potential of two bacterial strains, Bacillus thuringiensis B3 and B. cereus B6, and two fungi, Geomyces pannorum HR and Geomyces sp. strain HV, all soil isolates obtained from an oil field located in north-east region of Ecuador. Crude oil-treated soil samples contained in wooden boxes received a mixture of all the four microorganisms and were incubated for 90 days in an open low-land area of Amazon rainforest. The percent removal of TPHs in soil samples that received the mixed microbial inoculum was 87.45, indicating the great potential of the soil isolates in field-scale removal of crude oil. The TPHs-degrading efficiency was verified by determining the toxicity of residues, remained in soil after biodegradation, toward viability of Artemia salina or seed germination and plant growth of cowpea. Our results clearly suggest that the selected soil isolates of bacteria and fungi could be effectively used for large-scale bioremediation of sites contaminated with crude oil.

  3. Bioremediation and reclamation of soil contaminated with petroleum oil hydrocarbons by exogenously seeded bacterial consortium: a pilot-scale study.

    Science.gov (United States)

    Mukherjee, Ashis K; Bordoloi, Naba K

    2011-03-01

    Spillage of petroleum hydrocarbons causes significant environmental pollution. Bioremediation is an effective process to remediate petroleum oil contaminant from the ecosystem. The aim of the present study was to reclaim a petroleum oil-contaminated soil which was unsuitable for the cultivation of crop plants by using petroleum oil hydrocarbon-degrading microbial consortium. Bacterial consortium consisting of Bacillus subtilis DM-04 and Pseudomonas aeruginosa M and NM strains were seeded to 20% (v/w) petroleum oil-contaminated soil, and bioremediation experiment was carried out for 180 days under laboratory condition. The kinetics of hydrocarbon degradation was analyzed using biochemical and gas chromatographic (GC) techniques. The ecotoxicity of the elutriates obtained from petroleum oil-contaminated soil before and post-treatment with microbial consortium was tested on germination and growth of Bengal gram (Cicer aretinum) and green gram (Phaseolus mungo) seeds. Bacterial consortium showed a significant reduction in total petroleum hydrocarbon level in contaminated soil (76% degradation) as compared to the control soil (3.6% degradation) 180 days post-inoculation. The GC analysis confirmed that bacterial consortium was more effective in degrading the alkane fraction compared to aromatic fraction of crude petroleum oil hydrocarbons in soil. The nitrogen, sulfur, and oxygen compounds fraction was least degraded. The reclaimed soil supported the germination and growth of crop plants (C. aretinum and P. mungo). In contrast, seeds could not be germinated in petroleum oil-contaminated soil. The present study reinforces the application of bacterial consortium rather than individual bacterium for the effective bioremediation and reclamation of soil contaminated with petroleum oil.

  4. Summary report on the aerobic degradation of diesel fuel and the degradation of toluene under aerobic, denitrifying and sulfate reducing conditions

    International Nuclear Information System (INIS)

    Coyne, P.; Smith, G.

    1995-01-01

    This report contains a number of studies that were performed to better understand the technology of the biodegradation of petroleum hydrocarbons. Topics of investigation include the following: diesel fuel degradation by Rhodococcus erythropolis; BTEX degradation by soil isolates; aerobic degradation of diesel fuel-respirometry; aerobic degradation of diesel fuel-shake culture; aerobic toluene degradation by A3; effect of HEPES, B1, and myo-inositol addition on the growth of A3; aerobic and anaerobic toluene degradation by contaminated soils; denitrifying bacteria MPNs; sulfate-reducing bacteria MPNs; and aerobic, DNB and SRB enrichments

  5. Methanogenic paraffin degradation proceeds via alkane addition to fumarate by 'Smithella' spp. mediated by a syntrophic coupling with hydrogenotrophic methanogens.

    Science.gov (United States)

    Wawrik, Boris; Marks, Christopher R; Davidova, Irene A; McInerney, Michael J; Pruitt, Shane; Duncan, Kathleen E; Suflita, Joseph M; Callaghan, Amy V

    2016-09-01

    Anaerobic microbial biodegradation of recalcitrant, water-insoluble substrates, such as paraffins, presents unique metabolic challenges. To elucidate this process, a methanogenic consortium capable of mineralizing long-chain n-paraffins (C28 -C50 ) was enriched from San Diego Bay sediment. Analysis of 16S rRNA genes indicated the dominance of Syntrophobacterales (43%) and Methanomicrobiales (26%). Metagenomic sequencing allowed draft genome assembly of dominant uncultivated community members belonging to the bacterial genus Smithella and the archaeal genera Methanoculleus and Methanosaeta. Five contigs encoding homologs of the catalytic subunit of alkylsuccinate synthase (assA) were detected. Additionally, mRNA transcripts for these genes, including a homolog binned within the 'Smithella' sp. SDB genome scaffold, were detected via RT-PCR, implying that paraffins are activated via 'fumarate addition'. Metabolic reconstruction and comparison with genome scaffolds of uncultivated n-alkane degrading 'Smithella' spp. are consistent with the hypothesis that syntrophically growing 'Smithella' spp. may achieve reverse electron transfer by coupling the reoxidation of ETFred to a membrane-bound FeS oxidoreductase functioning as an ETF:menaquinone oxidoreductase. Subsequent electron transfer could proceed via a periplasmic formate dehydrogenase and/or hydrogenase, allowing energetic coupling to hydrogenotrophic methanogens such as Methanoculleus. Ultimately, these data provide fundamental insight into the energy conservation mechanisms that dictate interspecies interactions salient to methanogenic alkane mineralization. © 2016 Society for Applied Microbiology and John Wiley & Sons Ltd.

  6. Distribution of hydrocarbon-degrading bacteria in the soil environment and their contribution to bioremediation.

    Science.gov (United States)

    Fukuhara, Yuki; Horii, Sachie; Matsuno, Toshihide; Matsumiya, Yoshiki; Mukai, Masaki; Kubo, Motoki

    2013-05-01

    A real-time PCR quantification method for indigenous hydrocarbon-degrading bacteria (HDB) carrying the alkB gene in the soil environment was developed to investigate their distribution in soil. The detection limit of indigenous HDB by the method was 1 × 10(6) cells/g-soil. The indigenous HDB were widely distributed throughout the soil environment and ranged from 3.7 × 10(7) to 5.0 × 10(8) cells/g-soil, and the ratio to total bacteria was 0.1-4.3 %. The dynamics of total bacteria, indigenous HDB, and Rhodococcus erythropolis NDKK6 (carrying alkB R2) during bioremediation were analyzed. During bioremediation with an inorganic nutrient treatment, the numbers of these bacteria were slightly increased. The numbers of HDB (both indigenous bacteria and strain NDKK6) were gradually decreased from the middle stage of bioremediation. Meanwhile, the numbers of these bacteria were highly increased and were maintained during bioremediation with an organic nutrient. The organic treatment led to activation of not only the soil bacteria but also the HDB, so an efficient bioremediation was carried out.

  7. AGRONOMIC OPTIMIZATION FOR PHYTOREMEDIATION OF POLYCYCLIC AROMATIC HYDROCARBONS

    Science.gov (United States)

    Phytoremediation is a low-cost method of using plants to degrade, volatilize or sequester organic and metal pollutants that has been used in efforts to remediate sites contaminated with polycyclic aromatic hydrocarbon (PAH) refinery wastes. Non-native plant species aggressivel...

  8. Purex diluent degradation

    International Nuclear Information System (INIS)

    Tallent, O.K.; Mailen, J.C.; Pannell, K.D.

    1984-02-01

    The chemical degradation of normal paraffin hydrocarbon (NPH) diluents both in the pure state and mixed with 30% tributyl phosphate (TBP) was investigated in a series of experiments. The results show that degradation of NPH in the TBP-NPH-HNO 3 system is consistent with the active chemical agent being a radical-like nitrogen dioxide (NO 2 ) molecule, not HNO 3 as such. Spectrophotometric, gas chromatographic, mass spectrographic, and titrimetric methods were used to identify the degradation products, which included alkane nitro and nitrate compounds, alcohols, unsaturated alcohols, nitro alcohols, nitro alkenes, ketones, and carboxylic acids. The degradation rate was found to increase with increases in the HNO 3 concentration and the temperature. The rate was decreased by argon sparging to remove NO 2 and by the addition of butanol, which probably acts as a NO 2 scavenger. 13 references, 11 figures

  9. Degradation potential and microbial community structure of heavy oil-enriched microbial consortia from mangrove sediments in Okinawa, Japan.

    Science.gov (United States)

    Bacosa, Hernando P; Suto, Koichi; Inoue, Chihiro

    2013-01-01

    Mangroves constitute valuable coastal resources that are vulnerable to oil pollution. One of the major processes to remove oil from contaminated mangrove sediment is microbial degradation. A study on heavy oil- and hydrocarbon-degrading bacterial consortia from mangrove sediments in Okinawa, Japan was performed to evaluate their capacity to biodegrade and their microbial community composition. Surface sediment samples were obtained from mangrove sites in Okinawa (Teima, Oura, and Okukubi) and enriched with heavy oil as the sole carbon and energy source. The results revealed that all enriched microbial consortia degraded more than 20% of heavy oil in 21 days. The K1 consortium from Okukubi site showed the most extensive degradative capacity after 7 and 21 days. All consortia degraded more than 50% of hexadecane but had little ability to degrade polycyclic aromatic hydrocarbons (PAHs). The consortia were dominated by Pseudomonas or Burkholderia. When incubated in the presence of hydrocarbon compounds, the active bacterial community shifted to favor the dominance of Pseudomonas. The K1 consortium was a superior degrader, demonstrating the highest ability to degrade aliphatic and aromatic hydrocarbon compounds; it was even able to degrade heavy oil at a concentration of 15%(w/v). The dominance and turn-over of Pseudomonas and Burkholderia in the consortia suggest an important ecological role for and relationship between these two genera in the mangrove sediments of Okinawa.

  10. Investigating bioremediation of petroleum hydrocarbons through landfarming using apparent electrical conductivity measurements

    Science.gov (United States)

    Van De Vijver, Ellen; Van Meirvenne, Marc; Seuntjens, Piet

    2015-04-01

    Bioremediation of soil contaminated with petroleum hydrocarbons through landfarming has been widely applied commercially at large scale. Biodegradation is one of the dominant pollutant removal mechanisms involved in landfarming, but strongly depends on the environmental conditions (e.g. presence of oxygen, moisture content). Conventionally the biodegradation process is monitored by the installation of field monitoring equipment and repeated sample collection and analysis. Because the presence of petroleum hydrocarbons and their degradation products can affect the electrical properties of the soil, proximal soil sensors such as electromagnetic induction (EMI) sensors may provide an alternative to investigate the biodegradation process of these contaminants. We investigated the relation between the EMI-based apparent electrical conductivity (ECa) of a landfarm soil and the presence and degradation status of petroleum hydrocarbons. The 3 ha study area was located in an oil refinery complex contaminated with petroleum hydrocarbons, mainly composed of diesel. At the site, a landfarm was constructed in 1999. The most recent survey of the petroleum hydrocarbon concentrations was conducted between 2011 and 2013. The sampling locations were defined by a grid with a 10 m by 10 m cell size and on each location a sample was taken from four successive soil layers with a thickness of 0.5 m each. Because the survey was carried out in phases using different georeferencing methods, the final dataset suffered from uncertainty in the coordinates of the sampling locations. In September 2013 the landfarm was surveyed for ECa with a multi-receiver electromagnetic induction sensor (DUALEM-21S) using motorized conveyance. The horizontal measurement resolution was 1 m by 0.25 m. On each measurement location the sensor recorded four ECa values representative of measurement depths of 0.5 m, 1.0 m, 1.6 m and 3.2 m. After the basic processing, the ECa measurements were filtered to remove

  11. Remediation of petroleum hydrocarbons by inoculation with laboratory-cultured microorganisms

    International Nuclear Information System (INIS)

    Maxwell, C.R.; Baqai, H.A.

    1995-01-01

    An unauthorized release of gasoline from an underground storage tank (UST) impacted the soil and groundwater beneath a maintenance and fueling capacity. The property owner attempted to remediate the site by inoculating wells screened within the unsaturated and saturated zones with laboratory-cultured microorganisms. The inoculation was a one-time event. No nutrients were added to the subsurface. Air was injected into all inoculation wells during the project to promote aerobic microbial activity. At the first groundwater sampling event after inoculation, concentrations of petroleum hydrocarbon constituents increased inoculation wells. Measurements of dissolved oxygen in the groundwater appeared to indicate that oxygen consumption, and thus hydrocarbon degradation, was not occurring. Visual and olfactory evidence of the groundwater indicated evidence of decaying organic matter. After approximately 1 year and a thorough purging of the inoculation wells, decaying matter disappeared and dissolved oxygen and hydrocarbon concentrations generally returned to preproject levels. Further contaminant reduction did not occur, indicating temporary degradation of water quality as a result of the project and unsuccessful remediation

  12. Metagenome reveals potential microbial degradation of hydrocarbon coupled with sulfate reduction in an oil-immersed chimney from Guaymas Basin

    Directory of Open Access Journals (Sweden)

    Ying eHe

    2013-06-01

    Full Text Available Deep-sea hydrothermal vent chimneys contain a high diversity of microorganisms, yet the metabolic activity and the ecological functions of the microbial communities remain largely unexplored. In this study, a metagenomic approach was applied to characterize the metabolic potential in a Guaymas hydrothermal vent chimney and to conduct comparative genomic analysis among a variety of environments with sequenced metagenomes. Complete clustering of functional gene categories with a comparative metagenomic approach showed that this Guaymas chimney metagenome was clustered most closely with a chimney metagenome from Juan de Fuca. All chimney samples were enriched with genes involved in recombination and repair, chemotaxis and flagellar assembly, highlighting their roles in coping with the fluctuating extreme deep-sea environments. A high proportion of transposases was observed in all the metagenomes from deep-sea chimneys, supporting the previous hypothesis that horizontal gene transfer may be common in the deep-sea vent chimney biosphere. In the Guaymas chimney metagenome, thermophilic sulfate reducing microorganisms including bacteria and archaea were found predominant, and genes coding for the degradation of refractory organic compounds such as cellulose, lipid, pullullan, as well as a few hydrocarbons including toluene, ethylbenzene and o-xylene were identified. Therefore, this oil-immersed chimney supported a thermophilic microbial community capable of oxidizing a range of hydrocarbons that served as electron donors for sulphate reduction under anaerobic conditions.

  13. Development and application of techniques for monitoring the bioremediation of petroleum hydrocarbon-contaminated soils

    International Nuclear Information System (INIS)

    Greer, C.; Hawar, J.; Samson, R.

    1994-01-01

    A series of tests was designed to examine bioremediation potential in soil and to monitor performance during the treatment operation. Physical and chemical characterization of the soil provides information on the types of organics, their concentrations, and whether interfering materials are present. Microbiological assessment involves culturing of bacterial populations in the soil and examination of the colonies to determine which have the genetic potential to degrade the soil contaminants. Catabolic gene probes are used to survey viable bacteria from petroleum hydrocarbon contaminated soils. Such soils consistently demonstrate the presence of bacteria possessing the genetic capability to degrade simple straight-chain alkanes and aromatics. Mineralization and respirometric studies are indicators of the biological activity in the soil, and can be directed at microbial activity towards specific substrates. Gene probe monitoring of a petroleum hydrocarbon contaminated soil during biopile treatment demonstrated that hydrocarbon-degrading bacterial numbers and activity were temperature dependent. The results showed that the activity of the indigenous bacteria as measured by hexadecane mineralization also correlated with the disappearance of the oil and grease. The application of this protocol has provided a useful means to screen contaminated soils for bacteria with desirable catabolic properties and to monitor pollutant-degrading bacteria during biotreatment. 15 refs., 10 figs

  14. Theory and application of landfarming to remediate polycyclic aromatic hydrocarbons and mineral oil-contaminated sediments: beneficial reuse

    NARCIS (Netherlands)

    Harmsen, J.; Rulkens, W.H.; Sims, R.C.; Rijtema, P.E.; Zweers, A.J.

    2007-01-01

    When applying landfarming for the remediation of contaminated soil and sediment, a fraction of the soil-bound contaminant is rapidly degraded; however, a residual concentration may remain, which slowly degrades. Degradation of polycyclic aromatic hydrocarbons (PAHs) and mineral oil can be described

  15. Analysis of organic pollutant degradation in pulsed plasma by coherent anti-Stokes Raman spectroscopy

    International Nuclear Information System (INIS)

    Bratescu, Maria Antoneta; Hieda, Junko; Umemura, Tomonari; Saito, Nagahiro; Takai, Osamu

    2011-01-01

    The degradation of p-benzoquinone (p-BQ) in water was investigated by the coherent anti-Stokes Raman spectroscopy (CARS) method, in which the change of the anti-Stokes signal intensity corresponding to the vibrational transitions of the molecule is monitored during and after solution plasma processing (SPP). In the beginning of SPP treatment, the CARS signal intensity of the ring vibrational molecular transitions at 1233 and 1660 cm -1 increases under the influence of the electric field of the plasma, depending on the delay time between the plasma pulse and the laser firing pulse. At the same time, the plasma contributes to the degradation of p-BQ molecules by generating hydrogen and hydroxyl radicals, which decompose p-BQ into different carboxylic acids. After SPP, the CARS signal intensity of the vibrational bands of p-BQ ceased and the degradation of p-BQ was confirmed by UV-visible absorption spectroscopy and liquid chromatography analysis.

  16. The marine bacterium Marinobacter hydrocarbonoclasticus SP17 degrades a wide range of lipids and hydrocarbons through the formation of oleolytic biofilms with distinct gene expression profiles.

    Science.gov (United States)

    Mounier, Julie; Camus, Arantxa; Mitteau, Isabelle; Vaysse, Pierre-Joseph; Goulas, Philippe; Grimaud, Régis; Sivadon, Pierre

    2014-12-01

    Hydrophobic organic compounds (mainly lipids and hydrocarbons) represent a significant part of the organic matter in marine waters, and their degradation has an important impact in the carbon fluxes within oceans. However, because they are nearly insoluble in the water phase, their degradation by microorganisms occurs at the interface with water and thus requires specific adaptations such as biofilm formation. We show that Marinobacter hydrocarbonoclasticus SP17 develops biofilms, referred to as oleolytic biofilms, on a large variety of hydrophobic substrates, including hydrocarbons, fatty alcohols, fatty acids, triglycerides, and wax esters. Microarray analysis revealed that biofilm growth on n-hexadecane or triolein involved distinct genetic responses, together with a core of common genes that might concern general mechanisms of biofilm formation. Biofilm growth on triolein modulated the expression of hundreds of genes in comparison with n-hexadecane. The processes related to primary metabolism and genetic information processing were downregulated. Most of the genes that were overexpressed on triolein had unknown functions. Surprisingly, their genome localization was restricted to a few regions identified as putative genomic islands or mobile elements. These results are discussed with regard to the adaptive responses triggered by M. hydrocarbonoclasticus SP17 to occupy a specific niche in marine ecosystems. © 2014 Federation of European Microbiological Societies. Published by John Wiley & Sons Ltd. All rights reserved.

  17. Application of compound specific 13C isotope investigations of chlorinated hydrocarbons in contaminated groundwaters

    International Nuclear Information System (INIS)

    Osenbrueck, K.; Heidinger, M.; Voropaev, A.; Ertl, S.; Eichinger, L.

    2002-01-01

    Full text: Chlorinated hydrocarbons are one of the most common pollutants found in groundwater. Due to complex contamination situations with overlapping contamination plumes the assessment of the organic contaminants requires the installation of expensive observation wells and high analytical effort. Here the determination of the stable isotope ratio 13 C/ 12 C of the organic compounds offers a promising and efficient tool to investigate the origin and the biodegradation characteristics of the chlorinated hydrocarbons in groundwater. The application of the method is based on characteristic isotope fingerprints, differing in chlorinated solvents. This isotope fingerprint is derived from different production pathways and is not influenced by transport or by retardation processes in the underground. Due to the fact, that two different contaminations can easily be distinguished by isotope ratios, an improved distinction of spatially and temporally different contamination plumes might be possible. In course of biologically mediated degradation processes a shift of the isotope ratios between the precursor and the product can frequently be observed, such as with denitrification or sulfate reduction processes. The isotope fractionation is due to a preferential reaction of the bonds formed by the lighter isotopes and leads to a progressive enrichment of the heavy isotopes in the precursor while the product becomes depleted in the heavy isotopes. Biological degradation of the highly chlorinated hydrocarbons is due to a co-metabolic dechlorinisation. Tetrachloroethene (PCE) for example degrades under anoxic conditions via trichloroethene (TCE) to cis-1,2-dichloroethene (cDCE). Subsequent degradation to vinyl chloride (VC) and ethene may appear under aerobic as well as reducing environments depending on the site specific conditions. In several laboratory studies it has been shown, that biodegradation of the chlorinated hydrocarbons is accompanied by an isotope fractionation of

  18. Biodegradation of aged polycyclic aromatic hydrocarbons (PAHs) by microbial consortia in soil and slurry phases.

    Science.gov (United States)

    Li, Xiaojun; Li, Peijun; Lin, Xin; Zhang, Chungui; Li, Qi; Gong, Zongqiang

    2008-01-15

    Microbial consortia isolated from aged oil-contaminated soil were used to degrade 16 polycyclic aromatic hydrocarbons (15.72 mgkg(-1)) in soil and slurry phases. The three microbial consortia (bacteria, fungi and bacteria-fungi complex) could degrade polycyclic aromatic hydrocarbons (PAHs), and the highest PAH removals were found in soil and slurry inoculated with fungi (50.1% and 55.4%, respectively). PAHs biodegradation in slurry was lower than in soil for bacteria and bacteria-fungi complex inoculation treatments. Degradation of three- to five-ring PAHs treated by consortia was observed in soil and slurry, and the highest degradation of individual PAHs (anthracene, fluoranthene, and benz(a)anthracene) appeared in soil (45.9-75.5%, 62-83.7% and 64.5-84.5%, respectively) and slurry (46.0-75.8%, 50.2-86.1% and 54.3-85.7%, respectively). Therefore, inoculation of microbial consortia (bacteria, fungi and bacteria-fungi complex) isolated from in situ contaminated soil to degrade PAHs could be considered as a successful method.

  19. Degradation and mineralization of the polycyclic aromatic hydrocarbons anthracene and naphthalene in intertidal marine sediments

    International Nuclear Information System (INIS)

    Bauer, J.E.; Capone, D.G.

    1985-01-01

    The degradation of the polynuclear aromatic hydrocarbons (PAHs) anthracene and naphthalene by the microbiota of intertidal sediments was investigated in laboratory studies. No mineralization of either PAH was observed in the absence of oxygen. Both rates and total amounts of PAH mineralization were strongly controlled by oxygen content and temperature of the incubations. Inorganic nitrogen and glucose amendments had minimal effects on PAH mineralization. The rates and total amounts of PAH mineralized were directly related to compound concentration, pre-exposure time, and concentration. Maximum mineralization was observed at the higher concentrations (5 to 100 μg/g [ppm]) of both PAHs. Optimal acclimation to anthracene and naphthalene (through pre-exposures to the compounds) occurred at the highest acclimation concentration (1,000 ppm). However, acclimation to a single concentration (100 ppm) resulted in initial relative mineralization rates over a range of re-exposure concentrations (1 to 1,000 ppm) being nearly identical. Maximum mineralization of both PAHs occurred after intermediate periods (1 to 2 weeks) of pre-exposure. The fraction of the total heterotrophic population capable of utilizing anthracene or naphthalene as sole carbon source was also greatest after 2 weeks

  20. Exposing of Trichoderma spp. to gamma radiation for stimulating its pesticide biodegradation activity

    International Nuclear Information System (INIS)

    Afify, A.E.M.R.; Ibrahim, G.M.; Abo El Seoud, M.A.; Helal, I.M.M.; Kassem, B.W.

    2012-01-01

    This work has been conducted to study the possibility of making use of fungi for degrading insecticide-carbofuran. Trichoderma spp. were showed highly potentiality to metabolize carbofuran (200 mg/ kg) to 3-ketocarbofuran in soil as a sole carbon and energy source within 14 days. Carbofuran and its main metabolite were analyzed by high performance liquid chromatography (HPLC). Studies on biodegradation in the soil showed that 81.5 % and 86 % of carbofuran degraded within 14 days of incubation by T. harzianum and T. viride strains, respectively. The lowest dose of gamma irradiation 0.25 KGy enhanced the mycelial dry weight by 22.8 % and 16.2 % for T. harzianum and T. viride strains, respectively. This indicated that the isolates of Trichoderma spp. were potentially useful for carbofuran bioremediation.

  1. Potential impact of soil microbial heterogeneity on the persistence of hydrocarbons in contaminated subsurface soils.

    Science.gov (United States)

    Aleer, Sam; Adetutu, Eric M; Weber, John; Ball, Andrew S; Juhasz, Albert L

    2014-04-01

    In situ bioremediation is potentially a cost effective treatment strategy for subsurface soils contaminated with petroleum hydrocarbons, however, limited information is available regarding the impact of soil spatial heterogeneity on bioremediation efficacy. In this study, we assessed issues associated with hydrocarbon biodegradation and soil spatial heterogeneity (samples designated as FTF 1, 5 and 8) from a site in which in situ bioremediation was proposed for hydrocarbon removal. Test pit activities showed similarities in FTF soil profiles with elevated hydrocarbon concentrations detected in all soils at 2 m below ground surface. However, PCR-DGGE-based cluster analysis showed that the bacterial community in FTF 5 (at 2 m) was substantially different (53% dissimilar) and 2-3 fold more diverse than communities in FTF 1 and 8 (with 80% similarity). When hydrocarbon degrading potential was assessed, differences were observed in the extent of (14)C-benzene mineralisation under aerobic conditions with FTF 5 exhibiting the highest hydrocarbon removal potential compared to FTF 1 and 8. Further analysis indicated that the FTF 5 microbial community was substantially different from other FTF samples and dominated by putative hydrocarbon degraders belonging to Pseudomonads, Xanthomonads and Enterobacteria. However, hydrocarbon removal in FTF 5 under anaerobic conditions with nitrate and sulphate electron acceptors was limited suggesting that aerobic conditions were crucial for hydrocarbon removal. This study highlights the importance of assessing available microbial capacity prior to bioremediation and shows that the site's spatial heterogeneity can adversely affect the success of in situ bioremediation unless area-specific optimizations are performed. Copyright © 2014 Elsevier Ltd. All rights reserved.

  2. Bioremediation of petroleum hydrocarbons in soil environments

    International Nuclear Information System (INIS)

    Rowell, M.J.; Ashworth, J.; Qureshi, A.A.

    1992-12-01

    The bioremediation of petroleum hydrocarbons in soil environments was reviewed via a literature survey and discussions with workers in relevant disciplines. The impacts of hydrocarbons on soil are discussed along with a range of methods available to assist in their decomposition by soil microorganisms. The range of petroleum-based materials considered includes conventional and synthetic crude oils, refined oils, sludges, asphalts and bitumens, drilling mud residues, creosote tars, and some pesticides. The degradability of hydrocarbons largely depends upon their aqueous solubility and their adsorption on soil surfaces and, therefore, is related to their molecular structures. The ease of decomposition decreases with increasing complexity of structure, in the order aliphatics > aromatics > heterocyclics and asphaltenes (most recalcitrant). Most soils contain an adequate population of microorganisms and hence bioaugmentation may only be needed in special circumstances. Decomposition is fastest in soils where the hydrocarbon loading rate, aeration, nutrition, moisture, and pH are all optimized. At spill sites there is little control over the application rate, although containment measures can assist in either limiting contamination or distributing it more evenly. The enhancement of bioremediation is discussed in light of all these factors. Other techniques such as enhanced aeration, hydrocarbon decomposition by anaerobic processes, surfactants, and burning are also discussed. 211 refs., 11 figs., 10 tabs

  3. Bioremediation of petroleum hydrocarbons in soil environments

    Energy Technology Data Exchange (ETDEWEB)

    Rowell, M J; Ashworth, J; Qureshi, A A

    1992-12-01

    The bioremediation of petroleum hydrocarbons in soil environments was reviewed via a literature survey and discussions with workers in relevant disciplines. The impacts of hydrocarbons on soil are discussed along with a range of methods available to assist in their decomposition by soil microorganisms. The range of petroleum-based materials considered includes conventional and synthetic crude oils, refined oils, sludges, asphalts and bitumens, drilling mud residues, creosote tars, and some pesticides. The degradability of hydrocarbons largely depends upon their aqueous solubility and their adsorption on soil surfaces and, therefore, is related to their molecular structures. The ease of decomposition decreases with increasing complexity of structure, in the order aliphatics > aromatics > heterocyclics and asphaltenes (most recalcitrant). Most soils contain an adequate population of microorganisms and hence bioaugmentation may only be needed in special circumstances. Decomposition is fastest in soils where the hydrocarbon loading rate, aeration, nutrition, moisture, and pH are all optimized. At spill sites there is little control over the application rate, although containment measures can assist in either limiting contamination or distributing it more evenly. The enhancement of bioremediation is discussed in light of all these factors. Other techniques such as enhanced aeration, hydrocarbon decomposition by anaerobic processes, surfactants, and burning are also discussed. 211 refs., 11 figs., 10 tabs.

  4. Advances of naphthalene degradation in Pseudomonas putida ND6

    Science.gov (United States)

    Song, Fu; Shi, Yifei; Jia, Shiru; Tan, Zhilei; Zhao, Huabing

    2018-03-01

    Naphthalene is one of the most common and simple polycyclic aromatic hydrocarbons. Degradation of naphthalene has been greatly concerned due to its economic, free-pollution and its fine effect in Pseudomonas putida ND6. This review summarizes the development history of naphthalene degradation, the research progress of naphthalene degrading gene and naphthalene degradation pathway of Pseudomonas putida ND6, and the researching path of this strain. Although the study of naphthalene degradation is not consummate in Pseudomonas putida ND6, there is a potential capability for Pseudomonas putida ND6 to degrade the naphthalene in the further research.

  5. Traditional herbal medicines: potential degradation of sterols and sterolins by microbial contaminants

    Directory of Open Access Journals (Sweden)

    S. Govender

    2010-01-01

    Full Text Available Medicinal plants with a high content of sterols and sterolins, such as Bulbine natalensis (rooiwortel and Hypoxis hemerocallidea (African potato, are commonly and inappropriately used in South Africa for the treatment of HIV/AIDS due to the inaccessibility of antiretroviral drugs. This study investigated the presence of active compounds, such as sterols and sterolins, in the herbal medicines. The research was carried out in the Nelson Mandela Metropole area. The effect of microbial contaminants isolated from the medicines on sterols and sterolins of rooiwortel extracts was assessed. Sterols and sterolins were detected in rooiwortel, raw African potatoes and one ready-made mixture. Co-incubation of rooiwortel with bacteria (Bacillus spp. and Pseudomonas putida and fungi (Aspergillus spp., Penicillium spp. and Mucor spp. that were isolated from these samples increased the rate of degradation of sterols and sterolins over time, with slower degradation at 4°C than at 28°C.

  6. Hydrocarbons (aliphatic and aromatic) in the snow-ice cover in the Arctic

    International Nuclear Information System (INIS)

    Nemirovskaya, I.A.; Novigatsky, A.N.; Kluvitkin, A.A.

    2002-01-01

    This paper presented the concentration and composition of aliphatic hydrocarbons and polycyclic aromatic hydrocarbons (PAHs) in snow and ice-infested waters in the France-Victoria trough in the northern Barents Sea and in the Mendeleev ridge in the Amerasian basin of the Arctic Ocean. Extreme conditions such as low temperatures, ice sheets and the polar nights render the arctic environment susceptible to oil spills. Hydrocarbons found in these northern seas experience significant transformations. In order to determine the sources, pathways and transformations of the pollutants, it is necessary to know their origin. Hydrocarbon distributions is determined mostly by natural hydrobiological and geochemical conditions. The regularity of migration is determined by natural factors such as formation and circulation of air and ice drift. There is evidence suggesting that the hydrocarbons come from pyrogenic sources. It was noted that hydrocarbons could be degraded even at low temperatures. 17 refs., 1 tab

  7. Wheat straw lignin degradation induction to aromatics by por Aspergillus spp. and Penicillium chrysogenum

    Directory of Open Access Journals (Sweden)

    Baltierra-Trejo Eduardo

    2016-02-01

    Full Text Available Wheat straw is a recalcitrant agricultural waste; incineration of this material represents an important environmental impact. Different reports have been made regarding the use of the structural components of wheat straw, i.e. cellulose, hemicellulose and lignin; however, lignin has been less exploited because it is largely considered the recalcitrant part. Residual wheat straw lignin (REWSLI has a potential biotech-nological value if depolymerization is attained to produce aromatics. Ligninolytic mitosporic fungus represent an alternative where very little research has been done, even though they are capable of depol-ymerize REWSLI in simple nutritional conditions in relatively short periods, when compared to basidio-mycetes. The aim of this research was to study the depolymerization activity of Aspergillus spp and Penicillium spp on semipurified REWSLI as the sole carbon source to produce aromatics. The depoly-merization capacity was determined by the activity of the laccase, lignin peroxidase and manganese peroxidase enzymes. The generated aromatics derived from the REWSLI depolymerization were identi-fied by gas chromatography. Obtained results revealed that Penicillium chrysogenum depolymerized the lignin material by 34.8% during the 28-day experimentation period. Laccase activity showed the largest activity with 111 U L-1 in a seven-day period, this enzyme induction was detected in a smaller period than that required by basidiomycetes to induce it. Moreover, the enzymatic activity was produced with-out the addition of an extra carbon source as metabolic inductor. Aspergillus spp and Penicillium spp generated guaiacol, vanillin, and hydroxybenzoic, vanillinic, syringic and ferulic acid with a maximum weekly production of 3.5, 3.3, 3.2, 3.3, 10.1 and 21.9 mg mL-1, respectively.

  8. Nutrients can enhance the abundance and expression of alkane hydroxylase CYP153 gene in the rhizosphere of ryegrass planted in hydrocarbon-polluted soil.

    Directory of Open Access Journals (Sweden)

    Muhammad Arslan

    Full Text Available Plant-bacteria partnership is a promising strategy for the remediation of soil and water polluted with hydrocarbons. However, the limitation of major nutrients (N, P and K in soil affects the survival and metabolic activity of plant associated bacteria. The objective of this study was to explore the effects of nutrients on survival and metabolic activity of an alkane degrading rhizo-bacterium. Annual ryegrass (Lolium multiflorum was grown in diesel-contaminated soil and inoculated with an alkane degrading bacterium, Pantoea sp. strain BTRH79, in greenhouse experiments. Two levels of nutrients were applied and plant growth, hydrocarbon removal, and gene abundance and expression were determined after 100 days of sowing of ryegrass. Results obtained from these experiments showed that the bacterial inoculation improved plant growth and hydrocarbon degradation and these were further enhanced by nutrients application. Maximum plant biomass production and hydrocarbon mineralization was observed by the combined use of inoculum and higher level of nutrients. The presence of nutrients in soil enhanced the colonization and metabolic activity of the inoculated bacterium in the rhizosphere. The abundance and expression of CYP153 gene in the rhizosphere of ryegrass was found to be directly associated with the level of applied nutrients. Enhanced hydrocarbon degradation was associated with the population of the inoculum bacterium, the abundance and expression of CYP153 gene in the rhizosphere of ryegrass. It is thus concluded that the combination between vegetation, inoculation with pollutant-degrading bacteria and nutrients amendment was an efficient approach to reduce hydrocarbon contamination.

  9. Nutrients Can Enhance the Abundance and Expression of Alkane Hydroxylase CYP153 Gene in the Rhizosphere of Ryegrass Planted in Hydrocarbon-Polluted Soil

    Science.gov (United States)

    Arslan, Muhammad; Afzal, Muhammad; Amin, Imran; Iqbal, Samina; Khan, Qaiser M.

    2014-01-01

    Plant-bacteria partnership is a promising strategy for the remediation of soil and water polluted with hydrocarbons. However, the limitation of major nutrients (N, P and K) in soil affects the survival and metabolic activity of plant associated bacteria. The objective of this study was to explore the effects of nutrients on survival and metabolic activity of an alkane degrading rhizo-bacterium. Annual ryegrass (Lolium multiflorum) was grown in diesel-contaminated soil and inoculated with an alkane degrading bacterium, Pantoea sp. strain BTRH79, in greenhouse experiments. Two levels of nutrients were applied and plant growth, hydrocarbon removal, and gene abundance and expression were determined after 100 days of sowing of ryegrass. Results obtained from these experiments showed that the bacterial inoculation improved plant growth and hydrocarbon degradation and these were further enhanced by nutrients application. Maximum plant biomass production and hydrocarbon mineralization was observed by the combined use of inoculum and higher level of nutrients. The presence of nutrients in soil enhanced the colonization and metabolic activity of the inoculated bacterium in the rhizosphere. The abundance and expression of CYP153 gene in the rhizosphere of ryegrass was found to be directly associated with the level of applied nutrients. Enhanced hydrocarbon degradation was associated with the population of the inoculum bacterium, the abundance and expression of CYP153 gene in the rhizosphere of ryegrass. It is thus concluded that the combination between vegetation, inoculation with pollutant-degrading bacteria and nutrients amendment was an efficient approach to reduce hydrocarbon contamination. PMID:25360680

  10. Coastal habitat degradation and green sea turtle diets in Southeastern Brazil

    Science.gov (United States)

    Santos, Robson G.; Martins, Agnaldo Silva; Farias, Julyana da Nobrega; Horta, Antunes Paulo; Pinheiro, Hudson Tercio; Baptistotte, Cecilia; Seminoff, Jeffrey A.; Balazs, George H.; Work, Thierry M.

    2011-01-01

    To show the influence of coastal habitat degradation on the availability of food for green turtles (Chelonia mydas), we assessed the dietary preferences and macroalgae community at a feeding area in a highly urbanized region. The area showed low species richness and was classified as degraded. We examined stomach contents of 15 dead stranded turtles (CCL = 44.0 cm (SD 6.7 cm)). The diet was composed primarily of green algae Ulva spp. (83.6%). In contrast, the macroalgae community was dominated by the green alga Caulerpa mexicana. We found a selection for red algae, seagrass and Ulva spp., and avoidance for C. mexicana and brown alga Dictyopteris delicatula. The low diversity of available food items, possibly a result of environmental degradation, likely contributed to the low dietary diversity. The nutritional implications of this restricted diet are unclear.

  11. Comparison of the fuel oil biodegradation potential of hydrocarbon-assimilating microorganisms isolated from a temperate agricultural soil

    International Nuclear Information System (INIS)

    Chaineau, C.H.; Dupont, J.; Bury, E.; Oudot, J.; Morel, J.

    1999-01-01

    Strains of hydrocarbon-degrading microorganisms (bacteria and fungi) were isolated from an agricultural soil in France. In a field, a portion was treated with oily cuttings resulting from the drilling of an onshore well. The cuttings which were spread at the rate of 600 g HC m -2 contained 10% of fuel oil hydrocarbons (HC). Another part of the field was left untreated. Three months after HC spreading, HC adapted bacteria and fungi were isolated at different soil depths in the two plots and identified. The biodegradation potential of the isolated strains was monitored by measuring the degradation rate of total HC, saturated hydrocarbons, aromatic hydrocarbons and resins of the fuel. Bacteria of the genera Pseudomonas, Brevundimonas, Sphingomonas, Acinetobacter, Rhodococcus, Arthrobacter, Corynebacterium and fungi belonging to Aspergillus, Penicillium, Beauveria, Acremonium, Cladosporium, Fusarium, and Trichoderma were identified. The most active strains in the assimilation of saturates and aromatics were Arthrobacter sp., Sphingomonas spiritivorum, Acinetobacter baumanii, Beauveria alba and Penicillum simplicissimum. The biodegradation potential of the hydrocarbon utilizing microorganisms isolated from polluted or unpolluted soils were similar. In laboratory pure cultures, saturated HC were more degraded than aromatic HC, whereas resins were resistant to microbial attack. On an average, individual bacterial strains were more active than fungi in HC biodegradation. (Copyright (c) 1999 Elsevier Science B.V., Amsterdam. All rights reserved.)

  12. Bioavailability of hydrocarbons to bacterial consortia during Triton X-100 mediated biodegradation in aqueous media.

    Science.gov (United States)

    Pęziak, Daria; Piotrowska, Aleksandra; Marecik, Roman; Lisiecki, Piotr; Woźniak, Marta; Szulc, Alicja; Ławniczak, Łukasz; Chrzanowski, Łukasz

    2013-01-01

    The aim of our study was to investigate the effect of Triton X-100 on the biodegradation efficiency of hexadecane and phenanthrene carried out by two bacterial consortia. It was established that the tested consortia were not able to directly uptake compounds closed in micelles. It was observed that in micellar systems the nonionic synthetic surfactant was preferentially degraded (the degradation efficiency of Triton X-100 after 21 days was 70% of the initial concentration - 500 mg/l), followed by a lesser decomposition of hydrocarbon released from the micelles (30% for hexadecane and 20% for phenanthrene). However, when hydrocarbons were used as the sole carbon source, 70% of hexadecane and 30% of phenanthrene were degraded. The degradation of the surfactant did not contribute to notable shifts in bacterial community dynamics, as determined by Real-Time PCR. The obtained results suggest that if surfactant-supplementation is to be used as an integral part of a bioremediation process, then possible bioavailability decrease due to entrapment of the contaminant into surfactant micelles should also be taken into consideration, as this phenomenon may have a negative impact on the biodegradation efficiency. Surfactant-induced mobilization of otherwise recalcitrant hydrocarbons may contribute to the spreading of contaminants in the environment and prevent their biodegradation.

  13. Evidence for in situ degradation of mono-and polyaromatic hydrocarbons in alluvial sediments based on microcosm experiments with 13C-labeled contaminants

    International Nuclear Information System (INIS)

    Morasch, B.; Hoehener, P.; Hunkeler, D.

    2007-01-01

    A microcosm study was conducted to investigate the degradation of mono- and polyaromatic hydrocarbons under in situ-like conditions using alluvial sediments from the site of a former cokery. Benzene, naphthalene, or acenaphthene were added to the sediments as 13 C-labeled substrates. Based on the evolution of 13 C-CO 2 determined by gas chromatography isotope-ratio mass spectrometry (GC-IRMS) it was possible to prove mineralization of the compound of interest in the presence of other unknown organic substances of the sediment material. This new approach was suitable to give evidence for the intrinsic biodegradation of benzene, naphthalene, and acenaphthene under oxic and also under anoxic conditions, due to the high sensitivity and reproducibility of 13 C/ 12 C stable isotope analysis. This semi-quantitative method can be used to screen for biodegradation of any slowly degrading, strongly sorbing compound in long-term experiments. - A method based on 13 C-labeled substrates was developed to determine the intrinsic biodegradation potential of aromatic pollutants under oxic and under anoxic conditions

  14. Isolation and characterisation of theobromine-degrading filamentous fungi.

    Science.gov (United States)

    Oduro-Mensah, Daniel; Ocloo, Augustine; Lowor, Sammy T; Bonney, Evelyn Y; Okine, Laud K N A; Adamafio, Naa Ayikailey

    2018-01-01

    Strategies for achieving global food security include identification of alternative feedstock for use as animal feed, to contribute towards efforts at increasing livestock farming. The presence of theobromine in cocoa pod husks, a major agro-waste in cocoa-producing countries, hinders its utilisation for this purpose. Cheap treatment of cocoa pod husks to remove theobromine would allow largescale beneficial use of the millions of metric tonnes generated annually. The aim of this study was to isolate theobromine-degrading filamentous fungi that could serve as bioremediation agents for detheobromination of cocoa pod husks. Filamentous fungi were screened for ability to degrade theobromine. The most promising isolates were characterized with respect to optimal environmental conditions for theobromine degradation. Secretion of theobromine-degrading enzymes by the isolates was investigated. Theobromine degradation was monitored by HPLC. Of fourteen theobromine-degrading isolates collected and identified by rDNA 5.8S and ITS sequences, seven belonged to Aspergillus spp. and six were Talaromyces spp. Based on the extent of theobromine utilization, four isolates; Aspergillus niger, Talaromyces verruculosus and two Talaromyces marneffei, showed the best potential for use as bioagents for detheobromination. First-time evidence was found of the use of xanthine oxidase and theobromine oxidase in degradation of a methylxanthine by fungal isolates. Metabolism of theobromine involved initial demethylation at position 7 to form 3-methylxanthine, or initial oxidation at position 8 to form 3,7-dimethyuric acid. All four isolates degraded theobromine beyond uric acid. The data suggest that the four isolates can be applied to substrates, such as cocoa pod husks, for elimination of theobromine. Copyright © 2017 Elsevier GmbH. All rights reserved.

  15. More than 2500 years of oil exposure shape sediment microbiomes with the potential for syntrophic degradation of hydrocarbons linked to methanogenesis.

    Science.gov (United States)

    Michas, Antonios; Vestergaard, Gisle; Trautwein, Kathleen; Avramidis, Pavlos; Hatzinikolaou, Dimitris G; Vorgias, Constantinos E; Wilkes, Heinz; Rabus, Ralf; Schloter, Michael; Schöler, Anne

    2017-09-11

    Natural oil seeps offer the opportunity to study the adaptation of ecosystems and the associated microbiota to long-term oil exposure. In the current study, we investigated a land-to-sea transition ecosystem called "Keri Lake" in Zakynthos Island, Greece. This ecosystem is unique due to asphalt oil springs found at several sites, a phenomenon already reported 2500 years ago. Sediment microbiomes at Keri Lake were studied, and their structure and functional potential were compared to other ecosystems with oil exposure histories of various time periods. Replicate sediment cores (up to 3-m depth) were retrieved from one site exposed to oil as well as a non-exposed control site. Samples from three different depths were subjected to chemical analysis and metagenomic shotgun sequencing. At the oil-exposed site, we observed high amounts of asphalt oil compounds and a depletion of sulfate compared to the non-exposed control site. The numbers of reads assigned to genes involved in the anaerobic degradation of hydrocarbons were similar between the two sites. The numbers of denitrifiers and sulfate reducers were clearly lower in the samples from the oil-exposed site, while a higher abundance of methanogens was detected compared to the non-exposed site. Higher abundances of the genes of methanogenesis were also observed in the metagenomes from other ecosystems with a long history of oil exposure, compared to short-term exposed environments. The analysis of Keri Lake metagenomes revealed that microbiomes in the oil-exposed sediment have a higher potential for methanogenesis over denitrification/sulfate reduction, compared to those in the non-exposed site. Comparison with metagenomes from various oil-impacted environments suggests that syntrophic interactions of hydrocarbon degraders with methanogens are favored in the ecosystems with a long-term presence of oil.

  16. Extracellular enzyme activities during lignocellulose degradation by Streptomyces spp.: a comparative study of wild-type and genetically manipulated strains

    International Nuclear Information System (INIS)

    Ramachandra, M.; Crawford, D.L.; Pometto, A.L. III

    1987-01-01

    The wild-type ligninolytic actinomycete Streptomyces viridosporus T7A and two genetically manipulated strains with enhanced abilities to produce a water-soluble lignin degradation intermediate, an acid-precipitable polymeric lignin (APPL), were grown on lignocellulose in solid-state fermentation cultures. Culture filtrates were periodically collected, analyzed for APPL, and assayed for extracellular lignocellulose-catabolizing enzyme activities. Two APPL-overproducing strains, UV irradiation mutant T7A-81 and protoplast fusion recombinant SR-10, had higher and longer persisting peroxidase, esterase, and endoglucanase activities than did the wild-type strain T7A. Results implicated one or more of these enzymes in lignin solubilization. Only mutant T7A-81 had higher xylanase activity than the wild type. The peroxidase was induced by both lignocellulose and APPL. This extracellular enzyme has some similarities to previously described ligninases in fungi. This is the first report of such an enzyme in Streptomyces spp. Four peroxidase isozymes were present, and all catalyzed the oxidation of 3,4-dihydroxyphenylalanine, while one also catalyzed hydrogen peroxide-dependent oxidation of homoprotocatechuic acid and caffeic acid. Three constitutive esterase isozymes were produced which differed in substrate specificity toward α-naphthyl acetate and α-naphthyl butyrate. Three endoglucanase bands, which also exhibited a low level of xylanase activity, were identified on polyacrylamide gels as was one xylanase-specific band. There were no major differences in the isoenzymes produced by the different strains. The probable role of each enzyme in lignocellulose degradation is discussed

  17. Predicting bioremediation of hydrocarbons: Laboratory to field scale

    International Nuclear Information System (INIS)

    Diplock, E.E.; Mardlin, D.P.; Killham, K.S.; Paton, G.I.

    2009-01-01

    There are strong drivers to increasingly adopt bioremediation as an effective technique for risk reduction of hydrocarbon impacted soils. Researchers often rely solely on chemical data to assess bioremediation efficiently, without making use of the numerous biological techniques for assessing microbial performance. Where used, laboratory experiments must be effectively extrapolated to the field scale. The aim of this research was to test laboratory derived data and move to the field scale. In this research, the remediation of over thirty hydrocarbon sites was studied in the laboratory using a range of analytical techniques. At elevated concentrations, the rate of degradation was best described by respiration and the total hydrocarbon concentration in soil. The number of bacterial degraders and heterotrophs as well as quantification of the bioavailable fraction allowed an estimation of how bioremediation would progress. The response of microbial biosensors proved a useful predictor of bioremediation in the absence of other microbial data. Field-scale trials on average took three times as long to reach the same endpoint as the laboratory trial. It is essential that practitioners justify the nature and frequency of sampling when managing remediation projects and estimations can be made using laboratory derived data. The value of bioremediation will be realised when those that practice the technology can offer transparent lines of evidence to explain their decisions. - Detailed biological, chemical and physical characterisation reduces uncertainty in predicting bioremediation.

  18. Targeting of insect epicuticular lipids by the entomopathogenic fungus Beauveria bassiana: hydrocarbon oxidation within the context of a host-pathogen interaction

    Science.gov (United States)

    Pedrini, Nicolás; Ortiz-Urquiza, Almudena; Huarte-Bonnet, Carla; Zhang, Shizhu; Keyhani, Nemat O.

    2013-01-01

    Broad host range entomopathogenic fungi such as Beauveria bassiana attack insect hosts via attachment to cuticular substrata and the production of enzymes for the degradation and penetration of insect cuticle. The outermost epicuticular layer consists of a complex mixture of non-polar lipids including hydrocarbons, fatty acids, and wax esters. Long chain hydrocarbons are major components of the outer waxy layer of diverse insect species, where they serve to protect against desiccation and microbial parasites, and as recognition molecules or as a platform for semiochemicals. Insect pathogenic fungi have evolved mechanisms for overcoming this barrier, likely with sets of lipid degrading enzymes with overlapping substrate specificities. Alkanes and fatty acids are substrates for a specific subset of fungal cytochrome P450 monooxygenases involved in insect hydrocarbon degradation. These enzymes activate alkanes by terminal oxidation to alcohols, which are further oxidized by alcohol and aldehyde dehydrogenases, whose products can enter β-oxidation pathways. B. bassiana contains at least 83 genes coding for cytochrome P450s (CYP), a subset of which are involved in hydrocarbon oxidation, and several of which represent new CYP subfamilies/families. Expression data indicated differential induction by alkanes and insect lipids and four CYP proteins have been partially characterized after heterologous expression in yeast. Gene knockouts revealed a phenotype for only one (cyp52X1) out of six genes examined to date. CYP52X1 oxidizes long chain fatty acids and participates in the degradation of specific epicuticular lipid components needed for breaching the insect waxy layer. Examining the hydrocarbon oxidizing CYP repertoire of pathogens involved in insect epicuticle degradation can lead to the characterization of enzymes with novel substrate specificities. Pathogen targeting may also represent an important co-evolutionary process regarding insect cuticular hydrocarbon

  19. Spatial structure and activity of sedimentary microbial communities underlying a Beggiatoa spp. mat in a Gulf of Mexico hydrocarbon seep.

    Directory of Open Access Journals (Sweden)

    Karen G Lloyd

    Full Text Available BACKGROUND: Subsurface fluids from deep-sea hydrocarbon seeps undergo methane- and sulfur-cycling microbial transformations near the sediment surface. Hydrocarbon seep habitats are naturally patchy, with a mosaic of active seep sediments and non-seep sediments. Microbial community shifts and changing activity patterns on small spatial scales from seep to non-seep sediment remain to be examined in a comprehensive habitat study. METHODOLOGY/PRINCIPAL FINDINGS: We conducted a transect of biogeochemical measurements and gene expression related to methane- and sulfur-cycling at different sediment depths across a broad Beggiatoa spp. mat at Mississippi Canyon 118 (MC118 in the Gulf of Mexico. High process rates within the mat ( approximately 400 cm and approximately 10 cm from the mat's edge contrasted with sharply diminished activity at approximately 50 cm outside the mat, as shown by sulfate and methane concentration profiles, radiotracer rates of sulfate reduction and methane oxidation, and stable carbon isotopes. Likewise, 16S ribosomal rRNA, dsrAB (dissimilatory sulfite reductase and mcrA (methyl coenzyme M reductase mRNA transcripts of sulfate-reducing bacteria (Desulfobacteraceae and Desulfobulbaceae and methane-cycling archaea (ANME-1 and ANME-2 were prevalent at the sediment surface under the mat and at its edge. Outside the mat at the surface, 16S rRNA sequences indicated mostly aerobes commonly found in seawater. The seep-related communities persisted at 12-20 cm depth inside and outside the mat. 16S rRNA transcripts and V6-tags reveal that bacterial and archaeal diversity underneath the mat are similar to each other, in contrast to oxic or microoxic habitats that have higher bacterial diversity. CONCLUSIONS/SIGNIFICANCE: The visual patchiness of microbial mats reflects sharp discontinuities in microbial community structure and activity over sub-meter spatial scales; these discontinuities have to be taken into account in geochemical and

  20. Novel diesel-oil-degrading bacteria and fungi from the Ecuadorian Amazon rainforest.

    Science.gov (United States)

    Maddela, N R; Masabanda, M; Leiva-Mora, M

    2015-01-01

    Isolating new diesel-oil-degrading microorganisms from crude-oil contaminated sites and evaluating their degradation capacities are vitally important in the remediation of oil-polluted environments and crude-oil exploitation. In this research, new hydrocarbon-degrading bacteria and fungi were isolated from the crude-oil contaminated soil of the oil-fields in the Amazon rainforest of north-east Ecuador by using a soil enrichment technique. Degradation analysis was tracked by gas chromatography and a flame ionization detector. Under laboratory conditions, maximum degradability of the total n-alkanes reached up to 77.34 and 62.62 removal ratios after 30 days of incubation for the evaporated diesel oil by fungi (isolate-1) and bacteria (isolate-1), respectively. The 16S/18S rDNA sequence analysis indicated that the microorganisms were most closely (99-100%) related to Bacillus cereus (isolate-1), Bacillus thuringiensis (isolate-2), Geomyces pannorum (isolate-1), and Geomyces sp. (isolate-2). Therefore, these strains enable the degradation of hydrocarbons as the sole carbon source, and these findings will benefit these strains in the remediation of oil-polluted environments and oil exploitation.

  1. Monitoring biodegradation of hydrocarbons by stable isotope fractionation

    Science.gov (United States)

    Dorer, Conrad; Fischer, Anko; Herrmann, Steffi; Richnow, Hans-Hermann; Vogt, Carsten

    2010-05-01

    In the last decade, several studies have demonstrated that stable isotope tools are highly applicable for monitoring anaerobic biodegradation processes. An important methodological approach is to characterize distinct degradation pathways with respect to the specific mechanism of C-H-bond cleavage and to quantify the extent of biodegradation by compound specific isotope analysis (CSIA). Here, enrichment factors (ɛbulk) needed for a CSIA field site approach must be determined in laboratory reference experiments. Recent research results from different laboratories have shown that single ɛbulk values for similar degradation pathways can be highly variable; thus, the use of two-dimensional compound specific isotope analysis (2D-CSIA) has been encouraged for characterizing biodegradation pathways more precisely. 2D-CSIA for hydrocarbons can be expressed by the slope of the linear regression for hydrogen versus carbon discrimination known as lambda ≈ ɛHbulk/ɛCbulk. We determined the carbon and hydrogen isotope fractionation for the biodegradation of benzene, toluene and xylenes by various reference cultures. Specific enzymatic reactions initiating different biodegradation pathways could be distinguished by 2D-CSIA. For the aerobic di- and monohydroxylation of the benzene ring, lambda values always lower than 9 were observed. Enrichment cultures degrading benzene anaerobically produced significant different values: lambda values between 8-19 were oberved for nitrate-reducing consortia, whereas sulfate-reducing and methanogenic consortia showed always lambda values greater than 20 [1,2]. The observed variations suggest that (i) aerobic benzene biodegradation can be distinguished from anaerobic biodegradation, and (ii) that more than a single mechanism seems to exist for the activation of benzene under anoxic conditions. lambda values for anaerobic toluene degradation initiated by the enzyme benzylsuccinate synthase (BSS) ranged from 4 to 41, tested with strains using

  2. Phytoremediation of petroleum hydrocarbon-contaminated saline-alkali soil by wild ornamental Iridaceae species.

    Science.gov (United States)

    Cheng, Lijuan; Wang, Yanan; Cai, Zhang; Liu, Jie; Yu, Binbin; Zhou, Qixing

    2017-03-04

    As a green remediation technology, phytoremediation is becoming one of the most promising methods for treating petroleum hydrocarbons (PHCs)-contaminated soil. Pot culture experiments were conducted in this study to investigate phytoremediation potential of two representative Iridaceae species (Iris dichotoma Pall. and Iris lactea Pall.) in remediation of petroleum hydrocarbon-contaminated saline-alkali soil from the Dagang Oilfield in Tianjin, China. The results showed that I. lactea was more endurable to extremely high concentration of PHCs (about 40,000 mg/kg), with a relatively high degradation rate of 20.68%.The degradation rate of total petroleum hydrocarbons (TPHs) in soils contaminated with 10,000 and 20,000 mg/kg of PHCs was 30.79% and 19.36% by I. dichotoma, and 25.02% and 19.35% by I. lactea, respectively, which improved by 10-60% than the unplanted controls. The presence of I. dichotoma and I. lactea promoted degradation of PHCs fractions, among which saturates were more biodegradable than aromatics. Adaptive specialization was observed within the bacterial community. In conclusion, phytoremediation by I. dichotoma should be limited to soils contaminated with ≤20,000 mg/kg of PHCs, while I. lactea could be effectively applied to phytoremediation of contaminated soils by PHCs with at least 40,000 mg/kg.

  3. Insights into the biodegradation of weathered hydrocarbons in contaminated soils by bioaugmentation and nutrient stimulation.

    Science.gov (United States)

    Jiang, Ying; Brassington, Kirsty J; Prpich, George; Paton, Graeme I; Semple, Kirk T; Pollard, Simon J T; Coulon, Frédéric

    2016-10-01

    The potential for biotransformation of weathered hydrocarbon residues in soils collected from two commercial oil refinery sites (Soil A and B) was studied in microcosm experiments. Soil A has previously been subjected to on-site bioremediation and it was believed that no further degradation was possible while soil B has not been subjected to any treatment. A number of amendment strategies including bioaugmentation with hydrocarbon degrader, biostimulation with nutrients and soil grinding, were applied to the microcosms as putative biodegradation improvement strategies. The hydrocarbon concentrations in each amendment group were monitored throughout 112 days incubation. Microcosms treated with biostimulation (BS) and biostimulation/bioaugmentation (BS + BA) showed the most significant reductions in the aliphatic and aromatic hydrocarbon fractions. However, soil grinding was shown to reduce the effectiveness of a nutrient treatment on the extent of biotransformation by up to 25% and 20% for the aliphatic and aromatic hydrocarbon fractions, respectively. This is likely due to the disruption to the indigenous microbial community in the soil caused by grinding. Further, ecotoxicological responses (mustard seed germination and Microtox assays) showed that a reduction of total petroleum hydrocarbon (TPH) concentration in soil was not directly correlable to reduction in toxicity; thus monitoring TPH alone is not sufficient for assessing the environmental risk of a contaminated site after remediation. Copyright © 2016 The Authors. Published by Elsevier Ltd.. All rights reserved.

  4. Treatment of petroleum hydrocarbon polluted environment through bioremediation: a review.

    Science.gov (United States)

    Singh, Kriti; Chandra, Subhash

    2014-01-01

    Bioremediation play key role in the treatment of petroleum hydrocarbon contaminated environment. Exposure of petroleum hydrocarbon into the environment occurs either due to human activities or accidentally and cause environmental pollution. Petroleum hydrocarbon cause many toxic compounds which are potent immunotoxicants and carcinogenic to human being. Remedial methods for the treatment of petroleum contaminated environment include various physiochemical and biological methods. Due to the negative consequences caused by the physiochemical methods, the bioremediation technology is widely adapted and considered as one of the best technology for the treatment of petroleum contaminated environment. Bioremediation utilizes the natural ability of microorganism to degrade the hazardous compound into simpler and non hazardous form. This paper provides a review on the role of bioremediation in the treatment of petroleum contaminated environment, discuss various hazardous effects of petroleum hydrocarbon, various factors influencing biodegradation, role of various enzymes in biodegradation and genetic engineering in bioremediation.

  5. Influence of adhesion on aerobic biodegradation and bioremediation of liquid hydrocarbons.

    Science.gov (United States)

    Abbasnezhad, Hassan; Gray, Murray; Foght, Julia M

    2011-11-01

    Biodegradation of poorly water-soluble liquid hydrocarbons is often limited by low availability of the substrate to microbes. Adhesion of microorganisms to an oil-water interface can enhance this availability, whereas detaching cells from the interface can reduce the rate of biodegradation. The capability of microbes to adhere to the interface is not limited to hydrocarbon degraders, nor is it the only mechanism to enable rapid uptake of hydrocarbons, but it represents a common strategy. This review of the literature indicates that microbial adhesion can benefit growth on and biodegradation of very poorly water-soluble hydrocarbons such as n-alkanes and large polycyclic aromatic hydrocarbons dissolved in a non-aqueous phase. Adhesion is particularly important when the hydrocarbons are not emulsified, giving limited interfacial area between the two liquid phases. When mixed communities are involved in biodegradation, the ability of cells to adhere to the interface can enable selective growth and enhance bioremediation with time. The critical challenge in understanding the relationship between growth rate and biodegradation rate for adherent bacteria is to accurately measure and observe the population that resides at the interface of the hydrocarbon phase. © Springer-Verlag 2011

  6. Uji Infeksi Mycosphaerella spp Terhadap Bibit Eucalyptus spp

    OpenAIRE

    Lidya Morita Sondang

    2009-01-01

    Tujuan penelitian ini adalah untuk mengetahui tingkat ketahanan 2 klon Eucalyptus spp yaitu Eucalyptus grandis x Eucalyptus pellita dan Eucalyptus grandis x Eucalyptus urophylla terhadap Mycosphaerella spp serta mengetahui virulensi Mycospaherella spp pada 2 kelas umur (2 dan 3 bulan) pada tanaman Eucalyptus spp. Penelitian ini dilaksanakan dengan pengambilan sampel bibit tanaman Eucalyptus grandis x Eucalyptus pellita dan Eucalyptus grandis x Eucalyptus urophylla dari pembibitan PT.Toba Pulp...

  7. Anaerobic transformation of chlorinated hydrocarbons in a packed-bed reactor

    NARCIS (Netherlands)

    Best, Jappe Hinco de

    1999-01-01

    Chlorinated aliphatic hydrocarbons belong to the most frequently found contaminants in soil. Because of their toxicity and persistence, they are a potential threat to human health and the diversity of ecosystems. For the cleanup of soils contaminated with these compounds, biological degradation by

  8. Biodegradation of aliphatic vs. aromatic hydrocarbons in fertilized arctic soils

    Science.gov (United States)

    Braddock, J.F.

    1999-01-01

    A study was carried out to test a simple bioremediation treatment strategy in the Arctic and analyze the influence of fertilization the degradation of aliphatic and aromatic hydrocarbons, e.g., pristine, n-tetradecane, n-pentadecane, 2-methylnaphthalene, naphthalene, and acenaphthalene. The site was a coarse sand pad that once supported fuel storage tanks. Diesel-range organics concentrations were 250-860 mg/kg soil at the beginning of the study. Replicate field plots treated with fertilizer yielded final concentrations of 0, 50, 100, or 200 mg N/kg soil. Soil pH and soil-water potentials decreased due to fertilizer application. The addition of fertilizer considerably increased soil respiration potentials, but not the populations of microorganisms measured. Fertilizer addition also led to ??? 50% loss of measured aliphatic and aromatic hydrocarbons in surface and subsurface soils. For fertilized plots, hydrocarbon loss was not associated with the quantity of fertilizer added. Losses of aliphatic hydrocarbons were ascribed to biotic processes, while losses of aromatic hydrocarbons were due to biotic and abiotic processes.

  9. BIOREMEDIATION - TECHNOLOGY FOR DECONTAMINATION OF SOILS POLLUTED WITH PETROLEUM HYDROCARBONS

    Directory of Open Access Journals (Sweden)

    Irina-Ramona PECINGINĂ

    2013-05-01

    Full Text Available The pollution of soil with petroleum hydrocarbons prevents unfolding processes ofwater infiltration in soil, its circulation and the exchanges of the gaseous substances with theatmosphere. The biodegradation speed of the pollutants by the microorganisms is influenced ofsome factors: nutrients, soil type, humidity, temperature, pH, the type and the metabolism of themicroorganisms. The spill of the crude oil in the soil results in numerical growth of bacteriapopulations, with a concomitant reduction in their diversity, respectively with the predominantspecies that degrade hydrocarbons to simpler compounds, determining their gradualdisappearance.

  10. Enhanced bioremediation of hydrocarbon-contaminated soil using pilot-scale bioelectrochemical systems

    International Nuclear Information System (INIS)

    Lu, Lu; Yazdi, Hadi; Jin, Song; Zuo, Yi; Fallgren, Paul H.; Ren, Zhiyong Jason

    2014-01-01

    Highlights: • Pilot bioelectrochemical system showed high-performance hydrocarbon remediation. • Radius of influence characterization demonstrated system efficacy. • Current serves as degradation indicator. - Abstract: Two column-type bioelectrochemical system (BES) modules were installed into a 50-L pilot scale reactor packed with diesel-contaminated soils to investigate the enhancement of passive biodegradation of petroleum compounds. By using low cost electrodes such as biochar and graphite granule as non-exhaustible solid-state electron acceptors, the results show that 82.1–89.7% of the total petroleum hydrocarbon (TPH) was degraded after 120 days across 1–34 cm radius of influence (ROI) from the modules. This represents a maximum of 241% increase of biodegradation compared to a baseline control reactor. The current production in the BESs correlated with the TPH removal, reaching the maximum output of 70.4 ± 0.2 mA/m 2 . The maximum ROI of the BES, deducting influence from the baseline natural attenuation, was estimated to be more than 90 cm beyond the edge of the reactor (34 cm), and exceed 300 cm should a non-degradation baseline be used. The ratio of the projected ROI to the radius of BES (ROB) module was 11–12. The results suggest that this BES can serve as an innovative and sustainable technology for enhanced in situ bioremediation of petroleum hydrocarbons in large field scale, with additional benefits of electricity production and being integrated into existing field infrastructures

  11. Enhanced bioremediation of hydrocarbon-contaminated soil using pilot-scale bioelectrochemical systems

    Energy Technology Data Exchange (ETDEWEB)

    Lu, Lu; Yazdi, Hadi [Department of Civil, Environmental, and Architectural Engineering, University of Colorado Boulder, Boulder, CO (United States); Jin, Song [Department of Civil and Architectural Engineering, University of Wyoming, Laramie, WY (United States); Zuo, Yi [Chevron Energy Technology Company, San Ramon, CA (United States); Fallgren, Paul H. [Department of Civil Engineering, University of Colorado Denver, Denver, CO (United States); Ren, Zhiyong Jason, E-mail: jason.ren@colorado.edu [Department of Civil, Environmental, and Architectural Engineering, University of Colorado Boulder, Boulder, CO (United States); Department of Civil Engineering, University of Colorado Denver, Denver, CO (United States)

    2014-06-01

    Highlights: • Pilot bioelectrochemical system showed high-performance hydrocarbon remediation. • Radius of influence characterization demonstrated system efficacy. • Current serves as degradation indicator. - Abstract: Two column-type bioelectrochemical system (BES) modules were installed into a 50-L pilot scale reactor packed with diesel-contaminated soils to investigate the enhancement of passive biodegradation of petroleum compounds. By using low cost electrodes such as biochar and graphite granule as non-exhaustible solid-state electron acceptors, the results show that 82.1–89.7% of the total petroleum hydrocarbon (TPH) was degraded after 120 days across 1–34 cm radius of influence (ROI) from the modules. This represents a maximum of 241% increase of biodegradation compared to a baseline control reactor. The current production in the BESs correlated with the TPH removal, reaching the maximum output of 70.4 ± 0.2 mA/m{sup 2}. The maximum ROI of the BES, deducting influence from the baseline natural attenuation, was estimated to be more than 90 cm beyond the edge of the reactor (34 cm), and exceed 300 cm should a non-degradation baseline be used. The ratio of the projected ROI to the radius of BES (ROB) module was 11–12. The results suggest that this BES can serve as an innovative and sustainable technology for enhanced in situ bioremediation of petroleum hydrocarbons in large field scale, with additional benefits of electricity production and being integrated into existing field infrastructures.

  12. How Specific Microbial Communities Benefit the Oil Industry: Dynamics of Alcanivorax spp. in Oil-Contaminated Intertidal Beach Sediments Undergoing Bioremediation

    Science.gov (United States)

    Singh, Arvind K.; Sherry, Angela; Gray, Neil D.; Jones, Martin D.; Röling, Wilfred F. M.; Head, Ian M.

    The industrial revolution has led to significant increases in the consumption of petroleum hydrocarbons. Concomitant with this increase, hydrocarbon pollution has become a global problem resulting from emissions related to operational use, releases during production, pipeline failures and tanker spills. Importantly, in addition to these anthropogenic sources of hydrocarbon pollution, natural seeps alone account for about 50% of total petroleum hydrocarbon releases in the aquatic environment (National Research Council, 2003). The annual input from natural seeps would form a layer of hydrocarbons 20 molecules thick on the sea surface globally if it remained un-degraded (Prince, 2005). By contrast with natural seeps, many oil spills, e.g. Sea Empress (Milford Haven, UK), Prestige (Galicia, Spain), EXXON Valdez (Prince William Sound, Alaska, USA), released huge amounts of oil (thousands to hundreds of thousand tonnes; Table 24.1) in a locally confined area over a short period of time with a huge acute impact on the marine environment. These incidents have attracted the attention of both the general public and the scientific community due to their great impact on coastal ecosystems. Although many petroleum hydrocarbons are toxic, they are degraded by microbial consortia naturally present in marine ecosystems.

  13. Direct photolysis of polycyclic aromatic hydrocarbons in drinking water sources

    International Nuclear Information System (INIS)

    Sanches, S.; Leitao, C.; Penetra, A.; Cardoso, V.V.; Ferreira, E.; Benoliel, M.J.; Crespo, M.T. Barreto; Pereira, V.J.

    2011-01-01

    Highlights: → Low pressure UV photolysis can be used by drinking water utilities to degrade PAHs. → Real water matrices with different compositions were tested. → Photolysis kinetic parameters and by-product formation are described. → The formation of photolysis by-products is highly dependent on the source waters. - Abstract: The widely used low pressure lamps were tested in terms of their efficiency to degrade polycyclic aromatic hydrocarbons listed as priority pollutants by the European Water Framework Directive and the U.S. Environmental Protection Agency, in water matrices with very different compositions (laboratory grade water, groundwater, and surface water). Using a UV fluence of 1500 mJ/cm 2 , anthracene and benzo(a)pyrene were efficiently degraded, with much higher percent removals obtained when present in groundwater (83-93%) compared to surface water (36-48%). The removal percentages obtained for fluoranthene were lower and ranged from 13 to 54% in the different water matrices tested. Several parameters that influence the direct photolysis of polycyclic aromatic hydrocarbons were determined and their photolysis by-products were identified by mass spectrometry. The formation of photolysis by-products was found to be highly dependent on the source waters tested.

  14. Alkanes as Components of Soil Hydrocarbon Status: Behavior and Indication Significance

    Science.gov (United States)

    Gennadiev, A. N.; Zavgorodnyaya, Yu. A.; Pikovskii, Yu. I.; Smirnova, M. A.

    2018-01-01

    Studies of soils on three key plots with different climatic conditions and technogenic impacts in Volgograd, Moscow, and Arkhangelsk oblasts have showed that alkanes in the soil exchange complex have some indication potential for the identification of soil processes. The following combinations of soil-forming factors and processes have been studied: (a) self-purification of soil after oil pollution; (b) accumulation of hydrocarbons coming from the atmosphere to soils of different land use patterns; and (c) changes in the soil hydrocarbon complex beyond the zone of technogenic impact due to the input of free hydrocarbon-containing gases. At the injection input of hydrocarbon pollutants, changes in the composition and proportions of alkanes allow tracing the degradation trend of pollutants in the soil from their initial content to the final stage of soil self-purification, when the background concentrations of hydrocarbons are reached. Upon atmospheric deposition of hydrocarbons onto the soil, from the composition and mass distribution of alkanes, conclusions can be drawn about the effect of toxicants on biogeochemical processes in the soil, including their manifestation under different land uses. Composition analysis of soil alkanes in natural landscapes can reveal signs of hydrocarbon emanation fluxes in soils. The indication potentials of alkanes in combination with polycyclic aromatic hydrocarbons and other components of soil hydrocarbon complex can also be used for the solution of other soil-geochemical problems.

  15. Microbial degradation of polycyclic aromatic hydrocarbons (PAHs). Pt. 1

    International Nuclear Information System (INIS)

    Eichler, B.; Bryniok, D.; Vorbeck, C.; Lutz, M.; Ackermann, B.; Freier-Schroeder, D.; Knackmuss, H.J.

    1992-01-01

    Productive degradation of the higher molecular PAHs benz(a)anthracene (four rings), benzo(a)pyrene and benzo(k)fluoranthene (five rings) through pure bacterial cultures is demonstrated in this paper for the first time. Consequently, a degradation potential for lower and higher molecular polycyclic aromatics up to five rings exists both in the ground of the fromer coking site and in the ground of the former gas works of Stuttgart. Further samples from contaminated soils, coking waste water and sediments showed similar results. This suggests that the bacterial flora present in the soil itself can be successfully used to clean up contaminated ground. (orig.) [de

  16. Linkage between bacterial and fungal rhizosphere communities in hydrocarbon-contaminated soils is related to plant phylogeny.

    Science.gov (United States)

    Bell, Terrence H; El-Din Hassan, Saad; Lauron-Moreau, Aurélien; Al-Otaibi, Fahad; Hijri, Mohamed; Yergeau, Etienne; St-Arnaud, Marc

    2014-02-01

    Phytoremediation is an attractive alternative to excavating and chemically treating contaminated soils. Certain plants can directly bioremediate by sequestering and/or transforming pollutants, but plants may also enhance bioremediation by promoting contaminant-degrading microorganisms in soils. In this study, we used high-throughput sequencing of bacterial 16S rRNA genes and the fungal internal transcribed spacer (ITS) region to compare the community composition of 66 soil samples from the rhizosphere of planted willows (Salix spp.) and six unplanted control samples at the site of a former petrochemical plant. The Bray-Curtis distance between bacterial communities across willow cultivars was significantly correlated with the distance between fungal communities in uncontaminated and moderately contaminated soils but not in highly contaminated (HC) soils (>2000 mg kg(-1) hydrocarbons). The mean dissimilarity between fungal, but not bacterial, communities from the rhizosphere of different cultivars increased substantially in the HC blocks. This divergence was partly related to high fungal sensitivity to hydrocarbon contaminants, as demonstrated by reduced Shannon diversity, but also to a stronger influence of willows on fungal communities. Abundance of the fungal class Pezizomycetes in HC soils was directly related to willow phylogeny, with Pezizomycetes dominating the rhizosphere of a monophyletic cluster of cultivars, while remaining in low relative abundance in other soils. This has implications for plant selection in phytoremediation, as fungal associations may affect the health of introduced plants and the success of co-inoculated microbial strains. An integrated understanding of the relationships between fungi, bacteria and plants will enable the design of treatments that specifically promote effective bioremediating communities.

  17. Phylogenetic diversity of dominant bacterial communities during bioremediation of crude oil-polluted soil

    Directory of Open Access Journals (Sweden)

    Eugene Thomas Cloete

    2011-08-01

    degradation. Cluster analysis of DGGE bands using simple matching group average setting revealed that poultry droppings-amended soils and calcium ammonium nitrate-amended soils formed distinct clades meaning that the treatment selected similar bacterial populations for each of the treatments whereas NPK soils showed less association. Excision, reamplification and sequencing of dominant DGGE bands in biostimulated soils revealed the presence of distinct hydrocarbon degraders like Corynebacterium spp., Dietzia spp., low G+C Gram positive bacteria and some uncultured bacterial clones. Phylogenetic analysis of the 16S rRNA gene sequences of these dominant bacterial communities was conducted using the neighbour joining method of PHYLIP. Two distinct clades appeared in the tree clustered members of the Actinobacteria and Firmicutes separately. The overall data suggested that Gram positive bacteria especially members of the Actinobacteria may have a key role in bioremediation of crude oil-polluted soil.

  18. Changes to the structure of Sphingomonas spp. communities associated with biodegradation of the herbicide isoproturon in soil.

    Science.gov (United States)

    Shi, Shengjing; Bending, Gary D

    2007-04-01

    The phenyl-urea herbicide isoproturon is a major contaminant of surface and ground-water in agricultural catchments. Earlier work suggested that within-field spatial variation of isoproturon degradation rate resulted from interactions between catabolizing Sphingomonas spp. and pH. In the current study, changes to the structure of Sphingomonas communities during isoproturon catabolism were investigated using Sphingomonas-specific 16S rRNA gene primers. Growth-linked catabolism at high-pH (>7.5) sites was associated with the appearance of multiple new denaturing gradient gel electrophoresis (DGGE) bands. At low-pH sites, there was no change in DGGE banding at sites in which there was cometabolism, but at sites in which there was growth-linked catabolism, degradation was associated with the appearance of a new band not present at high pH sites. Sequencing of DGGE bands indicated that a strain related to Sphingomonas mali proliferated at low pH sites, while strain Sphingomonas sp. SRS2, a catabolic strain identified in earlier work, together with several further Sphingomonas spp., proliferated at high-pH sites. The data indicate that degradation was associated with complex changes to the structure of Sphingomonas spp. communities, the precise nature of which was spatially variable.

  19. Natural attenuation of diesel aliphatic hydrocarbons in contaminated agricultural soil

    International Nuclear Information System (INIS)

    Serrano, Antonio; Gallego, Mercedes; Gonzalez, Jose Luis; Tejada, Manuel

    2008-01-01

    A diesel fuel spill at a concentration of 1 L m -2 soil was simulated on a 12 m 2 plot of agricultural land, and natural attenuation of aliphatic hydrocarbons was monitored over a period of 400 days following the spill after which the aliphatic hydrocarbon concentrations were found to be below the legal contamination threshold for soil. The main fraction of these compounds (95%) remained at the surface layer (0-10 cm). Shortly after the spill (viz. between days 0 and 18), evaporation was the main origin of the dramatic decrease in pollutant concentrations in the soil. Thereafter, soil microorganisms used aliphatic hydrocarbons as sources of carbon and energy, as confirmed by the degradation ratios found. Soil quality indicators, soil microbial biomass and dehydrogenase activity, regained their original levels about 200 days after the spill. - The effect of aliphatic hydrocarbons contamination on soil quality was monitored over a period of 400 days after a Diesel fuel spill

  20. Field-scale assessment of phytotreatment of soil contaminated with weathered hydrocarbons and heavy metals

    Energy Technology Data Exchange (ETDEWEB)

    Palmroth, M.R.T.; Koskinen, P.E.P.; Tuhkanen, T.A.; Puhakka, J.A. [Inst. of Environmental Engineering and Biotechnology, Tampere Univ. of Tech., Tampere (Finland); Pichtel, J. [Natural Resources and Environmental Management, Ball State Univ., Muncie, IN (United States); Vaajasaari, K. [Pirkanmaa Regional Environment Centre, Tampere (Finland); Joutti, A. [Finnish Environment Inst., Helsinki (Finland)

    2006-08-15

    Background, Aims, and Scope. Phytoremediation is remediation method which uses plants to remove, contain or detoxify environmental contaminants. Phytoremediation has successfully been applied for the removal of fresh hydrocarbon contamination, but removal of aged hydrocarbons has proven more difficult. Biodegradation of hydrocarbons in the subsurface can be enhanced by the presence of plant roots, i.e. the rhizosphere effect. Phytostabilization reduces heavy metal availability via immobilization in the rhizosphere. Soils contaminated by both hydrocarbons and heavy metals are abundant and may be difficult to treat. Heavy metal toxicity can inhibit the activity of hydrocarbon-degrading micro-organisms and decrease the metabolic diversity of soil bacteria. In this experiment, weathered hydrocarbon- and heavy metal-contaminated soil was treated using phytoremediation in a 39-month field study in attempts to achieve both hydrocarbon removal and heavy metal stabilization. Methods. A combination of hydrocarbon degradation and heavy metal stabilization was evaluated in a field-scale phytoremediation study of weathered contaminants. Soil had been contaminated over several years with hydrocarbons (11,400{+-}4,300 mg kg dry soil){sup -1} and heavy metals from bus maintenance activities and was geologically characterized as till. Concentrations of soil copper, lead and zinc were 170{+-}50 mgkg{sup -1}, 1,100{+-}1,500 mg kg{sup -1} and 390{+-} 340 mg kg{sup -1}, respectively. The effect of contaminants, plant species and soil amendment (NPK fertilizer or biowaste compost) on metabolic activity of soil microbiota was determined. Phytostabilization performance was investigated by analyses of metal concentrations in plants, soil and site leachate as well as acute toxicity to Vibrio fischeri and Enchtraeus albidus. Results. Over 39 months hydrocarbon concentrations did not decrease significantly (P=0.05) in non-amended soil, although 30% of initial hydrocarbon concentrations were

  1. Biosurfactant production by yeasts isolated from hydrocarbon polluted environments.

    Science.gov (United States)

    Kaur, Kamalpreet; Sangwan, Seema; Kaur, Harpreet

    2017-11-03

    Thirty-two yeast isolates were retrieved from four soil samples collected from hydrocarbon-polluted locations of Hisar, Haryana, using enrichment culture technique with 1% (v/v) diesel as carbon source. Total nine isolates showing blood agar haemolysis were screened further for biosurfactant production. Yeast isolate, YK32, gave highest 8.4-cm oil displacement which was found to be significantly higher as compared to positive control, 0.2% (w/v) SDS (6.6 cm), followed by 6.2 and 6.0 cm by isolates YK20 and YK21, respectively. Maximum emulsification index was obtained in case of isolates YK20 and YK21 measuring 53.8%, after 6 days of incubation utilizing glucose as carbon source, whereas isolate YK32 was found to be reducing surface tension up to 93 dynes/cm and presented 99.6% degree of hydrophobicity. Olive oil has supported maximum surface tension reduction in isolates YK32 and YK21 equivalent to 53 and 48 dynes/cm and gave 88.3 and 88.5% degree of hydrophobicity, respectively. Diesel was not preferred as carbon source by most of the isolates except YK28 which generated 5.5-cm oil displacement, 25% emulsification index, reduced surface tension to the level of 38 dynes/cm and presented 89% degree of hydrophobicity. Conclusively, isolates YK20, YK21, YK22 and YK32 were marked as promising biosurfactant producers and were subjected to identification. Based on microscopic examination and biochemical peculiarities, isolates YK21 and YK22 might be identified as Candida spp., whereas, isolates YK20 and YK32 might be identified as Saccharomycopsis spp. and Brettanomyces spp., respectively. Interestingly it is the first report indicating Saccharomycopsis spp. and Brettanomyces spp. as a potential biosurfactant producer.

  2. Occurrence of Campylobacter spp. and Cryptosporidium spp. in seagulls (Larus spp.).

    Science.gov (United States)

    Moore, John E; Gilpin, Deidre; Crothers, Elizabeth; Canney, Anne; Kaneko, Aki; Matsuda, Motoo

    2002-01-01

    An investigation was carried out into the prevalence of thermophilic Campylobacter subspecies (spp.) and Cryptosporidium spp. in fresh fecal specimens collected from members of the gull family (Larus spp.) from three coastal locations of Northern Ireland. A total of 205 fresh fecal specimens were collected from gulls, of which 28 of 205 (13.7%) were positive for Campylobacter spp. and none of 205 for Cryptosporidium spp. Of these campylobacters, 21 of 28 (75%) isolates obtained belonged to the urease-positive thermophilic Campylobacter (UPTC) taxon, followed by five of 28 (17.9%) Campylobacter lari and 2/28 (7.1%) Campylobacter jejuni. It is significant that seagulls are the sole warm-blooded animal host of this bacterial taxon in Northern Ireland. It is proposed that physiological adaptation to starvation by gulls may lead to increased concentrations of urea through energy production from protein, yielding increased levels of urea for metabolism by UPTC organisms. In general, the possibility exists that environmental contamination of surface waters with campylobacters might be mediated by wild birds (such as gulls), where such waters are used for recreational purposes or where such waters are consumed untreated, might represent a risk to public health.

  3. Assessment of Bacterial Degradation of Aromatic Hydrocarbons in the Environment by Analysis of Stable Carbon Isotope Fractionation

    International Nuclear Information System (INIS)

    Meckenstock, Rainer U.; Morasch, Barbara; Kaestner, Matthias; Vieth, Andrea; Richnow, Hans Hermann

    2002-01-01

    concentrations accompanied with an increase in the 13 C/ 12 C stable carbon isotope ratio of the residual toluene. Calculation of the extent of biodegradation based on the isotope values and laboratory derived isotope fractionation factors showed that the residual toluene was degraded to more than 99% by microbial activity. Calculation of the theoretical residual toluene concentrations based on the measured isotope values described the strongly decreasing concentrations along the plume. Other aromatic hydrocarbons like benzene and naphthalene which were analysed in the same course also showed decreasing concentrations along the groundwater flow path accompanied by increasing δ 13 C values indicating biodegradation

  4. Biodegradation testing of hydrophobic chemicals in mixtures at low concentrations – covering the chemical space of petroleum hydrocarbons

    DEFF Research Database (Denmark)

    Birch, Heidi; Hammershøj, Rikke Høst; Mayer, Philipp

    Petroleum products are complex mixtures of varying composition containing thousands of hydrocarbons each with their own physicochemical properties and degradation kinetics. One approach for risk assessment of these products is therefore to group the hydrocarbons by carbon number and chemical class...... i.e. hydrocarbon blocks. However, the biodegradation kinetic data varies in quantity and quality for the different hydrocarbon blocks, hampering the characterization of their fate properties. In this study, biodegradation kinetics of a large number of hydrocarbons aiming to cover the chemical space...... of petroleum hydrocarbons, were therefore determined at ng/L to µg/L concentrations in surface water, seawater and activated sludge filtrate. Two hydrocarbon mixtures were prepared, comprising a total of 53 chemicals including paraffins, naphthenics and aromatic hydrocarbons from C8 to C20. Passive dosing from...

  5. Degradation of phenanthrene and pyrene using genetically engineered dioxygenase producing Pseudomonas putida in soil

    Directory of Open Access Journals (Sweden)

    Mardani Gashtasb

    2016-01-01

    Full Text Available Bioremediation use to promote degradation and/or removal of contaminants into nonhazardous or less-hazardous substances from the environment using microbial metabolic ability. Pseudomonas spp. is one of saprotrophic soil bacterium and can be used for biodegradation of polycyclic aromatic hydrocarbons (PAHs but this activity in most species is weak. Phenanthrene and pyrene could associate with a risk of human cancer development in exposed individuals. The aim of the present study was application of genetically engineered P. putida that produce dioxygenase for degradation of phenanthrene and pyrene in spiked soil using high-performance liquid chromatography (HPLC method. The nahH gene that encoded catechol 2,3-dioxygenase (C23O was cloned into pUC18 and pUC18-nahH recombinant vector was generated and transformed into wild P. putida, successfully. The genetically modified and wild types of P. putida were inoculated in soil and pilot plan was prepared. Finally, degradation of phenanthrene and pyrene by this bacterium in spiked soil were evaluated using HPLC measurement technique. The results were showed elimination of these PAH compounds in spiked soil by engineered P. putida comparing to dishes containing natural soil with normal microbial flora and inoculated autoclaved soil by wild type of P. putida were statistically significant (p0.05 but it was few impact on this process (more than 2%. Additional and verification tests including catalase, oxidase and PCR on isolated bacteria from spiked soil were indicated that engineered P. putida was alive and functional as well as it can affect on phenanthrene and pyrene degradation via nahH gene producing. These findings indicated that genetically engineered P. putida generated in this work via producing C23O enzyme can useful and practical for biodegradation of phenanthrene and pyrene as well as petroleum compounds in polluted environments.

  6. Root Exudation: The Ecological Driver of Hydrocarbon Rhizoremediation

    Directory of Open Access Journals (Sweden)

    Fanny Rohrbacher

    2016-03-01

    Full Text Available Rhizoremediation is a bioremediation technique whereby microbial degradation of organic contaminants occurs in the rhizosphere. It is considered to be an effective and affordable “green technology” for remediating soils contaminated with petroleum hydrocarbons. Root exudation of a wide variety of compounds (organic, amino and fatty acids, carbohydrates, vitamins, nucleotides, phenolic compounds, polysaccharides and proteins provide better nutrient uptake for the rhizosphere microbiome. It is thought to be one of the predominant drivers of microbial communities in the rhizosphere and is therefore a potential key factor behind enhanced hydrocarbon biodegradation. Many of the genes responsible for bacterial adaptation in contaminated soil and the plant rhizosphere are carried by conjugative plasmids and transferred among bacteria. Because root exudates can stimulate gene transfer, conjugation in the rhizosphere is higher than in bulk soil. A better understanding of these phenomena could thus inform the development of techniques to manipulate the rhizosphere microbiome in ways that improve hydrocarbon bioremediation.

  7. Effects of Planting and Processing Modes on the Degradation of Dithianon and Pyraclostrobin in Chinese Yam (Dioscorea spp.).

    Science.gov (United States)

    Shi, Kaiwei; Wu, Xujin; Ma, Jingwei; Zhang, Junfeng; Zhou, Ling; Wang, Hong; Li, Li

    2017-12-06

    The yam (Dioscorea spp.) is widely cultivated in China. The degradation of dithianon and pyraclostrobin in yams with different planting and processing treatments was investigated in this article. An analytical method for two pesticides in yam and yam plant was developed, and recoveries were between 77% and 93%, with relative standard deviations from 0.8% to 7.4%, respectively. On the basis of this method, half-lives for plants grown on stakes versus plants grown without stakes were compared. The results indicated that the half-life for pesticide residues for plants grown on stakes versus plants grown without stakes differed as 6.7 versus 3.1 days for dithianon and 5.4 versus 5.2 days for pyraclostrobin. Dithianon was significantly influenced by planting mode because of its low stability under sunlight. The processing factors of various processing treatments (hot air-drying, vacuum freeze-drying, microwave vacuum-drying, infrared-drying, steaming, and boiling) were all <1, indicating that those processes can reduce residues of two pesticides at different levels. Significant amounts of residues were removed during the boiling treatment, whereas the others showed less effect.

  8. Microbial degradation of Cold Lake Blend and Western Canadian select dilbits by freshwater enrichments.

    Science.gov (United States)

    Deshpande, Ruta S; Sundaravadivelu, Devi; Techtmann, Stephen; Conmy, Robyn N; Santo Domingo, Jorge W; Campo, Pablo

    2018-06-15

    Treatability experiments were conducted to determine the biodegradation of diluted bitumen (dilbit) at 5 and 25 °C for 72 and 60 days, respectively. Microbial consortia obtained from the Kalamazoo River Enbridge Energy spill site were enriched on dilbit at both 5 (cryo) and 25 (meso) ºC. On every sampling day, triplicates were sacrificed and residual hydrocarbon concentrations (alkanes and polycyclic aromatic hydrocarbons) were determined by GCMS/MS. The composition and relative abundance of different bacterial groups were identified by 16S rRNA gene sequencing analysis. While some physicochemical differences were observed between the two dilbits, their biodegradation profiles were similar. The rates and extent of degradation were greater at 25 °C. Both consortia metabolized 99.9% of alkanes; however, the meso consortium was more effective at removing aromatics than the cryo consortium (97.5 vs 70%). Known hydrocarbon-degrading bacteria were present in both consortia (Pseudomonas, Rhodococcus, Hydrogenophaga, Parvibaculum, Arthrobacter, Acidovorax), although their relative abundances depended on the temperatures at which they were enriched. Regardless of the dilbit type, the microbial community structure significantly changed as a response to the diminishing hydrocarbon load. Our results demonstrate that dilbit can be effectively degraded by autochthonous microbial consortia from sites with recent exposure to dilbit contamination. Published by Elsevier B.V.

  9. Laboratory scale bioremediation of diesel hydrocarbon in soil by indigenous bacterial consortium.

    Science.gov (United States)

    Sharma, Anjana; Rehman, Meenal Budholia

    2009-09-01

    In vitro experiment was performed by taking petrol pump soils and diesel in flasks with the micronutrients and macronutrients supplements. Cemented bioreactors having sterilized soil and diesel was used for in vivo analysis of diesel hydrocarbon degradation. There were two sets of experiments, first having three bioreactors (1) inoculated by KI. pneumoniae subsp. aerogenes with soil and diesel; (2) with addition of NH4NO3; and (3) served as control. In second set, one bioreactor was inoculated by bacterial consortium containing Moraxella saccharolytica, Alteromonas putrefaciens, KI. pneumoniae subsp. aerogenes and Pseudomonas fragi along with soil and diesel. The remaining two bioreactors (having NH4NO3 and control) were similar to the first set. The experiments were incubated for 30 days. Ability of bacterial inoculum to degrade diesel was analyzed through GC-MS. Smaller chain compounds were obtained after experimental period of 30 days. Rate of diesel degradation was better with the present bacterial consortium than individual bacteria. Present bacterial consortium can be a better choice for faster and complete remediation of contaminated hydrocarbon soils.

  10. Regulation of cuticle-degrading subtilisin proteases from the entomopathogenic fungi, Lecanicillium spp: implications for host specificity.

    Science.gov (United States)

    Bye, Natasha J; Charnley, A Keith

    2008-01-01

    The ability to produce cuticle-degrading proteases to facilitate host penetration does not distinguish per se entomopathogenic fungi from saprophytes. However, adapted pathogens may produce host-protein specific enzymes in response to cues. This possibility prompted an investigation of the regulation of isoforms of the subtilisin Pr1-like proteases from five aphid-pathogenic isolates of Lecanicillium spp. Significant differences were found in substrate specificity and regulation of Pr1-like proteases between isoforms of the same isolate and between different isolates. For example, the pI 8.6 isoform from KV71 was considerably more active against aphid than locust cuticle and was induced specifically by N-acetylglucosamine (NAG). Isoform pI 9.1 from the same isolate was only produced on insect cuticle while most other isoforms were more prominent on chitin containing substrates but not induced by NAG. The ability to regulate isoforms independently may allow production at critical points in host penetration. Appearance of proteases (not subtilisins) with pI 4.2 and 4.4 only on aphid cuticle was a possible link with host specificity of KV71. The absence of C or N metabolite repression in subtilisins from KV42 is unusual for pathogen proteases and may help to account for differences in virulence strategy between aphid-pathogenic isolates of Lecanicillium longisporum (unpublished data).

  11. Enumeration of phenanthrene-degrading bacteria by an overlayer technique and its use in evaluation of petroleum-contaminated sites

    International Nuclear Information System (INIS)

    Bogardt, A.H.; Hemmingsen, B.B.

    1992-01-01

    Bacteria that are capable of degrading polycyclic aromatic hydrocarbons were enumerated by incorporating soil and water dilutions together with fine particles of phenanthrene, a polycyclic aromatic hydrocarbon, into an agarose overlayer and pouring the mixture over a mineral salts underlayer. The phenanthrene-degrading bacteria embedded in the overlayer were recognized by a halo of clearing in the opaque phenanthrene layer. Diesel fuel- or creosote-contaminated soil and water that were undergoing bioremediation contained 6 x 10 6 to 100 x 10 6 phenanthrene-degrading bacteria per g and ca. 5 x 10 5 phenanthrene-degrading bacteria per ml, respectively, whereas samples from untreated polluted sites contained substantially lower numbers. Unpolluted soil and water contained no detectable phenanthrene degraders or only very modest numbers of these organisms

  12. Bovine intestinal bacteria inactivate and degrade ceftiofur and ceftriaxone with multiple beta-lactamases.

    Science.gov (United States)

    Wagner, R Doug; Johnson, Shemedia J; Cerniglia, Carl E; Erickson, Bruce D

    2011-11-01

    The veterinary cephalosporin drug ceftiofur is rapidly degraded in the bovine intestinal tract. A cylinder-plate assay was used to detect microbiologically active ceftiofur, and high-performance liquid chromatography-mass spectrometry analysis was used to quantify the amount of ceftiofur remaining after incubation with bovine intestinal anaerobic bacteria, which were isolated from colon contents or feces from 8 cattle. Ninety-six percent of the isolates were able to inactivate ceftiofur to some degree, and 54% actually degraded the drug. None of 9 fungal isolates inactivated or degraded ceftiofur. Facultative and obligate anaerobic bacterial species that inactivated or degraded ceftiofur were identified with Vitek and Biolog systems, respectively. A subset of ceftiofur degraders also degraded the chemically similar drug ceftriaxone. Most of the species of bacteria that degraded ceftiofur belonged to the genera Bacillus and Bacteroides. PCR analysis of bacterial DNA detected specific β-lactamase genes. Bacillus cereus and B. mycoides isolates produced extended-spectrum β-lactamases and metallo-β-lactamases. Seven isolates of Bacteroides spp. produced multiple β-lactamases, including possibly CepA, and metallo-β-lactamases. Isolates of Eubacterium biforme, Bifidobacterium breve, and several Clostridium spp. also produced ceftiofur-degrading β-lactamases. An agar gel overlay technique on isoelectric focusing separations of bacterial lysates showed that β-lactamase enzymes were sufficient to degrade ceftiofur. These results suggest that ceftiofur is inactivated nonenzymatically and degraded enzymatically by multiple β-lactamases from bacteria in the large intestines of cattle.

  13. Bovine Intestinal Bacteria Inactivate and Degrade Ceftiofur and Ceftriaxone with Multiple β-Lactamases▿

    Science.gov (United States)

    Wagner, R. Doug; Johnson, Shemedia J.; Cerniglia, Carl E.; Erickson, Bruce D.

    2011-01-01

    The veterinary cephalosporin drug ceftiofur is rapidly degraded in the bovine intestinal tract. A cylinder-plate assay was used to detect microbiologically active ceftiofur, and high-performance liquid chromatography-mass spectrometry analysis was used to quantify the amount of ceftiofur remaining after incubation with bovine intestinal anaerobic bacteria, which were isolated from colon contents or feces from 8 cattle. Ninety-six percent of the isolates were able to inactivate ceftiofur to some degree, and 54% actually degraded the drug. None of 9 fungal isolates inactivated or degraded ceftiofur. Facultative and obligate anaerobic bacterial species that inactivated or degraded ceftiofur were identified with Vitek and Biolog systems, respectively. A subset of ceftiofur degraders also degraded the chemically similar drug ceftriaxone. Most of the species of bacteria that degraded ceftiofur belonged to the genera Bacillus and Bacteroides. PCR analysis of bacterial DNA detected specific β-lactamase genes. Bacillus cereus and B. mycoides isolates produced extended-spectrum β-lactamases and metallo-β-lactamases. Seven isolates of Bacteroides spp. produced multiple β-lactamases, including possibly CepA, and metallo-β-lactamases. Isolates of Eubacterium biforme, Bifidobacterium breve, and several Clostridium spp. also produced ceftiofur-degrading β-lactamases. An agar gel overlay technique on isoelectric focusing separations of bacterial lysates showed that β-lactamase enzymes were sufficient to degrade ceftiofur. These results suggest that ceftiofur is inactivated nonenzymatically and degraded enzymatically by multiple β-lactamases from bacteria in the large intestines of cattle. PMID:21876048

  14. The effect of mycorrhizal inoculation on hybrid poplar fine root dynamics in hydrocarbon contaminated soils

    Energy Technology Data Exchange (ETDEWEB)

    Gunderson, J.; Knight, J.D.; Van Rees, K.C.J. [Saskatchewan Univ., Saskatoon, SK (Canada). Dept. of Soil Science

    2006-07-01

    The biological remediation of contaminated soils using plants was discussed. Hybrid poplars are good candidates for phytoremediation because they root deeply, cycle large amounts of water and grow quickly. Their fine root system is pivotal in nutrient and water acquisition. Therefore, in order to maximize the phytoremediation potential, it is important to understand the response of the fine root system. In addition to degrading organic chemicals, ectomycorrhizal (ECM) fungi provide the host with greater access to nutrients. This study determined the relationship between residual soil hydrocarbons and soil properties at a field site. The effects of residual contamination on hybrid poplar fine root dynamics was also examined along with the effect of ectomycorrhizal colonization on hybrid poplar fine root dynamics when grown in diesel contaminated soil under controlled conditions. A minirhizotron camera inside a growth chamber captured images of mycorrhizal inoculation on hybrid poplar fine root production. Walker hybrid poplar seedlings were grown for 12 weeks in a control soil and also in a diesel contaminated soil. Seedlings were also grown in control and diesel contaminated, ectomycorrhizal inoculated soils. The inoculum was a mycorrhizal mix containing Pisolithus tinctorius and Rhizopogon spp. The images showed that colonization by ECM fungi increased hybrid poplar fine root production and aboveground biomass in a diesel contaminated soil compared to non-colonized trees in the same soil. Root:shoot ratios were much higher in the diesel contaminated/non-inoculated treatment than in either of the control soil treatments. Results of phytoremediation in diesel contaminated soil were better in the non-colonized treatment than in the colonized treatment. Both treatments removed more contaminants from the soil than the unplanted control. Much higher quantities of hydrocarbons were found sequestered in the roots from the inoculated treatment than from the non

  15. Bacterial Endophytes Isolated from Plants in Natural Oil Seep Soils with Chronic Hydrocarbon Contamination

    OpenAIRE

    Lumactud, Rhea; Shen, Shu Yi; Lau, Mimas; Fulthorpe, Roberta

    2016-01-01

    The bacterial endophytic communities of four plants growing abundantly in soils highly contaminated by hydrocarbons were analyzed through culturable and and culture-independent means. Given their tolerance to the high levels of petroleum contamination at our study site, we sought evidence that Achillea millefolium, Solidago canadensis, Trifolium aureum and Dactylis glomerata support high levels of hydrocarbon degrading endophytes. A total of 190 isolates were isolated from four plant species....

  16. Biodegradation of polycyclic aromatic hydrocarbons by Trichoderma species: a mini review.

    Science.gov (United States)

    Zafra, German; Cortés-Espinosa, Diana V

    2015-12-01

    Fungi belonging to Trichoderma genus are ascomycetes found in soils worldwide. Trichoderma has been studied in relation to diverse biotechnological applications and are known as successful colonizers of their common habitats. Members of this genus have been well described as effective biocontrol organisms through the production of secondary metabolites with potential applications as new antibiotics. Even though members of Trichoderma are commonly used for the commercial production of lytic enzymes, as a biological control agent, and also in the food industry, their use in xenobiotic biodegradation is limited. Trichoderma stands out as a genus with a great range of substrate utilization, a high production of antimicrobial compounds, and its ability for environmental opportunism. In this review, we focused on the recent advances in the research of Trichoderma species as potent and efficient aromatic hydrocarbon-degrading organisms, as well as aimed to provide insight into its potential role in the bioremediation of soils contaminated with heavy hydrocarbons. Several Trichoderma species are associated with the ability to metabolize a variety of both high and low molecular weight polycyclic aromatic hydrocarbons (PAHs) such as naphthalene, phenanthrene, chrysene, pyrene, and benzo[a]pyrene. PAH-degrading species include Trichoderma hamatum, Trichoderma harzianum, Trichoderma reesei, Trichoderma koningii, Trichoderma viride, Trichoderma virens, and Trichoderma asperellum using alternate enzyme systems commonly seen in other organisms, such as multicooper laccases, peroxidases, and ring-cleavage dioxygenases. Within these species, T. asperellum stands out as a versatile organism with remarkable degrading abilities, high tolerance, and a remarkable potential to be used as a remediation agent in polluted soils.

  17. Biodegradation of an oil-hydrocarbon contaminated soil, enhanced by surfactants: Effect of the type and dose of surfactant

    International Nuclear Information System (INIS)

    Torres, L. G.; Galindo, C.; Rojas, N.; Iturbe, R.

    2009-01-01

    The aim of this work was to study the effect of different parameters, such as surfactant type an dose, soil initial hydrocarbons concentration, and soil granulometry, over the total petroleum hydrocarbons TPH degradation, as well as over the microbial count (as colony formation units CFU/g soil) along the process. (Author)

  18. Horizontal arrangement of anodes of microbial fuel cells enhances remediation of petroleum hydrocarbon-contaminated soil.

    Science.gov (United States)

    Zhang, Yueyong; Wang, Xin; Li, Xiaojing; Cheng, Lijuan; Wan, Lili; Zhou, Qixing

    2015-02-01

    With the aim of in situ bioremediation of soil contaminated by hydrocarbons, anodes arranged with two different ways (horizontal or vertical) were compared in microbial fuel cells (MFCs). Charge outputs as high as 833 and 762C were achieved in reactors with anodes horizontally arranged (HA) and vertically arranged (VA). Up to 12.5 % of the total petroleum hydrocarbon (TPH) was removed in HA after 135 days, which was 50.6 % higher than that in VA (8.3 %) and 95.3 % higher than that in the disconnected control (6.4 %). Hydrocarbon fingerprint analysis showed that the degradation rates of both alkanes and polycyclic aromatic hydrocarbons (PAHs) in HA were higher than those in VA. Lower mass transport resistance in the HA than that of the VA seems to result in more power and more TPH degradation. Soil pH was increased from 8.26 to 9.12 in HA and from 8.26 to 8.64 in VA, whereas the conductivity was decreased from 1.99 to 1.54 mS/cm in HA and from 1.99 to 1.46 mS/cm in VA accompanied with the removal of TPH. Considering both enhanced biodegradation of hydrocarbon and generation of charge in HA, the MFC with anodes horizontally arranged is a promising configuration for future applications.

  19. Characterization of Crude Oil Degrading Bacteria Isolated from Contaminated Soils Surrounding Gas Stations.

    Science.gov (United States)

    Abou-Shanab, Reda A I; Eraky, Mohamed; Haddad, Ahmed M; Abdel-Gaffar, Abdel-Rahman B; Salem, Ahmed M

    2016-11-01

    A total of twenty bacterial cultures were isolated from hydrocarbon contaminated soil. Of the 20 isolates, RAM03, RAM06, RAM13, and RAM17 were specifically chosen based on their relatively higher growth on salt medium amended with 4 % crude oil, emulsion index, surface tension, and degradation percentage. These bacterial cultures had 16S rRNA gene sequences that were most similar to Ochrobactrum cytisi (RAM03), Ochrobactrum anthropi (RAM06 and RAM17), and Sinorhizobium meliloti (RAM13) with 96 %, 100 % and 99 %, and 99 % similarity. The tested strains revealed a promising potential for bioremediation of petroleum oil contamination as they could degrade >93 % and 54 % of total petroleum hydrocarbons (TPHs) in a liquid medium and soil amended with 4 % crude oil, respectively, after 30 day incubation. These bacteria could effectively remove both aliphatic and aromatic petroleum hydrocarbons. In conclusion, these strains could be considered as good prospects for their application in bioremediation of hydrocarbon contaminated environment.

  20. Characterization and degradation potential of diesel-degrading bacterial strains for application in bioremediation.

    Science.gov (United States)

    Balseiro-Romero, María; Gkorezis, Panagiotis; Kidd, Petra S; Van Hamme, Jonathan; Weyens, Nele; Monterroso, Carmen; Vangronsveld, Jaco

    2017-10-03

    Bioremediation of polluted soils is a promising technique with low environmental impact, which uses soil organisms to degrade soil contaminants. In this study, 19 bacterial strains isolated from a diesel-contaminated soil were screened for their diesel-degrading potential, biosurfactant (BS) production, and biofilm formation abilities, all desirable characteristics when selecting strains for re-inoculation into hydrocarbon-contaminated soils. Diesel-degradation rates were determined in vitro in minimal medium with diesel as the sole carbon source. The capacity to degrade diesel range organics (DROs) of strains SPG23 (Arthobacter sp.) and PF1 (Acinetobacter oleivorans) reached 17-26% of total DROs after 10 days, and 90% for strain GK2 (Acinetobacter calcoaceticus). The amount and rate of alkane degradation decreased significantly with increasing carbon number for strains SPG23 and PF1. Strain GK2, which produced BSs and biofilms, exhibited a greater extent, and faster rate of alkane degradation compared to SPG23 and PF1. Based on the outcomes of degradation experiments, in addition to BS production, biofilm formation capacities, and previous genome characterizations, strain GK2 is a promising candidate for microbial-assisted phytoremediation of diesel-contaminated soils. These results are of particular interest to select suitable strains for bioremediation, not only presenting high diesel-degradation rates, but also other characteristics which could improve rhizosphere colonization.

  1. Bioremediation of Petroleum and Radiological Contaminated Soils at the Savannah River Site: Laboratory to Field Scale Applications

    Energy Technology Data Exchange (ETDEWEB)

    BRIGMON, ROBINL.

    2004-06-07

    In the process of Savannah River Site (SRS) operations limited amounts of waste are generated containing petroleum, and radiological contaminated soils. Currently, this combination of radiological and petroleum contaminated waste does not have an immediate disposal route and is being stored in low activity vaults. SRS developed and implemented a successful plan for clean up of the petroleum portion of the soils in situ using simple, inexpensive, bioreactor technology. Treatment in a bioreactor removes the petroleum contamination from the soil without spreading radiological contamination to the environment. This bioreactor uses the bioventing process and bioaugmentation or the addition of the select hydrocarbon degrading bacteria. Oxygen is usually the initial rate-limiting factor in the biodegradation of petroleum hydrocarbons. Using the bioventing process allowed control of the supply of nutrients and moisture based on petroleum contamination concentrations and soil type. The results of this work have proven to be a safe and cost-effective means of cleaning up low level radiological and petroleum-contaminated soil. Many of the other elements of the bioreactor design were developed or enhanced during the demonstration of a ''biopile'' to treat the soils beneath a Polish oil refinery's waste disposal lagoons. Aerobic microorganisms were isolated from the aged refinery's acidic sludge contaminated with polycyclic aromatic hydrocarbons (PAHs). Twelve hydrocarbon-degrading bacteria were isolated from the sludge. The predominant PAH degraders were tentatively identified as Achromobacter, Pseudomonas Burkholderia, and Sphingomonas spp. Several Ralstonia spp were also isolated that produce biosurfactants. Biosurfactants can enhance bioremediation by increasing the bioavailability of hydrophobic contaminants including hydrocarbons. The results indicated that the diversity of acid-tolerant PAH-degrading microorganisms in acidic oil wastes may

  2. Bioavailability enhanced rhizosphere remediation of petroleum hydrocarbon contaminated soil

    International Nuclear Information System (INIS)

    Marchenko, A.; Vorobyov, A.; Zharikov, G.; Ermolenko, Z.; Dyadishchev, N.; Borovick, R.; Sokolov, M.; Ortega-Calvo, J.J.

    2005-01-01

    Aliphatic, aromatic and polycyclic aromatic oil hydrocarbons are structurally complicated man-caused pollutants that are constantly brought into biosphere. Oil production in Russia, so as all over the world, is connected with pollution of biotopes, ecosystems and agro-landscapes. Presently large funds are allocated either for oil leak prevention or for discharged oil gathering. At the same time, in spite of large necessity in technologies for efficient reconstruction of soil bio-productivity, reliable regional systems of their remediation in situ have not been developed yet. One such method is rhizosphere remediation, a biotechnology, based on the functioning of plant-microbial complexes. Little is known about bioavailability in phyto-remediation systems. Specific bioavailability-promoting mechanisms, operating in soil with hydrocarbon-degrading populations, may be responsible for increased rates of pollutant transformation (increased bacterial adherence to the pollutants, production of bio-surfactants by bacteria or by plants, possible role of chemotaxis). In the course of work collection of 42 chemo-tactically active bio-surfactant producing strain-degraders of petroleum hydrocarbons including polycyclic aromatic hydrocarbons (PAHs) was created. Two representative strains were selected for detailed chemotaxis studies with PAHs (naphthalene, phenanthrene, anthracene, and pyrene), bacterial lipopolysaccharide and root exudates from seven different plants. These strains are produce the bio-surfactants (rhamno-lipid). The chemotactic response was quantified with a capillary and densitometric chemotaxis assay. Surface tension of cultural liquid was measured after cultivation of strains in the presence of hexadecane or phenanthrene with the use of a ring tensiometer. Before measuring of surface tension microbial cells were collected from liquid culture by centrifugation. Total petroleum Hydrocarbons (TPH) in soil were analyzed by infra-red spectroscopy method. PAHs

  3. Bioavailability enhanced rhizosphere remediation of petroleum hydrocarbon contaminated soil

    Energy Technology Data Exchange (ETDEWEB)

    Marchenko, A.; Vorobyov, A.; Zharikov, G.; Ermolenko, Z.; Dyadishchev, N.; Borovick, R.; Sokolov, M. [Research Centre for Toxicology and Hygienic Regulation of Biopreparations, Moscow region (Russian Federation); Ortega-Calvo, J.J. [Instituto de Recursos Naturales y Agrobiologia, CSIC, Sevilla (Spain)

    2005-07-01

    Aliphatic, aromatic and polycyclic aromatic oil hydrocarbons are structurally complicated man-caused pollutants that are constantly brought into biosphere. Oil production in Russia, so as all over the world, is connected with pollution of biotopes, ecosystems and agro-landscapes. Presently large funds are allocated either for oil leak prevention or for discharged oil gathering. At the same time, in spite of large necessity in technologies for efficient reconstruction of soil bio-productivity, reliable regional systems of their remediation in situ have not been developed yet. One such method is rhizosphere remediation, a biotechnology, based on the functioning of plant-microbial complexes. Little is known about bioavailability in phyto-remediation systems. Specific bioavailability-promoting mechanisms, operating in soil with hydrocarbon-degrading populations, may be responsible for increased rates of pollutant transformation (increased bacterial adherence to the pollutants, production of bio-surfactants by bacteria or by plants, possible role of chemotaxis). In the course of work collection of 42 chemo-tactically active bio-surfactant producing strain-degraders of petroleum hydrocarbons including polycyclic aromatic hydrocarbons (PAHs) was created. Two representative strains were selected for detailed chemotaxis studies with PAHs (naphthalene, phenanthrene, anthracene, and pyrene), bacterial lipopolysaccharide and root exudates from seven different plants. These strains are produce the bio-surfactants (rhamno-lipid). The chemotactic response was quantified with a capillary and densitometric chemotaxis assay. Surface tension of cultural liquid was measured after cultivation of strains in the presence of hexadecane or phenanthrene with the use of a ring tensiometer. Before measuring of surface tension microbial cells were collected from liquid culture by centrifugation. Total petroleum Hydrocarbons (TPH) in soil were analyzed by infra-red spectroscopy method. PAHs

  4. Enhanced aerobic biodegradation of some toxic hydrocarbon pollutants

    International Nuclear Information System (INIS)

    Elshahawy, M.R.M.

    2007-01-01

    samples were collected from the same location in Suez Gulf during the period from June, 2004 to April 2006 then microbiologically and chemically analyzed . the TPH levels ranged from 55 to 86 ppm and exceeded the known permissible limits referring to a settled situation of chronic hydrocarbon pollution in the studied area. on the other hand the biodegrading bacterial counts cfu clearly reflected the great adaptation of endogenous bacteria to use hydrocarbons as a sole source of carbon . the ratio of biodegrading bacteria to heterotrophic ones ranged between 26 and 50% over the period of collection. the biodegradation potentials of suez gulf consortia were studied at different concentrations of phenanthrene as a sole carbon source. it was found that the degradation kinetics of phenanthrene either due to biotic or abiotic factors is affected with the initial concentration of PAHs. twenty PAHs degraders were isolated from Suez Gulf consortia after different adaptation periods on phenanthrene.ten isolates were selected to be promising due to their ability to tolerate high base oil concentrations, grow at wide range of temperatures and their short incubation period on MSO. the biodegradation kinetics of 200 ppm phenanthrene by the selected isolates was monitored by HPLC

  5. From Rare to Dominant: a Fine-Tuned Soil Bacterial Bloom during Petroleum Hydrocarbon Bioremediation.

    Science.gov (United States)

    Fuentes, Sebastián; Barra, Bárbara; Caporaso, J Gregory; Seeger, Michael

    2016-02-01

    Hydrocarbons are worldwide-distributed pollutants that disturb various ecosystems. The aim of this study was to characterize the short-lapse dynamics of soil microbial communities in response to hydrocarbon pollution and different bioremediation treatments. Replicate diesel-spiked soil microcosms were inoculated with either a defined bacterial consortium or a hydrocarbonoclastic bacterial enrichment and incubated for 12 weeks. The microbial community dynamics was followed weekly in microcosms using Illumina 16S rRNA gene sequencing. Both the bacterial consortium and enrichment enhanced hydrocarbon degradation in diesel-polluted soils. A pronounced and rapid bloom of a native gammaproteobacterium was observed in all diesel-polluted soils. A unique operational taxonomic unit (OTU) related to the Alkanindiges genus represented ∼ 0.1% of the sequences in the original community but surprisingly reached >60% after 6 weeks. Despite this Alkanindiges-related bloom, inoculated strains were maintained in the community and may explain the differences in hydrocarbon degradation. This study shows the detailed dynamics of a soil bacterial bloom in response to hydrocarbon pollution, resembling microbial blooms observed in marine environments. Rare community members presumably act as a reservoir of ecological functions in high-diversity environments, such as soils. This rare-to-dominant bacterial shift illustrates the potential role of a rare biosphere facing drastic environmental disturbances. Additionally, it supports the concept of "conditionally rare taxa," in which rareness is a temporary state conditioned by environmental constraints. Copyright © 2016, American Society for Microbiology. All Rights Reserved.

  6. Functional diversity of bacterial genes associated with aromatic hydrocarbon degradation in anthropogenic dark earth of Amazonia

    Directory of Open Access Journals (Sweden)

    Mariana Gomes Germano

    2012-05-01

    Full Text Available The objective of this work was to evaluate the catabolic gene diversity for the bacterial degradation of aromatic hydrocarbons in anthropogenic dark earth of Amazonia (ADE and their biochar (BC. Functional diversity analyses in ADE soils can provide information on how adaptive microorganisms may influence the fertility of soils and what is their involvement in biogeochemical cycles. For this, clone libraries containing the gene encoding for the alpha subunit of aromatic ring-hydroxylating dioxygenases (α-ARHD bacterial gene were constructed, totaling 800 clones. These libraries were prepared from samples of an ADE soil under two different land uses, located at the Caldeirão Experimental Station - secondary forest (SF and agriculture (AG -, and the biochar (SF_BC and AG_BC, respectively. Heterogeneity estimates indicated greater diversity in BC libraries; and Venn diagrams showed more unique operational protein clusters (OPC in the SF_BC library than the ADE soil, which indicates that specific metabolic processes may occur in biochar. Phylogenetic analysis showed unidentified dioxygenases in ADE soils. Libraries containing functional gene encoding for the alpha subunit of the aromatic ring-hydroxylating dioxygenases (ARHD gene from biochar show higher diversity indices than those of ADE under secondary forest and agriculture.

  7. Biodegrader metabolic expansion during polyaromatic hydrocarbons rhizoremediation

    Energy Technology Data Exchange (ETDEWEB)

    Rugh, C.L.; Susilawati, E.; Kravchenko, A.N. [Dept. of Crop and Soil Sciences, Michigan State Univ., East Lansing, MI (United States); Thomas, J.C. [Dept. of Natural Sciences, Univ. of Michigan-Dearborn, Dearborn, MI (United States)

    2005-04-01

    Root-microbe interactions are considered to be the primary process of polyaromatic hydrocarbon (PAH) phytoremediation, since bacterial degradation has been shown to be the dominant pathway for environmental PAH dissipation. However, the precise mechanisms driving PAH rhizostimulation symbiosis remain largely unresolved. In this study, we assessed PAH degrading bacterial abundance in contaminated soils planted with 18 different native Michigan plant species. Phenanthrene metabolism assays suggested that each plant species differentially influenced the relative abundance of PAH biodegraders, though they generally were observed to increase heterotrophic and biodegradative cell numbers relative to unplanted soils. Further study of > 1800 phenanthrene degrading isolates indicated that most of the tested plant species stimulated biodegradation of a broader range of PAH compounds relative to the unplanted soil bacterial consortia. These observations suggest that a principal contribution of planted systems for PAH bioremediation may be via expanded metabolic range of the rhizosphere bacterial community. (orig.)

  8. Microbial degradation of crude oil in marine environments tested in a flask experiment

    International Nuclear Information System (INIS)

    Aldrett, Salvador; Bonner, James S.; Mills, Marc A.; Autenrieth, Robin L.; Stephens, Frank L.

    1997-01-01

    Thirteen different bioremediation products were evaluated for their effectiveness in biodegrading petroleum hydrocarbons. All 13 products tested in this experiment were listed on the NCP product schedule. Of these 13 products, 12 were bioaugmentation agents and one was a biostimulation agent. All the products were tested for toxicity levels initially, using standardized protocols. The products were sampled and analyzed three times over a 28-day period for most-probable number (MPN) of hydrocarbon degraders and total petroleum hydrocarbon as separate fractions. A subsample was analyzed for MPN, and the rest of the sample was extracted and fractionated in total saturated petroleum hydrocarbons (TsPH) and total aromatic petroleum hydrocarbons (TarPH). This experiment revealed that the petroleum hydrocarbons were biodegraded to an extent significantly greater than that achieved by the naturally occurring microorganisms. (author)

  9. IDENTIFICATION OF DIFFERENT FUSARIUM SPP. IN ALLIUM SPP. IN GERMANY.

    Science.gov (United States)

    Boehnke, B; Karlovsky, P; Pfohl, K; Gamliel, A; Isack, Y; Dehne, H W

    2015-01-01

    In 2013 Allium cepa bulbs from different fields in Northern and Southern Germany, seeds and sets from onion breeders were analysed for infestation with Fusarium species. The same investigation was done in 2014 with different edible Allium spp. from local markets. Different Fusarium spp. were isolated and identified by morphological characterisation. 24 different Fusarium spp. were identified. The diversity of Fusarium spp. and the intensity of infestation was higher on edible bulbs compared to the younger sets and seeds. The analysed onions and other edible Allium spp. from local markets showed also high contents of different Fusarium species. The most prevalent identified Fusarium sp. in the analysed Allium spp. in Germany was Fusarium oxysporum which can cause the Fusarium Basal Rot, followed by Fusarium solani. Fusarium proliferatum, which can cause the Fusarium Salmon Blotch in onions, could be detected in about half of the sampled onion fields and in approximately 10% of all analysed onions from fields. Also in the onion sets, on the surface of the seeds and in other edible Allium spp. F. proliferatum could be identified. Besides F. proliferatum, further mycotoxin producing Fusarium spp. like Fusarium equiseti or Fusarium tricinctum were identified. Other Fusarium spp. like Fusarium sporotrichioides and Fusarium poae were first described in Allium sp. in this study. The two most prevalent Fusarium spp. F. oxysporum and F. solani are able to produce mycotoxins like enniatins, fumonisins, moniliformin and T-2 toxins. Fusarium sp. like F. proliferatum, F. equiseti and F. tricinctum are able to produce additional toxins like beauvericins, zearalenone and diacetoscirpenol. This high number of Fusarium spp., which are able to produce a broad spectrum of different mycotoxins, could be a potential health risk for human beings and livestock.

  10. Abundance and activity of oil-degrading and indigenous bacteria in sediment microcosms

    International Nuclear Information System (INIS)

    Araujo, R.; Molina, M.; Bachoon, D.

    1995-01-01

    The responses of bacterial community composition and degradation crude oil to applications of bioremediation products and plant detrital material were investigated in wetlands microcosms. The microcosms were constructed of sieved sediments and operated as tidal marshes. Products included nutrients, organisms, surfactants and combinations thereof; dried ground Spartina was the source of detrital material. Plate count and most probable-number techniques were used to enumerate microbial populations and GC/MS analysis of indicator petroleum hydrocarbons was used to assess oil degradation. Microbial communities were characterized by whole-genome hybridization and specific probes for bacterial groups, including Pseudomonas, Streptomycetes, Vibrio, and sulfate-reducing bacteria. Although the total microbial numbers were similar in all bioremediation treatments, the numbers of oil degraders increased two to three log units in the fertilizer and microbial-degrader-enriched treatments. Oil-degraders comprised the largest fraction of the total population in the treatment amended with microbial degraders, apparently at the expense of indigenous bacteria, as indicated by specific probes. Oil-degraders were also detected in the subsurface in all treatments except the controls. The extent of oil degradation was not consistent with bacterial numbers; only nutrient additions resulted in significantly enhanced degradation of oil. After 1 month of microcosm operation, oil-degraders had increased at least two orders of magnitude in sediment surface layers when oil was added alone or with Spartina detritus, although total bacterial numbers and the number of oil-degraders decreased to near initial levels by 2 months. The peak coincides with bacterial utilization of the alkane fraction of petroleum hydrocarbons

  11. Distribution of endophytic bacteria in Alopecurus aequalis Sobol and Oxalis corniculata L. from soils contaminated by polycyclic aromatic hydrocarbons.

    Directory of Open Access Journals (Sweden)

    Anping Peng

    Full Text Available The distributions of endophytic bacteria in Alopecurus aequalis Sobol and Oxalis corniculata L. grown in soils contaminated with different levels of polycyclic aromatic hydrocarbons (PAHs were investigated with polymerase chain reaction followed by denaturing gradient gel electrophoresis technology (PCR-DGGE and cultivation methods. Twelve types of PAHs, at concentrations varying from 0.16 to 180 mg·kg(-1, were observed in the roots and shoots of the two plants. The total PAH concentrations in Alopecurus aequalis Sobol obtained from three different PAH-contaminated stations were 184, 197, and 304 mg·kg(-1, and the total PAH concentrations in Oxalis corniculata L. were 251, 346, and 600 mg·kg(-1, respectively. The PCR-DGGE results showed that the endophytic bacterial communities in the roots and shoots of the two plants were quite different, although most bacteria belonged to Firmicutes, Proteobacteria, Actinobacteria and Bacteroidetes. A total of 68 endophytic bacterial strains were isolated from different tissues of the two plants and classified into three phyla: Firmicutes, Proteobacteria and Bacteroidetes. In both plants, Bacillus spp. and Pseudomonas spp. were the dominant cultivable populations. With an increase in the PAH pollution level, the diversity and distribution of endophytic bacteria in the two plants changed correspondingly, and the number of cultivable endophytic bacterial strains decreased rapidly. Testing of the isolated endophytic bacteria for tolerance to each type of PAH showed that most isolates could grow well on Luria-Bertani media in the presence of different PAHs, and some isolates were able to grow rapidly on a mineral salt medium with a single PAH as the sole carbon and energy source, indicating that these strains may have the potential to degrade PAHs in plants. This research provides the first insight into the characteristics of endophytic bacterial populations under different PAH pollution levels and provides a

  12. Radiation degradation of biological residues (Aflatoxins) produced in food laboratory

    International Nuclear Information System (INIS)

    Rogovschi, Vladimir D.; Aquino, Simone; Nunes, Thaise C.F.; Trindade, Reginaldo A.; Villavicencio, Anna L.C.H.; Zorzete, Patricia; Correa, Benedito

    2007-01-01

    Some molds have the capacity to produce substances that are toxic and generally cancer-causing agents, such as aflatoxins, that stand between the most important carcinogenic substances (class one of the agents which are certainly carcinogenous for human people according to the International Agency for Research on Cancer). Aspergillus spp. is present in world-wide distribution, with predominance in tropical and subtropical regions growing in any substratum. The aim of this work is establish a minimum dose of radiation that degrades aflatoxins produced by fungi Aspergillus spp. The Aspergillus spp. colonies will be cultivated in coconut agar medium and the samples will be conditioned in appropriate bags for irradiation treatment of contaminated material and processed in the Gammacell 220 with dose of 20 kGy. (author)

  13. Radiation degradation of biological residues (Aflatoxins) produced in food laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Rogovschi, Vladimir D.; Aquino, Simone; Nunes, Thaise C.F.; Trindade, Reginaldo A.; Villavicencio, Anna L.C.H. [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (brazil)]. E-mails: vladrogo@yahoo.com.br; villavic@ipen.br; Zorzete, Patricia; Correa, Benedito [Universidade de Sao Paulo, SP (Brazil). Inst. de Ciencias Biomedicas]. E-mail: correabe@usp.br

    2007-07-01

    Some molds have the capacity to produce substances that are toxic and generally cancer-causing agents, such as aflatoxins, that stand between the most important carcinogenic substances (class one of the agents which are certainly carcinogenous for human people according to the International Agency for Research on Cancer). Aspergillus spp. is present in world-wide distribution, with predominance in tropical and subtropical regions growing in any substratum. The aim of this work is establish a minimum dose of radiation that degrades aflatoxins produced by fungi Aspergillus spp. The Aspergillus spp. colonies will be cultivated in coconut agar medium and the samples will be conditioned in appropriate bags for irradiation treatment of contaminated material and processed in the Gammacell 220 with dose of 20 kGy. (author)

  14. Investigation of Underground Hydrocarbon Leakage using Ground Penetrating Radar

    Science.gov (United States)

    Srigutomo, Wahyu; Trimadona; Agustine, Eleonora

    2016-08-01

    Ground Penetrating Radar (GPR) survey was carried out in several petroleum plants to investigate hydrocarbon contamination beneath the surface. The hydrocarbon spills are generally recognized as Light Non-Aqueous Phase Liquids (LNAPL) if the plume of leakage is distributed in the capillary fringe above the water table and as Dense Non-Aqueous Phase Liquids (DNAPL) if it is below the water table. GPR antennas of 200 MHz and 400 MHz were deployed to obtain clear radargrams until 4 m deep. In general, the interpreted radargram sections indicate the presence of surface concrete layer, the compacted silty soill followed by sand layer and the original clayey soil as well as the water table. The presence of hydrocarbon plumes are identified as shadow zones (radar velocity and intensity contrasts) in the radargram that blur the layering pattern with different intensity of reflected signal. Based on our results, the characteristic of the shadow zones in the radargram is controlled by several factors: types of hydrocarbon (fresh or bio-degraded), water moisture in the soil, and clay content which contribute variation in electrical conductivity and dielectric constants of the soil.

  15. Salix purpurea Stimulates the Expression of Specific Bacterial Xenobiotic Degradation Genes in a Soil Contaminated with Hydrocarbons.

    Directory of Open Access Journals (Sweden)

    Antoine P Pagé

    Full Text Available The objectives of this study were to uncover Salix purpurea-microbe xenobiotic degradation systems that could be harnessed in rhizoremediation, and to identify microorganisms that are likely involved in these partnerships. To do so, we tested S. purpurea's ability to stimulate the expression of 10 marker microbial oxygenase genes in a soil contaminated with hydrocarbons. In what appeared to be a detoxification rhizosphere effect, transcripts encoding for alkane 1-monooxygenases, cytochrome P450 monooxygenases, laccase/polyphenol oxidases, and biphenyl 2,3-dioxygenase small subunits were significantly more abundant in the vicinity of the plant's roots than in bulk soil. This gene expression induction is consistent with willows' known rhizoremediation capabilities, and suggests the existence of S. purpurea-microbe systems that target many organic contaminants of interest (i.e. C4-C16 alkanes, fluoranthene, anthracene, benzo(apyrene, biphenyl, polychlorinated biphenyls. An enhanced expression of the 4 genes was also observed within the bacterial orders Actinomycetales, Rhodospirillales, Burkholderiales, Alteromonadales, Solirubrobacterales, Caulobacterales, and Rhizobiales, which suggest that members of these taxa are active participants in the exposed partnerships. Although the expression of the other 6 marker genes did not appear to be stimulated by the plant at the community level, signs of additional systems that rest on their expression by members of the orders Solirubrobacterales, Sphingomonadales, Actinomycetales, and Sphingobacteriales were observed. Our study presents the first transcriptomics-based identification of microbes whose xenobiotic degradation activity in soil appears stimulated by a plant. It paints a portrait that contrasts with the current views on these consortia's composition, and opens the door for the development of laboratory test models geared towards the identification of root exudate characteristics that limit the

  16. Bioaugmentation and biostimulation as strategies for the bioremediation of a burned woodland soil contaminated by toxic hydrocarbons: a comparative study.

    Science.gov (United States)

    Andreolli, Marco; Lampis, Silvia; Brignoli, Pierlorenzo; Vallini, Giovanni

    2015-04-15

    In this work, the natural attenuation strategy (no soil amendments done) was compared with two different bioremediation approaches, namely bioaugmentation through soil inoculation with a suspension of Trichoderma sp. mycelium and biostimulation by soil addition with a microbial growth promoting formulation, in order to verify the effectiveness of these methods in terms of degradation efficiency towards toxic hydrocarbons, with particular attention to the high molecular weight (HMW) fraction, in a forest area impacted by recent wildfire in Northern Italy. The area under investigation, divided into three parcels, was monitored to figure out the dynamics of decay in soil concentration of C₁₂₋₄₀ hydrocarbons (including isoalkanes, cycloalkanes, alkyl-benzenes and alkyl-naphthalenes besides PAHs) and low molecular weight (LMW) PAHs, following the adoption of the foregoing different remediation strategies. Soil hydrocarbonoclastic potential was even checked by characterizing the autochthonous microbial cenoses. Field experiments proved that the best performance in the abatement of HMW hydrocarbons was reached 60 days after soil treatment through the biostimulation protocol, when about 70% of the initial concentration of HMW hydrocarbons was depleted. Within the same time, about 55% degradation was obtained with the bioaugmentation protocol, whilst natural attenuation allowed only a 45% removal of the starting C12-40 hydrocarbon fraction. Therefore, biostimulation seems to significantly reduce the time required for the remediation, most likely because of the enhancement of microbial degradation through the improvement of nutrient balance in the burned soil. Copyright © 2015 Elsevier Ltd. All rights reserved.

  17. Assessment of Bacterial Degradation of Aromatic Hydrocarbons in the Environment by Analysis of Stable Carbon Isotope Fractionation

    Energy Technology Data Exchange (ETDEWEB)

    Meckenstock, Rainer U. [Eberhard-Karls University of Tuebingen, Center for Applied Geoscience (Germany)], E-mail: rainer.meckenstock@uni-tuebingen.de; Morasch, Barbara [University of Konstanz, Faculty of Biology (Germany); Kaestner, Matthias; Vieth, Andrea; Richnow, Hans Hermann [Center for Environmental Research, Department of Remediation Research (Germany)

    2002-05-15

    direction of the groundwater flow and revealed decreasing concentrations accompanied with an increase in the {sup 13}C/{sup 12}C stable carbon isotope ratio of the residual toluene. Calculation of the extent of biodegradation based on the isotope values and laboratory derived isotope fractionation factors showed that the residual toluene was degraded to more than 99% by microbial activity. Calculation of the theoretical residual toluene concentrations based on the measured isotope values described the strongly decreasing concentrations along the plume. Other aromatic hydrocarbons like benzene and naphthalene which were analysed in the same course also showed decreasing concentrations along the groundwater flow path accompanied by increasing {delta}{sup 13}C values indicating biodegradation.

  18. Degradation of n-alkanes and PAHs from the heavy crude oil using salt-tolerant bacterial consortia and analysis of their catabolic genes.

    Science.gov (United States)

    Gurav, Ranjit; Lyu, Honghong; Ma, Jianli; Tang, Jingchun; Liu, Qinglong; Zhang, Hairong

    2017-04-01

    In the present study, salt-tolerant strains, Dietzia sp. HRJ2, Corynebacterium variabile HRJ4, Dietzia cinnamea HRJ5 and Bacillus tequilensis HRJ6 were isolated from the Dagang oil field, China. These strains degraded n-alkanes and polycyclic aromatic hydrocarbons (PAHs) aerobically from heavy crude oil (HCO) in an experiment at 37 °C and 140 rpm. The GC/MS investigation for degradation of different chain lengths of n-alkanes (C8-C40) by individual strains showed the highest degradation of C8-C19 (HRJ5), C20-C30 (HRJ4) and C31-C40 (HRJ5), respectively. Moreover, degradation of 16 PAHs with individual strains demonstrated that the bicyclic and pentacyclic aromatic hydrocarbons (AHs) were mostly degraded by HRJ5, tricyclic and tetracyclic AHs by HRJ6 and hexacyclic AHs by HRJ2. However, the highest degradation of total petroleum hydrocarbons (TPHs), total saturated hydrocarbons (TSH), total aromatic hydrocarbons (TAH), n-alkanes (C8-C40) and 16 PAHs was achieved by a four-membered consortium (HRJ2 + 4 + 5 + 6) within 12 days, with the predominance of HRJ4 and HRJ6 strains which was confirmed by denaturing gradient gel electrophoresis. The abundance of alkB and nah genes responsible for catabolism of n-alkanes and PAHs was quantified using the qPCR. Maximum copy numbers of genes were observed in HRJ2 + 4 + 5 + 6 consortium (gene copies l -1 ) 2.53 × 10 4 (alkB) and 3.47 × 10 3 (nah) at 12 days, which corresponded to higher degradation rates of petroleum hydrocarbons. The superoxide dismutase (SOD) (total SOD (T-SOD), Cu 2+ Zn 2+ -SOD), catalase (CAT) and ascorbate peroxidase (APX) activities in Allium sativum and Triticum aestivum were lower in the HRJ2 + 4 + 5 + 6-treated HCO as compared to the plantlets exposed directly to HCO. The present results revealed the effective degradation of HCO-contaminated saline medium using the microbial consortium having greater metabolic diversity.

  19. Plant residues--a low cost, effective bioremediation treatment for petrogenic hydrocarbon-contaminated soil.

    Science.gov (United States)

    Shahsavari, Esmaeil; Adetutu, Eric M; Anderson, Peter A; Ball, Andrew S

    2013-01-15

    Petrogenic hydrocarbons represent the most commonly reported environmental contaminant in industrialised countries. In terms of remediating petrogenic contaminated hydrocarbons, finding sustainable non-invasive technologies represents an important goal. In this study, the effect of 4 types of plant residues on the bioremediation of aliphatic hydrocarbons was investigated in a 90 day greenhouse experiment. The results showed that contaminated soil amended with different plant residues led to statistically significant increases in the utilisation rate of Total Petroleum Hydrocarbon (TPH) relative to control values. The maximum TPH reduction (up to 83% or 6800 mg kg(-1)) occurred in soil mixed with pea straw, compared to a TPH reduction of 57% (4633 mg kg(-1)) in control soil. A positive correlation (0.75) between TPH reduction rate and the population of hydrocarbon-utilising microorganisms was observed; a weaker correlation (0.68) was seen between TPH degradation and bacterial population, confirming that adding plant materials significantly enhanced both hydrocarbonoclastic and general microbial soil activities. Microbial community analysis using Denaturing Gradient Gel Electrophoresis (DGGE) showed that amending the contaminated soil with plant residues (e.g., pea straw) caused changes in the soil microbial structure, as observed using the Shannon diversity index; the diversity index increased in amended treatments, suggesting that microorganisms present on the dead biomass may become important members of the microbial community. In terms of specific hydrocarbonoclastic activity, the number of alkB gene copies in the soil microbial community increased about 300-fold when plant residues were added to contaminated soil. This study has shown that plant residues stimulate TPH degradation in contaminated soil through stimulation and perhaps addition to the pool of hydrocarbon-utilising microorganisms, resulting in a changed microbial structure and increased alkB gene

  20. Impact of hydrocarbon type, concentration and weathering on its biodegradability in soil.

    Science.gov (United States)

    Maletić, Snežana P; Dalmacija, Božo D; Rončević, Srđan D; Agbaba, Jasmina R; Perović, Svetlana D Ugarčina

    2011-01-01

    The objective of this research was to investigate the impact of the hydrocarbon type and concentration, as well as the total effect of the natural weathering process to hydrocarbon biodegradability in sandy soil and the environment. In this experiment, sandy soil was separately contaminated with 0.5%, 1.0%, 2.0% and 3.5% of diesel and crude oils. Oil contaminated soil was taken from the Oil Refinery dumping sites after 9 years of weathering, and its concentration was adjusted to the above-mentioned levels. The biodegradation process was monitored by measuring CO(2), evolution rate, hydrocarbon degradation rate and dehydrogenase activity. The favourable concentration ranges for the soil contaminated with diesel oil were 1.0%, with concentrations at about 2.0% causing slightly adverse effects to CO(2) production which was overcome after 2 weeks, and with 3.5% diesel oil causing significant toxicity. For soil contaminated with crude oil, 2.0% was found to be optimum for effective biodegradation, with 3.5% crude oil also causing adverse effects to CO(2) production, although less so than the same concentration of diesel oil. No adverse effect was obtained for any concentration of the weathered oil, as after the weathering process, the remaining contaminants in the soil were mostly poorly degradable constituents like asphaltenes, resins etc. It has been proposed that such residual material from oil degradation is analogous to, and can even be regarded as, humic material. Due to its inert characteristics, insolubility and similarity to humic materials it is unlikely to be environmentally hazardous.

  1. Varying Conditions for Hexanoic Acid Degradation with BioTiger™

    Energy Technology Data Exchange (ETDEWEB)

    Foreman, Koji [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Milliken, Charles [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Brigmon, Robin [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2016-07-27

    BioTiger™ (BT) is a consortium of 12 bacteria designed for petroleum waste biodegradation. BT is currently being studied and could be considered for bioremediation of the Athabasca oil sands refineries in Canada and elsewhere. The run-off ponds from the petroleum extraction processes, called tailings ponds, are a mixture of polycyclic aromatic hydrocarbons, naphthenic acids, hydrocarbons, toxic chemicals like heavy metals, water, and sand. Due to environmental regulations the oil industry would like to separate and degrade the hazardous chemical species from the tailings ponds while recycling the water. It has been shown that BT at 30 C° is able to completely degrade 10 mM hexanoic acid (HA) co-metabolically with 0.2% yeast extract (w/v) in 48 hours when starting at 0.4 OD 600nm. After establishing this stable degradation capability, variations were tested to explore the wider parameters of BT activity in temperature, pH, intermediate degradation, co-metabolic dependence, and transfer stability. Due to the vast differences in temperature at various points in the refineries, a wide range of temperatures were assessed. The results indicate that BT retains the ability to degrade HA, a model surrogate for tailings pond contaminants, at temperatures ranging from 15°C to 35°C. Hexanamide (HAM) was shown to be an intermediate generated during the degradation of HA in an earlier work and HAM is completely degraded after 48 hours, indicating that HAM is not the final product of HA degradation. Various replacements for yeast extract were attempted. Glucose, a carbon source; casein amino acids, a protein source; additional ammonia, mimicking known media; and additional phosphate with Wolffe’s vitamins and minerals all showed no significant degradation of HA compared to control. Decreasing the yeast extract concentration (0.05%) demonstrated limited but significant degradation. Finally, serial inoculations of BT were performed to determine the stability of degradation

  2. Aliphatic and polycyclic aromatic hydrocarbons in Gulf of Trieste sediments (northern Adriatic): potential impacts of maritime traffic.

    Science.gov (United States)

    Bajt, Oliver

    2014-09-01

    The Gulf of Trieste (northern Adriatic) is one of the most urbanized and industrialized areas in the northern Adriatic, with intense maritime traffic experienced at multiple ports. The impact of maritime traffic on contamination by hydrocarbons in this area was assessed. Concentrations of hydrocarbons were higher near the expected contamination sources and still elevated in the adjacent offshore areas. Aliphatic hydrocarbons were mainly of petrogenic origin, with some contribution of biogenic origin. A continuous contamination by aliphatic hydrocarbons and degradation processes were hypothesized. Concentrations of total polycyclic aromatic hydrocarbons (PAH) were generally greater near the contamination sources. Compared to the prevailing pyrolytic origin, the petrogenic PAH origin seemed to be less important, but not negligible. Results revealed that intensive maritime traffic is a probable source of contamination by hydrocarbons in the investigated area, which is largely limited to areas near the contamination sources.

  3. Utilization of hydrocarbons by cyanobacteria from microbial mats on oily coasts of the Gulf

    International Nuclear Information System (INIS)

    Al Hasan, R.H.; Sorkhoh, N.A.; Al Bader, D.; Radwan, S.S.

    1994-01-01

    Several pieces of evidence indicate that Microcoleus chthonoplastes and Phormidium corium, the predominant cyanobacteria in microbial mats on crude oil polluting the Arabian Gulf coasts, contribute to oil degradation by consuming individual n-alkanes. Both cyanobacteria grew phototrophically better in the presence of crude oil or individual n-alkanes than in their absence, indicating that hydrocarbons may have been utilized. This result was true when growth was measured in terms of dry biomass, as well as in terms of the content of biliprotein, the accessory pigment characteristic of cyanobacteria. The phototrophic biomass production by P. corium was directly proportional to the concentration of n-nonadecane (C 19 ) in the medium. The chlorophyll to carotene ratio of hydrocarbon-grown cyanobacteria did not decrease compared to the ratio in the absence of hydrocarbons, indicating that on hydrocarbons the organisms were not stressed. Comparing the fatty acid patterns of total lipids from hydrocarbon-grown cyanobacteria to those of the same organisms grown without hydrocarbons confirms that n-alkanes were taken up and oxidized to fatty acids by both cyanobacteria. (orig.)

  4. Phytoremediation of abandoned crude oil contaminated drill sites of Assam with the aid of a hydrocarbon-degrading bacterial formulation.

    Science.gov (United States)

    Yenn, R; Borah, M; Boruah, H P Deka; Roy, A Sarma; Baruah, R; Saikia, N; Sahu, O P; Tamuli, A K

    2014-01-01

    Environmental deterioration due to crude oil contamination and abandoned drill sites is an ecological concern in Assam. To revive such contaminated sites, afield study was conducted to phytoremediate four crude oil abandoned drill sites of Assam (Gelakey, Amguri, Lakwa, and Borholla) with the aid of two hydrocarbon-degrading Pseudomonas strains designated N3 and N4. All the drill sites were contaminated with 15.1 to 32.8% crude oil, and the soil was alkaline in nature (pH8.0-8.7) with low moisture content, low soil conductivity and low activities of the soil enzymes phosphatase, dehydrogenase and urease. In addition, N, P, K, and C contents were below threshold limits, and the soil contained high levels of heavy metals. Bio-augmentation was achieved by applying Pseudomonas aeruginosa strains N3 and N4 followed by the introduction of screened plant species Tectona grandis, Gmelina arborea, Azadirachta indica, and Michelia champaca. The findings established the feasibility of the phytoremediation of abandoned crude oil-contaminated drill sites in Assam using microbes and native plants.

  5. Methane and Benzene in Drinking-Water Wells Overlying the Eagle Ford, Fayetteville, and Haynesville Shale Hydrocarbon Production Areas.

    Science.gov (United States)

    McMahon, Peter B; Barlow, Jeannie R B; Engle, Mark A; Belitz, Kenneth; Ging, Patricia B; Hunt, Andrew G; Jurgens, Bryant C; Kharaka, Yousif K; Tollett, Roland W; Kresse, Timothy M

    2017-06-20

    Water wells (n = 116) overlying the Eagle Ford, Fayetteville, and Haynesville Shale hydrocarbon production areas were sampled for chemical, isotopic, and groundwater-age tracers to investigate the occurrence and sources of selected hydrocarbons in groundwater. Methane isotopes and hydrocarbon gas compositions indicate most of the methane in the wells was biogenic and produced by the CO 2 reduction pathway, not from thermogenic shale gas. Two samples contained methane from the fermentation pathway that could be associated with hydrocarbon degradation based on their co-occurrence with hydrocarbons such as ethylbenzene and butane. Benzene was detected at low concentrations (2500 years, indicating the benzene was from subsurface sources such as natural hydrocarbon migration or leaking hydrocarbon wells. One sample contained benzene that could be from a surface release associated with hydrocarbon production activities based on its age (10 ± 2.4 years) and proximity to hydrocarbon wells. Groundwater travel times inferred from the age-data indicate decades or longer may be needed to fully assess the effects of potential subsurface and surface releases of hydrocarbons on the wells.

  6. Ecology and biotechnological potential of the thermophilic fermentative Coprothermobacter spp.

    Science.gov (United States)

    Gagliano, M C; Braguglia, C M; Petruccioli, M; Rossetti, S

    2015-05-01

    Thermophilic bacteria have been isolated from several terrestrial, marine and industrial environments. Anaerobic digesters treating organic wastes are often an important source of these microorganisms, which catalyze a wide array of metabolic processes. Moreover, organic wastes are primarily composed of proteins, whose degradation is often incomplete. Coprothermobacter spp. are proteolytic anaerobic thermophilic microbes identified in several studies focused on the analysis of the microbial community structure in anaerobic thermophilic reactors. They are currently classified in the phylum Firmicutes; nevertheless, several authors showed that the Coprothermobacter group is most closely related to the phyla Dictyoglomi and Thermotoga. Since only a few proteolytic anaerobic thermophiles have been characterized so far, this microorganism has attracted the attention of researchers for its potential applications with high-temperature environments. In addition to proteolysis, Coprothermobacter spp. showed several metabolic abilities and may have a biotechnological application either as source of thermostable enzymes or as inoculum in anaerobic processes. Moreover, they can improve protein degradation by establishing a syntrophy with hydrogenotrophic archaea. To gain a better understanding of the phylogenesis, metabolic capabilities and adaptations of these microorganisms, it is of importance to better define the role in thermophilic environments and to disclose properties not yet investigated. © FEMS 2015. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  7. Removal of high-molecular weight polycyclic aromatic hydrocarbons

    Directory of Open Access Journals (Sweden)

    Ulrich Vasconcelos

    2011-01-01

    Full Text Available Alternatives for the removal of high-molecular weight polycyclic aromatic hydrocarbons (HWM-PAH from soil were tested by adding fertilizer or glycerol, as well as the combination of both. Experiments were carried out for 60 days in reactors containing a HWM-PAH-contaminated soil (8030 μg kg-1, accompanied by pH monitoring, humidity control and quantification of total heterotrophic bacteria and total fungus. Fertilizer addition removed 41.6% of HWM-PAH. Fertilizer and glycerol in combination removed 46.2%. When glycerol was added individually, degradation reached 50.4%. Glycerol also promoted the increase of degradation rate during the first 30 days suggesting the HMW-PAH removal occurred through cometabolic pathways.

  8. Investigating bacterial populations in styrene-degrading biofilters by 16S rDNA tag pyrosequencing.

    Science.gov (United States)

    Portune, Kevin J; Pérez, M Carmen; Álvarez-Hornos, F Javier; Gabaldón, Carmen

    2015-01-01

    Microbial biofilms are essential components in the elimination of pollutants within biofilters, yet still little is known regarding the complex relationships between microbial community structure and biodegradation function within these engineered ecosystems. To further explore this relationship, 16S rDNA tag pyrosequencing was applied to samples taken at four time points from a styrene-degrading biofilter undergoing variable operating conditions. Changes in microbial structure were observed between different stages of biofilter operation, and the level of styrene concentration was revealed to be a critical factor affecting these changes. Bacterial genera Azoarcus and Pseudomonas were among the dominant classified genera in the biofilter. Canonical correspondence analysis (CCA) and correlation analysis revealed that the genera Brevundimonas, Hydrogenophaga, and Achromobacter may play important roles in styrene degradation under increasing styrene concentrations. No significant correlations (P > 0.05) could be detected between biofilter operational/functional parameters and biodiversity measurements, although biological heterogeneity within biofilms and/or technical variability within pyrosequencing may have considerably affected these results. Percentages of selected bacterial taxonomic groups detected by fluorescence in situ hybridization (FISH) were compared to results from pyrosequencing in order to assess the effectiveness and limitations of each method for identifying each microbial taxon. Comparison of results revealed discrepancies between the two methods in the detected percentages of numerous taxonomic groups. Biases and technical limitations of both FISH and pyrosequencing, such as the binding of FISH probes to non-target microbial groups and lack of classification of sequences for defined taxonomic groups from pyrosequencing, may partially explain some differences between the two methods.

  9. Solo Mycoremediation Impacted by Waste Hydrocarbons

    Directory of Open Access Journals (Sweden)

    Franklin Santos Freire

    2015-06-01

    Full Text Available Oil and its derivatives are the principal means of energy generation for vehicles that transport raw materials and goods produced in developed and developing regions accentuating the risk of accidents by spills in stockpiling, transport, use or discarding. The contamination by total hydrocarbons suggests the elevated propension to mutations and to the formation of carcinogenic tumors, as a consequence of the exposure to human contamination by these products. This work had as aims: a To investigate, in a laboratorial scale, the degrading capacity of autochthonous microbiota in the presence of differing concentrations of hydrocarbons (0%, 2,5%, 5% e 7,5%; b To isolate fungi tolerant to the contaminant; c To quantify and analyze the biodegradation capacity of soil through the microbial biomass and metabolic quotient; and d To set, in laboratory, ideal conditions of biodegradation of the xenobiotic compound. Some parameters of microbial activity have been evaluated, such as: biological (Carbon of microbial biomass, CO2 , qCO2 emission, and fungi growth, chemical (pH, electrical conductivity –EC –, analysis of fertility and total hydrocarbons and physical (physical composition of the soil for analysis and comparisons. The obtained results suggest that the adding of 5% of waste oil in the ground provided ideal condition for the biodegradation of he   contaminant in the environment. From the evaluated parameters, the emission of CO2 and microbial C were considered more indicative of changes in soil microbial activity subject to the addition of hydrocarbons, confirming the possibility of microremediation use.

  10. Secretion of laccase and manganese peroxidase by Pleurotus strains cultivate in solid-state using Pinus spp. sawdust

    Directory of Open Access Journals (Sweden)

    Marli Camassola

    2013-01-01

    Full Text Available Pleurotus species secrete phenol oxidase enzymes: laccase (Lcc and manganese peroxidase (MnP. New genotypes of these species show potential to be used in processes aiming at the degradation of phenolic compounds, polycyclic aromatic hydrocarbons and dyes. Hence, a screening of some strains of Pleurotus towards Lcc and MnP production was performed in this work. Ten strains were grown through solid-state fermentation on a medium based on Pinus spp. sawdust, wheat bran and calcium carbonate. High Lcc and MnP activities were found with these strains. Highest Lcc activity, 741 ± 245 U gdm-1 of solid state-cultivation medium, was detected on strain IB11 after 32 days, while the highest MnP activity occurred with strains IB05, IB09, and IB11 (5,333 ± 357; 4,701 ± 652; 5,999 ± 1,078 U gdm-1, respectively. The results obtained here highlight the importance of further experiments with lignocellulolytic enzymes present in different strains of Pleurotus species. Such results also indicate the possibility of selecting more valuable strains for future biotechnological applications, in soil bioremediation and biological biomass pre-treatment in biofuels production, for instance, as well as obtaining value-added products from mushrooms, like phenol oxidase enzymes.

  11. Degradation of petroleum hydrocarbons by oil field isolated bacterial ...

    African Journals Online (AJOL)

    A mixed consortium was prepared with 15 bacteria isolated by enrichment technique from the sample collected from an oil contaminated site. This consortium was incubated with crude oil to investigate the metabolic capability of bacteria. The degradation efficiency of the isolates in consortium was checked with 2% crude oil ...

  12. Bacterial Endophytes Isolated from Plants in Natural Oil Seep Soils with Chronic Hydrocarbon Contamination.

    Science.gov (United States)

    Lumactud, Rhea; Shen, Shu Yi; Lau, Mimas; Fulthorpe, Roberta

    2016-01-01

    The bacterial endophytic communities of four plants growing abundantly in soils highly contaminated by hydrocarbons were analyzed through culturable and culture-independent means. Given their tolerance to the high levels of petroleum contamination at our study site, we sought evidence that Achillea millefolium, Solidago canadensis, Trifolium aureum, and Dactylis glomerata support high levels of hydrocarbon degrading endophytes. A total of 190 isolates were isolated from four plant species. The isolates were identified by partial 16S rDNA sequence analysis, with class Actinobacteria as the dominant group in all species except S. canadensis, which was dominated by Gammaproteobacteria. Microbacterium foliorum and Plantibacter flavus were present in all the plants, with M. foliorum showing predominance in D. glomerata and both endophytic bacterial species dominated T. aureum. More than 50% of the isolates demonstrated degradative capabilities for octanol, toluene, naphthalene, kerosene, or motor oil based on sole carbon source growth screens involving the reduction of tetrazolium dye. P. flavus isolates from all the sampled plants showed growth on all the petroleum hydrocarbons (PHCs) substrates tested. Mineralization of toluene and naphthalene was confirmed using gas-chromatography. 16S based terminal restriction fragment length polymorphism analysis revealed significant differences between the endophytic bacterial communities showing them to be plant host specific at this site. To our knowledge, this is the first account of the degradation potential of bacterial endophytes in these commonly occurring pioneer plants that were not previously known as phytoremediating plants.

  13. Bacterial endophytes isolated from plants in natural oil seep soils with chronic hydrocarbon contamination

    Directory of Open Access Journals (Sweden)

    Rhea eLumactud

    2016-05-01

    Full Text Available The bacterial endophytic communities of four plants growing abundantly in soils highly contaminated by hydrocarbons were analyzed through culturable and and culture-independent means. Given their tolerance to the high levels of petroleum contamination at our study site, we sought evidence that Achillea millefolium, Solidago canadensis, Trifolium aureum and Dactylis glomerata support high levels of hydrocarbon degrading endophytes. A total of 190 isolates were isolated from four plant species. The isolates were identified by partial 16S rDNA sequence analysis, with class Actinobacteria as the dominant group in all species except Solidago canadensis, which was dominated by Gammaproteobacteria. Microbacterium foliorum and Plantibacter flavus were present in all the plants, with M. foliorum showing predominance in D. glomerata and both endophytic bacterial species dominated T. aureum. More than 50% of the isolates demonstrated degradative capabilities for octanol, toluene, naphthalene, kerosene or motor oil based on sole carbon source growth screens involving the reduction of tetrazolium dye. P. flavus isolates from all the sampled plants showed growth on all the petroleum hydrocarbons substrates tested. Mineralization of toluene and naphthalene was confirmed using gas-chromatography. 16S based terminal restriction fragment length polymorphism analysis revealed significant differences between the endophytic bacterial communities showing them to be plant host specific at this site. To our knowledge, this is the first account of the degradation potential of bacterial endophytes in these commonly occurring pioneer plants that were not previously known as phytoremediating plants.

  14. Carbazole angular dioxygenation and mineralization by bacteria isolated from hydrocarbon-contaminated tropical African soil.

    Science.gov (United States)

    Salam, L B; Ilori, M O; Amund, O O; Numata, M; Horisaki, T; Nojiri, H

    2014-01-01

    Four bacterial strains isolated from hydrocarbon-contaminated soils in Lagos, Nigeria, displayed extensive degradation abilities on carbazole, an N-heterocyclic aromatic hydrocarbon. Physicochemical analyses of the sampling sites (ACPP, MWO, NESU) indicate gross pollution of the soils with a high hydrocarbon content (157,067.9 mg/kg) and presence of heavy metals. Phylogenetic analysis of the four strains indicated that they were identified as Achromobacter sp. strain SL1, Pseudomonas sp. strain SL4, Microbacterium esteraromaticum strain SL6, and Stenotrophomonas maltophilia strain BA. The rates of degradation of carbazole by the four isolates during 30 days of incubation were 0.057, 0.062, 0.036, and 0.050 mg L(-1) h(-1) for strains SL1, SL4, SL6, and BA. Gas chromatographic (GC) analyses of residual carbazole after 30 days of incubation revealed that 81.3, 85, 64.4, and 76 % of 50 mg l(-1) carbazole were degraded by strains SL1, SL4, SL6, and BA, respectively. GC-mass spectrometry and high-performance liquid chromatographic analyses of the extracts from the growing and resting cells of strains SL1, SL4, and SL6 cultured on carbazole showed detection of anthranilic acid and catechol while these metabolites were not detected in strain BA under the same conditions. This study has established for the first time carbazole angular dioxygenation and mineralization by isolates from African environment.

  15. Comparative metagenomic analysis of PAH degradation in soil by a mixed microbial consortium.

    Science.gov (United States)

    Zafra, German; Taylor, Todd D; Absalón, Angel E; Cortés-Espinosa, Diana V

    2016-11-15

    In this study, we used a taxonomic and functional metagenomic approach to analyze some of the effects (e.g. displacement, permanence, disappearance) produced between native microbiota and a previously constructed Polycyclic Aromatic Hydrocarbon (PAH)-degrading microbial consortium during the bioremediation process of a soil polluted with PAHs. Bioaugmentation with a fungal-bacterial consortium and biostimulation of native microbiota using corn stover as texturizer produced appreciable changes in the microbial diversity of polluted soils, shifting native microbial communities in favor of degrading specific populations. Functional metagenomics showed changes in gene abundance suggesting a bias towards aromatic hydrocarbon and intermediary degradation pathways, which greatly favored PAH mineralization. In contrast, pathways favoring the formation of toxic intermediates such as cytochrome P450-mediated reactions were found to be significantly reduced in bioaugmented soils. PAH biodegradation in soil using the microbial consortium was faster and reached higher degradation values (84% after 30 d) as a result of an increased co-metabolic degradation when compared with other mixed microbial consortia. The main differences between inoculated and non-inoculated soils were observed in aromatic ring-hydroxylating dioxygenases, laccase, protocatechuate, salicylate and benzoate-degrading enzyme genes. Based on our results, we propose that several concurrent metabolic pathways are taking place in soils during PAH degradation. Copyright © 2016 Elsevier B.V. All rights reserved.

  16. Potential of Trichoderma spp. strains for the bioremediation of soils contaminated with petroleum

    Directory of Open Access Journals (Sweden)

    Marcia Pesántez

    2016-10-01

    Full Text Available Fungi species can degrade xenobiotic compounds contaminating the soil, including hydrocarbons. The objective of this work was to determine the potential of three strains of Trichoderma, isolated from soil contaminated with petroleum, for bioremediation. Trichoderma harzianum CCECH-Te1, Trichoderma viride CCECH-Te2 and Trichoderma psedokoningii CCECH-Te3 were included in one assay with each independent strain. The inoculum was adjusted to a concentration of 1x1010 conidia ml-1 which was applied to soil contaminated by an oil spill. After 96 days of inoculation, soil samples were taken at 10 and 15 cm depth. The content of total hydrocarbons, polycyclic aromatic hydrocarbons and heavy metals such as cadmium, nickel and lead were determined. With the data, it was calculated the percentage of removal of the analyzed compounds by each strain. At 10 cm and 15 cm depth, it was observed the removal of the compounds in percentages that reached between 47 and 69.1% in the hydrocarbons and up to 53.72% in the heavy metals. It which denoted the potential of the three strains for bioremediation in contaminated soils.   Keywords: heavy metals, polycyclic aromatic hydrocarbons, xenobiotic compounds

  17. Degradability of n-alkanes during ex situ natural bioremediation of soil contaminated by heavy residual fuel oil (mazut

    Directory of Open Access Journals (Sweden)

    Ali Ramadan Mohamed Muftah

    2013-01-01

    Full Text Available It is well known that during biodegradation of oil in natural geological conditions, or oil pollutants in the environment, a degradation of hydrocarbons occurs according to the well defined sequence. For example, the major changes during the degradation process of n-alkanes occur in the second, slight and third, moderate level (on the biodegradation scale from 1 to 10. According to previous research, in the fourth, heavy level, when intensive changes of phenanthrene and its methyl isomers begin, n-alkanes have already been completely removed. In this paper, the ex situ natural bioremediation (unstimulated bioremediation, without addition of biomass, nutrient substances and biosurfactant of soil contaminated with heavy residual fuel oil (mazut was conducted during the period of 6 months. Low abundance of n-alkanes in the fraction of total saturated hydrocarbons in the initial sample (identification was possible only after concentration by urea adduction technique showed that the investigated oil pollutant was at the boundary between the third and the fourth biodegradation level. During the experiment, an intense degradation of phenanthrene and its methyl-, dimethyl-and trimethyl-isomers was not followed by the removal of the remaining n-alkanes. The abundance of n-alkanes remained at the initial low level, even at end of the experiment when the pollutant reached one of the highest biodegradation levels. These results showed that the unstimulated biodegradation of some hydrocarbons, despite of their high biodegradability, do not proceed completely to the end, even at final degradation stages. In the condition of the reduced availability of some hydrocarbons, microorganisms tend to opt for less biodegradable but more accessible hydrocarbons.

  18. Microbial metabolism and community structure in response to bioelectrochemically enhanced remediation of petroleum hydrocarbon-contaminated soil.

    Science.gov (United States)

    Lu, Lu; Huggins, Tyler; Jin, Song; Zuo, Yi; Ren, Zhiyong Jason

    2014-04-01

    This study demonstrates that electrodes in a bioelectrochemical system (BES) can potentially serve as a nonexhaustible electron acceptor for in situ bioremediation of hydrocarbon contaminated soil. The deployment of BES not only eliminates aeration or supplement of electron acceptors as in contemporary bioremediation but also significantly shortens the remediation period and produces sustainable electricity. More interestingly, the study reveals that microbial metabolism and community structure distinctively respond to the bioelectrochemically enhanced remediation. Tubular BESs with carbon cloth anode (CCA) or biochar anode (BCA) were inserted into raw water saturated soils containing petroleum hydrocarbons for enhancing in situ remediation. Results show that total petroleum hydrocarbon (TPH) removal rate almost doubled in soils close to the anode (63.5-78.7%) than that in the open circuit positive controls (37.6-43.4%) during a period of 64 days. The maximum current density from the BESs ranged from 73 to 86 mA/m(2). Comprehensive microbial and chemical characterizations and statistical analyses show that the residual TPH has a strongly positive correlation with hydrocarbon-degrading microorganisms (HDM) numbers, dehydrogenase activity, and lipase activity and a negative correlation with soil pH, conductivity, and catalase activity. Distinctive microbial communities were identified at the anode, in soil with electrodes, and soil without electrodes. Uncommon electrochemically active bacteria capable of hydrocarbon degradation such as Comamonas testosteroni, Pseudomonas putida, and Ochrobactrum anthropi were selectively enriched on the anode, while hydrocarbon oxidizing bacteria were dominant in soil samples. Results from genus or phylum level characterizations well agree with the data from cluster analysis. Data from this study suggests that a unique constitution of microbial communities may play a key role in BES enhancement of petroleum hydrocarbons

  19. Bacterial community shift and hydrocarbon transformation during bioremediation of short-term petroleum-contaminated soil.

    Science.gov (United States)

    Wu, Manli; Ye, Xiqiong; Chen, Kaili; Li, Wei; Yuan, Jing; Jiang, Xin

    2017-04-01

    A laboratory study was conducted to evaluate the impact of bioaugmentation plus biostimulation (BR, added both nutrients and bacterial consortia), and natural attenuation (NA) on hydrocarbon degradation efficiency and microflora characterization during remediation of a freshly contaminated soil. After 112 days of remediation, the initial level of total petroleum hydrocarbon (TPH) (61,000 mg/kg soil) was reduced by 4.5% and 5.0% in the NA and BR treatments, respectively. Bioremediation did not significantly enhance TPH biodegradation compared to natural attenuation. The degradation of the aliphatic fraction was the most active with the degradation rate of 30.3 and 28.7 mg/kg/day by the NA and BR treatments, respectively. Soil microbial activities and counts in soil were generally greater for bioremediation than for natural attenuation. MiSeq sequencing indicated that the diversity and structure of microbial communities were affected greatly by bioremediation. In response to bioremediation treatment, Promicromonospora, Pseudomonas, Microcella, Mycobacterium, Alkanibacter, and Altererythrobacter became dominant genera in the soil. The result indicated that combining bioaugmentation with biostimulation did not improve TPH degradation, but soil microbial activities and structure of microbial communities are sensitive to bioremediation in short-term and heavily oil-contaminated soil. Copyright © 2017 Elsevier Ltd. All rights reserved.

  20. Screening for crude oil degrading bacteria in liquid organic waste (effluent samples)

    International Nuclear Information System (INIS)

    Akpe, A.R.

    2014-01-01

    The screening for crude oil degrading bacteria in some liquid organic wastes (cassava mill effluents, rubber effluents and oil palm mill effluents) was carried out. Hydrocarbon utilising bacteria were isolated on mineral salt agar using vapour phase technique. The samples yielded 20 bacterial isolates from 13 different genera. Cassava mill effluent and rubber effluent had the highest number (7), while oil palm effluent had the least number (6) of bacterial isolates. The isolates that had the highest occurrence (occurring in all samples) were Pseudomonas aeruginosa and Escherichia coli. Of these 13 genera 9 were gram negative, while only 4 were gram positive. The total heterotrophic bacterial (THB) count and total hydrocarbon utilisers (THU) from all the effluent samples ranged from 3.0 * 10/sup 4/ to 6.0* 10/sup 7/ cfu/mL and 2.3 *10/sup 2/ to 4.2*10/sup 3/ cfu/mL, respectively. The counts of hydrocarbon utilisers were obviously lower than the heterotrophic counts, although the differences in counts were found to be statistically non-significant (P > 0.05). Rubber effluents and oil palm mill effluents had the highest number of hydrocarbon utilisers with three isolates each. The active hydrocarbon utilisers encountered in this study included Serratia marscescens, Bacillus cereus, P. aeruginosa, Enterobacter aerogenes and Bacillus subtilis. Presence of nutrients and crude oil degrading bacteria in these effluents suggests that these effluents can be used to enhance bioremediation through their use as biostimulation and bioaugmentation agents. (author)

  1. Isolation of Asphaltene-Degrading Bacteria from Sludge Oil

    Directory of Open Access Journals (Sweden)

    Pingkan Aditiawati

    2015-03-01

    Full Text Available Sludge oil contains 30%–50% hydrocarbon fractions that comprise saturated fractions, aromatics, resins, and asphaltene. Asphaltene fraction is the most persistent fraction. In this research, the indigenous bacteria that can degrade asphaltene fractions from a sludge oil sample from Balikpapan that was isolated using BHMS medium (Bushnell-Hass Mineral Salt with 0.01% (w/v yeast extract, 2% (w/v asphaltene extract, and 2% (w/v sludge oil. The ability of the four isolates to degrade asphaltene fractions was conducted by the biodegradation asphaltene fractions test using liquid cultures in a BHMS medium with 0.01% (w/v yeast extract and 2% (w/v asphaltene extract as a carbon source. The parameters measured during the process of biodegradation of asphaltene fractions include the quantification of Total Petroleum Hydrocarbon (g, log total number of bacteria (CFU/ml, and pH. There are four bacteria (isolates 1, 2, 3, and 4 that have been characterized to degrade asphaltic fraction and have been identified as Bacillus sp. Lysinibacillus fusiformes, Acinetobacter sp., and Mycobacterium sp., respectively. The results showed that the highest ability to degrade asphaltene fractions is that of Bacillus sp. (isolate 1 and Lysinibacillus fusiformes (Isolate 2, with biodegradation percentages of asphaltene fractions being 50% and 55%, respectively, and growth rate at the exponential phase is 7.17x107 CFU/mL.days and 4.21x107 CFU/mL.days, respectively.

  2. Methylobacterium spp. as an indicator for the presence or absence of Mycobacterium spp.

    OpenAIRE

    Falkinham III, Joseph O.; Williams, Myra D.; Kwait, Rebecca; Lande, Leah

    2016-01-01

    Objective/Background: A published survey of bacteria in showerhead biofilm samples revealed that Methylobacterium spp. and Mycobacterium spp. seldom coexisted in biofilms. Method: To confirm that information, biofilm samples were collected from household plumbing of Mycobacterium avium patients and Methylobacterium spp. and M. avium numbers were measured by direct colony counts. Results: The results demonstrated that if Methylobacterium spp. were present, Mycobacterium spp. were absent,...

  3. Mineralization of polycyclic and n-heterocyclic aromatic compounds in hydrocarbon-contaminated soils

    International Nuclear Information System (INIS)

    Grosser, R.J.; Warshawsky, D.; Vestal, J.R.

    1995-01-01

    The comparative mineralization of eight polycyclic aromatic compounds in five soils collected from an abandoned coal tar refinery in eastern Ohio was determined. The soils showed differences only in total extractable hydrocarbon content of the soil chemical characteristics measured. The compounds studied included five polycyclic aromatic hydrocarbons (phenanthrene, anthracene, pyrene, and carcinogenic benz[a]anthracene and benzo[a]pyrene) and three N-heterocyclic aromatics (9H-carbazole, and carcinogenic 7H-dibenzo[c,g]carbazole and dibenz[a,j]acridine). Mineralization was measured by serum bottle radiorespirometry. Only phenanthrene, anthracene, pyrene, benz[a]anthracene, and carbazole were mineralized in the soils after 64 d. Two of the soils with eight to 15 times the hexane -extractable hydrocarbon content consistently showed more rapid initial rates and higher overall extents of mineralization compared to the other three soils. Overall extents of mineralization ranged from 38 to 55% for phenanthrene, 10 to 60% for anthracene, 25 to 70% for pyrene, background to 40% for benz[a]anthracene, and 25 to 50% for carbazole after 64 d. Extents of mineralization by indigenous soil microbiota appear to be more dependent on the chemical characteristics of the soil and not soil total biomass and activity. Cultures capable of degrading phenanthrene, anthracene, and pyrene were obtained following enrichment techniques. A Mycobacterium sp. capable of degrading these three compounds was isolated and reintroduced into two of the soils, resulting in mineralization enhanced above that of the indigenous soil microbial population. These data indicate that the future success of bioremediation methods relies on the characterization of environmental parameters affecting microbial degradation as well as the isolation of microbial populations that can reduce toxicity in the environment

  4. Varying Conditions for Hexanoic Acid Degradation with BioTigerTM

    International Nuclear Information System (INIS)

    Foreman, Koji; Milliken, Charles; Brigmon, Robin

    2016-01-01

    BioTiger TM (BT) is a consortium of 12 bacteria designed for petroleum waste biodegradation. BT is currently being studied and could be considered for bioremediation of the Athabasca oil sands refineries in Canada and elsewhere. The run-off ponds from the petroleum extraction processes, called tailings ponds, are a mixture of polycyclic aromatic hydrocarbons, naphthenic acids, hydrocarbons, toxic chemicals like heavy metals, water, and sand. Due to environmental regulations the oil industry would like to separate and degrade the hazardous chemical species from the tailings ponds while recycling the water. It has been shown that BT at 30 C° is able to completely degrade 10 mM hexanoic acid (HA) co-metabolically with 0.2% yeast extract (w/v) in 48 hours when starting at 0.4 OD 600nm. After establishing this stable degradation capability, variations were tested to explore the wider parameters of BT activity in temperature, pH, intermediate degradation, co-metabolic dependence, and transfer stability. Due to the vast differences in temperature at various points in the refineries, a wide range of temperatures were assessed. The results indicate that BT retains the ability to degrade HA, a model surrogate for tailings pond contaminants, at temperatures ranging from 15°C to 35°C. Hexanamide (HAM) was shown to be an intermediate generated during the degradation of HA in an earlier work and HAM is completely degraded after 48 hours, indicating that HAM is not the final product of HA degradation. Various replacements for yeast extract were attempted. Glucose, a carbon source; casein amino acids, a protein source; additional ammonia, mimicking known media; and additional phosphate with Wolffe's vitamins and minerals all showed no significant degradation of HA compared to control. Decreasing the yeast extract concentration (0.05%) demonstrated limited but significant degradation. Finally, serial inoculations of BT were performed to determine the stability of

  5. Laboratory based degradation of light crude oil by aquatic ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-08-18

    Aug 18, 2009 ... This spilled oil produces destructive effect on the environment. For example, when ... growth was separated from the oil using gas chromatography. The hydrocarbon that dissolved in carbon tetrachloride ... Gasoline and gas oil were also degraded (Figure 1). ACKNOWLEDGEMENT. The authors wish to ...

  6. Global Kinetic Constants for Thermal Oxidative Degradation of a Cellulosic Paper

    Science.gov (United States)

    Kashiwagi, Takashi; Nambu, Hidesaburo

    1992-01-01

    Values of global kinetic constants for pyrolysis, thermal oxidative degradation, and char oxidation of a cellulosic paper were determined by a derivative thermal gravimetric study. The study was conducted at heating rates of 0.5, 1, 1.5, 3, and 5 C/min in ambient atmospheres of nitrogen, 0.28, 1.08, 5.2 percent oxygen concentrations, and air. Sample weight loss rate, concentrations of CO, CO2, and H2O in the degradation products, and oxygen consumption were continuously measured during the experiment. Values of activation energy, preexponential factor, orders of reaction, and yields of CO, CO2, H2O, total hydrocarbons, and char for each degradation reaction were derived from the results. Heat of reaction for each reaction was determined by differential scanning calorimetry. A comparison of the calculated CO, CO2, H2O, total hydrocarbons, sample weight loss rate, and oxygen consumption was made with the measured results using the derived kinetic constants, and the accuracy of the values of kinetic constants was discussed.

  7. CTX-M extended-spectrum β-lactamase-producing Klebsiella spp, Salmonella spp, Shigella spp and Escherichia coli isolates in Iranian hospitals.

    Science.gov (United States)

    Bialvaei, Abed Zahedi; Kafil, Hossein Samadi; Asgharzadeh, Mohammad; Aghazadeh, Mohammad; Yousefi, Mehdi

    2016-01-01

    This study was conducted in Iran in order to assess the distribution of CTX-M type ESBLs producing Enterobacteriaceae. From January 2012 to December 2013, totally 198 E. coli, 139 Klebsiella spp, 54 Salmonella spp and 52 Shigella spp from seven hospitals of six provinces in Iran were screened for resistance to extended-spectrum cephalosporins. After identification and susceptibility testing, isolates presenting multiple-drug resistance (MDR) were evaluated for ESBL production by the disk combination method and by Etest using (cefotaxime and cefotaxime plus clavulanic acid). All isolates were also screened for blaCTX-M using conventional PCR. A total of 42.92%, 33.81%, 14.81% and 7.69% of the E. coli, Klebsiella spp, Salmonella spp and Shigella spp isolates were MDR, respectively. The presence of CTX-M enzyme among ESBL-producing isolates was 85.18%, 77.7%, 50%, and 66.7%, in E. coli, Klebsiella spp, Salmonella spp and Shigella spp respectively. The overall presence of CTX-M genes in Enterobacteriaceae was 15.4% and among the resistant isolates was 47.6%. This study indicated that resistance to β-lactams mediated by CTX-M enzymes in Iran had similar pattern as in other parts of the world. In order to control the spread of resistance, comprehensive studies and programs are needed. Copyright © 2016 Sociedade Brasileira de Microbiologia. Published by Elsevier Editora Ltda. All rights reserved.

  8. The hydrocarbon-degrading marine bacterium Cobetia sp. strain MM1IDA2H-1 produces a biosurfactant that interferes with quorum sensing of fish pathogens by signal hijacking

    Science.gov (United States)

    Ibacache-Quiroga, C; Ojeda, J; Espinoza-Vergara, G; Olivero, P; Cuellar, M; Dinamarca, M A

    2013-01-01

    Summary Biosurfactants are produced by hydrocarbon-degrading marine bacteria in response to the presence of water-insoluble hydrocarbons. This is believed to facilitate the uptake of hydrocarbons by bacteria. However, these diffusible amphiphilic surface-active molecules are involved in several other biological functions such as microbial competition and intra-or inter-species communication. We report the isolation and characterization of a marine bacterial strain identified as Cobetia sp. MM1IDA2H-1, which can grow using the sulfur-containing heterocyclic aromatic hydrocarbon dibenzothiophene (DBT). As with DBT, when the isolated strain is grown in the presence of a microbial competitor, it produces a biosurfactant. Because the obtained biosurfactant was formed by hydroxy fatty acids and extracellular lipidic structures were observed during bacterial growth, we investigated whether the biosurfactant at its critical micelle concentration can interfere with bacterial communication systems such as quorum sensing. We focused on Aeromonas salmonicida subsp. salmonicida, a fish pathogen whose virulence relies on quorum sensing signals. Using biosensors for quorum sensing based on Chromobacterium violaceum and Vibrio anguillarum, we showed that when the purified biosurfactant was mixed with N-acyl homoserine lactones produced by A. salmonicida, quorum sensing was inhibited, although bacterial growth was not affected. In addition, the transcriptional activities of A. salmonicida virulence genes that are controlled by quorum sensing were repressed by both the purified biosurfactant and the growth in the presence of Cobetia sp. MM1IDA2H-1. We propose that the biosurfactant, or the lipid structures interact with the N-acyl homoserine lactones, inhibiting their function. This could be used as a strategy to interfere with the quorum sensing systems of bacterial fish pathogens, which represents an attractive alternative to classical antimicrobial therapies in fish

  9. Biodegradation of Various Aromatic Compounds by Enriched Bacterial Cultures: Part A-Monocyclic and Polycyclic Aromatic Hydrocarbons.

    Science.gov (United States)

    Oberoi, Akashdeep Singh; Philip, Ligy; Bhallamudi, S Murty

    2015-08-01

    Present study focused on the screening of bacterial consortium for biodegradation of monocyclic aromatic hydrocarbon (MAH) and polycyclic aromatic hydrocarbons (PAHs). Target compounds in the present study were naphthalene, acenaphthene, phenanthrene (PAHs), and benzene (MAH). Microbial consortia enriched with the above target compounds were used in screening experiments. Naphthalene-enriched consortium was found to be the most efficient consortium, based on its substrate degradation rate and its ability to degrade other aromatic pollutants with significantly high efficiency. Substrate degradation rate with naphthalene-enriched culture followed the order benzene > naphthalene > acenaphthene > phenanthrene. Chryseobacterium and Rhodobacter were discerned as the predominant species in naphthalene-enriched culture. They are closely associated to the type strain Chryseobacterium arthrosphaerae and Rhodobacter maris, respectively. Single substrate biodegradation studies with naphthalene (PAH) and benzene (MAH) were carried out using naphthalene-enriched microbial consortium (NAPH). Phenol and 2-hydroxybenzaldehyde were identified as the predominant intermediates during benzene and naphthalene degradation, respectively. Biodegradation of toluene, ethyl benzene, xylene, phenol, and indole by NAPH was also investigated. Monod inhibition model was able to simulate biodegradation kinetics for benzene, whereas multiple substrate biodegradation model was able to simulate biodegradation kinetics for naphthalene.

  10. Enzymatic bioremediation of polyaromatic hydrocarbons by fungal consortia enriched from petroleum contaminated soil and oil seeds.

    Science.gov (United States)

    Balaji, V; Arulazhagan, P; Ebenezer, P

    2014-05-01

    The present study focuses on fungal strains capable of secreting extracellular enzymes by utilizing hydrocarbons present in the contaminated soil. Fungal strains were enriched from petroleum hydrocarbons contaminated soil samples collected from Chennai city, India. The potential fungi were isolated and screened for their enzyme secretion such as lipase, laccase, peroxidase and protease and also evaluated fungal enzyme mediated PAHs degradation. Total, 21 potential PAHs degrading fungi were isolated from PAHs contaminated soil, which belongs to 9 genera such as Aspergillus, Curvularia, Drechslera, Fusarium, Lasiodiplodia, Mucor Penicillium, Rhizopus, Trichoderma, and two oilseed-associated fungal genera such as Colletotrichum and Lasiodiplodia were used to test their efficacy in degradation of PAHs in polluted soil. Maximum lipase production was obtained with P. chrysogenum, M. racemosus and L. theobromae VBE1 under optimized cultural condition, which utilized PAHs in contaminated soil as sole carbon source. Fungal strains, P. chrysogenum, M. racemosus and L. theobromae VBE1, as consortia, used in the present study were capable of degrading branched alkane isoprenoids such as pristine (C17) and pyrene (C18) present in PAHs contaminated soil with high lipase production. The fungal consortia acts as potential candidate for bioremediation of PAHs contaminated environments.

  11. The effect of salinity, redox mediators and temperature on anaerobic biodegradation of petroleum hydrocarbons in microbial fuel cells

    Energy Technology Data Exchange (ETDEWEB)

    Adelaja, Oluwaseun, E-mail: o.adelaja@my.westminster.ac.uk; Keshavarz, Tajalli, E-mail: t.keshavarz@westminster.ac.uk; Kyazze, Godfrey, E-mail: g.kyazze@westminster.ac.uk

    2015-02-11

    Highlights: • Effective degradation of petroleum hydrocarbon mixtures was achieved using MFC. • Adapted anaerobic microbial consortium was used as inoculum. • Bio-electricity generation was enhanced by 30-fold when riboflavin, was added. • Optimum MFC performance was obtained at mesophilic and moderately saline conditions. • Stable MFC performance was obtained during prolonged fed-batch MFC operation. - Abstract: Microbial fuel cells (MFCs) need to be robust if they are to be applied in the field for bioremediation. This study investigated the effect of temperature (20–50 °C), salinity (0.5–2.5% (w/v) as sodium chloride), the use of redox mediators (riboflavin and anthraquinone-2-sulphonate, AQS) and prolonged fed-batch operation (60 days) on biodegradation of a petroleum hydrocarbon mix (i.e. phenanthrene and benzene) in MFCs. The performance criteria were degradation efficiency, % COD removal and electrochemical performance. Good electrochemical and degradation performance were maintained up to a salinity of 1.5% (w/v) but deteriorated by 35-fold and 4-fold respectively as salinity was raised to 2.5%w/v. Degradation rates and maximum power density were both improved by approximately 2-fold at 40 °C compared to MFC performance at 30 °C but decreased sharply by 4-fold when operating temperature was raised to 50 °C. The optimum reactor performance obtained at 40 °C was 1.15 mW/m{sup 2} maximum power density, 89.1% COD removal and a degradation efficiency of 97.10%; at moderately saline (1% w/v) conditions the maximum power density was 1.06 mW/m{sup 2}, 79.1% COD removal and 91.6% degradation efficiency. This work suggests the possible application of MFC technology in the effective treatment of petroleum hydrocarbons contaminated site and refinery effluents.

  12. The effect of salinity, redox mediators and temperature on anaerobic biodegradation of petroleum hydrocarbons in microbial fuel cells

    International Nuclear Information System (INIS)

    Adelaja, Oluwaseun; Keshavarz, Tajalli; Kyazze, Godfrey

    2015-01-01

    Highlights: • Effective degradation of petroleum hydrocarbon mixtures was achieved using MFC. • Adapted anaerobic microbial consortium was used as inoculum. • Bio-electricity generation was enhanced by 30-fold when riboflavin, was added. • Optimum MFC performance was obtained at mesophilic and moderately saline conditions. • Stable MFC performance was obtained during prolonged fed-batch MFC operation. - Abstract: Microbial fuel cells (MFCs) need to be robust if they are to be applied in the field for bioremediation. This study investigated the effect of temperature (20–50 °C), salinity (0.5–2.5% (w/v) as sodium chloride), the use of redox mediators (riboflavin and anthraquinone-2-sulphonate, AQS) and prolonged fed-batch operation (60 days) on biodegradation of a petroleum hydrocarbon mix (i.e. phenanthrene and benzene) in MFCs. The performance criteria were degradation efficiency, % COD removal and electrochemical performance. Good electrochemical and degradation performance were maintained up to a salinity of 1.5% (w/v) but deteriorated by 35-fold and 4-fold respectively as salinity was raised to 2.5%w/v. Degradation rates and maximum power density were both improved by approximately 2-fold at 40 °C compared to MFC performance at 30 °C but decreased sharply by 4-fold when operating temperature was raised to 50 °C. The optimum reactor performance obtained at 40 °C was 1.15 mW/m 2 maximum power density, 89.1% COD removal and a degradation efficiency of 97.10%; at moderately saline (1% w/v) conditions the maximum power density was 1.06 mW/m 2 , 79.1% COD removal and 91.6% degradation efficiency. This work suggests the possible application of MFC technology in the effective treatment of petroleum hydrocarbons contaminated site and refinery effluents

  13. Petroleum hydrocarbons in offshore sediments from the Gulf

    International Nuclear Information System (INIS)

    Al-Lihaibi, S.S.; Al-Omran, Laila

    1996-01-01

    Petroleum hydrocarbons in offshore sediments from the central part of the Gulf were measured using fluorescence spectrophotometry. Concentrations varied between 4.0 and 56.2 μg/g wet sediment (expressed as Kuwait Crude Oil equivalents), with an average of 12.3 μ/g. Highest concentrations were recorded in the north-west sector, with concentrations decreasing in a south-westerly direction. No significant correlations were observed between petroleum hydrocarbons and sedimentary organic carbon (r-0.07), 'mud' content (r=0.09), 'sand' content (r= -0.08) or 'gravel' content (r= -0.12). Distributions of oil are considered to relate more closely to prevailing current and localized pollutant sources in the region. Despite the substantial inputs of oil to the Gulf, contamination can be considered comparatively low, possibly reflecting physical processes and biological degradation which accelerate removal of petroleum from this marine environment. (author)

  14. Sonochemical degradation of perfluorooctanesulfonate in aqueous film-forming foams.

    Science.gov (United States)

    Vecitis, Chad D; Wang, Yajuan; Cheng, Jie; Park, Hyunwoong; Mader, Brian T; Hoffmann, Michael R

    2010-01-01

    Aqueous film-forming foams (AFFFs) are fire extinguishing agents developed by the Navy to quickly and effectively combat fires occurring close to explosive materials and are utilized today at car races, airports, oil refineries, and military locations. Fluorochemical (FC) surfactants represent 1-5% of the AFFF composition, which impart properties such as high spreadability, negligible fuel diffusion, and thermal stability to the foam. FC's are oxidatively recalcitrant, persistent in the environment, and have been detected in groundwater at AFFF training sites. Ultrasonic irradiation of aqueous FCs has been reported to degrade and subsequently mineralize the FC surfactants perfluorooctanoate (PFOA) and perfluorooctanesulfonate (PFOS). Here we present results of the sonochemical degradation of aqueous dilutions of FC-600, a mixture of hydrocarbon (HC) and fluorochemical components including cosolvents, anionic hydrocarbon surfactants, fluorinated amphiphilic surfactants, anionic fluorinated surfactants, and thickeners such as starch. The primary FC surfactant in FC-600, PFOS, was sonolytically degraded over a range of FC-600 aqueous dilutions, 65 ppb or = 1, indicating that bubble-water interfacial pyrolytic cleavage of the C-S bond in PFOS is the initial degradation step, in agreement with previous studies done in Milli-Q water. Sonochemical fluoride production is significantly below quantitative expectations, delta[F-]/delta[PFOS] 4 vs 17, suggesting that in the AFFF matrix, PFOS' fluorochemical tail is not completely degraded, whereas Milli-Q studies yielded quantitative F- production. Measurements of time-dependent methylene blue active substances and total organic carbon indicate that the other FC-600 components were also sonolytically decomposed.

  15. Occurrence of Babesia spp., Rickettsia spp. and Bartonella spp. in Ixodes ricinus in Bavarian public parks, Germany

    Directory of Open Access Journals (Sweden)

    Mahling Monia

    2011-07-01

    Full Text Available Abstract Background Only limited information is available about the occurrence of ticks and tick-borne pathogens in public parks, which are areas strongly influenced by human beings. For this reason, Ixodes ricinus were collected in public parks of different Bavarian cities in a 2-year survey (2009 and 2010 and screened for DNA of Babesia spp., Rickettsia spp. and Bartonella spp. by PCR. Species identification was performed by sequence analysis and alignment with existing sequences in GenBank. Additionally, coinfections with Anaplasma phagocytophilum were investigated. Results The following prevalences were detected: Babesia spp.: 0.4% (n = 17, including one pool of two larvae in 2009 and 0.5 to 0.7% (n = 11, including one pool of five larvae in 2010; Rickettsia spp.: 6.4 to 7.7% (n = 285, including 16 pools of 76 larvae in 2009. DNA of Bartonella spp. in I. ricinus in Bavarian public parks could not be identified. Sequence analysis revealed the following species: Babesia sp. EU1 (n = 25, B. divergens (n = 1, B. divergens/capreoli (n = 1, B. gibsoni-like (n = 1, R. helvetica (n = 272, R. monacensis IrR/Munich (n = 12 and unspecified R. monacensis (n = 1. The majority of coinfections were R. helvetica with A. phagocytophilum (n = 27, but coinfections between Babesia spp. and A. phagocytophilum, or Babesia spp. and R. helvetica were also detected. Conclusions I. ricinus ticks in urban areas of Germany harbor several tick-borne pathogens and coinfections were also observed. Public parks are of particularly great interest regarding the epidemiology of tick-borne pathogens, because of differences in both the prevalence of pathogens in ticks as well as a varying species arrangement when compared to woodland areas. The record of DNA of a Babesia gibsoni-like pathogen detected in I. ricinus suggests that I. ricinus may harbor and transmit more Babesia spp. than previously known. Because of their high recreational value for human beings, urban green

  16. Occurrence of Babesia spp., Rickettsia spp. and Bartonella spp. in Ixodes ricinus in Bavarian public parks, Germany.

    Science.gov (United States)

    Schorn, Sabine; Pfister, Kurt; Reulen, Holger; Mahling, Monia; Silaghi, Cornelia

    2011-07-15

    Only limited information is available about the occurrence of ticks and tick-borne pathogens in public parks, which are areas strongly influenced by human beings. For this reason, Ixodes ricinus were collected in public parks of different Bavarian cities in a 2-year survey (2009 and 2010) and screened for DNA of Babesia spp., Rickettsia spp. and Bartonella spp. by PCR. Species identification was performed by sequence analysis and alignment with existing sequences in GenBank. Additionally, coinfections with Anaplasma phagocytophilum were investigated. The following prevalences were detected: Babesia spp.: 0.4% (n = 17, including one pool of two larvae) in 2009 and 0.5 to 0.7% (n = 11, including one pool of five larvae) in 2010; Rickettsia spp.: 6.4 to 7.7% (n = 285, including 16 pools of 76 larvae) in 2009. DNA of Bartonella spp. in I. ricinus in Bavarian public parks could not be identified. Sequence analysis revealed the following species: Babesia sp. EU1 (n = 25), B. divergens (n = 1), B. divergens/capreoli (n = 1), B. gibsoni-like (n = 1), R. helvetica (n = 272), R. monacensis IrR/Munich (n = 12) and unspecified R. monacensis (n = 1). The majority of coinfections were R. helvetica with A. phagocytophilum (n = 27), but coinfections between Babesia spp. and A. phagocytophilum, or Babesia spp. and R. helvetica were also detected. I. ricinus ticks in urban areas of Germany harbor several tick-borne pathogens and coinfections were also observed. Public parks are of particularly great interest regarding the epidemiology of tick-borne pathogens, because of differences in both the prevalence of pathogens in ticks as well as a varying species arrangement when compared to woodland areas. The record of DNA of a Babesia gibsoni-like pathogen detected in I. ricinus suggests that I. ricinus may harbor and transmit more Babesia spp. than previously known. Because of their high recreational value for human beings, urban green areas are likely to remain in the research focus on

  17. Uptake of Hydrocarbon by Pseudomonas fluorescens (P1) and Pseudomonas putida (K1) Strains in the Presence of Surfactants: A Cell Surface Modification

    OpenAIRE

    Kaczorek, Ewa; Olszanowski, Andrzej

    2010-01-01

    The objective of this research was the evaluation of the effects of exogenous added surfactants on hydrocarbon biodegradation and on cell surface properties. Crude oil hydrocarbons are often difficult to remove from the environment because of their insolubility in water. The addition of surfactants enhances the removal of hydrocarbons by raising the solubility of these compounds. These surfactants cause them to become more vulnerable to degradation, thereby facilitating transportation across ...

  18. Enumeration of petroleum hydrocarbon utilizing bacteria

    International Nuclear Information System (INIS)

    Mukherjee, S.; Barot, M.; Levine, A.D.

    1996-01-01

    In-situ biological treatment is one among a number of emerging technologies that may be applied to the remediation of contaminated soils and groundwater. In 1985, a surface spill of 1,500 gallons of dielectric transformer oil at the Sandia National Laboratories (HERMES II facility) resulted in contamination of soil up to depths of 160 feet. The extent of contamination and site characteristics favored the application of in-situ bioremediation as a potential remedial technology. The purpose of this research was to enumerate indigenous microbial populations capable of degrading petroleum hydrocarbons. Microbial enumeration and characterization methods suitably adapted for hydrocarbon utilizing bacteria were used as an indicator of the presence of viable microbial consortia in excavated oil samples with hydrocarbon (TPH) concentrations ranging from 300 to 26,850 ppm. Microbial activity was quantified by direct and streak plating soil samples on silica gel media. Effects of toxicity and temperature were studied using batch cultures of hydrocarbon utilizing bacteria (selectively isolated in an enrichment medium), at temperatures of 20 and 35 C. It was concluded from this study that it is possible to isolate native microorganisms from contaminated soils from depths of 60 to 160 feet, and with oil concentration ranging from 300 to 26,850 ppm. About 62% of the microorganisms isolated form the contaminated soil were capable of using contaminant oil as a substrate for growth and metabolism under aerobic conditions. Growth rates were observed to be 50% higher for the highest contaminant concentration at 20 C. Resistance to toxicity to contaminant oil was also observed to be greater at 20 C than at 35 C

  19. Biodegradation of polycyclic aromatic hydrocarbons by arbuscular mycorrhizal leek plants

    International Nuclear Information System (INIS)

    Liu, A.; Dalpe, Y.

    2005-01-01

    A study was conducted to examine the response of arbuscular mycorrhizal fungi (AMF) on the degradation of polycyclic aromatic hydrocarbon (PAH), nutrient uptake, and leek growth under greenhouse conditions. This experiment included 3 mycorrhizal treatments, 2 microorganism treatments, 2 PAH chemicals, and 4 concentrations of PAHs. Plant growth was greatly reduced by the addition of anthracene or phenanthrene in soil, whereas mycorrhizal inoculation not only increased plant growth, but also enhanced uptake of nitrogen and phosphorus. PAH concentrations in soil was lowered through the inoculation of two different strains of the species G. intraradices and G. versiforme. In 12 weeks of pot cultures, anthracene and phenanthrene concentrations decreased for all 3 PAH levels tested. However, the reduced amount of phenanthrene in soil was greater than that of anthracene. The addition of a soil microorganism extract into pot cultures accelerated the PAH degradation. The inoculation of AMF in a hydrocarbon contaminated soil was shown to enhance PAHs soil decontamination. It was concluded that a soil colonized with AMF can not only improve plant growth but can also stimulate soil microflora abundance and diversity. AMF may therefore directly influence PAH soil decontamination through plant growth enhancement

  20. From oil spills to barley growth - oil-degrading soil bacteria and their promoting effects.

    Science.gov (United States)

    Mikolasch, Annett; Reinhard, Anne; Alimbetova, Anna; Omirbekova, Anel; Pasler, Lisa; Schumann, Peter; Kabisch, Johannes; Mukasheva, Togzhan; Schauer, Frieder

    2016-11-01

    Heavy contamination of soils by crude oil is omnipresent in areas of oil recovery and exploitation. Bioremediation by indigenous plants in cooperation with hydrocarbon degrading microorganisms is an economically and ecologically feasible means to reclaim contaminated soils. To study the effects of indigenous soil bacteria capable of utilizing oil hydrocarbons on biomass production of plants growing in oil-contaminated soils eight bacterial strains were isolated from contaminated soils in Kazakhstan and characterized for their abilities to degrade oil components. Four of them, identified as species of Gordonia and Rhodococcus turned out to be effective degraders. They produced a variety of organic acids from oil components, of which 59 were identified and 7 of them are hitherto unknown acidic oil metabolites. One of them, Rhodococcus erythropolis SBUG 2054, utilized more than 140 oil components. Inoculating barley seeds together with different combinations of these bacterial strains restored normal growth of the plants on contaminated soils, demonstrating the power of this approach for bioremediation. Furthermore, we suggest that the plant promoting effect of these bacteria is not only due to the elimination of toxic oil hydrocarbons but possibly also to the accumulation of a variety of organic acids which modulate the barley's rhizosphere environment. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  1. Isolation of Inositol Hexaphosphate (IHP)-Degrading Bacteria from Arbuscular Mycorrhizal Fungal Hyphal Compartments Using a Modified Baiting Method Involving Alginate Beads Containing IHP

    Science.gov (United States)

    Hara, Shintaro; Saito, Masanori

    2016-01-01

    Phytate (inositol hexaphosphate; IHP)-degrading microbes have been suggested to contribute to arbuscular mycorrhizal fungi (AMF)-mediated P transfer from IHP to plants; however, no IHP degrader involved in AMF-mediated P transfer has been isolated to date. We herein report the isolation of IHP-degrading bacteria using a modified baiting method. We applied alginate beads as carriers of IHP powder, and used them as recoverable IHP in the AM fungal compartment of plant cultivation experiments. P transfer from IHP in alginate beads via AMF was confirmed, and extracted DNA from alginate beads was analyzed by denaturing gradient gel electrophoresis targeting the 16S rRNA gene and a clone library method for the beta-propeller phytase (BPP) gene. The diversities of the 16S rRNA and BPP genes of microbes growing on IHP beads were simple and those of Sphingomonas spp. and Caulobacter spp. dominated. A total of 187 IHP-utilizing bacteria were isolated and identified, and they were consistent with the results of DNA analysis. Furthermore, some isolated Sphingomonas spp. and Caulobacter sp. showed IHP-degrading activity. Therefore, we successfully isolated dominant IHP-degrading bacteria from IHP in an AMF hyphal compartment. These strains may contribute to P transfer from IHP via AMF. PMID:27383681

  2. Potensi Trichoderma Spp. Sebagai Agens Pengendali Fusarium Spp. Penyebab Penyakit Layu Pada Tanaman Stroberi

    OpenAIRE

    Dwiastuti, Mutia Erti; Fajri, Melisa N; Yunimar, Yunimar

    2015-01-01

    Layu yang disebabkan oleh Fusarium spp. merupakan salah satu penyakit penting tanaman stroberi (Fragaria x ananassa Dutch.) di daerah subtropika, yang dapat menggagalkan panen. Penelitian bertujuan untuk mempelajari potensi Trichoderma spp. dalam mengendalikan Fusarium spp. Isolat Trichoderma spp. diisolasi dari rizosfer tanaman stroberi dan Fusarium spp. diisolasi dari tanaman stroberi yang mengalami layu fusarium. Isolat cendawan dimurnikan, dikarakterisasi, dan dibandingkan dengan isolat c...

  3. Aromatic hydrocarbons

    International Nuclear Information System (INIS)

    Roder, M.

    1985-01-01

    Papers dealing with radiolysis of aromatic hydrocarbons of different composition (from benzene to terphenyls and hydrocarbons with condensed rings) as well as their mixtures (with alkanes, alkenes, other aromatic hydrocarbons) are reviewed. High radiation stability of aromatic hydrocarbons in condensed phases associated with peculiarities of molecular structure of compounds is underlined. Mechanisms of radiolytic processes, vaues of product yields are considered

  4. Desorption and bioremediation of hydrocarbon contaminated soils

    International Nuclear Information System (INIS)

    Gray, M.R.

    1998-01-01

    A study was conducted in which the extent and pattern of contaminant biodegradation during bioremediation of four industrially-contaminated soils were examined to determine which factors control the ultimate extent of biodegradation and which limit the success of biological treatment. It was noted that although bioremediation is inexpensive and has low environmental impact, it often fails to completely remove the hydrocarbons in soils because of the complex interactions between contaminants, the soil environment, and the active microorganisms. In this study, the competency of the microorganisms in the soil to degrade the contaminants was examined. The equilibrium partitioning of the contaminants between the soil and the aqueous phase was also examined along with the transport of contaminants out of soil particles. The role of diffusion of compounds in the soil and the importance of direct contact between microorganisms and the hydrocarbons was determined. Methods for selecting suitable sites for biological treatment were also described

  5. The bacterial community structure of hydrocarbon-polluted marine environments as the basis for the definition of an ecological index of hydrocarbon exposure.

    Science.gov (United States)

    Lozada, Mariana; Marcos, Magalí S; Commendatore, Marta G; Gil, Mónica N; Dionisi, Hebe M

    2014-09-17

    The aim of this study was to design a molecular biological tool, using information provided by amplicon pyrosequencing of 16S rRNA genes, that could be suitable for environmental assessment and bioremediation in marine ecosystems. We selected 63 bacterial genera that were previously linked to hydrocarbon biodegradation, representing a minimum sample of the bacterial guild associated with this process. We defined an ecological indicator (ecological index of hydrocarbon exposure, EIHE) using the relative abundance values of these genera obtained by pyrotag analysis. This index reflects the proportion of the bacterial community that is potentially capable of biodegrading hydrocarbons. When the bacterial community structures of intertidal sediments from two sites with different pollution histories were analyzed, 16 of the selected genera (25%) were significantly overrepresented with respect to the pristine site, in at least one of the samples from the polluted site. Although the relative abundances of individual genera associated with hydrocarbon biodegradation were generally low in samples from the polluted site, EIHE values were 4 times higher than those in the pristine sample, with at least 5% of the bacterial community in the sediments being represented by the selected genera. EIHE values were also calculated in other oil-exposed marine sediments as well as in seawater using public datasets from experimental systems and field studies. In all cases, the EIHE was significantly higher in oiled than in unpolluted samples, suggesting that this tool could be used as an estimator of the hydrocarbon-degrading potential of microbial communities.

  6. Natural revegetation of hydrocarbon-contaminated soil in semi-arid grasslands

    International Nuclear Information System (INIS)

    Bizecki Robson, D.; Knight, J. D.; Farrell, R. E.; Germida, J. J.

    2004-01-01

    Phytoremediation, or the use of plants to degrade and contain soil contaminants is considered a cost-effective decontaminant for sites contaminated by spills in the oil and gas producing areas of Western Canada. The objective of this study was to determine if contamination by hydrocarbons changes soil properties, species composition, and species abundance when compared with uncontaminated plots, and to identify species and functional groups unique to contaminated sites that may be further screened for their hydrocarbon-degrading ability. In pursuit of these objectives the effect of contamination on coverage, litter and bare ground was examined, differences in species composition between contaminated and uncontaminated sites were assessed, and the ability to fix nitrogen, and form mycorrhiza, life form, pollination mode, seed dispersal and reproduction mode of each species was determined. Results showed less vegetation and litter cover in contaminated plots, and significantly higher soil carbon to nitrogen ratios. Species diversity was also lower on contaminated sites, although species richness was not significantly different. Self-pollinated species were significantly more common on contaminated sites. Five grasses and three forbs were identified as tolerant of hydrocarbon-contaminated soils, with two grasses -- Agropyron smithii, and Agropyron trachycaulum -- being the most promising for reclamation. The low vegetation cover on contaminated plots is attributed to high pH and carbon to nitrogen ratios, and low nitrogen and phosphorus that results from soil disturbance. High electrical conductivity is also considered to adversely affect vegetation and litter cover on contaminated sites. 54 refs., 3 tabs., 1 fig

  7. Natural revegetation of hydrocarbon-contaminated soil in semi-arid grasslands

    Energy Technology Data Exchange (ETDEWEB)

    Bizecki Robson, D.; Knight, J. D.; Farrell, R. E.; Germida, J. J. [University of Saskatchewan, Dept. of Soil Science, Saskatoon, SK (Canada)

    2004-01-01

    Phytoremediation, or the use of plants to degrade and contain soil contaminants is considered a cost-effective decontaminant for sites contaminated by spills in the oil and gas producing areas of Western Canada. The objective of this study was to determine if contamination by hydrocarbons changes soil properties, species composition, and species abundance when compared with uncontaminated plots, and to identify species and functional groups unique to contaminated sites that may be further screened for their hydrocarbon-degrading ability. In pursuit of these objectives the effect of contamination on coverage, litter and bare ground was examined, differences in species composition between contaminated and uncontaminated sites were assessed, and the ability to fix nitrogen, and form mycorrhiza, life form, pollination mode, seed dispersal and reproduction mode of each species was determined. Results showed less vegetation and litter cover in contaminated plots, and significantly higher soil carbon to nitrogen ratios. Species diversity was also lower on contaminated sites, although species richness was not significantly different. Self-pollinated species were significantly more common on contaminated sites. Five grasses and three forbs were identified as tolerant of hydrocarbon-contaminated soils, with two grasses -- Agropyron smithii, and Agropyron trachycaulum -- being the most promising for reclamation. The low vegetation cover on contaminated plots is attributed to high pH and carbon to nitrogen ratios, and low nitrogen and phosphorus that results from soil disturbance. High electrical conductivity is also considered to adversely affect vegetation and litter cover on contaminated sites. 54 refs., 3 tabs., 1 fig.

  8. Contamination by Salmonella spp., Campylobacter spp. and Listeria spp. of most popular chicken- and pork-sausages sold in Reunion Island.

    Science.gov (United States)

    Trimoulinard, A; Beral, M; Henry, I; Atiana, L; Porphyre, V; Tessier, C; Leclercq, A; Cardinale, E

    2017-06-05

    One of the most popular meat products of the local "cuisine" is sausage composed with 100% chicken or 100% pork. In this study, we aimed to determine the presence of Salmonella spp., Campylobacter spp. and Listeria spp. in chicken- and pork-sausages, quantify Salmonella spp. population and identify the factors that could be associated with contamination in the outlets. Two hundred and three batches of pork and chicken sausages were randomly collected from 67 local outlets (supermarkets, groceries and butcher shops). Salmonella spp. was detected in 11.8% (95% confidence interval (CI): [10.0; 13.5]) of samples, Campylobacter spp. in 1.5% [0.7; 4.2] and Listeria monocytogenes in 5.9% [4.4; 7.3]. Most probable number of Salmonella spp. varied between 6cfu per gram to 320cfu per gram. Salmonella serotypes isolated from pork and chicken sausages were S. Typhimurium (45.8%), S. London (20.8%), S. Derby (16.7%), S. Newport (8.33%), S. Blockley (4.2%) and S. Weltevreden (4.17%). Using a logistic (mixed-effect) regression model, we found that Salmonella spp. contamination was positively associated with sausages sold in papers or plastic bags and no control of rodents. Chicken sausages were associated with a decreasing risk of Salmonella contamination. Listeria monocytogenes contamination was positively associated with the presence of fresh rodent droppings in the outlet and negatively when the staff was cleaning regularly their hands with soap and water or water only. All the sampled outlets of Reunion Island were not equivalent in terms of food safety measures. Increasing awareness of these traders remains a cornerstone to limit the presence of Salmonella spp. and Listeria spp. in sausages, particularly in a tropical context (high temperature and humidity). Copyright © 2017 Elsevier B.V. All rights reserved.

  9. A Slurry Biocascade for the Enhanced Degradation of Fuels in Soils

    National Research Council Canada - National Science Library

    Apitz, Sabine

    1994-01-01

    .... In the first step of the cascade, the simplest fuel components (e.g., n-alkanes) are biodegraded. Then, the soil is transferred to the next steps in the cascade, in which different "microbial soups" degrade the next groups of hydrocarbons...

  10. A simple method to predict the biodegradation of hydrocarbon in soils: application to soil treatability

    International Nuclear Information System (INIS)

    Li, X.; Feng, Y.

    1997-01-01

    Biodegradation of hydrocarbons in a soil contaminated with crude oil and brine were examined in a field-size, solid state bioreactor. The objective was to develop a tool for a quick and economical assessment of the potential long term success of bioremediation technologies. The initial relative rate of degradation and a biodegradation module were determined. Results showed that the heterogeneity of the contaminant composition and its spatial distribution in hydrocarbon contaminant domains significantly reduced the rate of biodegradation. 2 refs., 1 tab., 6 figs

  11. Crude oil degradation by bacterial consortia under four different redox and temperature conditions.

    Science.gov (United States)

    Xiong, Shunzi; Li, Xia; Chen, Jianfa; Zhao, Liping; Zhang, Hui; Zhang, Xiaojun

    2015-02-01

    There is emerging interest in the anaerobic degradation of crude oil. However, there is limited knowledge about the geochemical effects and microbiological activities for it. A mixture of anaerobic sludge and the production water from an oil well was used as an inoculum to construct four consortia, which were incubated under sulfate-reducing or methanogenic conditions at either mesophilic or thermophilic temperatures. Significant degradation of saturated and aromatic hydrocarbons and the changing quantities of some marker compounds, such as pristane, phytane, hopane and norhopane, and their relative quantities, suggested the activity of microorganisms in the consortia. Notably, the redox conditions and temperature strongly affected the diversity and structure of the enriched microbial communities and the oil degradation. Although some specific biomarker showed larger change under methanogenic condition, the degradation efficiencies for total aromatic and saturated hydrocarbon were higher under sulfate-reducing condition. After the 540-day incubation, bacteria of unknown classifications were dominant in the thermophilic methanogenic consortia, whereas Clostridium dominated the mesophilic methanogenic consortia. With the exception of the dominant phylotypes that were shared with the methanogenic consortia, the sulfate-reducing consortia were predominantly composed of Thermotogae, Deltaproteobacteria, Spirochaeta, and Synergistetes phyla. In conclusion, results in this study demonstrated that the different groups of degraders were responsible for degradation in the four constructed crude oil degrading consortia and consequently led to the existence of different amount of marker compounds under these distinct conditions. There might be distinct metabolic mechanism for degrading crude oil under sulfate-reducing and methanogenic conditions.

  12. Alkane and crude oil degrading bacteria from the petroliferous soil of India

    International Nuclear Information System (INIS)

    Roy, I.; Mishra, A.K.; Ray, A.K.

    1991-01-01

    It has been estimated that approximately 0.5 percent of transported crude oil finds its way into seawater, largely through accidental spills and discharge of ballast and wash water from oil tankers. Some microorganisms are well known for their ability to degrade a variety of hydrocarbons present in crude oil. Oil spills at sea or on land have demonstrated the hydrocarbon-degrading potential of these organisms. Under laboratory conditions, nitrogen may be supplied in soluble form (inorganic salts of ammonia or nitrate of urea). Since most natural aquatic environments are deficient in utilizable forms of nitrogen, it is necessary to add the same exogeneously, but because of rapid dilution the added source of nitrogen does not remain effective. The need for nitrogen supplements may be overcome by appropriate choice of microbes with the genetic capacity to fix molecular nitrogen. In this paper the authors are reporting the isolation of a strain of Pseudomonas stutzeri from the petroliferous soil of India. This strain has the capacity to degrade alkane and crude oil and to fix nitrogen

  13. Geophysical Responses of Hydrocarbon-impacted Zones at the Various Contamination Conditions

    Science.gov (United States)

    Kim, C.; Ko, K.; Son, J.; Kim, J.

    2008-12-01

    One controlled experiment and two field surveys were conducted to investigate the geoelectrical responses of hydrocarbon-contaminated zones, so called smeared zone, on the geophysical data at the hydrocarbon- contaminated sites with various conditions. One controlled physical model experiment with GPR using fresh gasoline and two different 3-D electrical resistivity investigations at the aged sites. One field site (former military facilities for arms maintenance) was mainly contaminated with lubricating oils and the other (former gas station) was contaminated with gasoline and diesel, respectively. The results from the physical model experiment show that GPR signals were enhanced when LNAPL was present as a residual saturation in the water-saturated system due to less attenuation of the electromagnetic energy through the soil medium of the hydrocarbon-impacted zone (no biodegradation), compared to when the medium was saturated with only water (no hydrocarbon impaction). In the former gas station site, 3-D resistivity results demonstrate that the highly contaminated zones were imaged with low resistivity anomalies since the biodegradation of petroleum hydrocarbons has been undergone for many years, causing the drastic increase in the TDS at the hydrocarbon-impacted zones. Finally, 3-D resistivity data obtained from the former military maintenance site show that the hydrocarbon-contaminated zones show high resistivity anomalies since the hydrocarbons such as lubricating oils at the contaminated soils were not greatly influenced by microbial degradation and has relatively well kept their original physical properties of high electrical resistivity. The results of the study illustrated that the hydrocarbon-impacted zones under various contamination conditions yielded various geophysical responses which include (1) enhanced GPR amplitudes at the fresh LNAPL (Gasoline to middle distillates) spill sites, (2) low electrical resistivity anomalies due to biodegradation at the

  14. Isolation and characterization of an n-hexadecane degrading Acinetobacter baumannii KSS1060 from a petrochemical wastewater treatment plant

    International Nuclear Information System (INIS)

    Shiri, Z.; Kermanshahi, R. K.; Soudi, M. R.; Farajzadeh, D.

    2015-01-01

    Hydrocarbons are widespread in the environment, but because of the massive utilization of petroleum products, they are nowadays strongly involved in environmental pollution. Bioremediation is the obliging technology for the treatment of hydrocarbon-contaminated sites. Therefore, to investigate the potential of petrochemical hydrocarbon (HC)-degrading indigenous microorganisms in wastewater samples collected from Fajr petrochemical wastewater treatment plants, a strain of Acinetobacter baumannii was isolated from this hydrocarbon-contaminated wastewater and examined for its ability to utilize hexadecane. This strain was capable to grow on n-hexadecane as the sole source of carbon and energy. The ability of the isolate to degrade n-hexadecane was assessed by growth assays and gas chromatography/mass spectrometry analysis. Using GC analysis, it was shown that the strain KSS1060 was able to degrade 62 % of n-hexadecane within 6 days, which mostly (51.6 %) occurred within the first 24 h. Identification of this hexadecane-degrader bacterium was carried out using 16S rDNA sequence analysis. Additionally, characterization of chemical composition of wastewater samples by the use of gas chromatography/mass spectrometry analysis indicated the presence of Hexanal, Benzene methanol, Indanol, 1,2-benzenedicarboxylic acid diethyl ester, diisobutyl phthalate, and Phenol,4,4′-(1-methylethylidene) in the major constituents of wastewater. In conclusion, this study can focus on more cost-efficient applications of native bacterial strains for the large-scale biodegradation of wastewater samples from petrochemical plant in industry, where it causes disturbing problems due to its harmful effects on different organisms and human beings.

  15. Interactions between Pteris vittata L. genotypes and a polycyclic aromatic hydrocarbon (PAH)-degrading bacterium (Alcaligenes sp.) in arsenic uptake and PAH-dissipation.

    Science.gov (United States)

    Sun, Lu; Zhu, Ganghui; Liao, Xiaoyong; Yan, Xiulan

    2017-11-01

    The effects of two Pteris vittata L. accessions and a polycyclic aromatic hydrocarbon (PAH)-degrading bacterium (Alcaligenes sp.) on arsenic (As) uptake and phenanthrene dissipation were studied. The Alcaligenes sp. survived in the rhizosphere and improved soil As bioavailability with co-exposure. However, bacterial inoculation altered Pteris vittata L. stress tolerance, and substantially affected the As distribution in the rhizosphere of the two P. vittata accessions. Bacterial inoculation was beneficial to protect the Guangxi accession against the toxic effects, and significantly increased plant As and phenanthrene removal ratios by 27.8% and 2.89%, respectively. In contrast, As removal was reduced by 29.8% in the Hunan accession, when compared with corresponding non-inoculated treatments. We conclude that plant genotype selection is critically important for successful microorganism-assisted phytoremediation of soil co-contaminated with As and PAHs, and appropriate genotype selection may enhance remediation efficiency. Copyright © 2017 Elsevier Ltd. All rights reserved.

  16. Degradation of oil products in a soil from a Russian Barents hot-spot during electrodialytic remediation

    DEFF Research Database (Denmark)

    Pedersen, Kristine B.; Lejon, Tore; Jensen, Pernille Erland

    2016-01-01

    A highly oil-polluted soil from Krasnoe in North-West Russia was used to investigate the degradation of organic pollutants during electrodialytic remediation. Removal efficiencies were up to 70 % for total hydrocarbons (THC) and up to 65 % for polyaromatic hydrocarbons (PAH). Relatively more...... of the lighter PAH compounds and THC fractions were degraded. A principal component analysis (PCA) revealed a difference in the distribution of PAH compounds after the remediation. The observed clustering of experiments in the PCA scores plot was assessed to be related to the stirring rate. Multivariate analysis...... of the experimental settings and final concentrations in the 12 experiments revealed that the stirring rate of the soil suspension was by far the most important parameter for the remediation for both THC and PAH. Light was the second most important variable for PAH and seems to influence degradation. The experimental...

  17. Screening of extremotolerant fungi for the bioremediation of hydrocarbon contaminated sites

    Science.gov (United States)

    Poyntner, Caroline; Blasi, Barbara; Prenafeta, Francesc; Sterflinger, Katja

    2015-04-01

    Bioremediation can be used to treat contaminated sites, by taking advantage of microorganisms which have the potential to degrade a wide range of contaminants. While research has been focused mainly on bacteria, the knowledge on other microorganisms, especially fungal communities, is still limited. However, the use of fungi may have advantages compared to bacteria. Extremophile fungi like the black yeasts can withstand high levels of environmental stress (e.g. range of pH, water availability and temperature, presence of toxic chemicals). Therefore they might be applicable in situations, where bacterial communities show limited performance. In order to identify fungi which are good candidates for bioremediation application, a selection of 163 fungal strains, mostly from the group of the black yeasts, was tested for their capability to degrade three different pollutants: hexadecane, toluene, and polychlorinated biphenyl 126, which were used as model compounds for aliphatic hydrocarbons, aromatic hydrocarbons and polychlorinated biphenyls. These chemicals are frequently found in sites contaminated by oil, gas and coal. The screening was based on a two-step selection approach. As a first step, a high throughput method was developed to screen the relatively large amount of fungal strains regarding their tolerance to the contaminants. A microtiter plate based method was developed for monitoring fungal growth in the presence of the selected contaminants photometrically with a Tecan reader. Twenty five strains out of 163, being species of the genera Cladophilaophora, Scedosporium and Exophiala, showed the ability to grow on at least 2 hydrocarbons, and are therefore the most promising candidates for further tests. In a second step, degradation of the contaminants was investigated in more detail for a subset of the screened fungi. This was done by closing the carbon balance in sealed liquid cultures in which the selected pollutant was introduce as the sole source of carbon

  18. Critical point measurement of some polycyclic aromatic hydrocarbons

    International Nuclear Information System (INIS)

    Nikitin, Eugene D.; Popov, Alexander P.

    2015-01-01

    Highlights: • Critical properties of five polycyclic aromatic hydrocarbons were measured. • These hydrocarbons decompose at near-critical temperatures. • Pulse-heating method with short residence times was used. - Abstract: The critical temperatures and the critical pressures of five polycyclic aromatic compounds, namely, acenaphthene, fluorene, anthracene, phenanthrene, and pyrene have been measured. All the compounds studied decompose at near-critical temperatures. A pulse-heating technique applicable to measuring the critical properties of thermally unstable compounds has been used. The times from the beginning of a heating pulse to the moment of reaching the critical temperature were from (0.06 to 0.85) ms. The short residence times provide little degradation of the substances in the course of the experiments. The experimental critical parameters of the polycyclic aromatic compounds have been compared with those estimated by five predictive methods. The acentric factors of polycyclic aromatic compounds studied have been calculated

  19. Characterization of para-Nitrophenol-Degrading Bacterial Communities in River Water by Using Functional Markers and Stable Isotope Probing.

    Science.gov (United States)

    Kowalczyk, Agnieszka; Eyice, Özge; Schäfer, Hendrik; Price, Oliver R; Finnegan, Christopher J; van Egmond, Roger A; Shaw, Liz J; Barrett, Glyn; Bending, Gary D

    2015-10-01

    Microbial degradation is a major determinant of the fate of pollutants in the environment. para-Nitrophenol (PNP) is an EPA-listed priority pollutant with a wide environmental distribution, but little is known about the microorganisms that degrade it in the environment. We studied the diversity of active PNP-degrading bacterial populations in river water using a novel functional marker approach coupled with [(13)C6]PNP stable isotope probing (SIP). Culturing together with culture-independent terminal restriction fragment length polymorphism analysis of 16S rRNA gene amplicons identified Pseudomonas syringae to be the major driver of PNP degradation in river water microcosms. This was confirmed by SIP-pyrosequencing of amplified 16S rRNA. Similarly, functional gene analysis showed that degradation followed the Gram-negative bacterial pathway and involved pnpA from Pseudomonas spp. However, analysis of maleylacetate reductase (encoded by mar), an enzyme common to late stages of both Gram-negative and Gram-positive bacterial PNP degradation pathways, identified a diverse assemblage of bacteria associated with PNP degradation, suggesting that mar has limited use as a specific marker of PNP biodegradation. Both the pnpA and mar genes were detected in a PNP-degrading isolate, P. syringae AKHD2, which was isolated from river water. Our results suggest that PNP-degrading cultures of Pseudomonas spp. are representative of environmental PNP-degrading populations. Copyright © 2015, American Society for Microbiology. All Rights Reserved.

  20. Remediation of total petroleum hydrocarbons using combined in-vessel composting ‎and oxidation by activated persulfate

    Directory of Open Access Journals (Sweden)

    A.R. Asgari

    2017-12-01

    Full Text Available This study was investigated the efficiency of activated persulfate and ‎in-vessel composting for removal of total petroleum hydrocarbons. ‎Remediation by activated persulfate with ferrous sulfate as pre-treatment was done at batch system. In the chemical oxidation, various variables including persulfate concentrations (10-3000 mg/g as waste, pH (3-7, ferrous sulfate (0.5-4 mg/g as wasteand temperature (20-60°C were studied. In the biological system, premature compost was added as an amendment. The filter cake to compost ratio were 1:0 (as control and 1:5 to 15 (as dry basis. C: N: P ratio and moisture content were 100:5:1 and 45-60%, respectively. The results showed that acidic pH (pH=3 had high efficiency for the removal of total petroleum hydrocarbons by activated persulfate. Temperature had the significant effect during the persulfate oxidation. When ferrous sulfate was used as an activator for degradation at acidic condition and 60°C, removal efficiency increased to 47.32%. The results of biological process showed that the minimum total petroleum hydrocarbons removal in all reactors was 62 percent. The maximum and minimum removal efficiency was obtained at 1:5 (69.46% and 1:10 (62.42% mixing ratios, respectively. Kinetic study showed that second order kinetic model (R2>0.81 shows the best agreement with the experimental data and the rate of TPH degradation at low mixing ratio (1:3 was faster than high mixing ratio (1:15. Therefore, according to the results, in-vessel composting after pre-treatment by activated persulfate is suggested as an efficient process for degradation of total petroleum hydrocarbons.

  1. Distributions of Polycyclic Aromatic Hydrocarbons, Aromatic Ketones, Carboxylic Acids, and Trace Metals in Arctic Aerosols: Long-Range Atmospheric Transport, Photochemical Degradation/Production at Polar Sunrise.

    Science.gov (United States)

    Singh, Dharmendra Kumar; Kawamura, Kimitaka; Yanase, Ayako; Barrie, Leonard A

    2017-08-15

    The distributions, correlations, and source apportionment of aromatic acids, aromatic ketones, polycyclic aromatic hydrocarbons (PAHs), and trace metals were studied in Canadian high Arctic aerosols. Nineteen PAHs including minor sulfur-containing heterocyclic PAH (dibenzothiophene) and major 6 carcinogenic PAHs were detected with a high proportion of fluoranthene followed by benzo[k]fluoranthene, pyrene, and chrysene. However, in the sunlit period of spring, their concentrations significantly declined likely due to photochemical decomposition. During the polar sunrise from mid-March to mid-April, benzo[a]pyrene to benzo[e]pyrene ratios significantly dropped, and the ratios diminished further from late April to May onward. These results suggest that PAHs transported over the Arctic are subjected to strong photochemical degradation at polar sunrise. Although aromatic ketones decreased in spring, concentrations of some aromatic acids such as benzoic and phthalic acids increased during the course of polar sunrise, suggesting that aromatic hydrocarbons are oxidized to result in aromatic acids. However, PAHs do not act as the major source for low molecular weight (LMW) diacids such as oxalic acid that are largely formed at polar sunrise in the arctic atmosphere because PAHs are 1 to 2 orders of magnitude less abundant than LMW diacids. Correlations of trace metals with organics, their sources, and the possible role of trace transition metals are explained.

  2. Phytoremediation of polyaromatic hydrocarbons, anilines and phenols.

    Science.gov (United States)

    Harvey, Patricia J; Campanella, Bruno F; Castro, Paula M L; Harms, Hans; Lichtfouse, Eric; Schäffner, Anton R; Smrcek, Stanislav; Werck-Reichhart, Daniele

    2002-01-01

    Phytoremediation technologies based on the combined action of plants and the microbial communities that they support within the rhizosphere hold promise in the remediation of land and waterways contaminated with hydrocarbons but they have not yet been adopted in large-scale remediation strategies. In this review plant and microbial degradative capacities, viewed as a continuum, have been dissected in order to identify where bottle-necks and limitations exist. Phenols, anilines and polyaromatic hydrocarbons (PAHs) were selected as the target classes of molecule for consideration, in part because of their common patterns of distribution, but also because of the urgent need to develop techniques to overcome their toxicity to human health. Depending on the chemical and physical properties of the pollutant, the emerging picture suggests that plants will draw pollutants including PAHs into the plant rhizosphere to varying extents via the transpiration stream. Mycorrhizosphere-bacteria and -fungi may play a crucial role in establishing plants in degraded ecosystems. Within the rhizosphere, microbial degradative activities prevail in order to extract energy and carbon skeletons from the pollutants for microbial cell growth. There has been little systematic analysis of the changing dynamics of pollutant degradation within the rhizosphere; however, the importance of plants in supplying oxygen and nutrients to the rhizosphere via fine roots, and of the beneficial effect of microorganisms on plant root growth is stressed. In addition to their role in supporting rhizospheric degradative activities, plants may possess a limited capacity to transport some of the more mobile pollutants into roots and shoots via fine roots. In those situations where uptake does occur (i.e. only limited microbial activity in the rhizosphere) there is good evidence that the pollutant may be metabolised. However, plant uptake is frequently associated with the inhibition of plant growth and an

  3. Comparison of the degradation of 14C-labeled DHP and corn stalk lignins by micro- and macrofungi and bacteria

    International Nuclear Information System (INIS)

    Haider, K.; Trojanowski, J.

    1980-01-01

    To what extent and by which mode microfungi and bacteria from soil are able to degrade lignin have been investigated and their activity compared with those of white and brown rot Basidiomycetes. The experiments were made by means of specifically 14C-labeled DHPs prepared by polymerization of correspondingly labeled coniferyl alcohol. Also, a corn stalk material was used which was specifically labeled in the lignin part. This material was prepared by infusion of specifically labeled cinnamic acid compounds into growing maize plants. The potential of the organisms to degrade several specifically labeled phenols was determined and compared. White and brown rot fungi, as well as several microscopic fungi, were able to degrade phenolcarboxylic and cinnamic acids and even some phenolic compounds with completely alkylated phenolic hydroxl groups. They could also introduce hydroxl groups into benzoic and pi-hydroxybenzoic acids before ring cleavage. As compared to brown rot, the white rot fungi released higher amounts of CO2 from the aromatic and side chain carbons of DHP and plant lignins. Some brown rot fungi, however, had similar capacities in degrading DHP lignin as white rot fungi. They especially released more CO2 from methoxyl groups. This release was dependent upon the added carbohydrate source and could be either repressed or enhanced. Several bacteria, especially Nocardia spp. and Pseudomonas spp., were tested for their potential to degrade the labeled lignins or phenols. Most of these bacteria did not appreciably degrade lignins, although they were highly active in the metabolization of phenols. Some Nocardia spp., however, were found to have a noteworthy capacity in the degradation of lignins and phenols. Preliminary studies of the potentials of the organisms to attack labeled lignin sulfonates either in liquid or soil cultures are presented. (Refs. 100)

  4. Characterization of Three Mycobacterium spp. with Potential Use in Bioremediation by Genome Sequencing and Comparative Genomics.

    Science.gov (United States)

    Das, Sarbashis; Pettersson, B M Fredrik; Behra, Phani Rama Krishna; Ramesh, Malavika; Dasgupta, Santanu; Bhattacharya, Alok; Kirsebom, Leif A

    2015-06-16

    We provide the genome sequences of the type strains of the polychlorophenol-degrading Mycobacterium chlorophenolicum (DSM43826), the degrader of chlorinated aliphatics Mycobacterium chubuense (DSM44219) and Mycobacterium obuense (DSM44075) that has been tested for use in cancer immunotherapy. The genome sizes of M. chlorophenolicum, M. chubuense, and M. obuense are 6.93, 5.95, and 5.58 Mb with GC-contents of 68.4%, 69.2%, and 67.9%, respectively. Comparative genomic analysis revealed that 3,254 genes are common and we predicted approximately 250 genes acquired through horizontal gene transfer from different sources including proteobacteria. The data also showed that the biodegrading Mycobacterium spp. NBB4, also referred to as M. chubuense NBB4, is distantly related to the M. chubuense type strain and should be considered as a separate species, we suggest it to be named Mycobacterium ethylenense NBB4. Among different categories we identified genes with potential roles in: biodegradation of aromatic compounds and copper homeostasis. These are the first nonpathogenic Mycobacterium spp. found harboring genes involved in copper homeostasis. These findings would therefore provide insight into the role of this group of Mycobacterium spp. in bioremediation as well as the evolution of copper homeostasis within the Mycobacterium genus. © The Author(s) 2015. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution.

  5. A field experiment for the anaerobic biotransformation of aromatic hydrocarbon compounds at Seal Beach, California

    International Nuclear Information System (INIS)

    Reinhard, M.; Wills, L.E.; Ball, H.A.; Harmon, T.

    1991-01-01

    Biotransformation of aromatic hydrocarbons under anaerobic conditions is of interest because dissolved oxygen is rapidly consumed in groundwater contaminant plumes of hydrocarbon fuel. Anaerobic biotransformation of aromatic hydrocarbons has been demonstrated under different redox regimes including nitrate-reducing iron-reducing and fermentative-methanogenic conditions. Recently, laboratory evidence has been obtained for the degradation of alkylbenzenes including toluene under sulfate-reducing conditions. The long-term objective of this study is to determine transformation rates under the conditions of the Seal Beach site, and second to explore the feasibility of inducing nitrate- and sulfate-reducing conditions and fermentative-methanogenic conditions in field bioreactors. Both laboratory studies and field studies in bioreactors are being conducted. This paper reports on the experimental design of the bioreactors and initial results

  6. Characterization of the vadose zone above a shallow aquifer contaminated with gas condensate hydrocarbons

    International Nuclear Information System (INIS)

    Sublette, K.; Duncan, K.; Thoma, G.; Todd, T.

    2002-01-01

    A gas production site in the Denver Basin near Ft. Lupton, Colorado has leaked gas condensate hydrocarbons from an underground concrete tank used to store produced water. The leak has contaminated a shallow aquifer. Although the source of pollution has been removed, a plume of hydrocarbon contamination still remains for nearly 46 m from the original source. An extensive monitoring program was conducted in 1993 of the groundwater and saturated sediments. The objective was to determine if intrinsic aerobic or anaerobic bioremediation of hydrocarbons occurred at the site at a rate that would support remediation. Geochemical indicators of hydrogen biodegradation by microorganisms in the saturated zone included oxygen depletion, increased alkalinity, sulfate depletion, methane production and Fe2+ production associated with hydrogen contamination. The presence of sulfate-reducing bacteria and methanogens was also much higher in the contaminated sediments. Degraded hydrocarbon metabolites were found in contaminated groundwater. An extensive characterization of the vadose zone was conducted in which the vadose zone was sample in increments of 15 cm from the surface to the water table at contaminated and non contaminated sites. The samples were tested for individual C3+ hydrocarbons, methane, CO2, total organic carbon, total inorganic carbon, and total petroleum hydrocarbons. The vadose zone consisted of an active and aerobic bioreactor fueled by condensate hydrocarbons transported into the unsaturated zone by evaporation of hydrocarbons at the water table. It was concluded that the unsaturated zone makes an important contribution to the natural attenuation of gas condensate hydrocarbons in the area. 17 refs., 2 tabs., 28 figs

  7. Microbial utilization of naturally occurring hydrocarbons at the Guaymas Basin hydrothermal vent site

    International Nuclear Information System (INIS)

    Bazylinski, D.A.; Wirsen, C.O.; Jannasch, H.W.

    1989-01-01

    The Guaymas Basin (Gulf of California; depth, 2,000 m) is a site of hydrothermal activity in which petroliferous materials is formed by thermal alteration of deposited planktonic and terrestrial organic matter. We investigated certain components of these naturally occurring hydrocarbons as potential carbon sources for a specific microflora at these deep-sea vent sites. Respiratory conversion of [1- 14 C]hexadecane and [1(4,5,8)- 14 C]naphthalene to 14 CO 2 was observed at 4 degree C and 25 degree C, and some was observed at 55 degree C, but none was observed at 80 degree C. Bacterial isolates were capable of growing on both substrates as the sole carbon source. All isolates were aerobic and mesophilic with respect to growth on hydrocarbons but also grew at low temperatures (4 to 5 degree C). These results correlate well with previous geochemical analyses, indicating microbial hydrocarbon degradation, and show that at least some of the thermally produced hydrocarbons at Guaymas Basin are significant carbon sources to vent microbiota

  8. Arbuscular mycorrhizal wheat inoculation promotes alkane and polycyclic aromatic hydrocarbon biodegradation: Microcosm experiment on aged-contaminated soil.

    Science.gov (United States)

    Ingrid, Lenoir; Lounès-Hadj Sahraoui, Anissa; Frédéric, Laruelle; Yolande, Dalpé; Joël, Fontaine

    2016-06-01

    Very few studies reported the potential of arbuscular mycorrhizal symbiosis to dissipate hydrocarbons in aged polluted soils. The present work aims to study the efficiency of arbuscular mycorrhizal colonized wheat plants in the dissipation of alkanes and polycyclic aromatic hydrocarbons (PAHs). Our results demonstrated that the inoculation of wheat with Rhizophagus irregularis allowed a better dissipation of PAHs and alkanes after 16 weeks of culture by comparison to non-inoculated condition. These dissipations observed in the inoculated soil resulted from several processes: (i) a light adsorption on roots (0.5% for PAHs), (ii) a bioaccumulation in roots (5.7% for PAHs and 6.6% for alkanes), (iii) a transfer in shoots (0.4 for PAHs and 0.5% for alkanes) and mainly a biodegradation. Whereas PAHs and alkanes degradation rates were respectively estimated to 12 and 47% with non-inoculated wheat, their degradation rates reached 18 and 48% with inoculated wheat. The mycorrhizal inoculation induced an increase of Gram-positive and Gram-negative bacteria by 56 and 37% compared to the non-inoculated wheat. Moreover, an increase of peroxidase activity was assessed in mycorrhizal roots. Taken together, our findings suggested that mycorrhization led to a better hydrocarbon biodegradation in the aged-contaminated soil thanks to a stimulation of telluric bacteria and hydrocarbon metabolization in mycorrhizal roots. Copyright © 2016 Elsevier Ltd. All rights reserved.

  9. Biodegradation of gasoline in environment: from total assessment to the case of recalcitrant hydrocarbons; Biodegradabilite de l'essence dans l'environnement: de l'evaluation globale au cas des hydrocarbures recalcitrants

    Energy Technology Data Exchange (ETDEWEB)

    Solano-Serena, F.

    1999-11-26

    Because of their massive utilisation, hydrocarbons are major pollutants of soils and aquifers. Biodegradation is a key aspect of the fate of pollutants in the environment. Such knowledge, concerns in particular the intrinsic biodegradability of the products and the distribution in the environment of competent degradative microflora. In this study, a methodology has been developed to assess the aerobic biodegradability of gasoline. It is based on the direct gas chromatographic analysis of all hydrocarbons, after incubation in optimal conditions, of gasoline fractions and of model mixtures. The results demonstrated first the quasi-total biodegradability of gasoline ({>=} 94%). Concerning the distribution in the environment of degradative capacities, even microflora from non polluted sites exhibited a high performance (total degradation rates at least 85%) but were limited concerning the degradation of trimethyl-alkanes, such as 2,2,4-trimethyl-pentane (iso-octane) and 2,3,4-trimethyl-pentane, and of cyclohexane. Samples of polluted sites exhibited more extensive degradative capacities with total degradation in half of the cases studied. Cyclohexane was always degraded by mutualism and/or co-metabolism. Trimethyl-alkanes with quaternary carbons such as iso-octane and/or alkyl groups on consecutive carbons were degraded by co-metabolism but could also support growth of specialized strains. A strain of Mycobacterium austroafricanum (strain IFP 2173) growing on iso-octane was isolated from a gasoline polluted sample. This strain exhibited the capacity to co-metabolize various hydrocarbons (cyclic and branched alkanes, aromatics) and in particular cyclohexane. M austroafricanum lFP 2173 was also able to use a large spectrum of hydrocarbons (n- and iso-alkanes, aromatics) as sole carbon and energy source. (author)

  10. Assessment of intra-species diversity among strains of Acinetobacter baumannii isolated from sites contaminated with petroleum hydrocarbons

    International Nuclear Information System (INIS)

    Manab Sarma, P.; Bhattacharya, D.; Krishnan, S.; Lal, B.

    2004-01-01

    Intra-species diversity among Acinetobacter baumannii strains isolated from crude oil-contaminated soils from different geographic regions in India was assessed, including their capability to degrade different fractions of total petroleum hydrocarbons. A total of 96 strains were isolated from five different sites. Of the 96 isolates, 25 strains were identified as Acinetobacter baumannii; all of these strains were biochemically profiled and grouped into eight phenovars on the basis of multivariate analysis of their substrate utilization profiles. All strains were able to degrade the total petroleum hydrocarbon fractions of crude oil. Intraspecies relatedness among the 25 strains was determined using tRNA intergenic spacer length polymorphism. Specific variants among the strains with different degradation capacities for different fractions of crude oil were detected. Environmental influences that cause intra-species diversity, such as functional resilience, within the selected strains of A. baumannii were also noted. It is suggested that such diversities may make it possible to select contaminant-specific strains for efficient biotechnological strategies in environmental remediation. 19 refs., 4 tabs., 3 figs

  11. Assessment of intra-species diversity among strains of Acinetobacter baumannii isolated from sites contaminated with petroleum hydrocarbons

    Energy Technology Data Exchange (ETDEWEB)

    Manab Sarma, P.; Bhattacharya, D.; Krishnan, S. [TERI School of Advanced Studies, Center of Bioresources and Biotechnology, New Delhi (India); Lal, B. [TERI School of Advanced Studies, Microbial Biotechnology Division, New Delhi (India)

    2004-06-01

    Intra-species diversity among Acinetobacter baumannii strains isolated from crude oil-contaminated soils from different geographic regions in India was assessed, including their capability to degrade different fractions of total petroleum hydrocarbons. A total of 96 strains were isolated from five different sites. Of the 96 isolates, 25 strains were identified as Acinetobacter baumannii; all of these strains were biochemically profiled and grouped into eight phenovars on the basis of multivariate analysis of their substrate utilization profiles. All strains were able to degrade the total petroleum hydrocarbon fractions of crude oil. Intraspecies relatedness among the 25 strains was determined using tRNA intergenic spacer length polymorphism. Specific variants among the strains with different degradation capacities for different fractions of crude oil were detected. Environmental influences that cause intra-species diversity, such as functional resilience, within the selected strains of A. baumannii were also noted. It is suggested that such diversities may make it possible to select contaminant-specific strains for efficient biotechnological strategies in environmental remediation. 19 refs., 4 tabs., 3 figs.

  12. Bioremediation potential of diesel-contaminated Libyan soil.

    Science.gov (United States)

    Koshlaf, Eman; Shahsavari, Esmaeil; Aburto-Medina, Arturo; Taha, Mohamed; Haleyur, Nagalakshmi; Makadia, Tanvi H; Morrison, Paul D; Ball, Andrew S

    2016-11-01

    Bioremediation is a broadly applied environmentally friendly and economical treatment for the clean-up of sites contaminated by petroleum hydrocarbons. However, the application of this technology to contaminated soil in Libya has not been fully exploited. In this study, the efficacy of different bioremediation processes (necrophytoremediation using pea straw, bioaugmentation and a combination of both treatments) together with natural attenuation were assessed in diesel contaminated Libyan soils. The addition of pea straw was found to be the best bioremediation treatment for cleaning up diesel contaminated Libyan soil after 12 weeks. The greatest TPH degradation, 96.1% (18,239.6mgkg(-1)) and 95% (17,991.14mgkg(-1)) were obtained when the soil was amended with pea straw alone and in combination with a hydrocarbonoclastic consortium respectively. In contrast, natural attenuation resulted in a significantly lower TPH reduction of 76% (14,444.5mgkg(-1)). The presence of pea straw also led to a significant increased recovery of hydrocarbon degraders; 5.7log CFU g(-1) dry soil, compared to 4.4log CFUg(-1) dry soil for the untreated (natural attenuation) soil. DGGE and Illumina 16S metagenomic analyses confirm shifts in bacterial communities compared with original soil after 12 weeks incubation. In addition, metagenomic analysis showed that original soil contained hydrocarbon degraders (e.g. Pseudoxanthomonas spp. and Alcanivorax spp.). However, they require a biostimulant (in this case pea straw) to become active. This study is the first to report successful oil bioremediation with pea straw in Libya. It demonstrates the effectiveness of pea straw in enhancing bioremediation of the diesel-contaminated Libyan soil. Copyright © 2016 Elsevier Inc. All rights reserved.

  13. Presence of Staphylococcus spp. and Candida spp. in the human oral cavity

    Directory of Open Access Journals (Sweden)

    Martins Clélia Aparecida de Paiva

    2002-01-01

    Full Text Available The presence of yeasts and staphylococci in the oral cavity is important because they can act as supplementary microbiota and in certain situations can cause oral or systemic diseases. The aim of this work was to study the prevalence of Candida spp. and Staphylococcus spp. in the human oral cavity. Oral rinses were collected from sixty-eight individuals according to the technique described by Samaranayake and MacFarlane and then cultured on Sabouraud medium supplemented with chloramphenicol and Baird-Parker agar. After the incubation period, the microorganisms were isolated and identified through biochemical tests. The data obtained were statistically analysed by ANOVA. Candida spp. were isolated from 61.76% of the examined individuals and C. albicans was the more frequently isolated specie. Staphylococcus spp. were isolated from 95.60% of the individuals and 41 strains were coagulase negative (63%. Among the coagulase positive strains, nine were S. aureus, 11 S. hyicus and 4 S. schleiferi subspecie coagulans. No correlation was observed between the counts (cfu of the isolated Candida spp. and Staphylococcus spp.

  14. Arbuscular mycorrhizal wheat inoculation promotes alkane and polycyclic aromatic hydrocarbon biodegradation: Microcosm experiment on aged-contaminated soil

    International Nuclear Information System (INIS)

    Ingrid, Lenoir; Lounès-Hadj Sahraoui, Anissa; Frédéric, Laruelle; Yolande, Dalpé; Joël, Fontaine

    2016-01-01

    Very few studies reported the potential of arbuscular mycorrhizal symbiosis to dissipate hydrocarbons in aged polluted soils. The present work aims to study the efficiency of arbuscular mycorrhizal colonized wheat plants in the dissipation of alkanes and polycyclic aromatic hydrocarbons (PAHs). Our results demonstrated that the inoculation of wheat with Rhizophagus irregularis allowed a better dissipation of PAHs and alkanes after 16 weeks of culture by comparison to non-inoculated condition. These dissipations observed in the inoculated soil resulted from several processes: (i) a light adsorption on roots (0.5% for PAHs), (ii) a bioaccumulation in roots (5.7% for PAHs and 6.6% for alkanes), (iii) a transfer in shoots (0.4 for PAHs and 0.5% for alkanes) and mainly a biodegradation. Whereas PAHs and alkanes degradation rates were respectively estimated to 12 and 47% with non-inoculated wheat, their degradation rates reached 18 and 48% with inoculated wheat. The mycorrhizal inoculation induced an increase of Gram-positive and Gram-negative bacteria by 56 and 37% compared to the non-inoculated wheat. Moreover, an increase of peroxidase activity was assessed in mycorrhizal roots. Taken together, our findings suggested that mycorrhization led to a better hydrocarbon biodegradation in the aged-contaminated soil thanks to a stimulation of telluric bacteria and hydrocarbon metabolization in mycorrhizal roots. - Highlights: • Phytoremediation of aged-hydrocarbon polluted soils may be improved using arbuscular mycorrhizal fungi. • Inoculation of wheat with R. irregularis improved dissipation of PAH and alkanes. • Dissipation resulted from adsorption and bioaccumulation in wheat and mainly from biodegradation in soil. • Biodegradation was due to a stimulation of rhizosphere bacteria and an induction of root peroxidase. - Inoculation of wheat by an arbuscular mycorrhizal fungus improves biodegradation of alkanes and polycyclic aromatic hydrocarbons in an aged

  15. Coupling spectroscopic and chromatographic techniques for evaluation of the depositional history of hydrocarbons in a subtropical estuary

    International Nuclear Information System (INIS)

    Martins, César C.; Doumer, Marta E.; Gallice, Wellington C.; Dauner, Ana Lúcia L.; Cabral, Ana Caroline; Cardoso, Fernanda D.

    2015-01-01

    Spectroscopic and chromatographic techniques can be used together to evaluate hydrocarbon inputs to coastal environments such as the Paranaguá estuarine system (PES), located in the SW Atlantic, Brazil. Historical inputs of aliphatic hydrocarbons (AHs) and polycyclic aromatic hydrocarbons (PAHs) were analyzed using two sediment cores from the PES. The AHs were related to the presence of biogenic organic matter and degraded oil residues. The PAHs were associated with mixed sources. The highest hydrocarbon concentrations were related to oil spills, while relatively low levels could be attributed to the decrease in oil usage during the global oil crisis. The results of electron paramagnetic resonance were in agreement with the absolute AHs and PAHs concentrations measured by chromatographic techniques, while near-infrared spectroscopy results were consistent with unresolved complex mixture (UCM)/total n-alkanes ratios. These findings suggest that the use of a combination of techniques can increase the accuracy of assessment of contamination in sediments. - Highlights: • Historical inputs of hydrocarbons in a subtropical estuary were evaluated. • Spectroscopic and chromatographic methods were used in combination. • High hydrocarbon concentrations were related to anthropogenic activities. • Low hydrocarbon levels could be explained by the 1970s global oil crisis. - Spectroscopic and chromatographic techniques could be used together to evaluate hydrocarbon inputs to coastal environments

  16. Evaluation of Aliphatic and Aromatic Compounds Degradation by Indigenous Bacteria Isolated from Soil Contaminated with Petroleum

    Directory of Open Access Journals (Sweden)

    Farhad Gilavand

    2015-12-01

    Full Text Available Background:  The major of this study was to isolate oil-degrading bacteria from soil contaminated with petroleum and examining the removal of hydrocarbons by these bacteria. Methods: Oil-degrading colonies were purified from the samples obtained of around Ahvaz oil wells. Organic matter degradation was investigated with 1 g of crude oil in basal salt medium (BSM as sole carbon source. The growth rate was determined through total protein assay and hydrocarbon consuming was measured through organic carbon oxidation and titration by dichromate as oxidizing agent. Results: Two potential isolates named S1 and S2 strains were screened and identified as Planococcus and Pseudomonas aeruginosa. As results for S1 and S2 could degrade 80.86 and 65.6% of olive oil, 59.6 and 35.33 of crude oil, while 32 and 26.15 % of coal tar were consumed during 14 days incubation. Conclusion: The results of this investigation showed these indigenous strains high capability to biodegradation at short time and are desirable alternatives for treatment of oil pollutants.

  17. Biodegradation Of Polycyclic Aromatic Hydrocarbons In Petroleum Oil Contaminating The Environment

    International Nuclear Information System (INIS)

    Partila, A.M.

    2013-01-01

    Polycyclic aromatic hydrocarbons (PAHs) are ubiquitous pollutants in urban atmospheres (Chen et al., 2013). PAHs enter the environment via incomplete combustion of fossil fuels and accidental leakage of petroleum products, and as components of products such as creosote (Muckian et al., 2009). Due to PAHs carcinogenic activity, they have been included in the European Union (EU) and the Environmental Protection Agency (EPA) priority pollutant lists. Human exposure to PAHs occurs in three ways, inhalation, dermal contact and consumption of contaminated foods, which account for 88-98% of such contamination; in other words, diet is the major source of human exposure to these contaminants (Rey-Salgueiro et al., 2008). Both the World Health Organization and the UK Expert Panel on Air Quality Standards (EPAQS) have considered benzo(a)pyrene (BaP) as a marker of the carcinogenic potency of the polycyclic aromatic hydrocarbons (PAH) mixture (Delgado-Saborit et al., 2011). Polycyclic aromatic and heavier aliphatic hydrocarbons, which have a stable recalcitrant molecular structure, exhibit high hydrophobicity and low aqueous solubility, are not readily removed from soil through leaching and volatilization (Brassington et al., 2007). The hydrophobicity of PAHs limits desorption to the aqueous phase (Donlon et al., 2002). Six main ways of dissipation, i.e. disappearance, are recognized in the environment: volatilization, photooxidation, Aim of the Work chemical oxidation, sorption, leaching and biodegradation. Microbial degradation is considered to be the main process involved in the dissipation of PAH (Yuan et al., 2002). Thus, more and more research interests are turning to the biodegradation of PAHs. Some microorganisms can utilize PAHs as a source of carbon and energy so that PAHs can be degraded to carbon dioxide and water, or transformed to other nontoxic or low-toxic substances (Perelo, 2010). Compared with other physical and chemical methods such as combustion

  18. The MrCYP52 cytochrome P450 monoxygenase gene of Metarhizium robertsii is important for utilizing insect epicuticular hydrocarbons.

    Directory of Open Access Journals (Sweden)

    Liangcai Lin

    Full Text Available Fungal pathogens of plants and insects infect their hosts by direct penetration of the cuticle. Plant and insect cuticles are covered by a hydrocarbon-rich waxy outer layer that represents the first barrier against infection. However, the fungal genes that underlie insect waxy layer degradation have received little attention. Here we characterize the single cytochrome P450 monoxygenase family 52 (MrCYP52 gene of the insect pathogen Metarhizium robertsii, and demonstrate that it encodes an enzyme required for efficient utilization of host hydrocarbons. Expressing a green florescent protein gene under control of the MrCYP52 promoter confirmed that MrCYP52 is up regulated on insect cuticle as well as by artificial media containing decane (C10, extracted cuticle hydrocarbons, and to a lesser extent long chain alkanes. Disrupting MrCYP52 resulted in reduced growth on epicuticular hydrocarbons and delayed developmental processes on insect cuticle, including germination and production of appressoria (infection structures. Extraction of alkanes from cuticle prevented induction of MrCYP52 and reduced growth. Insect bioassays against caterpillars (Galleria mellonella confirmed that disruption of MrCYP52 significantly reduces virulence. However, MrCYP52 was dispensable for normal germination and appressorial formation in vitro when the fungus was supplied with nitrogenous nutrients. We conclude therefore that MrCYP52 mediates degradation of epicuticular hydrocarbons and these are an important nutrient source, but not a source of chemical signals that trigger infection processes.

  19. Contribution to the study of the degradation of the solvent used in a nuclear fuel reprocessing plant

    International Nuclear Information System (INIS)

    Goasmat, F.

    1984-01-01

    The degradation of a mixed solvent (tributylphosphate - hydrocarbons) in a fuel reprocessing plant (UP 2 at La Hague, France) is studied in this thesis. Laboratory studies on degradation mechanisms, decomposition products and regeneration processes are reviewed in a bibliographic synthesis. Solvent degradation is investigated on a real solvent from a reprocessing plant. Influence of degradation on solvent performance is shown and regeneration processes should be improved. Many regeneration processes are tested on solvent from the plant and results are discussed. Separation and analysis of degradation products show the polyfunctional structure of compounds formed [fr

  20. Naphthalene and pyrene degradation in contaminated soil as a ...

    African Journals Online (AJOL)

    The effect of soil particle size distribution and percent organic matter on the degradation rate of naphthalene and pyrene in a water medium of 7.05 ml/min at 27 ± 2oC in a soil reactor was studied. Analysis of the pattern of disappearance of these polycyclic aromatic hydrocarbons (PAHs) using various particle sizes showed ...

  1. The microbial ecology of anaerobic cellulose degradation in municipal waste landfill sites: evidence of a role for fibrobacters.

    Science.gov (United States)

    McDonald, James E; Houghton, James N I; Rooks, David J; Allison, Heather E; McCarthy, Alan J

    2012-04-01

    Cellulose is reputedly the most abundant organic polymer in the biosphere, yet despite the fundamental role of cellulolytic microorganisms in global carbon cycling and as potential sources of novel enzymes for biotechnology, their identity and ecology is not well established. Cellulose is a major component of landfill waste and its degradation is therefore a key feature of the anaerobic microbial decomposition process. Here, we targeted a number of taxa containing known cellulolytic anaerobes (members of the bacterial genus Fibrobacter, lineages of Clostridium clusters I, III, IV and XIV, and anaerobic fungi of the Neocallimastigales) in landfill leachate and colonized cellulose 'baits' via PCR and quantitative PCR (qPCR). Fibrobacter spp. and Clostridium clusters III, IV and XIV were detected in almost all leachate samples and cluster III and XIV clostridia were the most abundant (1-6% and 1-17% of total bacterial 16S rRNA gene copies respectively). Two landfill leachate microcosms were constructed to specifically assess those microbial communities that colonize and degrade cellulose substrates in situ. Scanning electron microscopy (SEM) of colonized cotton revealed extensive cellulose degradation in one microcosm, and Fibrobacter spp. and Clostridium cluster III represented 29% and 17%, respectively, of total bacterial 16S rRNA gene copies in the biofilm. Visible cellulose degradation was not observed in the second microcosm, and this correlated with negligible relative abundances of Clostridium cluster III and Fibrobacter spp. (≤ 0.1%), providing the first evidence that the novel fibrobacters recently detected in landfill sites and other non-gut environments colonize and degrade cellulose substrates in situ. © 2012 Society for Applied Microbiology and Blackwell Publishing Ltd.

  2. Characterisation of the effect of a simulated hydrocarbon spill on diazotrophs in mangrove sediment mesocosm

    NARCIS (Netherlands)

    Taketani, R.G.; dos Santos, H.F.; van Elsas, J.D.; Rosado, A.S.

    2009-01-01

    An analysis of the effect of an oil spill on mangrove sediments was carried out by contamination of mesocosms derived from two different mangroves, one with a history of contamination and one pristine. The association between N(2) fixers and hydrocarbon degradation was assessed using quantitative

  3. Mycobacterium Diversity and Pyrene Mineralization in Petroleum-Contaminated Soils

    OpenAIRE

    Cheung, Pui-Yi; Kinkle, Brian K.

    2001-01-01

    Degradative strains of fast-growing Mycobacterium spp. are commonly isolated from polycyclic aromatic hydrocarbon (PAH)-contaminated soils. Little is known, however, about the ecology and diversity of indigenous populations of these fast-growing mycobacteria in contaminated environments. In the present study 16S rRNA genes were PCR amplified using Mycobacterium-specific primers and separated by temperature gradient gel electrophoresis (TGGE), and prominent bands were sequenced to compare the ...

  4. Organic pollutants in the coastal environment off San Diego, California. 2: Petrogenic and biogenic sources of aliphatic hydrocarbons

    International Nuclear Information System (INIS)

    Tran, K.; Yu, C.C.; Zeng, E.Y.

    1997-01-01

    The results from the measurements of aliphatic hydrocarbons suggest that hydrocarbons suggest that hydrocarbons in the Point Loma Wastewater Treatment Plant (PLWTP) effluents are mainly petroleum derived; those in the Tijuana River runoff have largely originated from terrestrial plants with visible petroleum contamination; and those in the sea surface microlayer, sediment traps, and sediments at various coastal locations off San Diego have mostly resulted from biogenic contributions with enhanced microbial products in the summer season. Rainfall in the winter season appeared to amplify the inputs from terrestrial higher plants to the coastal areas. The PLWTP discharged approximately 3.85 metric tons of n-alkanes (C 10 -C 35 ) in 1994, well below the level (136 metric tons) estimated in 1979. The input of aliphatic hydrocarbons from the Tijuana River was about 0.101 metric tons in 1994. Diffusion, solubilization, evaporation, and microbial degradation seemed partially responsible for the difference in the concentrations and compositions of aliphatic hydrocarbons in different sample media, although the relative importance of each mechanism cannot be readily discerned from the available data. The results from analyses of aliphatic hydrocarbon compositional indices are generally consistent with those of polycyclic aromatic hydrocarbons

  5. Natural attenuation of hydrocarbon polluted soils in Mexico

    International Nuclear Information System (INIS)

    Fernandez-Linares, L.; Rojas-Avelizapa, N.; Roldan-Carrillo, T.; Islas-Ramirez, M.

    2009-01-01

    Crude oil and hydrocarbon by-proudcts are the most common pollutants in Mexico. In the last years, the two terms, contamination and remediation have being re-defined; also, based on both the scientific advancement and the human risk, the sustentability of remediation technologies and the definition of cleaning levels has been taking place. In this context, the Natural Attenuation of soils is a viable and low cost remediation choice, defined as the degradation of organic compounds without artificial stimulation, through microbial activity including physical processes, such as volatilization, dilution, sorption, and hydraulic dispersion. (Author)

  6. Epidemiology of Salmonella spp., Listeria monocytogenes and Campylobacter spp., in the poultry chain production system

    Directory of Open Access Journals (Sweden)

    Realpe-Delgado, María Elena

    2016-10-01

    Full Text Available Salmonella spp., Campylobacter spp., and L. monocytogenes are zoonotic foodborne pathogens, associated with the consumption of contaminated foods of animal origin. In this study we determined the prevalence and risk factors associated with the presence of these microorganisms at all stages of the production system, in two Colombian poultry companies (EI-EI-I and II. In EI-I, Campylobacter spp., and Salmonella spp., were isolated from 10 % and 4.4 % of the specimens, and S. Heidelberg was the predominant serotype. Salmonella spp., was found in 6 % of hands and stool samples of workers. S. Saphra was the most prevalent serotype. In EI-II, the prevalence of Campylobacter spp., and Salmonella spp., from animal specimens was 7 % and 17 %, respectively. L. monocytogenes was not detected. This study established the prevalence of these zoonotic pathogens through the production chain and showed the presence of pathogen carriers among workers/food handlers. “Lack of medical examination of employees in the previous year” was found to be a possible risk factor for carriage of Salmonella spp.

  7. Transcriptional profiling of nitrogen fixation and the role of NifA in the diazotrophic endophyte Azoarcus sp. strain BH72.

    Directory of Open Access Journals (Sweden)

    Abhijit Sarkar

    Full Text Available BACKGROUND: The model endophyte Azoarcus sp. strain BH72 is known to contribute fixed nitrogen to its host Kallar grass and also expresses nitrogenase genes endophytically in rice seedlings. Availability of nitrogen is a signal regulating the transcription of nitrogenase genes. Therefore, we analysed global transcription in response to differences in the nitrogen source. METHODOLOGY/PRINCIPAL FINDINGS: A DNA microarray, comprising 70-mer oligonucleotides representing 3989 open reading frames of the genome of strain BH72, was used for transcriptome studies. Transcription profiles of cells grown microaerobically on N2 versus ammonium were compared. Expression of 7.2% of the genes was significantly up-regulated, and 5.8% down-regulated upon N2 fixation, respectively. A parallel genome-wide prediction of σ(54-type promoter elements mapped to the upstream region of 38 sequences of which 36 were modulated under the N2 response. In addition to modulation of genes related to N2 fixation, the expressions of gene clusters that might be related to plant-microbe interaction and of several transcription factors were significantly enhanced. While comparing under N2-fixation conditions the transcriptome of wild type with a nifLA(- insertion mutant, NifA being the essential transcriptional activator for nif genes, 24.5% of the genome was found to be affected in expression. A genome-wide prediction of 29 NifA binding sequences matched to 25 of the target genes whose expression was differential during microarray analysis, some of which were putatively negatively regulated by NifA. For selected genes, differential expression was corroborated by real time RT-PCR studies. CONCLUSION/SIGNIFICANCE: Our data suggest that life under conditions of nitrogen fixation is an important part of the lifestyle of strain BH72 in roots, as a wide range of genes far beyond the nif regulon is modulated. Moreover, the NifA regulon in strain BH72 appears to encompass a wider range of

  8. ORF Alignment: NC_006513 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available [Azoarcus sp. EbN1] emb|CAI06629.1| nudix hydrolase ... [Azoarcus sp. EbN1] ... Length = 151 ... Query: 5 ... EGYRPNVGIILVNT...RNEVFWGKRIREHSWQFPQGGIKHGESPEQAMFRELFEEVGLRPEH 64 ... EGYRPNVGIILVNTRNEVFWGK...RIREHSWQFPQGGIKHGESPEQAMFRELFEEVGLRPEH Sbjct: 1 ... EGYRPNVGIILVNTRNEVFWGKRIREHSWQF

  9. Metagenomic Analysis of Hot Springs in Central India Reveals Hydrocarbon Degrading Thermophiles and Pathways Essential for Survival in Extreme Environments

    Science.gov (United States)

    Saxena, Rituja; Dhakan, Darshan B.; Mittal, Parul; Waiker, Prashant; Chowdhury, Anirban; Ghatak, Arundhuti; Sharma, Vineet K.

    2017-01-01

    Extreme ecosystems such as hot springs are of great interest as a source of novel extremophilic species, enzymes, metabolic functions for survival and biotechnological products. India harbors hundreds of hot springs, the majority of which are not yet explored and require comprehensive studies to unravel their unknown and untapped phylogenetic and functional diversity. The aim of this study was to perform a large-scale metagenomic analysis of three major hot springs located in central India namely, Badi Anhoni, Chhoti Anhoni, and Tattapani at two geographically distinct regions (Anhoni and Tattapani), to uncover the resident microbial community and their metabolic traits. Samples were collected from seven distinct sites of the three hot spring locations with temperature ranging from 43.5 to 98°C. The 16S rRNA gene amplicon sequencing of V3 hypervariable region and shotgun metagenome sequencing uncovered a unique taxonomic and metabolic diversity of the resident thermophilic microbial community in these hot springs. Genes associated with hydrocarbon degradation pathways, such as benzoate, xylene, toluene, and benzene were observed to be abundant in the Anhoni hot springs (43.5–55°C), dominated by Pseudomonas stutzeri and Acidovorax sp., suggesting the presence of chemoorganotrophic thermophilic community with the ability to utilize complex hydrocarbons as a source of energy. A high abundance of genes belonging to methane metabolism pathway was observed at Chhoti Anhoni hot spring, where methane is reported to constitute >80% of all the emitted gases, which was marked by the high abundance of Methylococcus capsulatus. The Tattapani hot spring, with a high-temperature range (61.5–98°C), displayed a lower microbial diversity and was primarily dominated by a nitrate-reducing archaeal species Pyrobaculum aerophilum. A higher abundance of cell metabolism pathways essential for the microbial survival in extreme conditions was observed at Tattapani. Taken together

  10. Biodegradation of polycyclic aromatic hydrocarbons: Using microbial bioelectrochemical systems to overcome an impasse.

    Science.gov (United States)

    Kronenberg, Maria; Trably, Eric; Bernet, Nicolas; Patureau, Dominique

    2017-12-01

    Polycyclic aromatic hydrocarbons (PAHs) are hardly biodegradable carcinogenic organic compounds. Bioremediation is a commonly used method for treating PAH contaminated environments such as soils, sediment, water bodies and wastewater. However, bioremediation has various drawbacks including the low abundance, diversity and activity of indigenous hydrocarbon degrading bacteria, their slow growth rates and especially a limited bioavailability of PAHs in the aqueous phase. Addition of nutrients, electron acceptors or co-substrates to enhance indigenous microbial activity is costly and added chemicals often diffuse away from the target compound, thus pointing out an impasse for the bioremediation of PAHs. A promising solution is the adoption of bioelectrochemical systems. They guarantee a permanent electron supply and withdrawal for microorganisms, thereby circumventing the traditional shortcomings of bioremediation. These systems combine biological treatment with electrochemical oxidation/reduction by supplying an anode and a cathode that serve as an electron exchange facility for the biocatalyst. Here, recent achievements in polycyclic aromatic hydrocarbon removal using bioelectrochemical systems have been reviewed. This also concerns PAH precursors: total petroleum hydrocarbons and diesel. Removal performances of PAH biodegradation in bioelectrochemical systems are discussed, focussing on configurational parameters such as anode and cathode designs as well as environmental parameters like porosity, salinity, adsorption and conductivity of soil and sediment that affect PAH biodegradation in BESs. The still scarcely available information on microbiological aspects of bioelectrochemical PAH removal is summarised here. This comprehensive review offers a better understanding of the parameters that affect the removal of PAHs within bioelectrochemical systems. In addition, future experimental setups are proposed in order to study syntrophic relationships between PAH

  11. Biodegradation of degradable plastic polyethylene by phanerochaete and streptomyces species.

    Science.gov (United States)

    Lee, B; Pometto, A L; Fratzke, A; Bailey, T B

    1991-03-01

    The ability of lignin-degrading microorganisms to attack degradable plastics was investigated in pure shake flask culture studies. The degradable plastic used in this study was produced commercially by using the Archer-Daniels-Midland POLYCLEAN masterbatch and contained pro-oxidant and 6% starch. The known lignin-degrading bacteria Streptomyces viridosporus T7A, S. badius 252, and S. setonii 75Vi2 and fungus Phanerochaete chrysosporium were used. Pro-oxidant activity was accelerated by placing a sheet of plastic into a drying oven at 70 degrees C under atmospheric pressure and air for 0, 4, 8, 12, 16, or 20 days. The effect of 2-, 4-, and 8-week longwave UV irradiation at 365 nm on plastic biodegradability was also investigated. For shake flask cultures, plastics were chemically disinfected and incubated-shaken at 125 rpm at 37 degrees C in 0.6% yeast extract medium (pH 7.1) for Streptomyces spp. and at 30 degrees C for the fungus in 3% malt extract medium (pH 4.5) for 4 weeks along with an uninoculated control for each treatment. Weight loss data were inconclusive because of cell mass accumulation. For almost every 70 degrees C heat-treated film, the Streptomyces spp. demonstrated a further reduction in percent elongation and polyethylene molecular weight average when compared with the corresponding uninoculated control. Significant (P < 0.05) reductions were demonstrated for the 4- and 8-day heat-treated films by all three bacteria. Heat-treated films incubated with P. chrysosporium consistently demonstrated higher percent elongation and molecular weight average than the corresponding uninoculated controls, but were lower than the corresponding zero controls (heat-treated films without 4-week incubation). The 2- and 4-week UV-treated films showed the greatest biodegradation by all three bacteria. Virtually no degradation by the fungus was observed. To our knowledge, this is the first report demonstrating bacterial degradation of these oxidized polyethylenes in

  12. Ectomycorrhizas impede phytoremediation of polycyclic aromatic hydrocarbons (PAHs) both within and beyond the rhizosphere

    Energy Technology Data Exchange (ETDEWEB)

    Joner, Erik J. [Laboratoire des Interactions Microorganismes-Mineraux-Matiere Organique dans les Sols (LIMOS), Universite H. Poincare Nancy 1, P.O. Box 239, F-54506 Vandoeuvre-les-Nancy (France)]. E-mail: erik.joner@jordforsk.no; Leyval, Corinne [Laboratoire des Interactions Microorganismes-Mineraux-Matiere Organique dans les Sols (LIMOS), Universite H. Poincare Nancy 1, P.O. Box 239, F-54506 Vandoeuvre-les-Nancy (France); Colpaert, Jan V. [Centre for Environmental Sciences, Environmental Biology Group, Hasselt University, Agoralaan, Gebouw D, B-3590 Diepenbeek (Belgium)

    2006-07-15

    Exploitation of mycorrhizas to enhance phytoremediation of organic pollutants has received attention recently due to their positive effects on establishment of plants in polluted soils. Some evidence exist that ectomycorrhizas enhance the degradation of pollutants of low recalcitrance, while less easily degradable polyaromatic molecules have been degraded only by some of these fungi in vitro. Natural polyaromatic (humic) substances are degraded more slowly in soil where ectomycorrhizal fungi are present, thus phytoremediation of recalcitrant pollutants may not benefit from the presence of these fungi. Using a soil spiked with three polycyclic aromatic hydrocarbons (PAHs) and an industrially polluted soil (1 g kg{sup -1} of {sigma}12 PAHs), we show that the ectomycorrhizal fungus Suillus bovinus, forming hydrophobic mycelium in soil that would easily enter into contact with hydrophobic pollutants, impedes rather than promotes PAH degradation. This result is likely to be a nutrient depletion effect caused by fungal scavenging of mineral nutrients. - The ectomycorrhizal fungus S. bovinus impeded degradation of PAHs in soil, probably due to its negative effect on the availability of mineral nutrients of more potent PAH degraders.

  13. Ectomycorrhizas impede phytoremediation of polycyclic aromatic hydrocarbons (PAHs) both within and beyond the rhizosphere

    International Nuclear Information System (INIS)

    Joner, Erik J.; Leyval, Corinne; Colpaert, Jan V.

    2006-01-01

    Exploitation of mycorrhizas to enhance phytoremediation of organic pollutants has received attention recently due to their positive effects on establishment of plants in polluted soils. Some evidence exist that ectomycorrhizas enhance the degradation of pollutants of low recalcitrance, while less easily degradable polyaromatic molecules have been degraded only by some of these fungi in vitro. Natural polyaromatic (humic) substances are degraded more slowly in soil where ectomycorrhizal fungi are present, thus phytoremediation of recalcitrant pollutants may not benefit from the presence of these fungi. Using a soil spiked with three polycyclic aromatic hydrocarbons (PAHs) and an industrially polluted soil (1 g kg -1 of Σ12 PAHs), we show that the ectomycorrhizal fungus Suillus bovinus, forming hydrophobic mycelium in soil that would easily enter into contact with hydrophobic pollutants, impedes rather than promotes PAH degradation. This result is likely to be a nutrient depletion effect caused by fungal scavenging of mineral nutrients. - The ectomycorrhizal fungus S. bovinus impeded degradation of PAHs in soil, probably due to its negative effect on the availability of mineral nutrients of more potent PAH degraders

  14. Molecular characterization of the presence of Eubacterium spp and Streptococcus spp in endodontic infections.

    Science.gov (United States)

    Fouad, A F; Kum, K-Y; Clawson, M L; Barry, J; Abenoja, C; Zhu, Q; Caimano, M; Radolf, J D

    2003-08-01

    Eubacterium spp. and Streptococcus spp. are virulent, commonly identified microorganisms in endodontic infections. The purpose of this study was to use molecular methods to identify these organisms in 22 infected root canals that include eight cases with preoperative clinical symptoms and five cases with a history of diabetes mellitus. The presence of Streptococcus spp. and Eubacterium spp. was examined using two sets of PCR primers specific with multiple species within the respective genera. Positive specimens had their PCR products sequenced and phylogenetically analyzed to identify the specific species. Sixteen specimens (73%) contained Eubacterium spp. and nine (41%) were positive for Streptococcus spp. Eubacterium infirmum was the most prevalent Eubacterium sp. This organism was significantly associated with a history of diabetes (OR = 9.6; P = 0.04). Streptococcus anginosus was the most common Streptococcus sp., but neither it nor any of the other streptococci were significantly associated with the clinical parameters evaluated.

  15. Enhancement of pyrene degradation efficacy of Synechocystis sp., by construction of an artificial microalgal-bacterial consortium

    Directory of Open Access Journals (Sweden)

    Jignasa G. Patel

    2015-12-01

    Full Text Available This study was carried out to investigate the ability of microalgae Synechocystis sp. to high molecular weight Polycyclic Aromatic Hydrocarbon pyrene (PYR and artificial microalgal–bacterial consortium at different concentrations. The consortium consisted of one axenic species Synechocystis sp. and two PYR-degrading bacteria with known complementary degradative capabilities viz. Pseudomonas sp. and Bacillus sp. The influence of PYR on growth in terms of chlorophyll-a were analysed, and it was found that in the presence of bacteria, Synechocystis sp. tremendously increased in growth as well as biodegradation capability, whereas Synechocystis sp. alone exhibited concentration-dependent decrease in growth and biodegradation ability. Degradation of PYR shows that the consortium could eliminate PYR by 94.1% at 50 mg/L; however, Synechocystis sp alone could degrade up to 36% at 1.5 mg/L after 16 days of incubation. The study revealed that microalgae grew better in the presence of the aerobic heterotrophic bacteria and provided them with necessary organics for efficient PYR degradation activities. Moreover, consortium JP-NKA7B2 grows efficiently on other xenobiotic compounds. The artificial consortia JP-NK is thus proven to be an effective and promising system for bioremediating PYR compound and could be suggested in degradation of PYR compound in hydrocarbon-polluted areas in situ and ex situ.

  16. Visualizing and Quantifying Bioaccessible Pores in Field-Aged Petroleum Hydrocarbon-Contaminated Clay Soils Using Synchrotron-based X-ray Computed Tomography

    Science.gov (United States)

    Chang, W.; Kim, J.; Zhu, N.; McBeth, J. M.

    2015-12-01

    Microbial hydrocarbon degradation is environmentally significant and applicable to contaminated site remediation practices only when hydrocarbons (substrates) are physically bioaccessible to bacteria in soil matrices. Powerful X-rays are produced by synchrotron radiation, allowing for bioaccessible pores in soil (larger than 4 microns), where bacteria can be accommodated, colonize and remain active, can be visualized at a much higher resolution. This study visualized and quantified such bioaccessible pores in intact field-aged, oil-contaminated unsaturated soil fractions, and examined the relationship between the abundance of bioaccessible pores and hydrocarbon biodegradation. Using synchrotron-based X-ray Computed Tomography (CT) at the Canadian Light Source, a large dataset of soil particle characteristics, such as pore volumes, surface areas, number of pores and pore size distribution, was generated. Duplicate samples of five different soil fractions with different soil aggregate sizes and water contents (13, 18 and 25%) were examined. The method for calculating the number and distribution of bioaccessible pores using CT images was validated using the known porosity of Ottawa sand. This study indicated that the distribution of bioaccessible pore sizes in soil fractions are very closely related to microbial enhancement. A follow-up aerobic biodegradation experiment for the soils at 17 °C (average site temperature) over 90 days confirmed that a notable decrease in hydrocarbon concentrations occurred in soils fractions with abundant bioaccessible pores and with a larger number of pores between 10 and 100 μm. The hydrocarbon degradation in bioactive soil fractions was extended to relatively high-molecular-weight hydrocarbons (C16-C34). This study provides quantitative information about how internal soil pore characteristics can influence bioremediation performance.

  17. Paraburkholderia aromaticivorans sp. nov., an aromatic hydrocarbon-degrading bacterium, isolated from gasoline-contaminated soil.

    Science.gov (United States)

    Lee, Yunho; Jeon, Che Ok

    2018-04-01

    A Gram-stain-negative, facultatively aerobic, aromatic hydrocarbon-degrading bacterium, designated strain BN5 T , was isolated from gasoline-contaminated soil. Cells were motile and slightly curved rods with a single flagellum showing catalase and oxidase activities. Growth was observed at 20-37 °C (optimum, 25-30 °C), pH 3-7 (optimum, pH 5-6) and 0-2 % NaCl (optimum, 0 %). Ubiquinone-8 was the predominant respiratory quinone. The major fatty acids were C16 : 0, cyclo-C19 : 0ω8c and summed feature 8 (comprising C18 : 1ω7c and/or C18 : 1ω6c). Diphosphatidylglycerol, phosphatidylglycerol, phosphatidylethanolamine, an unidentified phosphoamino lipid, three unidentified amino lipids and eight unidentified lipids were the identified polar lipids. The DNA G+C content was 62.93 mol%. Phylogenetic analysis based on 16S rRNA gene sequences revealed that strain BN5 T formed a phylogenic lineage with members of the genus Paraburkholderia and showed the highest 16S rRNA gene sequence similarities to Paraburkholderia phytofirmans PsJN T (99.4 %), Paraburkholderia dipogonis DL7 T (98.8 %) and Paraburkholderia insulsa PNG-April T (98.8 %). The average nucleotide identity and in silico DNA-DNA hybridization (DDH) values between strain BN5 T and P. phytofirmans PsJN T were 88.5 and 36.5 %, respectively. The DDH values for strain BN5 T with P. dipogonis LMG 28415 T and P. insulsa DSM 28142 T were 41.0±4.9 % (reciprocal, 33.0±4.3 %) and 47.1±6.6 % (reciprocal, 51.7±5.4 %), respectively. Based on its physiological, chemotaxonomic and phylogenetic features, we conclude that strain BN5 T is a novel species of the genus Paraburkholderia, for which the name Paraburkholderia aromaticivorans sp. nov. is proposed. The type strain is BN5 T (=KACC 19419 T =JCM 32303 T ).

  18. Biochemical ripening of dredged sediments. Part 2. Degradation of polycyclic aromatic hydrocarbons and total petroleum hydorcarbons in slurried and consolidated sediments

    NARCIS (Netherlands)

    Vermeulen, J.; Gool, van M.P.M.; Mentink, G.H.; Joziasse, J.; Bruning, H.; Grotenhuis, J.T.C.

    2007-01-01

    Ripening of polycyclic aromatic hydrocarbons (PAH) and total petroleum hydrocarbons (TPH) polluted dredged sediment can be considered as a bioremediation technique. Aerobic biodegradation of PAH and TPH was studied in five previously anaerobic-slurried sediments during a 350-d laboratory incubation

  19. Biosynthesis of Tropolones in Streptomyces spp: Interweaving Biosynthesis and Degradation of Phenylacetic Acid and Hydroxylations on Tropone Ring.

    Science.gov (United States)

    Chen, Xuefei; Xu, Min; Lü, Jin; Xu, Jianguo; Wang, Yemin; Lin, Shuangjun; Deng, Zixin; Tao, Meifeng

    2018-04-13

    Tropolonoids are important natural products that contain a unique seven-membered aromatic tropolone core and exhibit remarkable biological activities. 3,7-Dihydroxytropolone (DHT) isolated from Streptomyces species is a multiply hydroxylated tropolone exhibiting antimicrobial, anticancer, and antiviral activities. Herein, we determined the DHT biosynthetic pathway by heterologous expression, gene deletion, and bioconversion. Nine trl genes and some of the aerobic phenylacetic acid degradation pathway genes ( paa ) located outside of the trl biosynthetic gene cluster are required for the heterologous production of DHT. The trlA gene encodes a single-domain protein homologous to the C-terminal enoyl-CoA hydratase domain of PaaZ. TrlA truncates the phenylacetic acid catabolic pathway and redirects it towards the formation of heptacyclic intermediates. TrlB is a 3-deoxy-D-arabino-heptulosonic acid-7-phosphate (DAHP) synthase homolog. TrlH is an unusual bifunctional protein bearing an N-terminal prephenate dehydratase domain and a C-terminal chorismate mutase domain. TrlB and TrlH enhanced de novo biosynthesis of phenylpyruvate, thereby providing abundant precursor for the prolific production of DHT in Streptomyces Six seven-membered carbocyclic compounds were identified from the gene deletion mutants of trlC , trlD , trlE , and trlF Four of these chemicals, including 1,4,6-cycloheptatriene-1-carboxylic acid, tropone, tropolone and 7-hydroxytropolone, were verified as key biosynthetic intermediates. TrlF is required for the conversion of 1,4,6-cycloheptatriene-1-carboxylic acid into tropone. Monooxygenases TrlE and TrlCD catalyze the regioselective hydroxylations of tropone to afford DHT. This study reveals a natural association of anabolism of chorismate and phenylpyruvate, catabolism of phenylacetic acid, and biosynthesis of tropolones in Streptomyces spp. IMPORTANCE Tropolonoids are promising drug lead compounds because of their versatile bioactivities attributed to

  20. Improvement of phytoremediation of an aged petroleum hydrocarbon-contaminated soil by Rhodococcus erythropolis CD 106 strain.

    Science.gov (United States)

    Płociniczak, Tomasz; Fic, Ewa; Pacwa-Płociniczak, Magdalena; Pawlik, Małgorzata; Piotrowska-Seget, Zofia

    2017-07-03

    The aim of this study was to assess the impact of soil inoculation with the Rhodococcus erythropolis CD 106 strain on the effectiveness of the phytoremediation of an aged hydrocarbon-contaminated [approx. 1% total petroleum hydrocarbon (TPH)] soil using ryegrass (Lolium perenne). The introduction of CD 106 into the soil significantly increased the biomass of ryegrass and the removal of hydrocarbons in planted soil. The fresh weight of the shoots and roots of plants inoculated with CD 106 increased by 49% and 30%, respectively. After 210 days of the experiment, the concentration of TPH was reduced by 31.2%, whereas in the planted, non-inoculated soil, it was reduced by 16.8%. By contrast, the concentration of petroleum hydrocarbon decreased by 18.7% in non-planted soil bioaugmented with the CD 106 strain. The rifampicin-resistant CD 106 strain survived after inoculation into soil and was detected in the soil during the entire experimental period, but the number of CD 106 cells decreased constantly during the enhanced phytoremediation and bioaugmentation experiments. The plant growth-promoting and hydrocarbon-degrading properties of CD 106, which are connected with its long-term survival and limited impact on autochthonous microflora, make this strain a good candidate for improving the phytoremediation efficiency of soil contaminated with hydrocarbons.

  1. Photocatalytic oxidation of polycyclic aromatic hydrocarbons: Intermediates identification and toxicity testing

    International Nuclear Information System (INIS)

    Woo, O.T.; Chung, W.K.; Wong, K.H.; Chow, Alex T.; Wong, P.K.

    2009-01-01

    Polycyclic aromatic hydrocarbons (PAHs) are hydrophobic pollutants and their low water solubility limits their degradation in aqueous solution. The presence of water-miscible solvent such as acetone can increase the water solubility of PAHs, however acetone will also affect the degradation of PAH. In this study the effects of acetone on the photocatalytic degradation efficiency and pathways of 5 selected PAHs, namely naphthalene (2 rings), acenaphthylene (3 rings), phenanthrene (3 rings), anthracene (3 rings) and benzo[a]anthracene (4 rings) were investigated. The Microtox toxicity test was used to determine whether the PCO system can completely detoxify the parental PAHs and its intermediates. The addition of 16% acetone can greatly alter the degradation pathway of naphthalene and anthracene. Based on intermediates identified from degradation of the 5 PAHs, the location of parental PAHs attacked by reactive free radicals can be correlated with the localization energies of different positions of the compound. For toxicity analysis, irradiation by UV light was found to induce acute toxicity by generating intermediates/degradation products from PAHs and possibly acetone. Lastly, all PAHs (10 mg l -1 ) can be completely detoxified by titanium dioxide (100 mg l -1 ) within 24 h under UVA irradiation (3.9 mW cm -2 ).

  2. Bioelectrochemical BTEX removal at different voltages: assessment of the degradation and characterization of the microbial communities.

    Science.gov (United States)

    Daghio, Matteo; Espinoza Tofalos, Anna; Leoni, Barbara; Cristiani, Pierangela; Papacchini, Maddalena; Jalilnejad, Elham; Bestetti, Giuseppina; Franzetti, Andrea

    2018-01-05

    BTEX compounds (Benzene, Toluene, Ethylbenzene and Xylenes) are toxic hydrocarbons that can be found in groundwater due to accidental spills. Bioelectrochemical systems (BES) are an innovative technology to stimulate the anaerobic degradation of hydrocarbons. In this work, single chamber BESs were used to assess the degradation of a BTEX mixture at different applied voltages (0.8V, 1.0V, 1.2V) between the electrodes. Hydrocarbon degradation was linked to current production and to sulfate reduction, at all the tested potentials. The highest current densities (about 200mA/m 2 with a maximum peak at 480mA/m 2 ) were observed when 0.8V were applied. The application of an external voltage increased the removal of toluene, m-xylene and p-xylene. The highest removal rate constants at 0.8V were: 0.4±0.1days -1 , 0.34±0.09days -1 and 0.16±0.02days -1 , respectively. At the end of the experiment, the microbial communities were characterized by high throughput sequencing of the 16S rRNA gene. Microorganisms belonging to the families Desulfobulbaceae, Desulfuromonadaceae and Geobacteraceae were enriched on the anodes suggesting that both direct electron transfer and sulfur cycling occurred. The cathodic communities were dominated by the family Desulfomicrobiaceae that may be involved in hydrogen production. Copyright © 2017 Elsevier B.V. All rights reserved.

  3. Naphthalene degradation by bacterial consortium (DV-AL) developed from Alang-Sosiya ship breaking yard, Gujarat, India.

    Science.gov (United States)

    Patel, Vilas; Jain, Siddharth; Madamwar, Datta

    2012-03-01

    Naphthalene degrading bacterial consortium (DV-AL) was developed by enrichment culture technique from sediment collected from the Alang-Sosiya ship breaking yard, Gujarat, India. The 16S rRNA gene based molecular analyzes revealed that the bacterial consortium (DV-AL) consisted of four strains namely, Achromobacter sp. BAB239, Pseudomonas sp. DV-AL2, Enterobacter sp. BAB240 and Pseudomonas sp. BAB241. Consortium DV-AL was able to degrade 1000 ppm of naphthalene in Bushnell Haas medium (BHM) containing peptone (0.1%) as co-substrate with an initial pH of 8.0 at 37°C under shaking conditions (150 rpm) within 24h. Maximum growth rate and naphthalene degradation rate were found to be 0.0389 h(-1) and 80 mg h(-1), respectively. Consortium DV-AL was able to utilize other aromatic and aliphatic hydrocarbons such as benzene, phenol, carbazole, petroleum oil, diesel fuel, and phenanthrene and 2-methyl naphthalene as sole carbon source. Consortium DV-AL was also efficient to degrade naphthalene in the presence of other pollutants such as petroleum hydrocarbons and heavy metals. Copyright © 2011 Elsevier Ltd. All rights reserved.

  4. Accelerated methanogenesis from aliphatic and aromatic hydrocarbons under iron- and sulfate-reducing conditions.

    Science.gov (United States)

    Siegert, Michael; Cichocka, Danuta; Herrmann, Steffi; Gründger, Friederike; Feisthauer, Stefan; Richnow, Hans-Hermann; Springael, Dirk; Krüger, Martin

    2011-02-01

    The impact of four electron acceptors on hydrocarbon-induced methanogenesis was studied. Methanogenesis from residual hydrocarbons may enhance the exploitation of oil reservoirs and may improve bioremediation. The conditions to drive the rate-limiting first hydrocarbon-oxidizing steps for the conversion of hydrocarbons into methanogenic substrates are crucial. Thus, the electron acceptors ferrihydrite, manganese dioxide, nitrate or sulfate were added to sediment microcosms acquired from two brackish water locations. Hexadecane, ethylbenzene or 1-(13)C-naphthalene were used as model hydrocarbons. Methane was released most rapidly from incubations amended with ferrihydrite and hexadecane. Ferrihydrite enhanced only hexadecane-dependent methanogenesis. The rates of methanogenesis were negatively affected by sulfate and nitrate at concentrations of more than 5 and 1 mM, respectively. Metal-reducing Geobacteraceae and potential sulfate reducers as well as Methanosarcina were present in situ and in vitro. Ferrihydrite addition triggered the growth of Methanosarcina-related methanogens. Additionally, methane was removed concomitantly by anaerobic methanotrophy. ANME-1 and -2 methyl coenzyme M reductase genes were detected, indicating anaerobic methanotrophy as an accompanying process [Correction added 16 December after online publication: 'methyl coenzyme A' changed to 'methyl coenzyme M' in this sentence]. The experiments presented here demonstrate the feasibility of enhancing methanogenic alkane degradation by ferrihydrite or sulfate addition in different geological settings. © 2010 Federation of European Microbiological Societies. Published by Blackwell Publishing Ltd. All rights reserved.

  5. Response of microbial community and catabolic genes to simulated petroleum hydrocarbon spills in soils/sediments from different geographic locations.

    Science.gov (United States)

    Liu, Q; Tang, J; Liu, X; Song, B; Zhen, M; Ashbolt, N J

    2017-10-01

    Study the response of microbial communities and selected petroleum hydrocarbon (PH)-degrading genes on simulated PH spills in soils/sediments from different geographic locations. A microcosm experiment was conducted by spiking mixtures of petroleum hydrocarbons (PHs) to soils/sediments collected from four different regions of China, including the Dagang Oilfield (DG), Sand of Bohai Sea (SS), Northeast China (NE) and Xiamen (XM). Changes in bacterial community and the abundance of PH-degrading genes (alkB, nah and phe) were analysed by denaturing gradient electrophoresis (DGGE) and qPCR, respectively. Degradation of alkanes and PAHs in SS and NE materials were greater (P < 0·05) than those in DG and XM. Clay content was negatively correlated with the degradation of total alkanes by 112 days and PAHs by 56 days, while total organic carbon content was negatively correlated with initial degradation of total alkanes as well as PAHs. Abundances of alkB, nah and phe genes increased 10- to 100-fold and varied by soil type over the incubation period. DGGE fingerprints identified the dominance of α-, β- and γ-Proteobacteria (Gram -ve) and Actinobacteria (Gram +ve) bacteria associated with degradation of PHs in the materials studied. The geographic divergence resulting from the heterogeneity of physicochemical properties of soils/sediments appeared to influence the abundance of metabolic genes and community structure of microbes capable of degrading PHs. When developing practical in-situ bioremediation approaches for PHs contamination of soils/sediment, appropriate microbial community structures and the abundance of PH-degrading genes appear to be influenced by geographic location. © 2017 The Society for Applied Microbiology.

  6. ORF Alignment: NC_002516 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1

  7. ORF Alignment: NC_002695 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1

  8. ORF Alignment: NC_004337 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1

  9. ORF Alignment: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1

  10. ORF Alignment: NC_002947 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1

  11. ORF Alignment: NC_006513 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1

  12. ORF Alignment: NC_004578 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1

  13. ORF Alignment: NC_005966 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1

  14. ORF Alignment: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1

  15. ORF Alignment: NC_006085 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1

  16. ORF Alignment: NC_003197 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1

  17. ORF Alignment: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1

  18. ORF Alignment: NC_004431 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1

  19. ORF Alignment: NC_004741 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1

  20. ORF Alignment: NC_006511 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1