The interaction of extreme waves with hull elements
Galiev, Shamil; Flay, Richard
2010-05-01
The problem of the impact of a rogue wave onto a deformable marine structure is formulated in a few publications (see, for example, a short review in http://researchspace.auckland.ac.nz/handle/2292/4474). In this paper the results from numerical and experimental investigations of the effect of cavitation on the deformation of a hull element, loaded by a wall of water, generated by an extreme ocean surface wave are considered. The hull element is modelled as a circular metal plate with the edge of the plate rigidly clamped. The plate surface is much smaller than the surface of the wave front, so that at the initial moment of the interaction, the pressure is constant on the plate surface. At the next instant, because of the plate deformation, axisymmetric loading of the plate occurs. The influences of membrane forces and plastic deformations are ignored, and therefore, the equation of plate motion has the following classical form Eh3(wrrrr+2r -1wrrrr- r-2wrr+r-3wr) = - 121- ν2)[ρhwtt+ δ(r,t)(p+ ρ0a0wt)]. Here w is the plate displacement, subscripts t and rindicate derivatives with respect to time and the radial coordinate, PIC is the plate material density, his the plate thickness, Eis Young's modulus, PIC is Poisson's ratio and p is the pressure of the incident surface wave measured on the wall, PIC is the water density, PIC is the speed of sound in water, and PIC is the normal velocity of the plate. The term PIC takes into account the effect of the deformability of the plate. Obviously, the hull of a vessel is not rigid like a solid wall, but starts to deform and to move. This motion produces a reflected pressure wave, which travels from the hull into the water wave with a magnitude equal to PIC . The normal velocity is positive so the reflected pressure PIC is negative (tensile wave). If the fluid pressure drops below some critical value pk, the wet plate surface separates from the water, and cavitation may be generated. The function δ(r,t) takes into account
46 CFR 154.174 - Transverse contiguous hull structure.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Transverse contiguous hull structure. 154.174 Section... Equipment Hull Structure § 154.174 Transverse contiguous hull structure. (a) The transverse contiguous hull...) The transverse contiguous hull structure of a vessel having cargo containment systems with secondary...
46 CFR 154.176 - Longitudinal contiguous hull structure.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Longitudinal contiguous hull structure. 154.176 Section... Equipment Hull Structure § 154.176 Longitudinal contiguous hull structure. (a) The longitudinal contiguous hull structure of a vessel having cargo containment systems without secondary barriers must meet the...
46 CFR 154.178 - Contiguous hull structure: Heating system.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Contiguous hull structure: Heating system. 154.178... Equipment Hull Structure § 154.178 Contiguous hull structure: Heating system. The heating system for transverse and longitudinal contiguous hull structure must: (a) Be shown by a heat load calculation to have...
46 CFR 154.180 - Contiguous hull structure: Welding procedure.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Contiguous hull structure: Welding procedure. 154.180... Equipment Hull Structure § 154.180 Contiguous hull structure: Welding procedure. Welding procedure tests for contiguous hull structure designed for a temperature colder than −18 °C (0 °F) must meet § 54.05-15 and...
46 CFR 154.172 - Contiguous steel hull structure.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Contiguous steel hull structure. 154.172 Section 154.172... STANDARDS FOR SELF-PROPELLED VESSELS CARRYING BULK LIQUEFIED GASES Design, Construction and Equipment Hull Structure § 154.172 Contiguous steel hull structure. (a) Except as allowed in paragraphs (b) and (c) of this...
46 CFR 154.182 - Contiguous hull structure: Production weld test.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Contiguous hull structure: Production weld test. 154.182... Equipment Hull Structure § 154.182 Contiguous hull structure: Production weld test. If a portion of the contiguous hull structure is designed for a temperature colder than −34 °C (−30 °F) and is not part of the...
National Research Council Canada - National Science Library
Jones, Harry D; Gerzina, David M
1973-01-01
... small waterplane area, twin-hulled, attack aircraft carrier in waves. Motions of the model were measured, together with the forces and moments induced by the hulls on the cross structure spanning the two hulls...
46 CFR 32.63-20 - Hull structure-B/ALL.
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Hull structure-B/ALL. 32.63-20 Section 32.63-20 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY TANK VESSELS SPECIAL EQUIPMENT, MACHINERY, AND HULL REQUIREMENTS Hull and Cargo Tank Requirements for Tank Barges Constructed or Converted On or After July 1, 1964...
46 CFR 108.133 - Hull superstructure, structural bulkheads, decks, and deckhouses.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Hull superstructure, structural bulkheads, decks, and deckhouses. 108.133 Section 108.133 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A... Protection § 108.133 Hull superstructure, structural bulkheads, decks, and deckhouses. Each hull...
On Rational Design of Double Hull Tanker Structures against Collision
DEFF Research Database (Denmark)
Paik, Jeom Kee; Chung, Jang Young; Choe, Ich Hung
1999-01-01
This paper is a summary of recent research and development in areas related to the design technology for double hull tanker structures against low energy collision, jointly undertaken by the Hyundai Heavy Industries, the American Bureau of Shipping, the Technical University of Denmark and the Pusan...... in the present study were (i) developing a framework for the collision design procedure for double hull tanker structures, (ii) experimental investigation of the structural crashworthiness of the collided vessels in collision or stranding, using double skinned structural models, (iii) validation of the special...... investigation of the energy absorption capability characteristics of a collided double hull VLCC side structure in collision, and (vi) development of a new modified Minorsky method for double hull tanker side structures. The tools developed and the results and insights obtained by the present study should...
Diatom community structure on in-service cruise ship hulls.
Hunsucker, Kelli Zargiel; Koka, Abhishek; Lund, Geir; Swain, Geoffrey
2014-10-01
Diatoms are an important component of marine biofilms found on ship hulls. However, there are only a few published studies that describe the presence and abundance of diatoms on ships, and none that relate to modern ship hull coatings. This study investigated the diatom community structure on two in-service cruise ships with the same cruise cycles, one coated with an antifouling (AF) system (copper self-polishing copolymer) and the other coated with a silicone fouling-release (FR) system. Biofilm samples were collected during dry docking from representative areas of the ship and these provided information on the horizontal and vertical zonation of the hull, and intact and damaged coating and niche areas. Diatoms from the genera Achnanthes, Amphora and Navicula were the most common, regardless of horizontal ship zonation and coating type. Other genera were abundant, but their presence was more dependent on the ship zonation and coating type. Samples collected from damaged areas of the hull coating had a similar community composition to undamaged areas, but with higher diatom abundance. Diatom fouling on the niche areas differed from that of the surrounding ship hull and paralleled previous studies that investigated differences in diatom community structure on static and dynamically exposed coatings; niche areas were similar to static immersion and the hull to dynamic immersion. Additionally, diatom richness was greater on the ship with the FR coating, including the identification of several new genera to the biofouling literature, viz. Lampriscus and Thalassiophysa. These results are the first to describe diatom community composition on in-service ship hulls coated with a FR system. This class of coatings appears to have a larger diatom community compared to copper-based AF systems, with new diatom genera that have the ability to stick to ship hulls and withstand hydrodynamic forces, thus creating the potential for new problematic species in the biofilm.
Preparation and characterization of rice hull silica products
International Nuclear Information System (INIS)
Quirit, Leni L.; Llaguno, Elma C.; Pagdanganan, Fernando C.; Hernandez, Karen N.
2008-01-01
Rice hull is an abundant agricultural waste material which could be a renewable energy source when combusted. The combustion residue (called rice hull ash or RHA) contains a significant amount (20% of the hull) of potentially high grade silica. Silica gels prepared from rice hull were found to have properties comparable to two commercial desiccant silica gels (Blue Merck and FNG-A) in terms of chemical and amorphous structure, surface area, desiccant characteristics, microstructure and heats of adsorption. These properties were determined from water vapor adsorption measurements, electron microscopy, and from infrared and x-ray diffraction spectra. The acid treated rice hull gels were found to have fewer elemental impurities detected by qualitative x-ray fluorescence, compared to the commercial gels. Thermogravimetric analysis (TGA) data showed that this technique can also be used to indirectly compare impurity levels in the samples, in terms of the amorphous to crystalline phase transition. Using an improved acid treatment method, a silica gel sample was prepared from rice hull and compared to three commercial chromatographic silica gels using quantitative elemental x-ray fluorescence analysis. Elemental levels in the rice hull gel were within the range of levels or close to the detection limits of corresponding elements in the chromatographic gels. Water vapor adsorption, x-ray diffraction, infrared spectroscopy and scanning electron microscopy showed that the rice hull gel was similar to the commercial chromatographic silica gel Davison 12. Zeolites are crystalline aluminosilicates used as molecular sieves for purification and catalytic purposes. Zeolites X and Y were synthesized from rice hull silica gel and aluminum hydroxide. For comparison, controls were synthesized from commercial silica gel. The samples and controls exhibited characteristics infrared peaks corresponding to the vibrations of the TO 4 (T=Si, Al) of the zeolite framework. The x
Active vibration control of smart hull structure using piezoelectric composite actuators
International Nuclear Information System (INIS)
Sohn, Jung Woo; Choi, Seung-Bok; Lee, Chul-Hee
2009-01-01
In this paper, active vibration control performance of the smart hull structure with macro-fiber composite (MFC) is evaluated. MFC is an advanced piezoelectric composite which has great flexibility and increased actuating performance compared to a monolithic piezoelectric ceramic patch. The governing equations of motion of the hull structure with MFC actuators are derived based on the classical Donnell–Mushtari shell theory. The actuating model for the interaction between hull structure and MFC is included in the governing equations. Subsequently, modal characteristics are investigated and compared with the results obtained from experiment. The governing equations of the vibration control system are then established and expressed in the state space form. A linear quadratic Gaussian (LQG) control algorithm is designed in order to effectively and actively control the imposed vibration. The controller is experimentally realized and vibration control performances are evaluated
2010-10-01
..., underwater survey, and alternate hull exam intervals. 71.50-3 Section 71.50-3 Shipping COAST GUARD...-3 Drydock examination, internal structural examination, underwater survey, and alternate hull exam... wooden hulls must undergo two drydock and two internal structural examinations within any five year...
Calculation for Hull Strength Construction in Offshore Structures
African Journals Online (AJOL)
PROF. O. E. OSUAGWU
2013-09-01
Sep 1, 2013 ... of hull plating, reinforcing stiffeners, girders, and other structures. This paper therefore used the .... From these equations we derive that. Safety of. Factor. Stress ..... machineries, systems etc. of the ships or barge under design.
DEFF Research Database (Denmark)
Jacob, Riko
We determine the computational complexity of the dynamic convex hull problem in the planar case. We present a data structure that maintains a finite set of n points in the plane under insertion and deletion of points in amortized O(log n) time per operation. The space usage of the data structure...... is O(n). The data structure supports extreme point queries in a given direction, tangent queries through a given point, and queries for the neighboring points on the convex hull in O(log n) time. The extreme point queries can be used to decide whether or not a given line intersects the convex hull......, and the tangent queries to determine whether a given point is inside the convex hull. The space usage of the data structure is O(n). We give a lower bound on the amortized asymptotic time complexity that matches the performance of this data structure....
DEFF Research Database (Denmark)
Brodal, Gerth Stølfting; Jacob, Rico
2002-01-01
In this paper we determine the computational complexity of the dynamic convex hull problem in the planar case. We present a data structure that maintains a finite set of n points in the plane under insertion and deletion of points in amortized O(log n) time per operation. The space usage of the d......In this paper we determine the computational complexity of the dynamic convex hull problem in the planar case. We present a data structure that maintains a finite set of n points in the plane under insertion and deletion of points in amortized O(log n) time per operation. The space usage...... of the data structure is O(n). The data structure supports extreme point queries in a given direction, tangent queries through a given point, and queries for the neighboring points on the convex hull in O(log n) time. The extreme point queries can be used to decide whether or not a given line intersects...... the convex hull, and the tangent queries to determine whether a given point is inside the convex hull. We give a lower bound on the amortized asymptotic time complexity that matches the performance of this data structure....
Residual Strength Analysisof Asymmetrically Damaged Ship Hull GirderUsing Beam Finite Element Method
Directory of Open Access Journals (Sweden)
Muhammad Zubair Muis Alie
2016-04-01
Full Text Available The objective of the present study is to analyze the residual strength of asymmetrically damaged ship hull girder under longitudinal bending. Beam Finite Element Method isused for the assessment of the residual strength of two single hull bulk carriers (Ship B1 and Ship B4 and a three-cargo-hold model of a single-side Panamax Bulk Carrierin hogging and sagging conditions. The Smith’s method is adopted and implemented into Beam Finite Element Method. An efficient solution procedure is applied; i.e. by assuming the cross section remains plane, the vertical bending moment is applied to the cross section and three-cargo-hold model. As a fundamental case, the damage is simply created by removing the elements from the cross section, neglecting any welding residual stress and initial imperfection. Also no crack extension is considered. The result obtained by Beam Finite Element Method so-called Beam-HULLST is compared to the progressive collapse analysis obtained by HULLST for the validation of the present work. Then, for the three-hold-model, the Beam-HULLST is used to investigate the effect of the rotation of the netral axisboth intact and damage condition taking the one and five frame spaces into account.
Acoustic emission localization on ship hull structures using a deep learning approach
DEFF Research Database (Denmark)
Georgoulas, George; Kappatos, Vassilios; Nikolakopoulos, George
2016-01-01
In this paper, deep belief networks were used for localization of acoustic emission events on ship hull structures. In order to avoid complex and time consuming implementations, the proposed approach uses a simple feature extraction module, which significantly reduces the extremely high dimension......In this paper, deep belief networks were used for localization of acoustic emission events on ship hull structures. In order to avoid complex and time consuming implementations, the proposed approach uses a simple feature extraction module, which significantly reduces the extremely high...
International Nuclear Information System (INIS)
Reilly, T.D.
1979-07-01
Leached hulls are the short lengths of fuel rod cladding and fuel element hardware which constitute a major waste product of a reprocessing plant employing a chop-and-leach head-end process. The small, undissolved fuel residue (0.1 to 1.0% of original fuel content) which is discarded with this waste must be measured for safeguards, material accountability, and process control reasons. This report gives a critical analysis of hull measurement techniques involving the analysis of fission product gamma rays, spontaneous fission neutrons from curium, and delayed neutron activation. Major emphasis is given to the measurement of 2186-keV gamma rays from 144 Ce-- 144 Pr. A detailed description of typical leached hull characteristics is presented at the beginning of the report. An extensive review of experience gained from existing hull measurement systems in the United Kingdom, France, Japan, Germany, Italy, and the United States is presented
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Hull. 176.802 Section 176.802 Shipping COAST GUARD... CERTIFICATION Material Inspections § 176.802 Hull. (a) At each initial and subsequent inspection for... ready for inspections of the hull structure and its appurtenances, including the following: (1...
Alpha-Concave Hull, a Generalization of Convex Hull
Asaeedi, Saeed; Didehvar, Farzad; Mohades, Ali
2013-01-01
Bounding hull, such as convex hull, concave hull, alpha shapes etc. has vast applications in different areas especially in computational geometry. Alpha shape and concave hull are generalizations of convex hull. Unlike the convex hull, they construct non-convex enclosure on a set of points. In this paper, we introduce another generalization of convex hull, named alpha-concave hull, and compare this concept with convex hull and alpha shape. We show that the alpha-concave hull is also a general...
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Hull. 169.239 Section 169.239 Shipping COAST GUARD... Certification Inspections § 169.239 Hull. At each inspection for certification and periodic inspection, the vessel must be afloat and ready for the following tests and inspections of the hull structure and its...
Lee, Gileung; Lee, Kang-Ie; Lee, Yunjoo; Kim, Backki; Lee, Dongryung; Seo, Jeonghwan; Jang, Su; Chin, Joong Hyoun; Koh, Hee-Jong
2018-07-01
The split-hull phenotype caused by reduced lemma width and low lignin content is under control of SPH encoding a type-2 13-lipoxygenase and contributes to high dehulling efficiency. Rice hulls consist of two bract-like structures, the lemma and palea. The hull is an important organ that helps to protect seeds from environmental stress, determines seed shape, and ensures grain filling. Achieving optimal hull size and morphology is beneficial for seed development. We characterized the split-hull (sph) mutant in rice, which exhibits hull splitting in the interlocking part between lemma and palea and/or the folded part of the lemma during the grain filling stage. Morphological and chemical analysis revealed that reduction in the width of the lemma and lignin content of the hull in the sph mutant might be the cause of hull splitting. Genetic analysis indicated that the mutant phenotype was controlled by a single recessive gene, sph (Os04g0447100), which encodes a type-2 13-lipoxygenase. SPH knockout and knockdown transgenic plants displayed the same split-hull phenotype as in the mutant. The sph mutant showed significantly higher linoleic and linolenic acid (substrates of lipoxygenase) contents in spikelets compared to the wild type. It is probably due to the genetic defect of SPH and subsequent decrease in lipoxygenase activity. In dehulling experiment, the sph mutant showed high dehulling efficiency even by a weak tearing force in a dehulling machine. Collectively, the results provide a basis for understanding of the functional role of lipoxygenase in structure and maintenance of hulls, and would facilitate breeding of easy-dehulling rice.
Static analysis of the hull plate using the finite element method
Ion, A.
2015-11-01
This paper aims at presenting the static analysis for two levels of a container ship's construction as follows: the first level is at the girder / hull plate and the second level is conducted at the entire strength hull of the vessel. This article will describe the work for the static analysis of a hull plate. We shall use the software package ANSYS Mechanical 14.5. The program is run on a computer with four Intel Xeon X5260 CPU processors at 3.33 GHz, 32 GB memory installed. In terms of software, the shared memory parallel version of ANSYS refers to running ANSYS across multiple cores on a SMP system. The distributed memory parallel version of ANSYS (Distributed ANSYS) refers to running ANSYS across multiple processors on SMP systems or DMP systems.
46 CFR 45.107 - Strength of hull.
2010-10-01
... 46 Shipping 2 2010-10-01 2010-10-01 false Strength of hull. 45.107 Section 45.107 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) LOAD LINES GREAT LAKES LOAD LINES Conditions of Assignment § 45.107 Strength of hull. The general structural strength of the hull must be sufficient for the...
Morphologically intelligent underactuated robot for underwater hull cleaning
DEFF Research Database (Denmark)
Souto, Daniel; Faina, Andres; López-Peña, Fernando
2015-01-01
In this paper we discuss a new type of robot for underwater hull cleaning on ships with non-magnetic hulls. This robot is based on the concept that cleaning hulls regularly, without waiting to take them out of the water, will improve the efficiency of the ships and will permit a reduction...... in the use of the chemicals that are usually employed to prevent the growth of marine life on the hull and which are generally harmful to the environment. The robot described in this paper is an underactuated morphologically adapted robot that through an appropriate morphology and making use of the forces...... and constraints of the environment solves the most difficult problems that arise when moving along hulls. Some of these are changing planes, negotiating appendices, avoiding portholes, passing corners, and other elements. This greatly simplifies the control mechanisms that are required for its operation making...
46 CFR 154.188 - Membrane tank: Inner hull steel.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Membrane tank: Inner hull steel. 154.188 Section 154.188... STANDARDS FOR SELF-PROPELLED VESSELS CARRYING BULK LIQUEFIED GASES Design, Construction and Equipment Hull Structure § 154.188 Membrane tank: Inner hull steel. For a vessel with membrane tanks, the inner hull...
Hulls and structural material waste conditioning by high pressure compaction
International Nuclear Information System (INIS)
Frotscher, H.
1991-01-01
Since 1986 KfK is developing a conditioning process. Main subjects of the investigations were the development of the production technique and the planning of the most important equipments of the process under remote conditions. The process is based on an extensive program of experiments. Inactive bulks of hulls and structural material components were compacted using maximum axial pressure load of about 300 MPa. The product density as function of press force was experimentally determinated. The mechanical loads of the press and tools were estimated for the design of these equipments. The hydraulic press consists a horizontal four-cylinder press. The maximum force of the press is 25 MN. The main advantage is the modular design of the press which is open on all sides. Especially the free accessibility from top is ensured. The report also represents relevant radiological data of the alternative product. Co-60 is the dominating activity of the product due to the effects of the heat production. An amount of 10 kg hull waste or 25 kg top and bottom pieces of the spent fuel assemblies per package is already beyond the Co-60 limit of the KONRAD regulations. The nuclear thermal power of a filled container is approximately sixty times lower compared with a vitrified HLW-container. Since the product shows thermal stability beyond 200 0 C, this it is suited for a combined disposal together with vitrified HLW-containers in salt bore holes of a geological disposal. The preliminary cost evaluation is based on a reprocessing throughput of 500 t HM per year and volume reduction factor of 5.3. Accordingly there are produced 300 waste packages with hulls only or 625 units with hulls and top and bottom pieces which require 1.6 or 2.3 millions DM respectively
14 CFR 25.533 - Hull and main float bottom pressures.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Hull and main float bottom pressures. 25... AIRCRAFT AIRWORTHINESS STANDARDS: TRANSPORT CATEGORY AIRPLANES Structure Water Loads § 25.533 Hull and main float bottom pressures. (a) General. The hull and main float structure, including frames and bulkheads...
46 CFR 154.170 - Outer hull steel plating.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Outer hull steel plating. 154.170 Section 154.170... STANDARDS FOR SELF-PROPELLED VESSELS CARRYING BULK LIQUEFIED GASES Design, Construction and Equipment Hull Structure § 154.170 Outer hull steel plating. (a) Except as required in paragraph (b) of this section, the...
Visualizing RNA Secondary Structure Base Pair Binding Probabilities using Nested Concave Hulls
Sansen , Joris; Bourqui , Romain; Thebault , Patricia; Allali , Julien; Auber , David
2015-01-01
International audience; The challenge 1 of the BIOVIS 2015 design contest consists in designing an intuitive visual depiction of base pairs binding probabilities for secondary structure of ncRNA. Our representation depicts the potential nucleotide pairs binding using nested concave hulls over the computed MFE ncRNA secondary structure. Thus, it allows to identify regions with a high level of uncertainty in the MFE computation and the structures which seem to match to reality.
The study on radioactivity reduction of spent PWR cladding hull
International Nuclear Information System (INIS)
Jung, I. H.; Kim, J. H.; Park, C. J.; Jung, Y. H.; Song, K. C.; Lee, J. W.; Park, J. J.; Yang, M. S.
2003-01-01
Hull arising from the spent PWR fuel elements is classified as a high-level radioactive waste. This report describes the radio-chemical characteristics of the hull-from PWR spent fuel of 32,000MWd/tU burn-up and 15 years cooling, discharged from Gori Unit I cycled 4-7-by examination and literature survey. On the basis of the results, a method of degradation to middle and low-level radioactive waste was proposed by dry process such as laser or plasma technique with removing the nuclides deposited on the surface of the hull
Global Loads on FRP Ship Hulls
DEFF Research Database (Denmark)
Pedersen, Preben Terndrup
1997-01-01
Fibre reinforced plastic (FRP) composites used for high-speed vessels have lower modulus of elasticity than the conventionally used steels.Therefore, for large fast ships the lowest natural frequencies of the global hull modes can be relatively low compared to the frequency of waveencounter....... As part of the NoKoS project it was decided to investigate the effect of hull flexibility on the wave-induced as well as accidental structural loads on high-speed ships.Especially it was decided to determine whether there is an upper size of FRP and aluminium mono-hulls caused by continuous wave action...
46 CFR 91.40-1 - Definitions relating to hull examinations.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Definitions relating to hull examinations. 91.40-1... VESSELS INSPECTION AND CERTIFICATION Drydocking § 91.40-1 Definitions relating to hull examinations. As...-hull fittings. (b) Internal structural examination means an examination of the vessel while afloat or...
14 CFR 25.529 - Hull and main float landing conditions.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Hull and main float landing conditions. 25... AIRCRAFT AIRWORTHINESS STANDARDS: TRANSPORT CATEGORY AIRPLANES Structure Water Loads § 25.529 Hull and main.... (b) Unsymmetrical landing for hull and single float seaplanes. Unsymmetrical step, bow, and stern...
46 CFR 189.40-1 - Definitions relating to hull examinations.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Definitions relating to hull examinations. 189.40-1... VESSELS INSPECTION AND CERTIFICATION Drydocking § 189.40-1 Definitions relating to hull examinations. As...-hull fittings. (b) Internal structural examination means an examination of the vessel while afloat or...
14 CFR 25.527 - Hull and main float load factors.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Hull and main float load factors. 25.527... AIRCRAFT AIRWORTHINESS STANDARDS: TRANSPORT CATEGORY AIRPLANES Structure Water Loads § 25.527 Hull and main... 1=empirical hull station weighing factor, in accordance with figure 2 of appendix B. (7) r x=ratio...
14 CFR 25.531 - Hull and main float takeoff condition.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Hull and main float takeoff condition. 25... AIRCRAFT AIRWORTHINESS STANDARDS: TRANSPORT CATEGORY AIRPLANES Structure Water Loads § 25.531 Hull and main float takeoff condition. For the wing and its attachment to the hull or main float— (a) The aerodynamic...
The Assessment of the Ultimate Hull Girder Strength of RO-RO Ship after Damages
Zubair Muis Alie, Muhammad; Sitepu, Ganding; Izaak Latumahin, Samuel
2018-03-01
Many accidents of Ro-Ro ships happen in Indonesia such as collision and grounding. When the collision or grounding takes place on the Ro-Ro ship, the ultimate strength of hull structure after damage becomes decrease. Car and passenger decks are critical location since collision and/or grounding occur. In the present study, the assessment of the ultimate hull girder strength is conducted. The cross section of Ro-Ro ship is taken to be analyzed. The collision and grounding damages are assumed to be palced on the side and bottom area, respectively. The damages are created by removing the element from the side shell and bottom part. Finally, the result obtained is compared with one another.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Hulls. 23.755 Section 23.755 Aeronautics... Hulls § 23.755 Hulls. (a) The hull of a hull seaplane or amphibian of 1,500 pounds or more maximum weight must have watertight compartments designed and arranged so that the hull auxiliary floats, and...
Cold-crucible melting of hulls and structural materials
International Nuclear Information System (INIS)
Jouan, A.; Jacquet-Francillon, N.; Puyou, M.; Piccinato, R.
1990-01-01
The method currently implemented at the La Hague UP3 reprocessing plant for conditioning of PWR zircaloy hulls is cement embedding. Another promising method, mainly for reducing the waste volume and the available exchange surface area, is melting. A cold-crucible melting process has therefore been developed by the CEA at Marcoule (France) over the last decade. Development work first concentrated on cladding hulls from fast breeder reactors, then from pressurized water reactors. The process can be used for both types of cladding wastes. Subassembly head and foot end-caps are sheared off and should be suitable for surface storage after α decontamination by successive rinsing. If necessary because of their α activity, they could be melted in a larger furnace
Ultimate Strength of Ship Hulls under Torsion
DEFF Research Database (Denmark)
Paik, Jeom Kee; Thayamballi, Anil K.; Pedersen, Preben Terndrup
2001-01-01
For a ship hull with large deck openings such as container vessels and some large bulk carriers, the analysis of warping stresses and hatch opening deformations is an essential part of ship structural analyses. It is thus of importance to better understand the ultimate torsional strength characte......For a ship hull with large deck openings such as container vessels and some large bulk carriers, the analysis of warping stresses and hatch opening deformations is an essential part of ship structural analyses. It is thus of importance to better understand the ultimate torsional strength...... characteristics of ships with large hatch openings. The primary aim of the present study is to investigate the ultimate strength characteristics of ship hulls with large hatch openings under torsion. Axial (warping) as well as shear stresses are normally developed for thin-walled beams with open cross sections...... subjected to torsion. A procedure for calculating these stresses is briefly described. As an illustrative example, the distribution and magnitude of warping and shear stresses for a typical container vessel hull cross section under unit torsion is calculated by the procedure. By theoretical and numerical...
The Effect of Material and Side Walls on Hull Deflection during a Blast Event
2017-12-13
ARL-CR-0822 ● DEC 2017 US Army Research Laboratory The Effect of Material and Side Walls on Hull Deflection during a Blast Event...Army Research Laboratory The Effect of Material and Side Walls on Hull Deflection during a Blast Event prepared by Danielle Abell SURVICE...Walls on Hull Deflection during a Blast Event 5a. CONTRACT NUMBER W911QX-16-D-0014 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER 6. AUTHOR(S
33 CFR 110.31 - Hull Bay and Allerton Harbor at Hull, Mass.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Hull Bay and Allerton Harbor at Hull, Mass. 110.31 Section 110.31 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.31 Hull Bay and Allerton Harbor at...
Grounding-Induced Sectional Forces and Residual Strength of Grounded Ship Hulls
DEFF Research Database (Denmark)
Paik, Jeom Kee; Pedersen, Preben Terndrup
1996-01-01
The aim of the present study is to determine the sectional forces induced by ship grounding and also to assess the residual strength of groundedship hulls. An analytical approach is used to estimate the grounding-induced sectional forces of ships. The extent and location of structural damage due...... to grounding is defined based on the ABS Safe Hull guide. The residual strength of damaged hulls is calculated by using a simple analytical formula. The method is applied to residual strength assessment of a damaged double hull tanker of 38,400 dwt due to grounding....
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Hulls. 25.755 Section 25.755 Aeronautics... STANDARDS: TRANSPORT CATEGORY AIRPLANES Design and Construction Floats and Hulls § 25.755 Hulls. (a) Each hull must have enough watertight compartments so that, with any two adjacent compartments flooded, the...
Fluid-Structure Interaction Effects Resulting from Hull Appendage Coupling
National Research Council Canada - National Science Library
Avcu, Mehmet
2005-01-01
In previous work conducted in the modeling and simulation of ships subjected to underwater explosions, there has been some debate over the influence that hull appendages have upon the dynamic response...
A.F. Zakki; Parlindungan Manik
2012-01-01
This study comparation of hull form performance was analysed becaused there was suggestion that a ship was built by hull form scheming this time (Scheltema, Formdata, NPL Series) is better than a ship that was built traditionally because there is no basic erudite calculation in hull form design. So hull form design was result of natural adaptation. Such performance are ship’s resistance, stability, and ship’s navigation.This research about hull form performance is expected can giv...
On the global ship hull bending energy in ship collisions
DEFF Research Database (Denmark)
Pedersen, Preben Terndrup; Li, Yujie
2009-01-01
During ship collisions part of the kinetic energy of the involved vessels immediately prior to contact is absorbed as energy dissipated by crushing of the hull structures, by friction and by elastic energy. The purpose of this report is to present an estimate of the elastic energy that can...... be stored in elastic hull vibrations during a ship collision. When a ship side is strengthened in order to improve the crashworthiness it has been argued in the scientific literature that a non-trivial part of the energy released for structural deformation during the collision can be absorbed as elastic...... energy in global ship hull vibrations, such that with strong ship sides less energy has to be spent in crushing of the striking ship bow and/or the struck ship side. In normal ship–ship collision analyses both the striking and struck ship are usually considered as rigid bodies where structural crushing...
14 CFR 29.755 - Hull buoyancy.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Hull buoyancy. 29.755 Section 29.755... STANDARDS: TRANSPORT CATEGORY ROTORCRAFT Design and Construction Floats and Hulls § 29.755 Hull buoyancy. Water-based and amphibian rotorcraft. The hull and auxiliary floats, if used, must have enough...
The multi-element ultrasonic technology: examples of application on military naval structures
International Nuclear Information System (INIS)
Recolin, P.; Rivalin, S.
2009-01-01
DCNS is the European leader in the military ship construction and maintenance (conventional and nuclear propulsion). The potential of ultrasonic technologies with multi-element probes has been studied in its Materials laboratory since the end of the 80's, and a growing number of applications has appeared these last ten years. A series of examples is given: in-service nuclear reactor pipe welds monitoring, time-of-flight diffraction (TOFD) technique for the inspection of containment welds, coating fabrication control, detection of laminating corrosion on aluminum rings, detection of corrosion on submarine hulls in basin, inspection of hull welded joints
DEFF Research Database (Denmark)
Kappatos, Vassilios; Karvelis, Petros; Georgoulas, George
2018-01-01
In this paper a method for the estimation of the optimum sensor positions for acoustic emission localization on ship hull structures is presented. The optimum sensor positions are treated as a classification (localization) problem based on a deep learning paradigm. In order to avoid complex...
Chemical decontamination and melt densification of chop-leach fuel hulls
International Nuclear Information System (INIS)
Dillon, R.L.; Griggs, B.; Kemper, R.S.; Nelson, R.G.
1976-01-01
This paper reports on decontamination and densification studies of chop-leach fuel hull residues designed to minimize the transuranic element (TRU) contaminated waste stream. Decontamination requirements have been established from studies of TRU element distribution in the fuel hull residues. Effective surface decontamination of Zircaloy requires removal of zirconium oxide corrosion products. Good decontamination factors have been achieved with aqueous solutions following high temperature HF conditioning of oxide films. Molten fluoride salt mixtures are effective decontaminants, but pose problems in metal loss and salt dragout. Molten metal decontamination methods are highly preliminary, but may be required to reduce TRU originating from tramp uranium in Zircaloy. Low melting (1300 0 C) alloy of Zircaloy, stainless steel, and Inconel have been prepared in induction heated graphite crucibles. High quality ingots of Zircaloy-2 have been prepared directly from short sections of descaled fuel clad tubing using the Inductoslag process. This material is readily capable of refabrication. Inductoslag melts have also been prepared from heavily oxidized Zircaloy tubing demonstrating melt densification without prior decontamination is technically feasible. Hydrogen absorption kinetics have been demonstrated with cast Zircaloy-2 and cast Zircaloy-stainless steel-Inconel alloys. Metallic fuel hull residues have been proposed as a storage medium for tritium released from fuel during reprocessing. (author)
Ferreira, G; Yang, Y; Teets, C L; Brooks, W S; Griffey, C A
2018-07-01
The objective of this study was to compare ruminal starch disappearance rates of hull-less barley, hulled barley, and corn grains. Five different genotypes were used for each of the 2 barley types. In addition, each of these genotypes was grown in 2 different locations and years, resulting 10 independent barley samples for each of the 2 barley grain types. Five different genotypes of corn grain were obtained from a commercial seed company. After being ground to pass through a 4-mm screen of a cutter mill, 3.6 g of each grain was placed into a porous bag, which was then incubated in the rumen of 2 ruminally cannulated cows for 0, 4, 8, 12, 24, and 48 h. Corn grains had greater instant ruminal starch disappearances than barley grains (22.4 and 8.2%, respectively). Instant ruminal starch disappearances did not differ between hulled and hull-less barley grains. Ruminal starch fractional disappearance rates were greatest for hulled barley grains, moderate for hull-less barley grains, and lowest for corn grains (15.3, 13.9, and 7.1%/h, respectively). Ruminal starch half-life was shortest for hulled and hull-less barley grains (4.4 h) and longest for corn grains (6.6 h). Ruminal starch half-life did not differ between hulled barley and hull-less barley grains. In conclusion, using a holistic experimental design and statistical analysis, this study showed that starch from hull-less barley grains has a ruminal half-life similar to that of hulled barley grains and shorter than that of corn grains. Copyright © 2018 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.
On the Global Ship Hull Bending Energy in Ship Collisions
DEFF Research Database (Denmark)
Pedersen, Preben Terndrup; Li, Y.
2004-01-01
During ship collisions part of the kinetic energy of the involved vessels prior to contact is absorbed as energy dissipated by crushing of the hull structures, by friction and by elastic energy. The purpose of this report is to present an estimate of the elastic energy that can be stored in elastic...... hull vibrations during a ship collision. When a ship side is strengthened in order to improve the crashworthiness it has been argued in the scientific literature that a non trivial part of the energy released for structural deformation during the collision can be absorbed as elastic energy in global...... ship hull vibrations, such that with strong ship sides less energy has to be spent in crushing of the striking ship bow and/or the struck ship side. In normal ship-ship collision analyses both the striking and struck ship are usually considered as rigid bodies where structural crushing is confined...
46 CFR 45.129 - Hull fittings: General.
2010-10-01
... 46 Shipping 2 2010-10-01 2010-10-01 false Hull fittings: General. 45.129 Section 45.129 Shipping... Assignment § 45.129 Hull fittings: General. Hull fittings must be securely mounted in the hull so as to avoid increases in hull stresses and must be protected from local damage caused by movement of equipment or cargo. ...
Biofibres from biofuel industrial byproduct-Pongamia pinnata seed hull.
Manjula, Puttaswamy; Srinikethan, Govindan; Shetty, K Vidya
2017-01-01
Biodiesel production using Pongamia pinnata (P. pinnata) seeds results in large amount of unused seed hull. These seed hulls serve as a potential source for cellulose fibres which can be exploited as reinforcement in composites. These seed hulls were processed using chlorination and alkaline extraction process in order to isolate cellulose fibres. Scanning electron microscopy (SEM), dynamic light scattering (DLS), thermogravimetric analysis (TGA), X-ray diffraction (XRD), Fourier transform infrared spectroscopy (FTIR) and nuclear magnetic resonance spectroscopy (NMR) analysis demonstrated the morphological changes in the fibre structure. Cellulose microfibres of diameter 6-8 µm, hydrodynamic diameter of 58.4 nm and length of 535 nm were isolated. Thermal stability was enhanced by 70 °C and crystallinity index (CI) by 19.8% ensuring isolation of crystalline cellulose fibres. The sequential chlorination and alkaline treatment stemmed to the isolation of cellulose fibres from P. pinnata seed hull. The isolated cellulose fibres possessed enhanced morphological, thermal, and crystalline properties in comparison with P. pinnata seed hull. These cellulose microfibres may potentially find application as biofillers in biodegradable composites by augmenting their properties.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Hull. 115.802 Section 115.802 Shipping COAST GUARD....802 Hull. (a) At each initial and subsequent inspection for certification of a vessel, the owner or managing operator shall be prepared to conduct tests and have the vessel ready for inspections of the hull...
46 CFR 176.655 - Hull examination reports.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Hull examination reports. 176.655 Section 176.655... TONS) INSPECTION AND CERTIFICATION Hull and Tailshaft Examinations § 176.655 Hull examination reports. (a) If you use only divers for the underwater survey portion of the Alternative Hull Examination (AHE...
Full scale leak test of the MEGAPIE containment hull
Energy Technology Data Exchange (ETDEWEB)
Samec, K
2006-07-15
The Full Scale Leak Test (FSLT) experiment is designed to replicate an accidental leak of Lead-Bismuth Eutectic (LBE) liquid metal from the MEGAPIE neutron spallation source. The neutron source is totally encased in an aluminum containment hull cooled by heavy water. Any liquid metal which would, in a hypothetical accident, leak into the helium-filled insulation gap between the source and the aluminum containment hull, would immediately impact the hull. Furthermore, during irradiation in the PSI SINQ facility, the LBE in the MEGAPIE Lower Liquid Metal Container (LLMC) accumulates radio-active substances which, in the event of a leak, must be cooled and contained under controlled conditions, as they may otherwise contaminate the facility. The FSLT experiment has been devised to fully test the structural integrity of the containment hull against a sudden liquid metal leak, and in addition, to resolve the peak temperature of he coolant, to validate the sensors used in detecting a leak and of proof-test the analytical methods used in predicting the consequences of a leak. The FSLT experiment has been analysed ahead of the test, and both thermal and structural aspects calculated using commercial codes. The predictions applied conservative assumptions to the analysis of the thermal shock so as to preclude the likelihood of an unforeseen failure of the hull. In this document, these initial predictions are compared to the temperature and strain data recorded in the experiment. Further analysis, to be published at a later stage, will focus on applying actual conditions realised in the experiment, as opposed to the envelope case used in the test predictions. The integrity of the containment hull under loads resulting from liquid metal-leak is therefore the focal point of the experiment described in the current document, and serves as a key reference test for the Iicensing of the facility. The data recorded during the SLT experiment shows that the MEGAPIE containment hull is
Full scale leak test of the MEGAPIE containment hull
International Nuclear Information System (INIS)
Samec, K.
2006-07-01
The Full Scale Leak Test (FSLT) experiment is designed to replicate an accidental leak of Lead-Bismuth Eutectic (LBE) liquid metal from the MEGAPIE neutron spallation source. The neutron source is totally encased in an aluminum containment hull cooled by heavy water. Any liquid metal which would, in a hypothetical accident, leak into the helium-filled insulation gap between the source and the aluminum containment hull, would immediately impact the hull. Furthermore, during irradiation in the PSI SINQ facility, the LBE in the MEGAPIE Lower Liquid Metal Container (LLMC) accumulates radio-active substances which, in the event of a leak, must be cooled and contained under controlled conditions, as they may otherwise contaminate the facility. The FSLT experiment has been devised to fully test the structural integrity of the containment hull against a sudden liquid metal leak, and in addition, to resolve the peak temperature of he coolant, to validate the sensors used in detecting a leak and of proof-test the analytical methods used in predicting the consequences of a leak. The FSLT experiment has been analysed ahead of the test, and both thermal and structural aspects calculated using commercial codes. The predictions applied conservative assumptions to the analysis of the thermal shock so as to preclude the likelihood of an unforeseen failure of the hull. In this document, these initial predictions are compared to the temperature and strain data recorded in the experiment. Further analysis, to be published at a later stage, will focus on applying actual conditions realised in the experiment, as opposed to the envelope case used in the test predictions. The integrity of the containment hull under loads resulting from liquid metal-leak is therefore the focal point of the experiment described in the current document, and serves as a key reference test for the Iicensing of the facility. The data recorded during the SLT experiment shows that the MEGAPIE containment hull is
46 CFR 151.10-20 - Hull construction.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Hull construction. 151.10-20 Section 151.10-20 Shipping... BULK LIQUID HAZARDOUS MATERIAL CARGOES Barge Hull Construction Requirements § 151.10-20 Hull construction. (a) Construction features. (1) Each barge hull shall be constructed with a suitable bow form...
46 CFR 115.655 - Hull examination reports.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Hull examination reports. 115.655 Section 115.655... CERTIFICATION Hull and Tailshaft Examinations § 115.655 Hull examination reports. (a) If you use only divers for the underwater survey portion of the Alternative Hull Examination (AHE), you must provide the Officer...
21 CFR 573.160 - Ammoniated rice hulls.
2010-04-01
... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Ammoniated rice hulls. 573.160 Section 573.160... Additive Listing § 573.160 Ammoniated rice hulls. The food additive ammoniated rice hulls may be safely... obtained by the treatment of ground rice hulls with monocalcium phosphate and anhydrous ammonia at a...
Directory of Open Access Journals (Sweden)
Suresh Thenozhi
2012-01-01
Full Text Available An important objective of health monitoring systems for tall buildings is to diagnose the state of the building and to evaluate its possible damage. In this paper, we use our prototype to evaluate our data-mining approach for the fault monitoring. The offset cancellation and high-pass filtering techniques are combined effectively to solve common problems in numerical integration of acceleration signals in real-time applications. The integration accuracy is improved compared with other numerical integrators. Then we introduce a novel method for support vector machine (SVM classification, called convex-concave hull. We use the Jarvis march method to decide the concave (nonconvex hull for the inseparable points. Finally the vertices of the convex-concave hull are applied for SVM training.
ISOLATION AND CHARACTERIZATION OF NANOFIBRILLATED CELLULOSE FROM OAT HULLS
Directory of Open Access Journals (Sweden)
Giovanni B. Paschoal
2015-05-01
Full Text Available The objectives of this work were to investigate the microstructure, crystallinity and thermal stability of nanofibrillated cellulose obtained from oat hulls using bleaching and acid hydrolysis at a mild temperature (45 ºC followed by ultrasonication. The oat hulls were bleached with peracetic acid, and after bleaching, the compact structure around the cellulosic fibers was removed, and the bundles became individualized. The extraction time (30 or 60 min did not affect the properties of the nanofibrillated cellulose, which presented a higher crystallinity index and thermal stability than the raw material (oat hulls. The nanocellulose formed interconnected webs of tiny fibers with diameters of 70-100 nm and lengths of several micrometers, producing nanofibers with a relatively high aspect ratio, thus indicating that these materials are suitable for polymer reinforcement.
Rice Hulls as a Renewable Complex Material Resource
Directory of Open Access Journals (Sweden)
Irina Glushankova
2018-05-01
Full Text Available As a result of rice grain processing, a big amount of waste (up to 20% is produced. It is mainly rice hulls. The main components of rice hulls are cellulose, lignin and mineral ash. The mineral ash quantity in rice hulls varies from 15 up to 20%, by weight of the rice hulls. The mineral ash consists of amorphous silica (opal-type. Due to the high content of silica in rice hulls, the material burns with difficulty under natural conditions, and it is biodegradably destroyed only with difficulty, when composted. Utilization of rice hulls then becomes an ecological problem due to huge rice production and its continuous growth. At the same time, the annual quantity of silica content in rice hulls is comparable with the quantity of amorphous silica produced as a mineral resource. The issue of manufacturing cellular glass silica construction materials from rice hulls as a renewable resource is discussed in this paper. The utilization technology is based on an amorphous silicon oxide with the use of energy from the combustion of the organic component of rice hulls.
Treatment of stainless steels and zircaloy cladding hulls
International Nuclear Information System (INIS)
Jenkins, I.L.; Taylor, R.F.
1978-01-01
Results are reported on the fissile material content and the distribution of alpha and beta-gamma emitters in both types of cladding. Apart from very small amounts of residual fuel, fissile material is present as a deposit formed during the dissolution of fuel and also as material driven into the cladding by fission recoil. Alpha-emitters penetrate to depths of 1-2 μm into both S.S. and Zircaloy claddings. The surface deposits on individual hulls can be effectively removed by refluxing with nitric acid or by cleaning with nitric acid in an ultrasonic bath. The physical structural and handling behavior of hull assemblies are examined as being of key importance to the establishment of an efficient cleaning process. The reference leaching target is to extract residual fuel fragments and to remove surface deposits. Preferred routes for compaction, drumming, and encapsulation are briefly reviewed with regard to achieving a final package volume half that of the original hulls with associated hardware
Effects of Common Structural Rules on hull-girder reliability of an Aframax oil tanker
International Nuclear Information System (INIS)
Parunov, Josko; Guedes Soares, C.
2008-01-01
This paper aims at quantifying the changes in notional reliability levels that result from redesigning an existing Aframax tanker to comply with the Common Structural Rules (CSR) for double-hull oil tankers. The probability of structural failure is calculated using the first-order reliability method. The evaluation of the wave-induced load effects that occur during long-term operation of the ship in the seaway is carried out in accordance with the International Association of Classification Societies (IACS)-recommended procedure, while transfer functions are calculated using the sink-source 3D linear method. The still-water loads are defined on the basis of a statistical analysis of loading conditions from the loading manual. The ultimate collapse bending moment of the midship cross section, which is used as the basis for the reliability formulation, is evaluated by progressive collapse analysis and by a single-step procedure according to CSR. The reliability assessment is performed for 'as-built' and 'corroded' states of the existing ship and a reinforced ship complying with CSR. It is shown that the hull-girder failure probability of an Aframax tanker is reduced several times due to the reinforcements according to CSR. Sensitivity analysis and a parametric study are performed to investigate the variability of results with the change of parameters of pertinent random variables within their plausible ranges. Finally, differences between load combination approaches by Ferry-Borges and Castanheta method and Turkstra's rule are investigated
46 CFR 115.645 - Alternative Hull Examination (AHE) Procedure.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Alternative Hull Examination (AHE) Procedure. 115.645... AND CERTIFICATION Hull and Tailshaft Examinations § 115.645 Alternative Hull Examination (AHE... underwater hull plating and a detailed examination of all hull welds, propellers, tailshafts, rudders, and...
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Hull type. 172.085 Section 172.085 Shipping COAST GUARD... of This Chapter § 172.085 Hull type. If a cargo listed in Table 151.05 of part 151 of this chapter is to be carried, the tank barge must be at least the hull type specified in Table 151.05 of this...
International Nuclear Information System (INIS)
Taylor, W.C.; Horgan, J.B.G.; Downie, D.M.
1982-01-01
An 18 sided hull approximately 4 metres in diameter formed in prefabricated watertight sections from GRP has been designed for burying underground to withstand an overpressure of 12P.S.I above normal atmospheric pressure for human protection against a nuclear explosion and resultant radioactivity. The pre-fabricated sections are so designed to be stacked together prior to assembling and the assembled hulls can also be stacked together both vertically and horizontally in a honeycomb formation to form a multiple chamber. (author)
46 CFR 151.10-1 - Barge hull classifications.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Barge hull classifications. 151.10-1 Section 151.10-1... CARRYING BULK LIQUID HAZARDOUS MATERIAL CARGOES Barge Hull Construction Requirements § 151.10-1 Barge hull classifications. (a) Each barge constructed or converted in conformance with this subpart shall be assigned a hull...
46 CFR 45.153 - Through-hull piping: General.
2010-10-01
... 46 Shipping 2 2010-10-01 2010-10-01 false Through-hull piping: General. 45.153 Section 45.153... Conditions of Assignment § 45.153 Through-hull piping: General. (a) All through-hull pipes required by this subpart must be made of steel or material equivalent to the hull in strength and fatigue resistance. (b...
Wave induced extreme hull girder loads on containerships
DEFF Research Database (Denmark)
Jensen, Jørgen Juncher; Pedersen, Preben Terndrup; Shi, Bill
2009-01-01
This paper provides simple but rational procedures for prediction of extreme wave – induced sectional hull girder forces with reasonable engineering accuracy. The procedures take into account main ship hull characteristics such as: length, breadth, draught, block coefficient, bow flare coefficient......, forward speed and hull flexibility. The vertical hull girder loads are evaluated for specific operational profiles. Firstly a quadratic strip theory is presented which can give separate predictions for the hogging and sagging bending moments and shear forces and for hull girder loads. Then this procedure...... is based on rational methods it can be applied for novel single hull ship types not presently covered by the rules of the classification societies or to account for specific operational profiles....
46 CFR 154.516 - Piping: Hull protection.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Piping: Hull protection. 154.516 Section 154.516 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) CERTAIN BULK DANGEROUS CARGOES SAFETY... and Process Piping Systems § 154.516 Piping: Hull protection. A vessel's hull must be protected from...
Paik, Kwang-Jun; Park, Hyung-Gil; Seo, Jongsoo
2013-12-01
Simulations of cavitation flow and hull pressure fluctuation for a marine propeller operating behind a hull using the unsteady Reynolds-Averaged Navier-Stokes equations (RANS) are presented. A full hull body submerged under the free surface is modeled in the computational domain to simulate directly the wake field of the ship at the propeller plane. Simulations are performed in design and ballast draught conditions to study the effect of cavitation number. And two propellers with slightly different geometry are simulated to validate the detectability of the numerical simulation. All simulations are performed using a commercial CFD software FLUENT. Cavitation patterns of the simulations show good agreement with the experimental results carried out in Samsung CAvitation Tunnel (SCAT). The simulation results for the hull pressure fluctuation induced by a propeller are also compared with the experimental results showing good agreement in the tendency and amplitude, especially, for the first blade frequency.
46 CFR 91.25-25 - Hull equipment.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Hull equipment. 91.25-25 Section 91.25-25 Shipping COAST... CERTIFICATION Inspection for Certification § 91.25-25 Hull equipment. (a) At each inspection for certification and periodic inspection, the inspectors shall conduct the following tests and inspections of hull...
46 CFR 189.25-25 - Hull equipment.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Hull equipment. 189.25-25 Section 189.25-25 Shipping... CERTIFICATION Inspection for Certification § 189.25-25 Hull equipment. (a) At each inspection for certification and periodic inspection the inspector shall conduct the following tests and inspections of hull...
46 CFR 71.25-25 - Hull equipment.
2010-10-01
... 46 Shipping 3 2010-10-01 2010-10-01 false Hull equipment. 71.25-25 Section 71.25-25 Shipping COAST... Inspection § 71.25-25 Hull equipment. (a) At each annual inspection, the inspector shall conduct the following tests and inspections of hull equipment: (1) All subdivision bulkheads shall be examined to...
46 CFR 111.05-11 - Hull return.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Hull return. 111.05-11 Section 111.05-11 Shipping COAST... REQUIREMENTS Equipment Ground, Ground Detection, and Grounded Systems § 111.05-11 Hull return. (a) A vessel's hull must not carry current as a conductor except for the following systems: (1) Impressed current...
Directory of Open Access Journals (Sweden)
Kwang-Jun Paik
2013-12-01
Full Text Available Simulations of cavitation flow and hull pressure fluctuation for a marine propeller operating behind a hull using the unsteady Reynolds-Averaged Navier-Stokes equations (RANS are presented. A full hull body submerged under the free surface is modeled in the computational domain to simulate directly the wake field of the ship at the propeller plane. Simulations are performed in design and ballast draught conditions to study the effect of cavitation number. And two propellers with slightly different geometry are simulated to validate the detectability of the numerical simulation. All simulations are performed using a commercial CFD software FLUENT. Cavitation patterns of the simulations show good agreement with the experimental results carried out in Samsung CAvitation Tunnel (SCAT. The simulation results for the hull pressure fluctuation induced by a propeller are also compared with the experimental results showing good agreement in the tendency and amplitude, especially, for the first blade frequency.
Energy Technology Data Exchange (ETDEWEB)
Franco, Mireille
2010-07-01
The objective of the Hull Inspection, Maintenance and Repair Plan is to ensure the total integrity of the Floating Production Unit. To be efficient, the Monitoring has to be part of the Hull Inspection, Monitoring, Maintenance and Repair Plan (IMMR). The IMMR Plan should be developed during the design and project phases and take into account the interfaces between the different systems and teams' tasks in operation. The IMMR is multidisciplinary and form part of the hand-over to ensure an efficient and early implementation. Implementation of such a complex plan requires: - Cross-functionality: take advantage of the synergies - Boldness: break the mould and think outside the box - Listening: be attentive, be available, - Mutual support: during good and bad times. This paper presents the way Total believe the Hull IMMR Plan shall be developed, implemented and followed up. (Author)
A new approach to hull consistency
Directory of Open Access Journals (Sweden)
Kolev Lubomir
2016-06-01
Full Text Available Hull consistency is a known technique to improve the efficiency of iterative interval methods for solving nonlinear systems describing steady-states in various circuits. Presently, hull consistency is checked in a scalar manner, i.e. successively for each equation of the nonlinear system with respect to a single variable. In the present poster, a new more general approach to implementing hull consistency is suggested which consists in treating simultaneously several equations with respect to the same number of variables.
14 CFR 29.757 - Hull and auxiliary float strength.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Hull and auxiliary float strength. 29.757... AIRCRAFT AIRWORTHINESS STANDARDS: TRANSPORT CATEGORY ROTORCRAFT Design and Construction Floats and Hulls § 29.757 Hull and auxiliary float strength. The hull, and auxiliary floats if used, must withstand the...
International Nuclear Information System (INIS)
Chandrasekaran, S.; Rajagopal, V.; Jose, M.T.; Venkatraman, B.
2012-01-01
In Fuel Reprocessing Plant (FRP), un-dissolved clad of fuel pins known as hulls are the major sources of high level solid waste. Safe handling, transport and disposal require the estimation of radioactivity as a consequent of gamma dose rate from hulls in fast reactor fuel reprocessing plant in comparison with thermal reactor fuel. Due to long irradiation time and low cooling of spent fuel, the evolution of activation products 51 Cr, 58 Co, 54 Mn and 59 Fe present as impurities in the fuel clad are the major sources of gamma radiation. Gamma dose rate from hull container with hulls from Fuel Sub Assembly (FSA) and Radial Sub Assembly (RSA) of Fuel Reprocessing Plant (FRP) was estimated in order to design the hull transport cask. Shielding computations were done using point kernel code, IGSHIELD. This paper describes the details of source terms, estimation of dose rate and shielding design of hull transport cask in detail. (author)
46 CFR 32.75-5 - Hull requirements; general-TB/ALL.
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Hull requirements; general-TB/ALL. 32.75-5 Section 32.75..., AND HULL REQUIREMENTS Hull Requirements for Wood Hull Tank Vessels Constructed Prior to November 10, 1936 § 32.75-5 Hull requirements; general—TB/ALL. The scantlings, material, and workmanship, and the...
46 CFR 32.70-5 - Hull requirements; general-TB/ALL.
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Hull requirements; general-TB/ALL. 32.70-5 Section 32.70..., AND HULL REQUIREMENTS Hull Requirements for Steel Hull Tank Vessels Constructed Prior to November 10, 1936 § 32.70-5 Hull requirements; general—TB/ALL. The scantlings, material, and workmanship, the...
Heat-treated hull flour does not affect iron bioavailability in rats.
Martino, Hércia Stampini Duarte; Carvalho, Ariela Werneck de; Silva, Cassiano Oliveira da; Dantas, Maria Inês de Souza; Natal, Dorina Isabel Gomes; Ribeiro, Sônia Machado Rocha; Costa, Neuza Maria Brunoro
2011-06-01
In this study the chemical composition and iron bioavailability of hull and hull-less soybean flour from the new cultivar UFVTN 105AP was evaluated. The hemoglobin depletion-repletion method was used in Wistar rats. Soybean hull flour presented 37% more total dietary fiber and higher content of iron than hull-less soybean flour. The phytate:iron molar ratio, however, was 2-fold lower in the soybean hull flour in compared to the hull-less soybean flour. Animals fed soybean hull flour presented hemoglobin gains similar to those of the control diet group (p > 0.05). The Relative Biological Values of hull and hull-less soybean flour were 68.5% and 67.1%, respectively, compared to the control group. Heat-treated soybean hull flour (150 degrees C/30 minutes) showed high content of iron and low phytate, which favors the iron bioavailability. Thus, the soybean hull flour is a better source of dietary fiber and iron than hull-less soybean flour at comparable bioavailabilities.
Dynamic Planar Convex Hull with Optimal Query Time and O(log n · log log n ) Update Time
DEFF Research Database (Denmark)
Brodal, Gerth Stølting; Jakob, Riko
2000-01-01
The dynamic maintenance of the convex hull of a set of points in the plane is one of the most important problems in computational geometry. We present a data structure supporting point insertions in amortized O(log n · log log log n) time, point deletions in amortized O(log n · log log n) time......, and various queries about the convex hull in optimal O(log n) worst-case time. The data structure requires O(n) space. Applications of the new dynamic convex hull data structure are improved deterministic algorithms for the k-level problem and the red-blue segment intersection problem where all red and all...
CFD simulation on Kappel propeller with a hull wake field
DEFF Research Database (Denmark)
Shin, Keun Woo; Andersen, Poul; Møller Bering, Rasmus
2013-01-01
Marine propellers are designed not for the open-water operation, but for the operation behind a hull due to the inhomogeneous hull wake and thrust deduction. The adaptation for the hull wake is important for the propulsive efficiency and cavitation risk especially on single-screw ships. CFD...... simulations for a propeller with a hull model have showed acceptable agreement with a model test result in the thrust and torque (Larsson et al. 2010). In the current work, a measured hull wake is applied to the simulation instead of modelling a hull, because the hull geometry is mostly not available...... for propeller designers and the computational effort can be reduced by excluding the hull. The CFD simulation of a propeller flow with a hull wake is verified in order to use CFD as a propeller design tool. A Kappel propeller, which is an innovative tip-modified propeller, is handled. Kappel propellers...
33 CFR 181.29 - Hull identification number display.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Hull identification number... SECURITY (CONTINUED) BOATING SAFETY MANUFACTURER REQUIREMENTS Identification of Boats § 181.29 Hull identification number display. Two identical hull identification numbers are required to be displayed on each...
33 CFR 181.23 - Hull identification numbers required.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Hull identification numbers... SECURITY (CONTINUED) BOATING SAFETY MANUFACTURER REQUIREMENTS Identification of Boats § 181.23 Hull... identify each boat produced or imported with two hull identification numbers that meet the requirements of...
Strength Tests on Hulls and Floats
Matthaes, K
1942-01-01
The present report deals with strength tests on hulls and floats intended in part for the collection of construction data for the design of these components and in part for the stress analysis of the finished hulls and floats.
33 CFR 181.25 - Hull identification number format.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Hull identification number format... (CONTINUED) BOATING SAFETY MANUFACTURER REQUIREMENTS Identification of Boats § 181.25 Hull identification number format. Each of the hull identification numbers required by § 181.23 must consist of twelve...
Morphing hull implementation for unmanned underwater vehicles
International Nuclear Information System (INIS)
Miller, Timothy F; Gandhi, Farhan; Rufino, Russell J
2013-01-01
There has been much interest and work in the area of morphing aircraft since the 1980s. Morphing could also potentially benefit unmanned underwater vehicles (UUVs). The current paper envisions a UUV with an interior pressure hull and a variable diameter outer flexible hull with fuel stored in the annulus between, and presents a mechanism to realize diameter change of the outer hull. The outer hull diameter of UUVs designed for very long endurance/range could be progressively reduced as fuel was consumed, thereby reducing drag and further increasing endurance and range capability. Diameter morphing could also be advantageous for compact storage of UUVs. A prototype is fabricated to represent an axial section of such a morphing diameter UUV. Diameter change is achieved using eight morphing trusses arranged equidistant around the circumference of the representative interior rigid hull. Each morphing truss has a lower rail (attached to the rigid hull) and an upper rail with V-linkages between, at either ends of the rail. Horizontal motion of the feet of the V-linkages (sliding in the lower rail) results in vertical motion of the upper rail which in turn produces diameter change of the outer hull. For the prototype built and tested, a 63% increase in outer diameter from 12.75″ to 20.75″ was achieved. The introduction of a stretched latex representative flexible skin around the outer rails increased actuation force requirement and led to a propensity for the wheel-in-track sliders in the morphing truss to bind. It is anticipated that this could be overcome with higher precision manufacturing. In addition to symmetric actuation of the morphing trusses resulting in diameter change, the paper also shows that with asymmetric actuation the hull cross-section shape can be changed (for example, from a circular section for underwater operation to a V-section for surface operations). (paper)
Morphing hull implementation for unmanned underwater vehicles
Miller, Timothy F.; Gandhi, Farhan; Rufino, Russell J.
2013-11-01
There has been much interest and work in the area of morphing aircraft since the 1980s. Morphing could also potentially benefit unmanned underwater vehicles (UUVs). The current paper envisions a UUV with an interior pressure hull and a variable diameter outer flexible hull with fuel stored in the annulus between, and presents a mechanism to realize diameter change of the outer hull. The outer hull diameter of UUVs designed for very long endurance/range could be progressively reduced as fuel was consumed, thereby reducing drag and further increasing endurance and range capability. Diameter morphing could also be advantageous for compact storage of UUVs. A prototype is fabricated to represent an axial section of such a morphing diameter UUV. Diameter change is achieved using eight morphing trusses arranged equidistant around the circumference of the representative interior rigid hull. Each morphing truss has a lower rail (attached to the rigid hull) and an upper rail with V-linkages between, at either ends of the rail. Horizontal motion of the feet of the V-linkages (sliding in the lower rail) results in vertical motion of the upper rail which in turn produces diameter change of the outer hull. For the prototype built and tested, a 63% increase in outer diameter from 12.75″ to 20.75″ was achieved. The introduction of a stretched latex representative flexible skin around the outer rails increased actuation force requirement and led to a propensity for the wheel-in-track sliders in the morphing truss to bind. It is anticipated that this could be overcome with higher precision manufacturing. In addition to symmetric actuation of the morphing trusses resulting in diameter change, the paper also shows that with asymmetric actuation the hull cross-section shape can be changed (for example, from a circular section for underwater operation to a V-section for surface operations).
International Nuclear Information System (INIS)
Qiu, Kunzan; Zhang, Hailong; Zhou, Hao; Zhou, Bin; Li, Letian; Cen, Kefa
2014-01-01
This paper investigated the ash deposit characteristics during the co-firing Da Tong (DA) coal with different proportions of rice hull (0%, 5%, 10%, and 20%, based on weight) in a pilot-scale furnace. The growth of ash deposit with a four-stage mode was presented. The stable thickness values of DA coal, 5% rice hull, 10% rice hull, and 20% rice hull were 0.5, 1.4, 2.9, 5.7 cm, with stable heat flux values of 230, 200, 175, and 125 kW/m 2 , respectively. According to the results of scanning electron microscopy with energy dispersive X-ray analysis (SEM-EDX), the amount of Si in the deposits increased with the increasing proportion of rice hull rich in SiO 2 . The X-ray diffraction (XRD) analysis results indicated that most elements except Si were in the amorphous state because of the formation of eutectics. The stable thicknesses of deposits increased exponentially with the proportion of rice hull. The deposit was loose, easy removable but it reduced the heat transfer significantly. Consequently, sootblowing timely was necessary when co-firing DA coal with rice hull. - Highlights: • Digital image technique was used to monitor deposits growth process. • A type of four stages mode of ash deposit growth was presented. • The heat flux of ash deposits fit a three-stage mode. • The addition of rice hull increased the porosity of deposits
46 CFR 252.33 - Hull and machinery insurance.
2010-10-01
... 46 Shipping 8 2010-10-01 2010-10-01 false Hull and machinery insurance. 252.33 Section 252.33... Subsidy Rates § 252.33 Hull and machinery insurance. (a) Subsidy items. The fair and reasonable net premium costs (including stamp taxes) of hull and machinery, increased value, excess general average...
Approximate convex hull of affine iterated function system attractors
International Nuclear Information System (INIS)
Mishkinis, Anton; Gentil, Christian; Lanquetin, Sandrine; Sokolov, Dmitry
2012-01-01
Highlights: ► We present an iterative algorithm to approximate affine IFS attractor convex hull. ► Elimination of the interior points significantly reduces the complexity. ► To optimize calculations, we merge the convex hull images at each iteration. ► Approximation by ellipses increases speed of convergence to the exact convex hull. ► We present a method of the output convex hull simplification. - Abstract: In this paper, we present an algorithm to construct an approximate convex hull of the attractors of an affine iterated function system (IFS). We construct a sequence of convex hull approximations for any required precision using the self-similarity property of the attractor in order to optimize calculations. Due to the affine properties of IFS transformations, the number of points considered in the construction is reduced. The time complexity of our algorithm is a linear function of the number of iterations and the number of points in the output approximate convex hull. The number of iterations and the execution time increases logarithmically with increasing accuracy. In addition, we introduce a method to simplify the approximate convex hull without loss of accuracy.
46 CFR 282.23 - Hull and machinery insurance.
2010-10-01
... 46 Shipping 8 2010-10-01 2010-10-01 false Hull and machinery insurance. 282.23 Section 282.23... COMMERCE OF THE UNITED STATES Calculation of Subsidy Rates § 282.23 Hull and machinery insurance. (a) Subsidy items. The fair and reasonable net premium costs (including stamp taxes) of hull and machinery...
Double hull oil tankers - how effective are they?
International Nuclear Information System (INIS)
Keith, V.F.
1993-01-01
The groundings of the Exxon Valdez on Bligh Reef in Prince William Sound, spilling more than 10 million gallons of Alaska North Slope crude, and the American Trader off Huntington Beach, spilling almost 400,000 gallons of Alaska North Slope crude, suggest that the construction of oil tankers be re-examined with respect to a design which could reduce both the number and magnitude of oil spills. This paper discusses state-of-the-art tanker technology with respect to spill prevention, effectiveness, and cost. The design features include double hulls, centralized bunker tankers, vacuum-retaining valves, cargo control systems, auxiliary thrusters, electronic charting, and the retransmission of the ship's position. Double hulls provide the highest probability of surviving damage, either from a collision or grounding, with no loss of cargo. Use of double hulls can reduce oil spill incidence by 90 percent in grounding situations and by 75 percent in collisions. The oil spill from the AmericanTrader could have been completely avoided by double hull construction. The arrangement provides spaces below the cargo tanks and on the vessel's sides solely for the carriage of ballast water when the tanker is in ballast condition. These tanks are empty when the tanker is loaded and then also act as the first line of defense in the event of structural damage to the cargo tanks. Tanker design is integrated with port safety measures, including vessel monitoring systems, in this total spill prevention analysis. All aspects of the tanker transportation system are considered
46 CFR 71.50-29 - Hull examination reports.
2010-10-01
... 46 Shipping 3 2010-10-01 2010-10-01 false Hull examination reports. 71.50-29 Section 71.50-29... CERTIFICATION Drydocking § 71.50-29 Hull examination reports. (a) If you use only divers for the underwater survey portion of the Alternative Hull Examination (AHE), you must provide the Officer in Charge, Marine...
46 CFR 71.50-1 - Definitions relating to hull examinations.
2010-10-01
... 46 Shipping 3 2010-10-01 2010-10-01 false Definitions relating to hull examinations. 71.50-1... INSPECTION AND CERTIFICATION Drydocking § 71.50-1 Definitions relating to hull examinations. As used in this part— Adequate hull protection system means a method of protecting the vessel's hull from corrosion. It...
46 CFR 185.602 - Hull markings.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Hull markings. 185.602 Section 185.602 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SMALL PASSENGER VESSELS (UNDER 100 GROSS TONS) OPERATIONS Markings Required § 185.602 Hull markings. (a) Each vessel must be marked as required by part 67...
46 CFR 122.602 - Hull markings.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Hull markings. 122.602 Section 122.602 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SMALL PASSENGER VESSELS CARRYING MORE THAN 150....602 Hull markings. (a) Each vessel must be marked as required by part 67, subpart I, of this chapter...
46 CFR 32.63-5 - Barge hull classifications-B/ALL.
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Barge hull classifications-B/ALL. 32.63-5 Section 32.63..., AND HULL REQUIREMENTS Hull and Cargo Tank Requirements for Tank Barges Constructed or Converted On or After July 1, 1964, and Carrying Certain Dangerous Bulk Cargoes § 32.63-5 Barge hull classifications—B...
Region-of-interest volumetric visual hull refinement
Knoblauch, Daniel; Kuester, Falko
2010-01-01
This paper introduces a region-of-interest visual hull refinement technique, based on flexible voxel grids for volumetric visual hull reconstructions. Region-of-interest refinement is based on a multipass process, beginning with a focussed visual
14 CFR 23.533 - Hull and main float bottom pressures.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Hull and main float bottom pressures. 23... Water Loads § 23.533 Hull and main float bottom pressures. (a) General. The hull and main float....00213; K2=hull station weighing factor, in accordance with figure 2 of appendix I of this part; VS1...
Flaxseed hull: Chemical composition and antioxidant activity during development.
Herchi, Wahid; Al Hujaili, Abdullah D; Sakouhi, Faouzi; Sebei, Khaled; Trabelsi, Hajer; Kallel, Habib; Boukhchina, Sadok
2014-01-01
Changes in the chemical composition and antioxidant activity of flaxseed hull during maturation were investigated. P129 hull variety was studied at four maturation stages (St1, St2, St3, and St4). Significant variation in proximate composition and flaxseed hull oil characteristics were observed. A significant increase in the carbohydrates content of the hull was observed during development. The main methyl esters were linolenic acid (48.95 - 51.52 %), oleic acid (20.27-23.41%) and linoleic acid (15.62-17.70%). The highest polyunsaturated fatty acids (PUFA) were found to be 67.14 % at the first stage of maturity (St1). Flaxseed hull oil was of good quality, containing an abundance of omega-3 essential fatty acids. The iodine value increased, while the saponification value of oil decreased during seed development. The decrease in ascorbic acid content was steady. The maximum level of total phenolic acid content (128.3 mg/100 g oil) was reached at 7 DAF. The antioxidant activity of oilseed was assessed by means of 2, 2-diphenyl-1-picrylhydrazyl (DPPH) radical-scavenging assay. Radical scavenging activity for green hull was 52.74% and mature hull was 69.32%.
46 CFR 308.107 - War risk hull insurance policy.
2010-10-01
... 46 Shipping 8 2010-10-01 2010-10-01 false War risk hull insurance policy. 308.107 Section 308.107 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION EMERGENCY OPERATIONS WAR RISK INSURANCE War Risk Hull and Disbursements Insurance § 308.107 War risk hull insurance policy. Standard Form MA-240...
Calculation of Flows Over Underwater Bodies with Hull, Sail and Appendages
International Nuclear Information System (INIS)
Shoab, M.; Ayub, M.; Bilal, S.; Zahir, S.; Khan, M.A.
2004-01-01
A comprehensive study has been made for the hydrodynamic analysis of the submarine DARPA 2. The analysis was first performed for hull, then hull with sail on top and then for the complete submarine including hull, sail and appendages. A comparison of tangential velocity and pressure distribution for hull is accomplished using CFD flow solvers and published data. Further, the pressure distribution over the hull with sail is also analyzed. Finally, pressure distribution, forces and moments were calculated over the complete submarine including hull, sail and appendages. Comparison 01 pressure distribution and tangential velocity for the hull show a good agreement with published data. Pressure coefficient comparison for the hull with sail shows the good CFD-CFD agreement. Comparison of Normal force and pitching moment of complete submarine having hull, sail and appendages shows a reasonable agreement with the experimental results of DARPA 2. Both quantitative and qualitative analysis of the complete submarine estimates the required design force and moment at different angles of attack and also demonstrate the flow visualization. (author)
46 CFR 169.231 - Definitions relating to hull examinations.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Definitions relating to hull examinations. 169.231... hull examinations. As used in the part— (a) Drydock examination means hauling out a vessel or placing a... and all through-hull fittings, sea chests, sea valves, sea strainers, and valves for the emergency...
Study on the natural pigments present in the Hulls of Garcinia Mangostana Linn
International Nuclear Information System (INIS)
San Dar Aung; Aye Aye Tun; San San Aye; Maung Maung Htay
2005-09-01
Garcinia mangostana Linn,(Family; Guttiferae) is known to be a rich source of bioactive molecules including flavonoids, benzophenones and lactones. A variety of xanthones have been isolated from mangosteen plants and fruits include the hull, rind heartwood and flesh. The fruit hull is used as an astringent and also used against cholera, dysentery and diarrhoea in traditional medicinal system. Petroleum ether extraction of the dried and powered fruit hulls followed by column chromatographic separation afforded two compounds, namely, gartanin (1) (0.48% in yield, mp 146-152 ) and mangostin (2) (0.97% in yield, mp (179-180). The structures of these two compounds have been identified by UV, FT-IR, NMR and EIMS. These identifications were confirmed by comparison of melting point values with reported data in the literature
46 CFR 115.630 - The Alternative Hull Examination (AHE) Program application.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false The Alternative Hull Examination (AHE) Program... PASSENGERS INSPECTION AND CERTIFICATION Hull and Tailshaft Examinations § 115.630 The Alternative Hull... hull examination date to the Officer in Charge, Marine Inspection (OCMI) who will oversee the survey...
Evaluation of the biological activity of sunflower hull extracts
Energy Technology Data Exchange (ETDEWEB)
Taha, F. S.; Wagdy, S. M.; Hassanein, M. M. M.; Hamed, S. F.
2012-11-01
This work was planned with the aim of adding value to sunflower seed hulls, a waste product of the oil industry by preparing a sunflower hull phenolic extract rich in chlorogenic acid (CGA). In order to fulfill this goal, the optimization for the extraction of a phenolic extract from the hulls was investigated. The parameters studied were: type of solvent, solvent to water ratio and hull to solvent ratio. In addition, the solvent mixtures were also studied. The resulting phenolic extracts were evaluated for their biological activities. This included phenolic content determination, evaluation of the antioxidant and antimicrobial activities. Chlorogenic acid was determined in two chosen hull extracts using the UV spectrophotometric method and HPLC analysis. The anti carcinogenic activity of the two chosen extracts was tested on seven different cell line carcinomas. The results revealed that all the phenolic extracts of sunflower hull studied contain between 190-312.5 mg phenolics/ 100 g hulls. The highest phenolic extraction was achieved with 80% methanol (1:30, hull to solvent, w/v ratio) and methanol to ethanol to water (7:7:6 v/v/v) mixture with values of 312.5 and 306.5 mg phenolics/100 g hulls, respectively. The free radical scavenging activity and antioxidant activity of all the samples ranged from 33.6-72.6%. The highest antioxidant activity and free radical scavenging activity were achieved by the same extracts that possessed the highest phenolic content, namely methanol to ethanol to water extract and 80% methanol with values 71.8 and 72.6%, 68.2 and 70.9% respectively, compared to 77.9 and 76.9% respectively for TBHQ. All the phenolic extracts possessed antimicrobial activity but to different levels against different pathogenic bacteria. The two chosen extracts also possessed anti carcinogenic activity, which differed among varying cell line carcinomas. The HPLC analysis indicated that chlorogenic acid was the main phenolic acid in the extract. Thus it can
Estimation of penetration depth of fission products in cladding Hull
International Nuclear Information System (INIS)
Kim, Hee Moon; Jung, Yang Hong; Yoo, Byong Ok; Choo, Yong Sun; Hong, Kwon Pyo
2005-01-01
A disposal and a reprocessing for spent fuel rod with high burnup need de-cladding procedure. Pellet in this rod has been separated from a cladding hull to reduce a radioactivity of hull by chemical and mechanical methods. But fission products and actinides(U,Pu) still remain inside of cladding hull by chemical bonding and fission spike, which is called as 'contamination'. More specific removal of this contamination would have been considered. In this study, the sorts of fission products and penetration depth in hull were observed by EPMA test. To analyze this behavior, SRIM 2000 code was also used as energies of fission products and an oxide thickness of hull
14 CFR 29.519 - Hull type rotorcraft: Water-based and amphibian.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Hull type rotorcraft: Water-based and... § 29.519 Hull type rotorcraft: Water-based and amphibian. (a) General. For hull type rotorcraft, the... along and among the hull and auxiliary floats, if used, in a rational and conservative manner, assuming...
Treatment of zircaloy cladding hulls by isostatic pressing
International Nuclear Information System (INIS)
Tegman, R.; Burstroem, M.
1984-12-01
A method for the treatment of Zircaloy fuel hulls is proposed. It involves hot isostatic pressing (HIP) for making large, completely densified metallic bodies of the waste. The hulls are packed into a bellows-shaped container of steel. On packing the fuel hulls give a filling factor of only 14%, which is too low for non-deformable compaction in a normal container, but by using a belloped container, a non-deformable compaction can be obtained without any pretreatment of the hulls. Fully dense and mechanically strong blocks of Zircaloy can be fabricated by holding them at temperatures of around 1000 degrees C for three hours. It is also feasible to incorporate the other metallic parts of the fuel bundle, such as top and bottom tie plates and spacers, in the pressing. The HIP-densified hulls provide an effective means of self-containment of radioactive waste due to the excellent corrosion resistance of Zircaloy. A waste loading factor of close to 100% can be realized. Futher, a volume reduction factor of 7 and a surface reduction factor of aout 250 for a 1-ton canister can be achieved. Equilibrium calculations have shown that tritium present in the hulls can quantitatively be contained in the HIPed block. A study has been made of a possible process for industrilscale use. (Author)
Decontamination of fast reactor hulls and properties of immobilised waste forms
International Nuclear Information System (INIS)
Biddle, P.; Brown, P.E.; Rees, J.H.
1986-01-01
The studies described in this Report have been carried out on five batches of stainless steel hulls resulting from the reprocessing of fuel from the Prototype Fast Reactor at Dounreay. Direct immobilisation in cement and decontamination have been examined as possible routes for treating the hulls. A number of low temperature chemical techniques have been used to remove actinides and fission products from the hulls. The levels of α-activity could be reduced to less than 0.3 Ci/te of hulls. Thus decontamination might permit cheaper disposal than would be the case for undecontaminated hulls. 10mm sections of hulls have been immobilised in two cements in which either sand or blast furnace slag was used to extend the ordinary Portland cement. The level of Cs-137 leached from hulls immobilised in either of the cement compositions was about an order of magnitude lower than that leached from the bare hulls. For Sr-90, the BFS/OPC matrix gave a tenfold better retention than the sand/OPC. Ru-106 and Sb-125 were leached from the sand/OPC but not from the BFS/OPC samples. The preliminary studies suggested that cement was a satisfactory matrix for immobilising hulls and that the BFS/OPC was the better formulation. 30 refs, 26 tabs, 23 figs
Iron-59 absorption from soy hulls: intrinsic vs extrinsic labeling
International Nuclear Information System (INIS)
Lykken, G.I.; Mahalko, J.R.; Nielsen, E.J.; Dintzis, F.R.
1986-01-01
As part of an evaluation of the validity of the extrinsic labeling technique for measuring iron absorption, absorption from soy hulls extrinsically labeled ( 59 Fe added to bread dough) was compared with that from soy hulls intrinsically labeled ( 59 Fe incorporated into the soy plant during growth). Century soybeans were grown in a greenhouse. After pods had formed and were filling, each plant was stem injected twice, at 3 day intervals, with 22 μCi 59 Fe as FeCl 2 in 25 μl of 0.5 M HCl solution. After the plants had senesced, the soybeans were harvested, dried, shelled and the hulls removed. Standard meals containing 3.5 mg Fe/meal and up to 0.06 μCi 59 Fe in a soy hull bun were fed on 2 consecutive days to free-living volunteers in a crossover design. Absorption of 59 Fe was greater from intrinsically labeled soy hulls than from extrinsically labeled soy hulls, 20 +/- 20% vs 15 +/- 11% (n=14, p > 0.05 by paired t-test). Apparent absorption ranged from 1.3% to 77% from intrinsically labeled soy hulls and .5% to 29% from extrinsically labeled soy hulls with the highest absorption occurring in persons with low serum ferritin (S.F. < 8 ng/ml). These findings provide additional evidence that the extrinsic labeling method is a valid measure of iron bioavailability to humans
Inspecting the inside of underwater hull
Valkovic, Vladivoj; Sudac, Davorin
2009-05-01
In order to demonstrate the possibility of identifying the material within ship's underwater hull, sunken ships and other objects on the sea floor tests with the 14 MeV sealed tube neutron generator incorporated inside a small submarine submerged in the test basin filled with sea water have been performed. Results obtained for inspection of diesel fuel and explosive presence behind single and double hull constructions are presented.
Region-of-interest volumetric visual hull refinement
Knoblauch, Daniel
2010-01-01
This paper introduces a region-of-interest visual hull refinement technique, based on flexible voxel grids for volumetric visual hull reconstructions. Region-of-interest refinement is based on a multipass process, beginning with a focussed visual hull reconstruction, resulting in a first 3D approximation of the target, followed by a region-of-interest estimation, tasked with identifying features of interest, which in turn are used to locally refine the voxel grid and extract a higher-resolution surface representation for those regions. This approach is illustrated for the reconstruction of avatars for use in tele-immersion environments, where head and hand regions are of higher interest. To allow reproducability and direct comparison a publicly available data set for human visual hull reconstruction is used. This paper shows that region-of-interest reconstruction of the target is faster and visually comparable to higher resolution focused visual hull reconstructions. This approach reduces the amount of data generated through the reconstruction, allowing faster post processing, as rendering or networking of the surface voxels. Reconstruction speeds support smooth interactions between the avatar and the virtual environment, while the improved resolution of its facial region and hands creates a higher-degree of immersion and potentially impacts the perception of body language, facial expressions and eye-to-eye contact. Copyright © 2010 by the Association for Computing Machinery, Inc.
Use of Jatropha curcas hull biomass for bioactive compost production
Energy Technology Data Exchange (ETDEWEB)
Sharma, D.K. [Division of Environmental Sciences, Indian Agricultural Research Institute, New Delhi 110012 (India); Pandey, A.K.; Lata [Division of Microbiology, Indian Agricultural Research Institute, New Delhi 110012 (India)
2009-01-15
The paper deals with utilization of biomass of Jatropha hulls for production of bioactive compost. In the process of Jatropha oil extraction, a large amount of hull waste is generated. It has been found that the direct incorporation of hull into soil is considerably inefficient in providing value addition to soil due to its unfavorable physicochemical characteristics (high pH, EC and phenolic content). An alternative to this problem is the bioconversion of Jatropha hulls using effective lignocellulolytic fungal consortium, which can reduce the phytotoxicity of the degraded material. Inoculation with the fungal consortium resulted in better compost of jatropha hulls within 1 month, but it takes nearly 4 months for complete compost maturation as evident from the results of phytotoxicity test. Such compost can be applied to the acidic soil as a remedial organic manure to help maintaining sustainability of the agro-ecosystem. Likewise, high levels of cellulolytic enzymes observed during bioconversion indicate possible use of fungi for ethanol production from fermentation of hulls. (author)
A Study on the Radioactivity Reduction Method for the Decladding Hull
International Nuclear Information System (INIS)
Kim, Jong Ho; Jung, In Ha; Park, Jang Jin; Shin, Jin Myeong; Lee, Ho Hee; Yang, Myung Seung
1994-01-01
The cladding materials remaining after reprocessing process of the nuclear fuel, generally called as hulls, are classified as a high-level radioactive waste. They are usually packaged in the container for disposal after being compacted, melted, or solidified into the matrix. The efforts to fabricated a better ingot for a more favorable disposal to the environment have failed due to the technical difficulties encountered in the chemical decontamination method. In the early 1990s, the accumulation of radio-chemical data on hulls and the advent of new technology such as a laser or plasma have made the pre-treatment of the hulls mere efficient. This paper summarizes the information regarding the radio-chemical analysis of the hull through a literature survey and determines the characteristics of the hull and depth profile of the radio-nuclides within the hull thickness. The feasibility study was carried out to evaluate the reduction of the radioactivity by peeling off the surface of the hull with the application of laser technology
46 CFR 71.50-25 - Alternative Hull Examination (AHE) procedure.
2010-10-01
... 46 Shipping 3 2010-10-01 2010-10-01 false Alternative Hull Examination (AHE) procedure. 71.50-25... INSPECTION AND CERTIFICATION Drydocking § 71.50-25 Alternative Hull Examination (AHE) procedure. (a) To complete the underwater survey you must— (1) Perform a general examination of the underwater hull plating...
Automatic Generation of the Planning Tunnel High Speed Craft Hull Form
Institute of Scientific and Technical Information of China (English)
Morteza Ghassabzadeh; Hassan Ghassemi
2012-01-01
The creation of geometric model of a ship to determine the characteristics of hydrostatic and hydrodynamic,and also for structural design and equipments arrangement are so important in the ship design process.Planning tunnel high speed craft is one of the crafts in which,achievement to their top speed is more important.These crafts with the use of tunnel have the aero-hydrodynamics properties to diminish the resistance,good sea-keeping behavior,reduce slamming and avoid porpoising.Because of the existence of the tunnel,the hull form generation of these crafts is more complex and difficult.In this paper,it has attempted to provide a method based on geometry creation guidelines and with an entry of the least control and hull form adjustment parameters,to generate automatically the hull form of planning tunnel craft.At first,the equations of mathematical model are described and subsequent,three different models generated based on present method are compared and analyzed.Obviously,the generated model has more application in the early stages of design.
Convex Hull Aided Registration Method (CHARM).
Fan, Jingfan; Yang, Jian; Zhao, Yitian; Ai, Danni; Liu, Yonghuai; Wang, Ge; Wang, Yongtian
2017-09-01
Non-rigid registration finds many applications such as photogrammetry, motion tracking, model retrieval, and object recognition. In this paper we propose a novel convex hull aided registration method (CHARM) to match two point sets subject to a non-rigid transformation. First, two convex hulls are extracted from the source and target respectively. Then, all points of the point sets are projected onto the reference plane through each triangular facet of the hulls. From these projections, invariant features are extracted and matched optimally. The matched feature point pairs are mapped back onto the triangular facets of the convex hulls to remove outliers that are outside any relevant triangular facet. The rigid transformation from the source to the target is robustly estimated by the random sample consensus (RANSAC) scheme through minimizing the distance between the matched feature point pairs. Finally, these feature points are utilized as the control points to achieve non-rigid deformation in the form of thin-plate spline of the entire source point set towards the target one. The experimental results based on both synthetic and real data show that the proposed algorithm outperforms several state-of-the-art ones with respect to sampling, rotational angle, and data noise. In addition, the proposed CHARM algorithm also shows higher computational efficiency compared to these methods.
Development on the automatic separator of separation of residual powders from SF hulls
International Nuclear Information System (INIS)
Jung, Jae Hoo; Kim, Young Hwang; Kim, Ki Ho; Park, Byung Buk; Lee, Hyo Jik; Kim, Sung Hyun; Park, Hee Sung; Lee, Jong Kwang; Kim, Ho Dong
2009-12-01
At the previous process of auto hull separator, vol-oxidizer convert UO 2 pellets to U 3 O 8 powder, and in the next step, hulls and powders is collected into each part of two vessels. In order to enhance the recover rate, fine powders on the surface of hulls should be removed from hulls. Auto hulls separator for fine powders is a device which can separate fine powders from hulls. In order to design and manufacture this device, we analyzed fine powders which are remained on the surface of hulls for separation properties, and selected separation and operation methods. Also, the main mechanism is devised by using the design considerations. These main mechanism consists of rotation drum, parts feeder, hull conveyer, powders separator, air shower, and vessels. Design considerations for auto hulls separator as follows ; capacity : 100 kg HM/batch, rod-cut length : 50 mm, recovery rate for fine powders : 95 % and operation condition : over 12 hrs/batch. We considered connection methods of the vessel and high vacuum module which can join with the outlet of auto hulls separator. Also, by using the above results, we have manufactured auto hulls separator for fine powders, and conducted blank tests for operation condition. Here, hulls of 50 mm length for test are used with 20 kg HM/batch. We have conducted separation tests of 2 batches to collect fine powders with hulls of 10 kg HM/batch. Our goal of recovery rate was 95%, but in the test result, the recovery rate of fine powders on the surface of hulls was over 96 %
14 CFR 23.529 - Hull and main float landing conditions.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Hull and main float landing conditions. 23... Water Loads § 23.529 Hull and main float landing conditions. (a) Symmetrical step, bow, and stern... directed perpendicularly to the keel line. (b) Unsymmetrical landing for hull and single float seaplanes...
33 CFR 181.27 - Information displayed near hull identification number.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Information displayed near hull... displayed near hull identification number. With the exception of the characters “US-”, which constitute the... the 12-character hull identification number (HIN), that information must be separated from the HIN by...
46 CFR 167.15-27 - Definitions relating to hull examinations.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Definitions relating to hull examinations. 167.15-27... PUBLIC NAUTICAL SCHOOL SHIPS Inspections § 167.15-27 Definitions relating to hull examinations. As used... slipway for an examination of all accessible parts of the vessel's underwater body and all through-hull...
Feasibility of Using Rice Hulls as Bedding for Laboratory Mice.
Carbone, Elizabeth T; Kass, Philip H; Evans, Kristin D
2016-01-01
Factors that are considered when selecting laboratory mouse bedding include animal health and comfort, cost, effects on personnel, and bioactive properties. Corncob is economical and facilitates low intracage ammonia but has undesirable influences on some endocrine studies. Rice hulls are an economical material that has not been well characterized as a bedding substrate. In this pilot study, we compared various aspects of bedding performance of rice hulls and other materials. On a per-volume basis, rice hulls were less absorbent than was corncob bedding. Rice hulls had higher odds than did corncob or reclaimed wood pulp of having moisture present at the bedding surface. The results of the absorbency tests coupled with the results of preliminary monitoring of intracage ammonia raised concern about the ability of rice hulls to control ammonia levels sufficiently in cages with high occupancy. However, ammonia was negligible when cages contained 5 young adult female mice. The relative expression of 3 cytochrome p450 genes was compared among mice housed on rice hulls, corncob, reclaimed wood pulp, or pine shavings. The expression of Cyp1a2 was 1.7 times higher in the livers of mice housed on rice hulls than on pine shavings, but other differences were not statistically significant. This study provides information on the merits of rice hulls as laboratory mouse bedding. Their relatively poor moisture control is a major disadvantage that might preclude their widespread use.
46 CFR 78.50-5 - Hull markings.
2010-10-01
... 46 Shipping 3 2010-10-01 2010-10-01 false Hull markings. 78.50-5 Section 78.50-5 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PASSENGER VESSELS OPERATIONS Markings on Vessels § 78.50-5 Hull markings. Vessels shall be marked as required by parts 67 and 69 of this chapter. [CGD 72...
46 CFR 196.40-5 - Hull markings.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Hull markings. 196.40-5 Section 196.40-5 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS OPERATIONS Markings on Vessels § 196.40-5 Hull markings. Vessels shall be marked as required by parts 67 and 69 of this chapter...
46 CFR 97.40-5 - Hull markings.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Hull markings. 97.40-5 Section 97.40-5 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) CARGO AND MISCELLANEOUS VESSELS OPERATIONS Markings on Vessels § 97.40-5 Hull markings. Vessels shall be marked as required by parts 67 and 69 of this...
Soybean hulls as an iron source for bread enrichment
International Nuclear Information System (INIS)
Johnson, C.D.; Berry, M.F.; Weaver, C.M.
1985-01-01
Soybean hulls, a concentrated source of iron, may have potential as a source of iron fortification in baked products. Retention of 59 Fe in rats from white bread containing intrinsically labeled soybean hulls did not differ significantly (p<0.05) from extrinsically labeled white bread fortified with bakery grade ferrous sulfate (70.4 and 63.1%, respectively). Physical and sensory evaluations of bread containing up to 5% soybean hulls did not differ from white bread in loaf volume, cross-sectional area, tenderness or overall acceptance. These results suggest that soybean hulls are a good source of available iron and may be added to bakery products without deleterious effects in baking performance and sensory acceptability
37 CFR 212.5 - Recordation of distinctive identification of vessel hull designer.
2010-07-01
... identification of vessel hull designer. 212.5 Section 212.5 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT OFFICE AND PROCEDURES PROTECTION OF VESSEL HULL DESIGNS § 212.5 Recordation of distinctive identification of vessel hull designer. (a) General. Any owner of a vessel hull may...
14 CFR 23.531 - Hull and main float takeoff condition.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Hull and main float takeoff condition. 23.531 Section 23.531 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION... Water Loads § 23.531 Hull and main float takeoff condition. For the wing and its attachment to the hull...
33 CFR 80.135 - Hull, MA to Race Point, MA.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Hull, MA to Race Point, MA. 80... INTERNATIONAL NAVIGATION RULES COLREGS DEMARCATION LINES Atlantic Coast § 80.135 Hull, MA to Race Point, MA. (a... the east coast of Massachusetts from the easternmost radio tower at Hull, charted in approximate...
Characterisation of the activities associated with fast reactor cladding hulls
International Nuclear Information System (INIS)
Biddle, P.; Rees, J.H.
1987-01-01
Four batches of hulls from the reprocessing of fuel from the Prototype Fast Reactor at Dounreay have been examined visually and photographically. The appearance of the hulls (shiny or black) depended on the original location in the fuel pin. The total fissile activities measured corresponded to less than 0.1% or the original fuel. The α-emitter, fission product and activation product activities have been determined from dissolution studies. Profile diagrams have been constructed for the distribution of the principal activities along lengths of seventeen hulls. The evidence obtained suggested that much of the activity on the hulls arose through deposition from the dissolver liquors. The deposits included insoluble particulate material which was thought to be responsible for the wide variations in activity across short lengths of some of the hulls. (orig.)
Energy utilisation of biowaste - Sunflower-seed hulls for co-firing with coal
Energy Technology Data Exchange (ETDEWEB)
Raclavska, Helena; Juchelkova, Dagmar; Roubicek, Vaclav; Matysek, Dalibor [VSB-Technical University of Ostrava, 17. listopadu 15, CZ-70833 Ostrava (Czech Republic)
2011-01-15
Sunflower-seed hulls (SSH) represent a source of combustible biomass characterised by high contents of potassium and phosphorus and a low silica content. The relatively high net calorific value of 20 MJ/kg d.m. is mainly influenced by the lignin content. Potassium and phosphorus are very important elements in biomass combustion for fuel, influencing slagging and fouling problems. Mixtures with different ratios of brown coal and sunflower-seed hulls (0-22% SSH) were co-fired in the Olomouc power plant. The behaviour of elements in the fly ash and the bottom ash (SiO{sub 2}, Al{sub 2}O{sub 3}, K{sub 2}O, P{sub 2}O{sub 5}, Zn, Cu and Cd) varied in relation to the amount of SSH added to the coal. The fly ash from the co-firing of 20% SSH with coal had a high content of water-leachable sulphates and total dissolved solids. The utilisation of fly ash in civil engineering (land reclamation) should fulfil criteria established by the Council Decision 2003/33/EC for non-hazardous waste. To ensure that the required water-leachable sulphate concentrations are within regulatory limits the fuel may contain a maximum of 14% SSH. (author)
Evaluation of Composite-Hull Ships Operating in Arctic Ice
2016-06-01
COMPOSITE- HULL SHIPS OPERATING IN ARCTIC ICE by Ryan M. Tran June 2016 Thesis Advisor: Young W. Kwon Co-Advisor: Jarema M. Didoszak THIS...Master’s thesis 4. TITLE AND SUBTITLE EVALUATION OF COMPOSITE- HULL SHIPS OPERATING IN ARCTIC ICE 5. FUNDING NUMBERS 6. AUTHOR Ryan M. Tran 7...melting ice caps. Extensive research is thus being conducted to determine the interaction between ice and steel- hulls in anticipation of opening sea
Hull loss accident model for narrow body commercial aircraft
Directory of Open Access Journals (Sweden)
Somchanok Tiabtiamrat
2010-10-01
Full Text Available Accidents with narrow body aircraft were statistically evaluated covering six families of commercial aircraft includingBoeing B737, Airbus A320, McDonnell Douglas MD80, Tupolev TU134/TU154 and Antonov AN124. A risk indicator for eachflight phase was developed based on motion characteristics, duration time, and the presence of adverse weather conditions.The estimated risk levels based on these risk indicators then developed from the risk indicator. Regression analysis indicatedvery good agreement between the estimated risk level and the accident ratio of hull loss cases per number of delivered aircraft.The effect of time on the hull loss accident ratio per delivered aircraft was assessed for B737, A320 and MD80. Equationsrepresenting the effect of time on hull loss accident ratio per delivered aircraft were proposed for B737, A320, and MD80,while average values of hull loss accident ratio per delivered aircraft were found for TU134, TU154, and AN 124. Accidentprobability equations were then developed for each family of aircraft that the probability of an aircraft in a hull loss accidentcould be estimated for any aircraft family, flight phase, presence of adverse weather factor, hour of day, day of week, monthof year, pilot age, and pilot flight hour experience. A simplified relationship between estimated hull loss accident probabilityand unsafe acts by human was proposed. Numerical investigation of the relationship between unsafe acts by human andfatality ratio suggested that the fatality ratio in hull loss accident was dominated primarily by the flight phase media.
14 CFR 23.527 - Hull and main float load factors.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Hull and main float load factors. 23.527... Water Loads § 23.527 Hull and main float load factors. (a) Water reaction load factors nw must be...=seaplane landing weight in pounds. (6) K1=empirical hull station weighing factor, in accordance with figure...
7 CFR 319.8-9 - Hull fiber and gin trash.
2010-01-01
... 7 Agriculture 5 2010-01-01 2010-01-01 false Hull fiber and gin trash. 319.8-9 Section 319.8-9 Agriculture Regulations of the Department of Agriculture (Continued) ANIMAL AND PLANT HEALTH INSPECTION... Importation and Entry of Cotton and Covers § 319.8-9 Hull fiber and gin trash. (a) Entry of hull fiber will be...
Safety Evaluation for Hull Waste Treatment Process in JNC
International Nuclear Information System (INIS)
Kojima, H.; Kurakata, K.
2002-01-01
Hull wastes and some scrapped equipment are typical radioactive wastes generated from reprocessing process in Tokai Reprocessing Plant (TRP). Because hulls are the wastes remained in the fuel shearing and dissolution, they contain high radioactivity. Japan Nuclear Cycle Development Institute (JNC) has started the project of Hull Waste Treatment Facility (HWTF) to treat these solid wastes using compaction and incineration methods since 1993. It is said that Zircaloy fines generated from compaction process might burn and explode intensely. Therefore explosive conditions of the fines generated in compaction process were measured. As these results, it was concluded that the fines generated from the compaction process were not hazardous material. This paper describes the outline of the treatment process of hulls and results of safety evaluation
Experimental Evaluation of the Hydrodynamic Response of Crew Boat Hulls
DEFF Research Database (Denmark)
Pecher, Arthur; Kofoed, Jens Peter
This report presents the results of an experimental study on 3 different hulls of crew boats intended for service to offshore wind turbines. Their hydrodynamic behaviour has been tested in various sea states representing general wave conditions that could be expected at offshore wind farms. Two...... main setups were used during the tests, corresponding to the hulls being connected to an offshore windmill and being free floating. The following aspects were the main subjects of investigation: • The Response Amplitude Operators of the hulls in two different configurations and with waves coming from 3...... different directions. • The connection forces between the hulls and the wind turbine pile. • The natural frequency of oscillation. For the study, realistic scale models of the hulls of the crew boats were supplied by the client, Hauschildt Marine. The laboratory tests were performed by Arthur Pecher under...
46 CFR 176.630 - The Alternative Hull Examination (AHE) Program application.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false The Alternative Hull Examination (AHE) Program... PASSENGER VESSELS (UNDER 100 GROSS TONS) INSPECTION AND CERTIFICATION Hull and Tailshaft Examinations § 176.630 The Alternative Hull Examination (AHE) Program application. If your vessel meets the eligibility...
Amico, Vincenzo; Barresi, Vincenza; Condorelli, Daniele; Spatafora, Carmela; Tringali, Corrado
2006-02-08
Bioassay-guided fractionation of the EtOAc crude extract from Sicilian almond hulls, a waste material from Prunus dulcis crop, allowed identification of 10 constituents, isolated as pure compounds (1-5, 7, and 10) or unseparable mixtures (5 + 6 and 8 + 9). All compounds were subjected to spectroscopic analysis and 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyl tetrazolium bromide bioassay on MCF-7 human breast cancer cells. In addition to the main components oleanolic (1), ursolic (2), and betulinic (3) acids, the 2-hydroxy analogues alphitolic (4), corosolic (5), and maslinic (6) acids, as well as the related aldehydes, namely, betulinic (7), oleanolic (8), and ursolic (9), were identified. From a more polar fraction, the beta-sitosterol 3-O-glucoside (10) was also identified. A sample of commercially available betulin (11) was also included in bioassays as further support to a structure-activity relationship study. Betulinic acid showed antiproliferative activity toward MCF-7 cells (GI50 = 0.27 microM), higher than the anticancer drug 5-fluorouracil.
Effects of Geometry on the Steady Performance of Planing Hulls
DEFF Research Database (Denmark)
Wagner, M. K.; Andersen, Poul
2003-01-01
A vortex-lattice method is applied to planing hull forms. The geometry of the jet surfaces next to the wetted hull is estimated on the basis of the hull geometry while its sidewise extent has been found numerically applying a non-linear free-surface pressure condition in the jet region. The method...... is applied to practical hull forms with chines spray rails and with varying deadrise over the length of the boat. The deadrise variation has a large influence on lift and drag. For a design situation, where the total lift and centre of effort is given, the influence on the total drag is less due to change...
46 CFR 91.15-1 - Standards in inspection of hulls, boilers, and machinery.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Standards in inspection of hulls, boilers, and machinery... hulls, boilers, and machinery. In the inspection of hulls, boilers, and machinery of vessels, the..., respecting material and inspection of hulls, boilers, and machinery, and the certificate of classification...
46 CFR 189.15-1 - Standards in inspection of hulls, boilers, and machinery.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Standards in inspection of hulls, boilers, and machinery... inspection of hulls, boilers, and machinery. In the inspection of hulls, boilers, and machinery of vessels... chapter, respecting material and construction of hulls, boilers, and machinery, and certificate of...
Measurement of dose rate and estimation of beta activity in zircaloy hull drum
International Nuclear Information System (INIS)
Pandey, J.P.N.; Kumar, Pankaj; Shinde, A.M.; Purohit, R.G.; Sarkar, P.K.
2012-01-01
Fuel Reprocessing Plant is designed for the processing of spent fuel from reactor for the recovery of plutonium and uranium as PuO 2 and U 3 O 8 respectively. Zircaloy is used as cladding material of natural uranium fuel pins used in the reactors. In reprocessing plants chop and leach method is used to remove the zircaloy clad from the fuel matrix during Head End Treatment. Initially spent fuel bundles are chopped into pieces and collected in perforated baskets kept in dissolvers. All chopped pieces are dissolved in HNO 3 in the dissolvers followed by heating and boiling. Dissolved solutions are transferred to Filtrate Tank (FT) leaving behind un-dissolved zircoloy hull pieces in the dissolver baskets. Un-dissolved and almost dry hull pieces are transferred in hull drum from the dissolver baskets using the Hull Tilting Facility. Hull drums are made of stainless steel having 500 litre capacity and two third of its volume is filled with zircoloy pieces. Hull drums filled with hull pieces are loaded in Hull Removal Cask (HRC) and transported to SWMF (Solid Waste Management Facility) site for interim storage/disposal in tile holes. Hull pieces are high active solid wastes which contain significant amount of fission products. Radiation levels on hull drums are in the range of few hundreds of mGy/h which has high potential of external hazards if not handled properly. Therefore hull drums are handled remotely in specially designed lead shielded cask
Hull-Propeller Interaction and Its Effect on Propeller Cavitation
DEFF Research Database (Denmark)
Regener, Pelle Bo
In order to predict the required propulsion power for a ship reliably and accurately, it is not sufficient to only evaluate the resistance of the hull and the propeller performance in open water alone. Interaction effects between hull and propeller can even be a decisive factor in ship powering...... prediction and design optimization. The hull-propeller interaction coefficients of effective wake fraction, thrust deduction factor, and relative rotative efficiency are traditionally determined by model tests. Self-propulsion model tests consistently show an increase in effective wake fractions when using...... velocities. This offers an opportunity for additional insight into hull-propeller interaction and the propeller’s actual operating condition behind the ship, as the actual (effective) inflow is computed. Self-propulsion simulations at model and full scale were carried out for a bulk carrier, once...
46 CFR 45.135 - Hull openings at or below freeboard deck.
2010-10-01
... 46 Shipping 2 2010-10-01 2010-10-01 false Hull openings at or below freeboard deck. 45.135 Section 45.135 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) LOAD LINES GREAT LAKES LOAD LINES Conditions of Assignment § 45.135 Hull openings at or below freeboard deck. Closures for hull...
Preconditioning 2D Integer Data for Fast Convex Hull Computations.
Cadenas, José Oswaldo; Megson, Graham M; Luengo Hendriks, Cris L
2016-01-01
In order to accelerate computing the convex hull on a set of n points, a heuristic procedure is often applied to reduce the number of points to a set of s points, s ≤ n, which also contains the same hull. We present an algorithm to precondition 2D data with integer coordinates bounded by a box of size p × q before building a 2D convex hull, with three distinct advantages. First, we prove that under the condition min(p, q) ≤ n the algorithm executes in time within O(n); second, no explicit sorting of data is required; and third, the reduced set of s points forms a simple polygonal chain and thus can be directly pipelined into an O(n) time convex hull algorithm. This paper empirically evaluates and quantifies the speed up gained by preconditioning a set of points by a method based on the proposed algorithm before using common convex hull algorithms to build the final hull. A speedup factor of at least four is consistently found from experiments on various datasets when the condition min(p, q) ≤ n holds; the smaller the ratio min(p, q)/n is in the dataset, the greater the speedup factor achieved.
DECONTAMINATION OF ZIRCALOY SPENT FUEL CLADDING HULLS
International Nuclear Information System (INIS)
Rudisill, T; John Mickalonis, J
2006-01-01
The reprocessing of commercial spent nuclear fuel (SNF) generates a Zircaloy cladding hull waste which requires disposal as a high level waste in the geologic repository. The hulls are primarily contaminated with fission products and actinides from the fuel. During fuel irradiation, these contaminants are deposited in a thin layer of zirconium oxide (ZrO 2 ) which forms on the cladding surface at the elevated temperatures present in a nuclear reactor. Therefore, if the hulls are treated to remove the ZrO 2 layer, a majority of the contamination will be removed and the hulls could potentially meet acceptance criteria for disposal as a low level waste (LLW). Discard of the hulls as a LLW would result in significant savings due to the high costs associated with geologic disposal. To assess the feasibility of decontaminating spent fuel cladding hulls, two treatment processes developed for dissolving fuels containing zirconium (Zr) metal or alloys were evaluated. Small-scale dissolution experiments were performed using the ZIRFLEX process which employs a boiling ammonium fluoride (NH 4 F)/ammonium nitrate (NH 4 NO 3 ) solution to dissolve Zr or Zircaloy cladding and a hydrofluoric acid (HF) process developed for complete dissolution of Zr-containing fuels. The feasibility experiments were performed using Zircaloy-4 metal coupons which were electrochemically oxidized to produce a thin ZrO 2 layer on the surface. Once the oxide layer was in place, the ease of removing the layer using methods based on the two processes was evaluated. The ZIRFLEX and HF dissolution processes were both successful in removing a 0.2 mm (thick) oxide layer from Zircaloy-4 coupons. Although the ZIRFLEX process was effective in removing the oxide layer, two potential shortcomings were identified. The formation of ammonium hexafluorozirconate ((NH 4 ) 2 ZrF 6 ) on the metal surface prior to dissolution in the bulk solution could hinder the decontamination process by obstructing the removal of
Non-destructive assay of leached hulls in a nuclear fuel reprocessing plant
International Nuclear Information System (INIS)
Hofstetter, K.J.; Henderson, B.C.; Gray, J.H.; Huff, G.A.
1978-01-01
The hull monitor at the Barnwell Nuclear Fuels Plant (BNFP) will be a remotely controlled, fully automated system designed to quantitatively assay leached hulls for undissolved U and Pu. The hull monitor will assay the hulls from one metric ton of fuel per dissolver basket with the design goal of detecting 0.1% undissolved fuel and yet remain within the framework of the BNFP materials flow of five hull baskets per day. The non-destructive assay will be accomplished using a computer-based gamma-ray pulse height analysis system employing a 5 x 5 inch NaI(Tl) scintillation detector. The intense radiations from the fission product isotopes and the activation product isotopes produced in the reactor prevent direct assay of the undissolved fuel left in the hulls. The measurement will be made indirectly by demonstrating a correlation between the amount of 144 Ce undissolved and the remaining U. The isotope 144 Ce is a direct fission product with high cumulative yield. The daughter isotope 144 Pr has a gamma ray at 2.18 MeV well above other predominant radiations in the spectrum from the major interferences 60 Co, 58 Co, 95 Zr( 95 Nb), 137 Cs and 106 Ru( 106 Rh). Segmented scanning operation of the hull monitor is accomplished by rotation and vertical transversal of the hulls container past the detector station. Proper collimation and absorbers are required to maximize the 144 Ce( 144 Pr) to background ratio. A basket indexer is provided which monitors the scanning rate and ensures repositioning. The leached hull monitor system will be interfaced to a computer-based multichannel analyzer for ease of operation and data handling. A calibration basket has been fabricated to accomodate radioactive sources and inactive Zircaloy hulls
Automated Visual Inspection of Ship Hull Surfaces Using the Wavelet Transform
Directory of Open Access Journals (Sweden)
Carlos Fernández-Isla
2013-01-01
Full Text Available A new online visual inspection technique is proposed, based on a wavelet reconstruction scheme over images obtained from the hull. This type of visual inspection to detect defects in hull surfaces is commonly carried out at shipyards by human inspectors before the hull repair task starts. We propose the use of Shannon entropy for automatic selection of the band for image reconstruction which provides a low decomposition level, thus avoiding excessive degradation of the image, allowing more precise defect segmentation. The proposed method here is capable of on-line assisting to a robotic system to perform grit blasting operations over damage areas of ship hulls. This solution allows a reliable and cost-effective operation for hull grit spot blasting. A prototype of the automated blasting system has been developed and tested in the Spanish NAVANTIA shipyards.
CFD investigation of pentamaran ship model with chine hull form on the resistance characteristics
Yanuar; Sulistyawati, W.
2018-03-01
This paper presents an investigation of pentamaran hull form with chine hull form to the effects of outriggers position, asymmetry, and deadrise angles on the resistance characteristics. The investigation to the resistance characteristics by modelling pentamaran hull form using chine with symmetrical main hull and asymmetric outboard on the variation deadrise angles: 25°, 30°, 35° and Froude number 0,1 to 0,7. On calm water resistance characteristics of six pentamaran models with chine-hull form examined by variation of deadrise angles by using CFD. Comparation with Wigley hull form, the maximum resistance drag reduction of the chine hull form was reduced by 15.81% on deadrise 25°, 13.8% on deadrise 30°, and 20.38% on deadrise 35°. While the smallest value of total resistance coefficient was generated from chine 35° at R/L:1/14 and R/L:1/7. Optimum hull form for minimum resistance has been obtained, so it is interesting to continue with angle of entrance and stem angle of hull for further research.
Antioxidant constituents of almond [Prunus dulcis (Mill.) D.A. Webb] hulls.
Takeoka, Gary R; Dao, Lan T
2003-01-15
Almond hulls (Nonpareil variety) were extracted with methanol and analyzed by reversed phase HPLC with diode array detection. The extract contained 5-O-caffeoylquinic acid (chlorogenic acid), 4-O-caffeoylquinic acid (cryptochlorogenic acid), and 3-O-caffeoylquinic acid (neochlorogenic acid) in the ratio 79.5:14.8:5.7. The chlorogenic acid concentration of almond hulls was 42.52 +/- 4.50 mg/100 g of fresh weight (n = 4; moisture content = 11.39%). Extracts were tested for their ability to inhibit the oxidation of methyl linoleate at 40 degrees C. At an equivalent concentration (10 microg/1 g of methyl linoleate) almond hull extracts had higher antioxidant activity than alpha-tocopherol. At higher concentrations (50 microg/1 g of methyl linoleate) almond hull extracts showed increased antioxidant activity that was similar to chlorogenic acid and morin [2-(2,4-dihydroxyphenyl)-3,5,7-trihydroxy-4H-1-benzopyran-4-one] standards (at the same concentrations). These data indicate that almond hulls are a potential source of these dietary antioxidants. The sterols (3beta,22E)-stigmasta-5,22-dien-3-ol (stigmasterol) and (3beta)-stigmast-5-en-3-ol (beta-sitosterol) (18.9 mg and 16.0 mg/100 g of almond hull, respectively) were identified by GC-MS of the silylated almond hull extract.
Topology Model of the Flow around a Submarine Hull Form
2015-12-01
UNCLASSIFIED Topology Model of the Flow around a Submarine Hull Form S.-K. Lee Maritime Division Defence Science and Technology Group DST-Group–TR...3177 ABSTRACT A topology model constructed from surface-streamer visualisation describes the flow around a generic conventional submarine hull form at...pure yaw angles of 0 ◦, 10 ◦ and 18 ◦. The model is used to develop equations for sway-force and yaw-moment coefficients which relate to the hull - form
Refined universal laws for hull volumes and perimeters in large planar maps
International Nuclear Information System (INIS)
Guitter, Emmanuel
2017-01-01
We consider ensembles of planar maps with two marked vertices at distance k from each other, and look at the closed line separating these vertices and lying at distance d from the first one ( d < k ). This line divides the map into two components, the hull at distance d which corresponds to the part of the map lying on the same side as the first vertex and its complementary. The number of faces within the hull is called the hull volume, and the length of the separating line the hull perimeter. We study the statistics of the hull volume and perimeter for arbitrary d and k in the limit of infinitely large planar quadrangulations, triangulations and Eulerian triangulations. We consider more precisely situations where both d and k become large with the ratio d / k remaining finite. For infinitely large maps, two regimes may be encountered: either the hull has a finite volume and its complementary is infinitely large, or the hull itself has an infinite volume and its complementary is of finite size. We compute the probability for the map to be in either regime as a function of d / k as well as a number of universal statistical laws for the hull perimeter and volume when maps are conditioned to be in one regime or the other. (paper)
76 FR 7757 - Hull Identification Numbers for Recreational Vessels
2011-02-11
... DEPARTMENT OF HOMELAND SECURITY Coast Guard 33 CFR Part 181 [Docket No. USCG-2007-29236] Hull Identification Numbers for Recreational Vessels AGENCY: Coast Guard, DHS. ACTION: Follow-up to request for... expanded hull identification number (HIN). The Coast Guard's decision-making process included consideration...
International Nuclear Information System (INIS)
Kullen, B.J.; Levitz, N.M.; Steindler, M.J.
1977-11-01
This report reviews experience and research related to the pyrophoricity of zirconium and zirconium alloys. The results of recent investigations of the behavior of Zircaloy and some observations of industrial handling and treatment of Zircaloy tubing and scrap are also discussed. A model for the management of waste Zircaloy cladding hulls from light water reactor fuel reprocessing is offered, based on an evaluation of the reviewed information. It is concluded that waste Zircaloy cladding hulls do not constitute a pyrophoric hazard if, following the model flow sheet, finely divided metal is oxidized during the management procedure. Steps alternative to the model are described which yield zirconium in deactivated form and also accomplish varying degrees of transuranic decontamination. Information collected into appendixes is (1) a collation of zirconium pyrophoricity data from the literature, (2) calculated radioactivity contents in Zircaloy cladding hulls from spent LWR fuels, and (3) results of a laboratory study on volatilization of zirconium from Zircaloy using HCl or Cl 2
Grene and Hull on types and typological thinking in biology.
Honenberger, Phillip
2015-04-01
Marjorie Grene (1910-2009) and David Hull (1935-2010) were among the most influential voices in late twentieth-century philosophy of biology. But, as Grene and Hull pointed out in published discussions of one another's work over the course of nearly forty years, they disagreed strongly on fundamental issues. Among these contested issues is the role of what is sometimes called "typology" and "typological thinking" in biology. In regard to taxonomy and the species problem, Hull joined Ernst Mayr's construal of typological thinking as a backward relic of pre-Darwinian science that should be overcome. Grene, however, treated the suspicion of typological thinking that characterized Hull's views, as well as those of other architects of the New Evolutionary Synthesis, as itself suspicious and even unsustainable. In this paper I review three debates between Grene and Hull bearing on the question of the validity of so-called typological thinking in biology: (1) a debate about the dispensability of concepts of "type" within evolutionary theory, paleontology, and taxonomy; (2) a debate about whether species can be adequately understood as individuals, and thereby independently of those forms of thinking Hull and Mayr had construed as "typological"; and (3) a debate about the prospects of a biologically informed theory of human nature. Copyright © 2015 Elsevier Ltd. All rights reserved.
46 CFR 174.225 - Hull penetrations and shell connections.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Hull penetrations and shell connections. 174.225 Section 174.225 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SUBDIVISION AND STABILITY... § 174.225 Hull penetrations and shell connections. Each overboard discharge and shell connection except...
77 FR 59575 - Hull Identification Numbers for Recreational Vessels
2012-09-28
... DEPARTMENT OF HOMELAND SECURITY Coast Guard 33 CFR Part 181 [Docket No. USCG-2012-0843] Hull Identification Numbers for Recreational Vessels AGENCY: Coast Guard, DHS. ACTION: Request for public comments... requirement to indicate a boat's model year as part of the 12-character Hull Identification Number (HIN...
46 CFR 71.50-19 - The Alternative Hull Examination (AHE) Program application.
2010-10-01
... 46 Shipping 3 2010-10-01 2010-10-01 false The Alternative Hull Examination (AHE) Program...) PASSENGER VESSELS INSPECTION AND CERTIFICATION Drydocking § 71.50-19 The Alternative Hull Examination (AHE... apply to the AHE Program. You must submit an application at least 90 days before the requested hull...
77 FR 29251 - Safety Zone; Carnival Fireworks Display, Nantasket Beach, Hull, MA
2012-05-17
...-AA00 Safety Zone; Carnival Fireworks Display, Nantasket Beach, Hull, MA AGENCY: Coast Guard, DHS... zone on the navigable waters off of Nantasket Beach in the vicinity of Hull, MA for a Carnival... spectators and vessels from the hazards associated with fireworks displays. Discussion of Proposed Rule Hull...
Hulled wheats are largely untapped genetic resources with >10,000 years of genetic memory and diversity that can be used for wheat quality improvement, development of healthy products, and adaptation to climate change. Multivariate diversity was assessed in the diploid Triticum monococcum L. var mon...
46 CFR 45.143 - Hull openings above freeboard deck.
2010-10-01
... 46 Shipping 2 2010-10-01 2010-10-01 false Hull openings above freeboard deck. 45.143 Section 45.143 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) LOAD LINES GREAT LAKES LOAD LINES Conditions of Assignment § 45.143 Hull openings above freeboard deck. Closures for openings above...
Free-surface flow around an appended hull
International Nuclear Information System (INIS)
Lungu, A; Pacuraru, F
2010-01-01
The prediction of the total drag experienced by an advancing ship is a complicated problem which requires a thorough understanding of the hydrodynamic forces acting on the hull, the physical processes from which these forces arise as well as their mutual interaction. A general numerical method to predict the hydrodynamic performance of a twin-propeller combatant ship is presented in the paper, which describes the solution of a RANS solver coupled with a body force method as an attempt in investigating the flow features around the ship hull equipped with rotating propellers and rudders. A special focus is made on the propeller non-symmetrical inflow field, aimed at obtaining the necessary data for the propulsive performances evaluation as well as for the propeller final design. The reported work allows not only the performance evaluation for the overall performances of a hull, but also leads to the development, implementation and validation of new concepts in modeling the turbulent vortical flows, with direct connection to the ship propulsion problem.
46 CFR 42.09-30 - Additional survey requirements for steel-hull vessels.
2010-10-01
... 46 Shipping 2 2010-10-01 2010-10-01 false Additional survey requirements for steel-hull vessels...-30 Additional survey requirements for steel-hull vessels. (a) In addition to the requirements in § 42...) When the vessel is in drydock, the hull plating, etc., shall be examined. (c) The holds, 'tween decks...
Development of hull compaction system for nuclear recycle facility
International Nuclear Information System (INIS)
Manole, A.A.; Karkhanis, P.P.; Agarwal, Kailash; Basu, Sekhar
2013-01-01
India has adopted closed fuel cycle strategy for efficient management of available resources to meet long term energy requirements. Nuclear Recycle Facility (NRF) provides a vital link in three-stage Indian nuclear power programme. In a NRF for PHWR fuel cycle, reprocessing of spent fuel bundles from PHWRs is carried out using a chop-leach process where the spent fuel bundles are chopped into small pieces using a spent fuel chopper and the contents inside the zircaloy clad are dissolved using concentric nitric acid. This process generates empty zircaloy shells called 'hulls'. The present practice followed for management of hulls is to transfer them into SS drums and store these drums in underground RCC tile holes at a Waste Management Facility (WMF). This waste needs to be stored in an engineered WMF for at least 30-60 years before transferred to a final repository. The storage volumes required for this hull waste will keep increasing as the reprocessing capacity is being enhanced multi-folds. Compaction of hull waste has been employed internationally to reduce the volume required for storage. Hence indigenous development of hull compaction system was initiated by NRB to meet the future requirements. This is being achieved through a set of experiments and analysis with the available resources within the country. This paper describes the process of compaction, conceptualization of the system and benefits accrued from it. (author)
Reliability-Based Optimization of Structural Elements
DEFF Research Database (Denmark)
Sørensen, John Dalsgaard
In this paper structural elements from an optimization point of view are considered, i.e. only the geometry of a structural element is optimized. Reliability modelling of the structural element is discussed both from an element point of view and from a system point of view. The optimization...
A Fast Algorithm of Convex Hull Vertices Selection for Online Classification.
Ding, Shuguang; Nie, Xiangli; Qiao, Hong; Zhang, Bo
2018-04-01
Reducing samples through convex hull vertices selection (CHVS) within each class is an important and effective method for online classification problems, since the classifier can be trained rapidly with the selected samples. However, the process of CHVS is NP-hard. In this paper, we propose a fast algorithm to select the convex hull vertices, based on the convex hull decomposition and the property of projection. In the proposed algorithm, the quadratic minimization problem of computing the distance between a point and a convex hull is converted into a linear equation problem with a low computational complexity. When the data dimension is high, an approximate, instead of exact, convex hull is allowed to be selected by setting an appropriate termination condition in order to delete more nonimportant samples. In addition, the impact of outliers is also considered, and the proposed algorithm is improved by deleting the outliers in the initial procedure. Furthermore, a dimension convention technique via the kernel trick is used to deal with nonlinearly separable problems. An upper bound is theoretically proved for the difference between the support vector machines based on the approximate convex hull vertices selected and all the training samples. Experimental results on both synthetic and real data sets show the effectiveness and validity of the proposed algorithm.
Lightweight hull surface self-design vertical parameterization method based on NURBS
Directory of Open Access Journals (Sweden)
ZHANG Yanru
2017-10-01
Full Text Available [Objectives] At present, conventional design is limited to parent ship design space, and cannot drive ship hull design using as few parameters as possible. In order to solve the above problems, [Methods] by combining the draught function with NURBS, a ship hull surface self-design method based on vertical parameterization is proposed. In this method, the waterline is designated as the basic design unit; the bottom flat end line, designed waterline, stem and stern contours, side flat end line and maximum section line are designated as the characteristic constraints of the ship hull; and the draught function values corresponding to the characteristic parameters are designated as the design objectives. In this way, a waterline approximation model is built, and an evolutionary algorithm can be used to solve the approximation model. Finally, the ship hull surface is generated on the basis of the waterline using the NURBS skinning technique.[Results] The design examples of the characteristic curves of the full-scale ship hull surface indicate the practicable and advanced nature of this method.[Conclusions] The hull surface can be designed with as little data as possible using this method, making it much more suitable for the self-design of new ship forms.
Corn fiber hulls as a food additive or animal feed
Abbas, Charles; Beery, Kyle E.; Cecava, Michael J.; Doane, Perry H.
2010-12-21
The present invention provides a novel animal feed or food additive that may be made from thermochemically hydrolyzed, solvent-extracted corn fiber hulls. The animal feed or food additive may be made, for instance, by thermochemically treating corn fiber hulls to hydrolyze and solubilize the hemicellulose and starch present in the corn fiber hulls to oligosaccharides. The residue may be extracted with a solvent to separate the oil from the corn fiber, leaving a solid residue that may be prepared, for instance by aggolmerating, and sold as a food additive or an animal feed.
A Fiber-Optic Tether for the Hull Search UUV System Documentation
National Research Council Canada - National Science Library
Buescher, J. G
2006-01-01
...) conducting ship hull inspection missions, defines the required specifications that will allow the integration and installation of a FO tether system on UUVs with ship hull inspection capability...
Of Curriculum Conceptions, Orientations, and Cultures: A Rejoinder to John E. Hull
Van Brummelen, Harro
2009-01-01
In this article, the author presents a rejoinder to John E. Hull. Van Brummelen first states his appreciation of John Hull's thoughtful evaluation of his views of curriculum, views in which many Christian educators have played a part. It has been several decades since the author spelled out what Hull calls an "education for discipleship"…
46 CFR 115.660 - Continued participation in the Alternative Hull Examination (AHE) Program.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Continued participation in the Alternative Hull... MORE THAN 49 PASSENGERS INSPECTION AND CERTIFICATION Hull and Tailshaft Examinations § 115.660 Continued participation in the Alternative Hull Examination (AHE) Program. (a) To continue to participate in...
46 CFR 176.660 - Continued participation in the Alternative Hull Examination (AHE) Program.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Continued participation in the Alternative Hull... (CONTINUED) SMALL PASSENGER VESSELS (UNDER 100 GROSS TONS) INSPECTION AND CERTIFICATION Hull and Tailshaft Examinations § 176.660 Continued participation in the Alternative Hull Examination (AHE) Program. (a) To...
In-Water Hull Cleaning & Filtration System
George, Dan
2015-04-01
Dan George R & D Mining Technology LinkedIn GRD Franmarine have received the following prestigious awards in 2014 for their research & development of an in-water hull cleaning and filtration system "The Envirocart: Golden Gecko Award for Environmental Excellence; WA Innovator of the Year - Growth Sector; Department of Fisheries - Excellence in Marine Biosecurity Award - Innovation Category; Lloyd's List Asia Awards - Environmental Award; The Australian Innovation Challenge - Environment, Agriculture and Food Category; and Australian Shipping and Maritime Industry Award - Environmental Transport Award. The Envirocart developed and patented by GRD Franmarine is a revolutionary new fully enclosed capture and containment in-water hull cleaning technology. The Envirocart enables soft Silicon based antifouling paints and coatings containing pesticides such as Copper Oxide to be cleaned in situ using a contactless cleaning method. This fully containerised system is now capable of being deployed to remote locations or directly onto a Dive Support Vessel and is rated to offshore specifications. This is the only known method of in-water hull cleaning that complies with the Department of Agriculture Fisheries and Forestry (DAFF) and Department of Fisheries WA (DoF) Guidelines. The primary underwater cleaning tool is a hydraulically powered hull cleaning unit fitted with rotating discs. The discs can be fitted with conventional brushes for glass or epoxy based coatings or a revolutionary new patented blade system which can remove marine biofouling without damaging the antifouling paint (silicone and copper oxide). Additionally there are a patented range of fully enclosed hand cleaning tools for difficult to access niche areas such as anodes and sea chests, providing an innovative total solution that enables in-water cleaning to be conducted in a manner that causes no biological risk to the environment. In full containment mode or when AIS are present, material is pumped
Solid-state fermentation of Mortierella isabellina for lipid production from soybean hull.
Zhang, Jianguo; Hu, Bo
2012-02-01
Soybean hull, generated from soybean processing, is a lignocellulosic material with limited industrial applications and little market value. This research is exploring a new application of soybean hull to be converted to fungal lipids for biodiesel production through solid-state fermentation. Mortierella isabellina was selected as the oil producer because of its high lipid content at low C/N ratio. Several cultivation factors were investigated, including moisture content, inoculums size, fungal spore age, and nutrient supplements, in an attempt to enhance the lipid production of the solid-state fermentation process. The results showed that lipid production with the increase of the moisture content and the spore age, while decreased as the size of inoculums increased. Nutrients addition (KH₂PO₄ 1.2 mg and MgSO₄ 0.6 mg/g soybean hull) improved the lipid production. The total final lipid reached 47.9 mg lipid from 1 g soybean hull after the conversion, 3.3-fold higher than initial lipid reserve in the soybean hull. The fatty acid profile analysis indicated that fatty acid content consisted of 30.0% of total lipid, and 80.4% of total fatty acid was C16 and C18. Therefore, lipid production from soybean hull is a possible option to enable soybean hull as a new resource for biodiesel production and to enhance the overall oil production from soybeans.
Management of cladding hulls and fuel hardware
International Nuclear Information System (INIS)
1985-01-01
The reprocessing of spent fuel from power reactors based on chop-leach technology produces a solid waste product of cladding hulls and other metallic residues. This report describes the current situation in the management of fuel cladding hulls and hardware. Information is presented on the material composition of such waste together with the heating effects due to neutron-induced activation products and fuel contamination. As no country has established a final disposal route and the corresponding repository, this report also discusses possible disposal routes and various disposal options under consideration at present
Wave-induced Ship Hull Vibrations in Stochastic Seaways
DEFF Research Database (Denmark)
Jensen, Jørgen Juncher; Dogliani, M.
1996-01-01
A theoretical Study is undertaken on the determination of wave-induced loads in flexible ship hulls. The calculations are performed within the framework of a non-linear, quadratic strip theory formulated in the frequency domain. Included are non-linear effects due to changes in added mass......, hydrodynamic damping and water line breadth with sectional immersion in waves. The study is limited to continuous excitations from the waves and thus transient so-called whipping vibrations due to slamming loads are not considered.Because of the non-linearities the ship hull responses become non...... to the large separation between dominating wave frequencies and the lowest two-node frequency of the hull beam. Both extreme value predictions and fatigue damage are considered.For a fast container ship the rigid body and two-node (springing) vertical wave-induced bending moments amidship are calculated...
Determination of digestibility of almond hull in sheep | Yalchi ...
African Journals Online (AJOL)
Chemical compositions of almond hull and alfalfa hay were determined. The crude protein (CP), neutral detergent fiber (NDF) and acid detergent fiber (ADF) of almond hull were lower than those of alfalfa hay but the non fibrous carbohydrate (NFC) was more than that of alfalfa hay (3.5 times) (P < 0.01). The dry matter ...
46 CFR 71.15-1 - Standards in inspection of hulls, boilers, and machinery.
2010-10-01
... 46 Shipping 3 2010-10-01 2010-10-01 false Standards in inspection of hulls, boilers, and machinery..., boilers, and machinery. In the inspection of hulls, boilers, and machinery of vessels, the standards... and inspection of hulls, boilers, and machinery, and the certificate of classification referring...
46 CFR 176.650 - Alternative Hull Examination Program options: Divers or underwater ROV.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Alternative Hull Examination Program options: Divers or...) SMALL PASSENGER VESSELS (UNDER 100 GROSS TONS) INSPECTION AND CERTIFICATION Hull and Tailshaft Examinations § 176.650 Alternative Hull Examination Program options: Divers or underwater ROV. To complete the...
Effect of ship hull form on the resistance penalty from biofouling.
Oliveira, Dinis; Larsson, Ann I; Granhag, Lena
2018-03-01
Hull biofouling is a well-known problem for the shipping industry, leading to increased resistance and fuel consumption. Considering that the effects of hull form on resistance are known to be higher for a less slender hull, it is hypothesised in this paper that the effect of biofouling roughness on resistance is also dependent on the hull form. To test this hypothesis, previously reported full-scale numerical results on a containership are re-analysed. Form effects on roughness penalties, corresponding to K ΔCT = 0.058 ± 0.025, are observed at a low speed (19 knots, Re s = 2.29 × 10 9 ), which are however cancelled out by traditionally neglected roughness effects on wave-making resistance at a higher speed (24 knots, Re s = 2.89 × 10 9 ). It is concluded that hull form effects on biofouling penalties can be significant at low speeds, though not generalisable for higher speeds, namely when wave-making resistance corresponds to ≥ 29% of total resistance.
Decontamination of fast reactor hulls and properties of immobilised waste forms
International Nuclear Information System (INIS)
Biddle, P.; Brown, P.E.; Rees, J.H.
1984-01-01
The objectives of this contract are threefold: (i) to characterise the activities associated with genuine hulls generated in reprocessing fuel from the Prototype Fast Reactor; (ii) to examine the feasibility of decontaminating the hulls by the use of simple low-temperature techniques; and (iii) to immobilise the hulls in cement and evaluate the products. Over the last year, work has concentrated in areas (i) and (ii), but the balance of the programme is now shifting more towards topic (iii). Progress is reported. (author)
David Hull's generalized natural selection as an explanation for scientific change
Little, Michelle Yvette
2001-10-01
Philosophers of science such as Karl Popper and Thomas Kuhn have employed evolutionary idiom in describing scientific change. In Science as a Process (1988) Hull makes evolutionary theory explanatorily applicable. He modifies key evolutionary terms in order that both biological evolution and scientific change are instances of a general selection process. According to Hull, because of naturally-existing competition for credit among researchers and the professional lineages they constitute, scientists are constrained to cooperate and collaborate. This process entails two important philosophical consequences. First, it allows for a natural justification of why the sciences can provide objective empirical knowledge. Second, appreciating its strength means that a philosophical analysis of scientific change is solidly difficult features to combine. I work on strengthening two weaknesses in Hull's arguments. First, operating in his analysis is an unexplicated notion of ``information'' running parallel to the equally opaque notion of genetic information. My third chapter provides a clear account of ``genetic information'' whose usefulness extends beyond the assistance it can render Hull as a clear concept is needed in biological contexts as well. The fourth and fifth chapters submit evidence of scientific change from radio astronomy. Hull insists on empirical backing for philosophical theses but his own book stands to suffer from selection effects as it offers cases drawn from a single subspecialty in the biological sciences. I found that in the main scientists and the change they propel accords well with Hull's explanation. However, instances of major change reveal credit- and resource-sharing to a degree contrary with what Hull would expect. My conclusion is that the naturalness of competition, instantiated during the course of standardized and relatively ``normal'' scientific research, is not the norm during periods of new research and its uncertain standards of
Maw and spent HTR Fuel Element Test storage in Boreholes in rock salt
International Nuclear Information System (INIS)
Barnert, E.; Brucher, P.H.; Kroth, K.; Merz, E.; Niephaus, D.
1986-01-01
The Budesminister fur Forschung und Technolgie (BMFT, Federal Ministry for Research and Technology) is sponsoring a project at the Kernforschungsanlage Julich (KFA, Juelich Nuclear Research Centre) entitled ''MAW and HTR Fuel Element Test disposal in Boreholes.'' The aim of this project is to develop a technique for the final disposal of (1) dissolver sludge, (2) cladding hulls/structural components and (3) spent HTR fuels elements in salt, and to test this technique in the abandoned Asse salt mine, including safety calculations and safety engineering demonstrations. The project is divided into the sub-projects I ''Disposal/sealing technique'' and II ''Retrievable disposal test.''
Structural elements design manual
Draycott, Trevor
2012-01-01
Gives clear explanations of the logical design sequence for structural elements. The Structural Engineer says: `The book explains, in simple terms, and with many examples, Code of Practice methods for sizing structural sections in timber, concrete,masonry and steel. It is the combination into one book of section sizing methods in each of these materials that makes this text so useful....Students will find this an essential support text to the Codes of Practice in their study of element sizing'.
Veum, T L; Raboy, V
2016-03-01
A 35-d experiment was conducted using 63 crossbred pigs (35 barrows and 28 gilts) with an initial average BW of 7.0 kg and age of 28 d to evaluate the efficacy of the low-phytic acid (LPA) genetic trait in hulled or hull-less barley in isocaloric diets. Hulled barleys were the normal barley (NB) cultivar Harrington and the near-isogenic LPA mutant 955 (M955) with P availabilities of 36 and 95%, respectively. Hull-less lines were produced by crossing NB and the LPA mutant 422 line with a hull-less line, producing hull-less NB (HNB) and hull-less mutant 422 (HM422) with P availabilities of 41 and 66%, respectively. Pigs were in individual metabolism cages or pens for Phase 1 (d 0 to 14) and Phase 2 (d 14 to 35). Diets defined as NB, HNB, HM422, or M955 with no added inorganic P (iP) had available P (aP) concentrations of 0.27, 0.28, 0.35, and 0.40% for Phase 1 and 0.15, 0.17, 0.23, and 0.31% for Phase 2, respectively. Only diet M955 was adequate in aP. Therefore, iP was added to the P-deficient diets to make diets NB + iP, HNB + iP, and HM422 + iP with aP equal to that in diet M955. Overall (d 0 to 35), ADG and G:F were greater ( hulled and hull-less barley in isocaloric diets fed to young pigs. Pigs fed the diet with LPA M955 consumed 31% less P and excreted 78% less fecal P and 30% less fecal Ca than pigs fed the diet with NB + iP that was equal to diet M955 in aP. Therefore, LPA barley, especially M955 with 95% aP, will reduce the use of iP in swine diets, reduce P pollution from swine manure, and support the goal of achieving global P sustainability.
The role of hull in germination and salinity tolerance in some ...
African Journals Online (AJOL)
hulled and dehulled) of sunflower seeds of Opal, Shelly (Confectionary) and Pactol (Oily) were tested to determine the effects of the hull on salinity tolerance during germination. Germination percentage (%), mean germination time (day), root and ...
Passive non destructive assay of hull waste by gross neutron counting method
International Nuclear Information System (INIS)
Andola, Sanjay; Sur, Amit; Rawool, A.M.; Sharma, B.; Kaushik, T.C.; Gupta, S.C.; Basu, Sekhar; Raman Kumar; Agarwal, K.
2014-01-01
The special nuclear material accounting (SNMA) is an important and necessary issue now in nuclear waste management. The hull waste generated from dissolution of spent fuel contains small amounts of Uranium and Plutonium and other actinides due to undissolved trapped material inside zircoalloy tubes. We report here on the development of a Passive Hull monitoring system using gross neutron counting technique and its implementation with semiautomatic instrumentation. The overall sensitivity of the 3 He detector banks placed at 75 cm from the centre of loaded hull cask comes out to 5.2 x 10 -3 counts per neutron (c/n) while with standard Pu-Be source placed in same position it comes out to be 3.1 x 10 3 c/n. The difference in the efficiency is mainly because of the differences in the geometry and size of hull cask as well as difference in the energy spectrum of hull waste and Pu-Be source. This is accounted through Monte Carlo computations. The Pu mass in solid waste comes out as expected and varies with the surface dose rate of drum in almost a proportional manner. Being simple and less time consuming, this setup has been installed for routine assay of solid Hull waste at NRB, Tarapur
46 CFR 31.10-20 - Definitions relating to hull examinations-T/B ALL.
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Definitions relating to hull examinations-T/B ALL. 31.10... CERTIFICATION Inspections § 31.10-20 Definitions relating to hull examinations—T/B ALL. As used in this part— (a... examination of all accessible parts of the vessel's underwater body and all through-hull fittings. (b...
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Description of the Alternative Hull Examination (AHE... Hull and Tailshaft Examinations § 176.620 Description of the Alternative Hull Examination (AHE) Program for certain passenger vessels. The Alternative Hull Examination (AHE) Program provides you with an...
46 CFR 115.650 - Alternative Hull Examination (AHE) Program options: Divers or underwater ROV.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Alternative Hull Examination (AHE) Program options... MORE THAN 49 PASSENGERS INSPECTION AND CERTIFICATION Hull and Tailshaft Examinations § 115.650 Alternative Hull Examination (AHE) Program options: Divers or underwater ROV. To complete your underwater...
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Eligibility requirements for the Alternative Hull... CERTIFICATION Hull and Tailshaft Examinations § 176.625 Eligibility requirements for the Alternative Hull... if— (1) It is constructed of steel or aluminum; (2) It has an effective hull protection system; (3...
Genetic control of a transition from black to straw-white seed hull in rice domestication.
Zhu, Bo-Feng; Si, Lizhen; Wang, Zixuan; Zhou, Yan; Zhu, Jinjie; Shangguan, Yingying; Lu, Danfeng; Fan, Danlin; Li, Canyang; Lin, Hongxuan; Qian, Qian; Sang, Tao; Zhou, Bo; Minobe, Yuzo; Han, Bin
2011-03-01
The genetic mechanism involved in a transition from the black-colored seed hull of the ancestral wild rice (Oryza rufipogon and Oryza nivara) to the straw-white seed hull of cultivated rice (Oryza sativa) during grain ripening remains unknown. We report that the black hull of O. rufipogon was controlled by the Black hull4 (Bh4) gene, which was fine-mapped to an 8.8-kb region on rice chromosome 4 using a cross between O. rufipogon W1943 (black hull) and O. sativa indica cv Guangluai 4 (straw-white hull). Bh4 encodes an amino acid transporter. A 22-bp deletion within exon 3 of the bh4 variant disrupted the Bh4 function, leading to the straw-white hull in cultivated rice. Transgenic study indicated that Bh4 could restore the black pigment on hulls in cv Guangluai 4 and Kasalath. Bh4 sequence alignment of all taxa with the outgroup Oryza barthii showed that the wild rice maintained comparable levels of nucleotide diversity that were about 70 times higher than those in the cultivated rice. The results from the maximum likelihood Hudson-Kreitman-Aguade test suggested that the significant reduction in nucleotide diversity in rice cultivars could be caused by artificial selection. We propose that the straw-white hull was selected as an important visual phenotype of nonshattered grains during rice domestication.
46 CFR 71.50-31 - Continued participation in the Alternative Hull Examination (AHE) program.
2010-10-01
... 46 Shipping 3 2010-10-01 2010-10-01 false Continued participation in the Alternative Hull... the Alternative Hull Examination (AHE) program. (a) To continue to participate in the AHE Program, vessel operators must conduct an annual hull condition assessment. At a minimum, vessel operators must...
Effects of biofouling development on drag forces of hull coatings for ocean-going ships: a review
DEFF Research Database (Denmark)
Lindholdt, Asger; Dam-Johansen, Kim; Olsen, S. M.
2015-01-01
This review presents a systematic overview of the literature and describes the experimental methods used to quantify the drag of hull coatings. It also summarizes the findings of hull coating's drag performance and identifies the main parameters impacting it. The advantages and disadvantages...... of the reported methods listed in this review provide an assessment of the most efficient methods to quantify the drag performance of hull coatings. This review determines that drag performance of hull coating technology varies depending on whether the coating condition is newly applied, after dynamic or static...... seawater exposure. The summarized data reveal that, while several methods have attempted to quantify drag performance of hull coatings, other methods must be explored in order to accurately measure the long-term drag performance of hull coatings in conditions mimicking those that ship hulls encounter...
Obtaining high purity silica from rice hulls
Directory of Open Access Journals (Sweden)
José da Silva Júnior
2010-01-01
Full Text Available Many routes for extracting silica from rice hulls are based on direct calcining. These methods, though, often produce silica contaminated with inorganic impurities. This work presents the study of a strategy for obtaining silica from rice hulls with a purity level adequate for applications in electronics. The technique is based on two leaching steps, using respectively aqua regia and Piranha solutions, which extract the organic matrix and inorganic impurities. The material was characterized by Fourier-transform infrared spectroscopy (FTIR, powder x-ray diffraction (XRD, x-ray fluorescence (XRF, scanning electron microscopy (SEM, particle size analysis by laser diffraction (LPSA and thermal analysis.
Production of furfural and ethyl alcohol from cottonseed hulls
Energy Technology Data Exchange (ETDEWEB)
Bobovnikov, B M; Tsirlin, Yu A; Chepigo, S V; Shpuntova, M E
1957-01-01
Cottonseed hulls (8.3 tons per digester) and H/sub 2/SO/sub 4/ solution at temperature of 100/sup 0/ were added to the digester simultaneously. The final H/sub 2/SO/sub 4/ concentration of the charge was approximately 0.7%. The pentosans were hydrolyzed at 133/sup 0/ and 2 atmosphere for 6 hours and 15 minutes, then the temperature was raised to 179/sup 0/ at the top and to 150/sup 0/ at the bottom of the digester for 5 hours and 30 minutes. The hydrolytic products of pentosan were separated, neutralized, and transferred to a dehydration tank. The hexosans were then hydrolyzed at 179 to 187/sup 0/. Dry hulls gave 19.4% of pentose reducing sugars, of which 81.4% were fermented. One ton of dry hulls gave 74 to 79 l. of ethanol. The optimum condition for dehydration was at 165 to 175/sup 0/ for no longer than 4 to 4.5 hours. 2-Furaldehyde was produced in the following steps: the pentosan hydrolyzate was dehydrated with steam, the vapor-furaldehyde mixture was then reheated and finally distilled in a continuous column. The yield of furaldehyde was 36 to 37% of incoming pentoses (7% of dry hulls).
Convex Hull Abstraction in Specialisation of CLP Programs
DEFF Research Database (Denmark)
Peralta, J.C.; Gallagher, John Patrick
2003-01-01
We introduce an abstract domain consisting of atomic formulas constrained by linear arithmetic constraints (or convex hulls). This domain is used in an algorithm for specialization of constraint logic programs. The algorithm incorporates in a single phase both top-down goal directed propagation...... and bottom-up answer propagation, and uses a widening on the convex hull domain to ensure termination. We give examples to show the precision gained by this approach over other methods in the literature for specializing constraint logic programs. The specialization method can also be used for ordinary logic...
International Nuclear Information System (INIS)
Iijima, Shizuka; Goto, Yuichi; Samoto, Hirotaka; Shichi, Ryo; Shimizu, Takenori
2011-01-01
We have been developing a non-destructive assay system called hulls monitor for nuclear fuel materials retained in hulls at the Tokai Reprocessing Plant (TRP). The hulls monitor is based on a passive neutron measurement method, so its applicability should be evaluated by a destructive analysis of hulls that are recovered from the reprocessing process. In this study, hulls came from the Advanced Thermal Reactor (ATR) FUGEN were taken from the dissolution process of TRP and destructively analyzed. Two kinds of hulls from ATR-MOX spent fuel assemblies and from ATR-UO 2 spent fuel assemblies were taken and soaked with nitric acid then fused with ammonium hydrogen sulfate, followed by Pu, 244 Cm, U mass determination by alpha spectrometry and ICP-AES. The characteristics of hulls came from MOX spent fuel assemblies were revealed by comparison of ATR-MOX spent fuel with ATR-UO 2 spent fuel. (author)
Struijs, K.; Vincken, J.P.; Verhoef, R.P.; Voragen, A.G.J.; Gruppen, H.
2008-01-01
In flaxseed hulls, lignans are present in an oligomeric structure. Secoisolariciresinol diglucoside (SDG), ester-linked to hydroxy-methyl-glutaric acid (HMGA), forms the backbone of this lignan macromolecule. The hydroxycinnamic acids p-coumaric acid glucoside (CouAG) and ferulic acid glucoside
Consolidation of cladding hulls from the electrometallurgical treatment of spent fuel
International Nuclear Information System (INIS)
Keiser, D.D. Jr.
1998-01-01
To consolidate metallic waste that is residual from Argonne National Laboratory's electrometallurgical treatment of spent nuclear fuel, waste ingots are currently being cast using an induction furnace located in a hot cell. These ingots, which have been developed to serve as final waste forms destined for repository disposal, are stainless steel (SS)-Zr alloys (the Zr is very near 15 wt.%). The charge for the alloys consists of stainless steel cladding hulls, Zr from the fuel being treated, noble metal fission products, and minor amounts of actinides that are present with the cladding hulls. The actual in-dated cladding hulls have been characterized before they were melted into ingots, and the final as-cast ingots have been characterized to determine the degree of consolidation of the charge material. It has been found that ingots can be effectively cast from irradiated cladding hulls residual from the electrometallurgical treatment process by employing an induction furnace located in a hot cell
33 CFR Appendix G to Part 157 - Timetables for Application of Double Hull Requirements
2010-07-01
... Double Hull Requirements G Appendix G to Part 157 Navigation and Navigable Waters COAST GUARD, DEPARTMENT... Application of Double Hull Requirements 1. Source. These timetables conform to 46 U.S.C. 3703a(c). 2... double hull or with a double containment system determined by the Coast Guard to be as effective as a...
Yeast hulls: effect on spontaneous fermentation in different vinification conditions
Directory of Open Access Journals (Sweden)
Rosa López
2000-09-01
Full Text Available The effect of the addition of yeast hulls in vinification was investigated during three consecutive years. The study was carried out in the experimental winery of C.I.D.A in La Rioja (Spain with free running white grape juice of the Viura variety. Four different vinifications were studied. In two of these vinifications, stuck fermentations were detected. In all the studies, the addition of yeast hulls (yeast ghosts improved the fermentation kinetics, increasing the number of viable yeasts at the end of the exponential stage and decreasing the final content of reducing sugars. This work revealed a new effect of yeast hull addition which had not been identified previously; their selection effect on the wild yeast strain in spontaneous fermentation.
Bouacida, Soufyane; Gauci, Marc-Olivier; Coulet, Bertrand; Lazerges, Cyril; Cyteval, Catherine; Boileau, Pascal; Chammas, Michel
2017-07-01
Posterior humeral subluxation is the main cause of failure of total shoulder arthroplasty. We aimed to compare humeral head subluxation in various reference planes and to search for a correlation with retroversion, inclination, and glenoid wear. We included 109 computed tomography scans of primary glenohumeral osteoarthritis and 97 of shoulder problems unrelated to shoulder osteoarthritis (controls); all computed tomography scans were reconstructed in the anatomic scapular plane and the glenoid hull plane that we defined. In both planes, we measured retroversion, inclination, glenohumeral offset (Walch index), and scapulohumeral offset. Retroversion in the scapular plane (Friedman method) was lower than that in the glenoid hull plane for controls and for arthritic shoulders. The threshold of scapulohumeral subluxation was 60% and 65% in the scapular plane and glenoid hull plane, respectively. The mean upward inclination was lower in the scapular plane (Churchill method) than in the glenoid hull plane (Maurer method). In the glenoid hull plane, 35% of type A2 glenoids showed glenohumeral offset greater than 75%, with mean retroversion of 25.6° ± 6° as compared with 7.5° ± 7.2° for the "centered" type A2 glenoids (P hull plane and r = 0.59 in the scapular plane (P hull plane may be more accurate than in the scapular plane. Thus, the glenoid hull method allows for better understanding type B3 of the modified Walch classification. Copyright © 2017 Journal of Shoulder and Elbow Surgery Board of Trustees. Published by Elsevier Inc. All rights reserved.
Flooding and schools: experiences in Hull in 2007.
Convery, Ian; Carroll, Bob; Balogh, Ruth
2015-01-01
Hull, a city in the East Riding of Yorkshire, United Kingdom, suffered severe flooding in June 2007, affecting some 8,600 households and most schools. Despite the potential for damage in such disasters, no studies of the effects of floods on teachers and schools in the UK appear to have been published previously. This study analysed the impacts of the floods on teachers in Hull in two stages: first through correspondence with Hull City Council and a mailed questionnaire to 91 head teachers of primary, secondary, and special schools; and second, through in-depth interviews with head teachers from six flooded schools, representing different degrees of flood experience, and a questionnaire completed by eight teachers from the same schools. The findings reveal the importance and the complexity of the role of the school in the wider community in a time of crisis. The study highlights issues concerning preparedness for floods, support for schools, and flood protection for schools. © 2014 The Author(s). Disasters © Overseas Development Institute, 2014.
Characterization of whole assembly hulls produced by industrial reprocessing of LWR fuels
International Nuclear Information System (INIS)
Gue, J.P.; Isaac, M.
1987-03-01
The characterization program for Obrigheim and Stade PWR hulls sampled at La Hague was conducted in the CEA hot cells (Coquenstock program operating on whole assembly hulls). A description of the appearance of these hulls, recovered on the industrial scale and after severe damage, is followed by a review of the results of the different radiochemical characterization operations (neutron emission measurements, gamma scanning, alpha and mass spectrometry after dissolution of several samples, determination of the retention of tritium and other gaseous fission products occluded in the zircalloy clads etc). The alpha contamination of these hulls proved to be rather high, but it demonstrated that a large part (90 to 95%) was labile and could be removed by simple rinsing with cold 3N nitric acid. By contrast, contamination by fission products such as Cs 137, Ce 144 and Eu 154, remains high and relatively unaffected by nitriacid rinsing. Based on the results obtained and the observations recorded, an analysis is carried out of the origins of alpha contamination of these hulls treated on an industrial scale, among which the chief source is certainly the limited effectiveness of rinsing
Characterization of whole assembly hulls produced by industrial reprocessing of LWR fuels
International Nuclear Information System (INIS)
Gue, J.P.; Isaac, M.; Hebel, W.
1987-01-01
The characterization program for Obrigheim and Stade PWR hulls sampled at La Hague was conducted in the CEA hot cells (Coquenstock program operating on whole assembly hulls). A description of the appearance of these hulls, recovered on the industrial scale and after severe damage, is followed by a review of the results of the different radiochemical characterization operations (neutron emission measurements, gamma scanning, alpha and mass spectrometry after dissolution of several samples, determination of the retention of tritium and other gaseous fission products occluded in the zircalloy clads, etc.). The alpha contamination of these hulls proved to be rather high, but it demonstrated that a large part (90 to 95%) was labile and could be removed by simple rinsing with cold 3N nitric acid. By contrast, contamination by fission products such as Cs 137, Ce 144 and Eu 154, remains high and relatively unaffected by nitric acid rinsing. Based on the results obtained and the observations recorded, an analysis is carried out of the origins of alpha contamination of these hulls treated on an industrial scale, among which the chief source is certainly the limited effectiveness of rinsing
Development of a method for determining 93Zr, 107Pd and 135Cs nuclides in UP2 800/UP3 hulls
International Nuclear Information System (INIS)
Excoffier, E.; Bienvenu, Ph.; Combes, C.; Delteil, N.; Ferrini, R.
2000-01-01
A CEA and COGEMA joint project was established for the determination of the activity of three long-lived radionuclides, Zirconium 93, Palladium 107 and Cesium 135 in zircaloy hulls recovered from reprocessing operations. These isotopes are pure β- emitters with half-lives in the range of 10 6 years. It is difficult to measure such nuclides using routine radiochemical methods because of their low specific activity and the presence of many interfering radionuclides in irradiated hulls. The procedure described in this paper involves a mass spectrometry technique, Inductively Coupled Plasma - Mass Spectrometry (ICP - MS) applied after dissolution of the samples and selective extraction of each nuclide studied from the matrix. Theoretical contents of 93 Zr, 107 Pd and 135 Cs in hulls can be estimated by computer codes relative to fission and activation reactions. From the CESAR code, the contents are expected to be in the range of 1 to 10 2 ppm zircaloy, i.e. around 8.10 -5 to 5.10 -3 g.l -1 after dissolution of the hulls. While such values are much higher than the detection limits achievable by ICP-MS in simple matrices, the measurement of 93 Zr, 107 Pd and 135 Cs is unfeasible in irradiated zircaloy solutions unless chemical separations are performed prior to analysis. In fact, the high zirconium content (40 g.l -1 ), the radioactivity of the solution (1010 Bq.I -1 ), the nature of acids (HNO 3 , HF) and above all, the presence of interfering isotopes prevent the direct determination of these radionuclides in zircaloy solutions. To overcome these difficulties, a procedure was developed to extract each nuclide from the original matrix and to separate it from interfering nuclide. The procedure was carried out on a synthetic solution containing the studied elements (Zr, Pd, Cs), the interfering elements (Nb, Ag, Ba) and the elements with major * emitting isotopes (Co, Sr, Ru, Rh, Sb, Ce, Eu) in hulls. The first stage of the procedure is a reverse phase chromatography
Hull's Diploma in Teaching of Adults
Styler, W. E.
1971-01-01
A diploma in the Teaching of Adults for part-time students was introduced in the University of Hull in 1966 as a fully recognized university diploma. Article discusses the three major parts of the course, examinations, and requirements. (RB)
Drag Reduction trough Special paints Coated on the hull
Izaguirre Alza, Patricia; Pérez Rojas, Luis; Núñez Basáñez, José Fernando
2010-01-01
The economic recession, the environmental impact as well as the continuous fossil fuel consumption encourage actions that focus on saving energy. In the vessels sector, one of the main objectives has always been to reach a hydro-dynamically optimum hull which gave the desired speed with minimum power. Hydrodynamic drag is basically divided into two parts: a) the friction between the water and the hull, and b) the wave generation due to the free-surface air-water. Presented in this paper...
Development and application of α-hull and Voronoi diagrams in the assessment of roundness error
International Nuclear Information System (INIS)
Li, Xiuming; Liu, Hongqi; Li, Wei
2011-01-01
Computational geometry has been used to select effective data points from the measured data points for evaluating the roundness error to improve the computational complexity. However, for precision parts most of the measured points are on the vertices of the convex hull; it cannot have any effect on improving the computational complexity with the Voronoi diagrams. In this paper the roundness error is evaluated with α-hull and the Voronoi diagram instead of convex hull. An approach for constructing α-hull with the minimum radius separation is presented to determine the vertices of the Voronoi diagram. The experimental results showed that the roundness error of the minimum zone circle could be solved efficiently with α-hull and the Voronoi diagram
The role of Bh4 in parallel evolution of hull colour in domesticated and weedy rice.
Vigueira, C C; Li, W; Olsen, K M
2013-08-01
The two independent domestication events in the genus Oryza that led to African and Asian rice offer an extremely useful system for studying the genetic basis of parallel evolution. This system is also characterized by parallel de-domestication events, with two genetically distinct weedy rice biotypes in the US derived from the Asian domesticate. One important trait that has been altered by rice domestication and de-domestication is hull colour. The wild progenitors of the two cultivated rice species have predominantly black-coloured hulls, as does one of the two U.S. weed biotypes; both cultivated species and one of the US weedy biotypes are characterized by straw-coloured hulls. Using Black hull 4 (Bh4) as a hull colour candidate gene, we examined DNA sequence variation at this locus to study the parallel evolution of hull colour variation in the domesticated and weedy rice system. We find that independent Bh4-coding mutations have arisen in African and Asian rice that are correlated with the straw hull phenotype, suggesting that the same gene is responsible for parallel trait evolution. For the U.S. weeds, Bh4 haplotype sequences support current hypotheses on the phylogenetic relationship between the two biotypes and domesticated Asian rice; straw hull weeds are most similar to indica crops, and black hull weeds are most similar to aus crops. Tests for selection indicate that Asian crops and straw hull weeds deviate from neutrality at this gene, suggesting possible selection on Bh4 during both rice domestication and de-domestication. © 2013 The Authors. Journal of Evolutionary Biology © 2013 European Society For Evolutionary Biology.
Fabrication of renewable biocomposites from soy hull and bioplastics
Nanda, Malaya Ranjan
This is an investigation for fabrication of biocomposites from soy hull and bioplastics like polylactide (PLA) and polyhydroxy butyrate-co- valerate (PHBV). The study was divided into three parts; the first was the development of a suitable PHBV/PLA blend. The second part involved the fabrication of composites from soy hull and PHBV/PLA blend and its comparison with polypropylene (PP)/soy hull composites. The third part was the effect of compatibilizer on the performance of the composites. From tensile study, the elongation of an optimized blend was found to be improved by 148 and 250% over the virgin polymers PHBV and PLA respectively. Scanning electron microscope revealed a stronger fiber-matrix interaction in PHBV/PLA composites over PP composites. Furthermore, the compatibilizer improved the impact and flexural strength by 56 and 32% respectively over the un-compatibilized counterpart; more significantly the resulting compatibilized composites showed improved hydrophobicity by more than 22% over un-compatibilized counterpart.
Energy Technology Data Exchange (ETDEWEB)
Behgar, M [Agricultural, Medical and Industrial Research School, P.O. Box 31485498, Karaj (Iran, Islamic Republic of); Ghasemi, S; Naserian, A [Faculty of Agriculture, Excellence Center in Animal Science, Ferdowsi University of Mashhad, P.O. Box 917751163, Mashhad (Iran, Islamic Republic of); Borzoie, A; Fatollahi, H [Agricultural, Medical and Industrial Research School, P.O. Box 31485498, Karaj (Iran, Islamic Republic of)
2011-09-15
The effect of gamma radiation (10, 20, 30, 40, 50 and 60 kGy) on tannin, total phenolics, antioxidants activity and in vitro digestion of pistachio hulls has been investigated in this study. The possibility of using the radial diffusion method based on software measurement of the rings area has also been investigated in this study. The software based method in radial diffusion method showed a higher r{sup 2} (0.995) value when compared to the traditional method. Irradiation reduced the tannin content (P<0.01) and activity of antioxidants (P<0.05) of pistachio hull extracts but increased the total phenolic content (P<0.05). There was no effect of gamma irradiation on the in vitro digestion of the pistachio hull. Irradiation decreased the digestion rate of the pistachio hull at the dose of 40 kGy when compared to the control. This study showed that gamma irradiation decreased tannin and antioxidants activity of pistachio hull. - Highlights: > we investigate the effects of gamma irradiation on pistachio hull. > We examine changes in phenolics, antioxidant and digestion of pistachio hull. > Computerized radial diffusion method gives precise regression for standard curve. > Gamma irradiation will decrease tannin and antioxidants of pistachio hull extracts.
International Nuclear Information System (INIS)
Behgar, M.; Ghasemi, S.; Naserian, A.; Borzoie, A.; Fatollahi, H.
2011-01-01
The effect of gamma radiation (10, 20, 30, 40, 50 and 60 kGy) on tannin, total phenolics, antioxidants activity and in vitro digestion of pistachio hulls has been investigated in this study. The possibility of using the radial diffusion method based on software measurement of the rings area has also been investigated in this study. The software based method in radial diffusion method showed a higher r 2 (0.995) value when compared to the traditional method. Irradiation reduced the tannin content (P<0.01) and activity of antioxidants (P<0.05) of pistachio hull extracts but increased the total phenolic content (P<0.05). There was no effect of gamma irradiation on the in vitro digestion of the pistachio hull. Irradiation decreased the digestion rate of the pistachio hull at the dose of 40 kGy when compared to the control. This study showed that gamma irradiation decreased tannin and antioxidants activity of pistachio hull. - Highlights: → we investigate the effects of gamma irradiation on pistachio hull. → We examine changes in phenolics, antioxidant and digestion of pistachio hull. → Computerized radial diffusion method gives precise regression for standard curve. → Gamma irradiation will decrease tannin and antioxidants of pistachio hull extracts.
Isoprene Production on Enzymatic Hydrolysate of Peanut Hull Using Different Pretreatment Methods
Directory of Open Access Journals (Sweden)
Sumeng Wang
2016-01-01
Full Text Available The present study is about the use of peanut hull for isoprene production. In this study, two pretreatment methods, hydrogen peroxide-acetic acid (HPAC and popping, were employed prior to enzymatic hydrolysis, which could destroy the lignocellulosic structure and accordingly improve the efficiency of enzymatic hydrolysis. It is proven that the isoprene production on enzymatic hydrolysate with HPAC pretreatment is about 1.9-fold higher than that of popping pretreatment. Moreover, through High Performance Liquid Chromatography (HPLC analysis, the amount and category of inhibitors such as formic acid, acetic acid, and HMF were assayed and were varied in different enzymatic hydrolysates, which may be the reason leading to a decrease in isoprene production during fermentation. To further increase the isoprene yield, the enzymatic hydrolysate of HPAC was detoxified by activated carbon. As a result, using the detoxified enzymatic hydrolysate as the carbon source, the engineered strain YJM21 could accumulate 297.5 mg/L isoprene, which accounted for about 90% of isoprene production by YJM21 fermented on pure glucose (338.6 mg/L. This work is thought to be the first attempt on isoprene production by E. coli using peanut hull as the feedstock. More importantly, it also shows the prospect of peanut hull to be considered as an alternative feedstock for bio-based chemicals or biofuels production due to its easy access and high polysaccharide content.
78 FR 50335 - Double Hull Tanker Escorts on the Waters of Prince William Sound, Alaska
2013-08-19
...-AB96 Double Hull Tanker Escorts on the Waters of Prince William Sound, Alaska AGENCY: Coast Guard, DHS... mandates two tug escorts for double hull tankers over 5,000 gross tons transporting oil in bulk in PWS. The... tug escort requirements apply to certain double hull tankers. DATES: This interim rule is effective...
Effect of rice hull mulch on nutrient concentration of fertilized irrigation water
Parboiled rice hulls are an effective mulch for controlling weeds in nursery containers. A layer of rice hulls between 1.25 and 2.5 cm deep has been shown to provide effective control of liverwort (Marchantia polymorpha), bittercress (Cardamine flexuosa), and creeping woodsorrel (Oxalis corniculata...
Yang, Y; Ferreira, G; Teets, C L; Corl, B A; Thomason, W E; Griffey, C A
2018-04-01
The objective of this study was to evaluate lactation performance, nutrient digestibility, and milk fatty acid composition of high-producing dairy cows consuming diets containing hulled or hull-less barley as the grain source when feeding low-forage (LF) or high-forage (HF) diets. Eight primiparous (610 ± 40 kg of body weight and 72 ± 14 d in milk) and 16 multiparous (650 ± 58 kg of body weight and 58 ± 16 d in milk) Holstein cows were randomly assigned to 1 of 4 diets in a replicated 4 × 4 Latin square design with a 2 × 2 factorial arrangement of treatments and 21-d periods. Cows were assigned to squares based on parity (1, 2, and ≥3) and days in milk. Diets were formulated to contain on a dry matter basis (1) 45% forage and hulled barley as the sole grain source, (2) 65% forage and hulled barley as the sole grain source, (3) 45% forage and hull-less barley as the sole grain source, and (4) 65% forage and hull-less barley as the sole grain source. Dry matter intake tended to be lower for the diet with 65% forage and hulled barley than for the rest of the diets (24.4 vs. 26.6 kg/d). Neither the type of barley nor the forage-to-concentrate ratio affected milk yield (41.7 kg/d). Barley type did not affect milk fat or protein concentrations. Feeding LF diets decreased milk fat concentration from 3.91% to 3.50%. This decrease was less than anticipated and resulted in a 7% decrease in milk fat yield relative to cows consuming HF diets (1.60 and 1.49 kg/d for HF and LF diets, respectively). Feeding LF diets increased the concentration of C18:1 trans-10 in milk fat, suggesting that feeding LF diets may have marginally altered rumen function. In conclusion, LF diets containing barley grains can marginally decrease milk fat concentration. Overall, and based on the conditions of this study, there is limited evidence to anticipate a dramatic or acute milk fat depression when feeding hull-less barley as the grain source in diets for high-producing dairy cows. Copyright
Finite element analysis of an inflatable torus considering air mass structural element
Gajbhiye, S. C.; Upadhyay, S. H.; Harsha, S. P.
2014-01-01
Inflatable structures, also known as gossamer structures, are at high boom in the current space technology due to their low mass and compact size comparing to the traditional spacecraft designing. Internal pressure becomes the major source of strength and rigidity, essentially stiffen the structure. However, inflatable space based membrane structure are at high risk to the vibration disturbance due to their low structural stiffness and material damping. Hence, the vibration modes of the structure should be known to a high degree of accuracy in order to provide better control authority. In the past, most of the studies conducted on the vibration analysis of gossamer structures used inaccurate or approximate theories in modeling the internal pressure. The toroidal shaped structure is one of the important key element in space application, helps to support the reflector in space application. This paper discusses the finite-element analysis of an inflated torus. The eigen-frequencies are obtained via three-dimensional small-strain elasticity theory, based on extremum energy principle. The two finite-element model (model-1 and model-2) have cases have been generated using a commercial finite-element package. The structure model-1 with shell element and model-2 with the combination of the mass of enclosed fluid (air) added to the shell elements have been taken for the study. The model-1 is computed with present analytical approach to understand the convergence rate and the accuracy. The convergence study is made available for the symmetric modes and anti-symmetric modes about the centroidal-axis plane, meeting the eigen-frequencies of an inflatable torus with the circular cross section. The structural model-2 is introduced with air mass element and analyzed its eigen-frequency with different aspect ratio and mode shape response using in-plane and out-plane loading condition are studied.
Onboard monitoring of fatigue damage rates in the hull girder
DEFF Research Database (Denmark)
Nielsen, Ulrik Dam; Jensen, Jørgen Juncher; Pedersen, Preben Terndrup
2011-01-01
Most new advanced ships have extensive data collection systems to be used for continuous monitoring of engine and hull performance, for voyage performance evaluation etc. Such systems could be expanded to include also procedures for stress monitoring and for decision support, where the most...... critical wave-induced ship extreme responses and fatigue damage accumulation can be estimated for hypothetical changes in ship course and speed in the automatically estimated wave environment.The aim of this paper is to outline a calculation procedure for fatigue damage rate prediction in hull girders...... taking into account whipping stresses. It is conceptually shown how such a method, which integrates onboard estimation of sea states, can be used to deduce decision support with respect to the accumulated fatigue damage in the hull girder.The paper firstly presents a set of measured full-scale wave...
Treatment of cladding hulls by the HIPOW process
International Nuclear Information System (INIS)
Larker, H.T.; Tegman, R.
1981-01-01
The conditions for densifying and bonding Zircaloy cladding hulls from spent LWR fuel to blocks by the HIPOW (hot isostatic pressing of waste) process have been studied. Fully dense and mechanically strong blocks of Zircaloy can be made without additives at temperatures around 1000 0 C. A volume reduction of about seven times and surface area reduction of more than 300 times, compared to typical loose-filled cladding hulls remaining after the chop-leach operations in a reprocessing plant, can be obtained. A study of a possible process for industrial scale has been made. Handling under water can prevent any fire hazard in the preparation sequence. The use of a special hermetically sealed double-wall metal container encasing the hulls during the densification in the hot isostatic press virtually eliminates the problem of lasting contamination of this equipment, thus greatly simplifying service and maintenance. One hot isostatic press can serve a reprocessing line with an LWR fuel capacity of 800 tons/year. Fines (residues) from fuel dissolution and alpha-contaminated ashes from incinerated organic materials in the plant may also be incorporated in the Zircaloy blocks. Tritium can quantitatively be contained in these blocks
PAUT-based defect detection method for submarine pressure hulls
Directory of Open Access Journals (Sweden)
Min-jae Jung
2018-03-01
Full Text Available A submarine has a pressure hull that can withstand high hydraulic pressure and therefore, requires the use of highly advanced shipbuilding technology. When producing a pressure hull, periodic inspection, repair, and maintenance are conducted to maintain its soundness. Of the maintenance methods, Non-Destructive Testing (NDT is the most effective, because it does not damage the target but sustains its original form and function while inspecting internal and external defects. The NDT process to detect defects in the welded parts of the submarine is applied through Magnetic particle Testing (MT to detect surface defects and Ultrasonic Testing (UT and Radiography Testing (RT to detect internal defects. In comparison with RT, UT encounters difficulties in distinguishing the types of defects, can yield different results depending on the skills of the inspector, and stores no inspection record. At the same time, the use of RT gives rise to issues related to worker safety due to radiation exposure. RT is also difficult to apply from the perspectives of the manufacturing of the submarine and economic feasibility. Therefore, in this study, the Phased Array Ultrasonic Testing (PAUT method was applied to propose an inspection method that can address the above disadvantages by designing a probe to enhance the precision of detection of hull defects and the reliability of calculations of defect size. Keywords: Submarine pressure hull, Non-destructive testing, Phased array ultrasonic testing
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Eligibility requirements for the Alternative Hull... OVERNIGHT ACCOMMODATIONS FOR MORE THAN 49 PASSENGERS INSPECTION AND CERTIFICATION Hull and Tailshaft Examinations § 115.625 Eligibility requirements for the Alternative Hull Examination (AHE) Program for certain...
Energy Technology Data Exchange (ETDEWEB)
Nose, M; Suzuki, K; Furuno, H [Nagasaki Institute of Applied Science, Nagasaki (Japan); Suzuki, K
1997-10-01
Discussions were given on practical application of a stress analyzing method for thin-wall deformed cross-sectional beam considering cross section camber in longitudinal bending. The non-static calculation method described in the previous report can be applied to a box-type cross section having multi-connected cells, bulk cargo transport vessels and container ships with dual hull structure, and oil tankers with dual hull structure of medium size. The calculation method was capable of achieving remarkable enhancement in efficiency over that of conventional calculation methods. The present study is intended to make the method applicable also to multi-connected cross section shapes having more than one longitudinal partitions as used in dual hull VLCC and ULCC. As a result, an expanded non-static calculation system was developed, which has introduced into the conception described in the previous report a new conception of triple point and independent start point members. As a result of applying the method to dual hull bulk cargo transport vessels, container ships, dual hull oil tankers of medium size, VLCC and ULCC, it was verified that the system operated properly. Remarkable efficiency improvement has been made possible as compared with conventional analysis methods applied to individual ships. The system is capable of automatic calculation, and makes possible the practical application of the hull strength theory considering cross section camber. 3 refs., 10 figs., 1 tab.
46 CFR 167.15-25 - Inspection standards for hulls, boilers and machinery.
2010-10-01
... SCHOOLS PUBLIC NAUTICAL SCHOOL SHIPS Inspections § 167.15-25 Inspection standards for hulls, boilers and... 46 Shipping 7 2010-10-01 2010-10-01 false Inspection standards for hulls, boilers and machinery... inspection. These rules may be purchased from the American Bureau of Shipping (ABS), ABS Plaza, 16855...
Directory of Open Access Journals (Sweden)
Jialong Jiao
2015-01-01
Full Text Available It is of great importance to evaluate the hull structural vibrations response of large ships in extreme seas. Studies of hydroelastic response of an ultra large ship have been conducted with comparative verification between experimental and numerical methods in order to estimate the wave loads response considering hull vibration and water impact. A segmented self-propelling model with steel backbone system was elaborately designed and the experiments were performed in a tank. Time domain numerical simulations of the ship were carried out by using three-dimensional nonlinear hydroelasticity theory. The results from the computational analyses have been correlated with those from model tests.
2010-10-01
... 46 Shipping 3 2010-10-01 2010-10-01 false Alternative Hull Examination (AHE) program options...-27 Alternative Hull Examination (AHE) program options: Divers or underwater remotely operated vehicle... operations; (2) Provide permanent hull markings, a temporary grid system of wires or cables spaced not more...
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Description of the Alternative Hull Examination (AHE... ACCOMMODATIONS FOR MORE THAN 49 PASSENGERS INSPECTION AND CERTIFICATION Hull and Tailshaft Examinations § 115.620 Description of the Alternative Hull Examination (AHE) Program for certain passenger vessels. The Alternative...
HTGR fuel element structural design consideration
International Nuclear Information System (INIS)
Alloway, R.; Gorholt, W.; Ho, F.; Vollman, R.; Yu, H.
1987-01-01
The structural design of the large HTGR prismatic core fuel elements involve the interaction of four engineering disciplines: nuclear physics, thermo-hydraulics, structural and material science. Fuel element stress analysis techniques and the development of structural criteria are discussed in the context of an overview of the entire design process. The core of the proposed 2240 MW(t) HTGR is described as an example where the design process was used. Probabilistic stress analysis techniques coupled with probabilistic risk analysis (PRA) to develop structural criteria to account for uncertainty are described. The PRA provides a means for ensuring that the proposed structural criteria are consistant with plant investment and safety risk goals. The evaluation of cracked fuel elements removed from the Fort St. Vrain reactor in the U.S.A. is discussed in the context of stress analysis uncertainty and structural criteria development. (author)
HTGR fuel element structural design considerations
International Nuclear Information System (INIS)
Alloway, R.; Gorholt, W.; Ho, F.; Vollman, R.; Yu, H.
1986-09-01
The structural design of the large HTGR prismatic core fuel elements involve the interaction of four engineering disciplines: nuclear physics, thermo-hydraulics, structural and material science. Fuel element stress analysis techniques and the development of structural criteria are discussed in the context of an overview of the entire design process. The core of the proposed 2240 MW(t) HTGR is described as an example where the design process was used. Probabalistic stress analysis techniques coupled with probabalistic risk analysis (PRA) to develop structural criteria to account for uncertainty are described. The PRA provides a means for ensuring that the proposed structural criteria are consistent with plant investment and safety risk goals. The evaluation of cracked fuel elements removed from the Fort St. Vrain reactor in the USA is discussed in the context of stress analysis uncertainty and structural criteria development
Directory of Open Access Journals (Sweden)
Do Kyun Kim
2013-03-01
Full Text Available This study compares the Residual ultimate longitudinal strength – grounding Damage index (R-D diagrams produced by two analysis methods: the ALPS/HULL Intelligent Supersize Finite Element Method (ISFEM and the design formula (modified Paik and Mansour method – used to assess the safety of damaged ships. The comparison includes four types of double-hull oil tankers: Panamax, Aframax, Suezmax and VLCC. The R-D diagrams were calculated for a series of 50 grounding scenarios. The diagrams were efficiently sampled using the Latin Hypercube Sampling (LHS technique and comprehensively analysed based on ship size. Finally, the two methods were compared by statistically analysing the differences between their grounding damage indices and ultimate longitudinal strength predictions. The findings provide a useful example of how to apply the ultimate longitudinal strength analysis method to grounded ships.
33 CFR 187.321 - What are the hull identification number (HIN) provisions?
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false What are the hull identification number (HIN) provisions? 187.321 Section 187.321 Navigation and Navigable Waters COAST GUARD, DEPARTMENT... Vessel Titling Systems § 187.321 What are the hull identification number (HIN) provisions? A State must...
"Keisri hull" on viimast korda laval
2010-01-01
Neli hooaega Ugala repertuaaris olnud Jaan Krossi romaani põhjal lavastatud draama "Keisri hull" etendub viimast korda 10. veebruaril. Viimane etendus on pühendatud Jaan Krossi 90. sünniaastapäevale, mis on 19. veebruaril. Lavastajad Peeter Tammearu ja Jaak Allik. Peaosas Peeter Tammearu
Ship with a double hull used to transport liquefied gases
Energy Technology Data Exchange (ETDEWEB)
1968-07-18
A ship with a double hull is described which is used to transport liquefied gases in reservoirs which are held inside the inner hull by a glide support and surrounded by insulation. Troughs are situated at the bottom and along the adjacent ends of the side walls to catch leakage from the reservoirs. These catchers are made of a material which is tough when chilled. The catchers have a suction installation to remove the leaked fluid. (5 claims)
Inhibition of α-glucosidase by polysaccharides from the fruit hull of Camellia oleifera Abel.
Zhang, Sheng; Li, Xiang-Zhou
2015-01-22
We isolated and purified polysaccharides from the Camellia oleifera Abel. fruit hull and studied its hypoglycemic potential. Our results revealed six polysaccharides (CFPA-1-5 & CFPB) from the aqueous extract from the defatted C. oleifera fruit hull. Purified polysaccharides (purity >90%) were investigated for the inhibition of α-glucosidase activity in vitro. Two polysaccharides, CFPB and CFPA-3 were present in high concentration in the fruit hull and showed a dose-dependent inhibition of α-glucosidase activity, with IC50 concentrations of 11.80 and 10.95 μg/mL, respectively. This result suggests that polysaccharides (CFP) extracted from the fruit hull of C. oleifera may have potential as functional foods with featuring a hypoglycemic effect. Copyright © 2014 Elsevier Ltd. All rights reserved.
Macroalgal Introductions by Hull Fouling on Recreational Vessels: Seaweeds and Sailors
Mineur, Frédéric; Johnson, Mark P.; Maggs, Christine A.
2008-10-01
Macroalgal invasions in coastal areas have been a growing concern during the past decade. The present study aimed to assess the role of hull fouling on recreational yachts as a vector for macroalgal introductions. Questionnaire and hull surveys were carried out in marinas in France and Spain. The questionnaires revealed that the majority of yacht owners are aware of seaweed introductions, usually undertake short range journeys, dry dock their boat at least once a year, and use antifouling paints. The hull survey showed that many in-service yachts were completely free of macroalgae. When present, fouling assemblages consisted mainly of one to two macroalgal species. The most commonly found species was the tolerant green seaweed Ulva flexuosa. Most of the other species found are also cosmopolitan and opportunistic. A few nonnative and potentially invasive Ceramiales (Rhodophyta) were found occasionally on in-service yachts. On the basis of the information gathered during interviews of yacht owners in the surveyed area, these occurrences are likely to be uncommon. However they can pose a significant risk of primary or secondary introductions of alien macroalgal species, especially in the light of the increase in yachting activities. With large numbers of recreational yachts and relatively rare occurrences of nonnative species on hulls, comprehensive screening programs do not seem justified or practical. The risks of transferring nonnative species may, however, be minimized by encouraging the behaviors that prevent fouling on hulls and by taking action against neglected boats before they can act as vectors.
Effects of quinoa hull meal on piglet performance and intestinal epithelial physiology
DEFF Research Database (Denmark)
Carlson, Dorthe; Fernandez, J.A.; Poulsen, H.D.
2012-01-01
Saponin-containing feed additives have shown positive effects on pig performance. Quinoa hull has high saponin content and may be of interest as a feed additive. This study aimed to evaluate quinoa hull meal (QHM) as a feed additive in a pig diet. The effects of QHM were assessed for three dosages...
46 CFR 42.09-35 - Additional survey requirements for wood-hull vessels.
2010-10-01
... 46 Shipping 2 2010-10-01 2010-10-01 false Additional survey requirements for wood-hull vessels. 42.09-35 Section 42.09-35 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) LOAD LINES... Additional survey requirements for wood-hull vessels. (a) In addition to the requirements in § 42.09-25, the...
Fluid-structure finite-element vibrational analysis
Feng, G. C.; Kiefling, L.
1974-01-01
A fluid finite element has been developed for a quasi-compressible fluid. Both kinetic and potential energy are expressed as functions of nodal displacements. Thus, the formulation is similar to that used for structural elements, with the only differences being that the fluid can possess gravitational potential, and the constitutive equations for fluid contain no shear coefficients. Using this approach, structural and fluid elements can be used interchangeably in existing efficient sparse-matrix structural computer programs such as SPAR. The theoretical development of the element formulations and the relationships of the local and global coordinates are shown. Solutions of fluid slosh, liquid compressibility, and coupled fluid-shell oscillation problems which were completed using a temporary digital computer program are shown. The frequency correlation of the solutions with classical theory is excellent.
Numerical Simulation of Galvanic Corrosion Caused by Shaft Grounding Systems in Steel Ship Hulls
National Research Council Canada - National Science Library
Wang, Y
2005-01-01
.... This led to the accelerated corrosion of the exposed steel ship hull on paint holidays because of the substantial difference of the electric potentials between the steel ship hull and the nickel...
Directory of Open Access Journals (Sweden)
Jongguk Lim
2017-09-01
Full Text Available The purpose of this study is to use near-infrared reflectance (NIR spectroscopy equipment to nondestructively and rapidly discriminate Fusarium-infected hulled barley. Both normal hulled barley and Fusarium-infected hulled barley were scanned by using a NIR spectrometer with a wavelength range of 1175 to 2170 nm. Multiple mathematical pretreatments were applied to the reflectance spectra obtained for Fusarium discrimination and the multivariate analysis method of partial least squares discriminant analysis (PLS-DA was used for discriminant prediction. The PLS-DA prediction model developed by applying the second-order derivative pretreatment to the reflectance spectra obtained from the side of hulled barley without crease achieved 100% accuracy in discriminating the normal hulled barley and the Fusarium-infected hulled barley. These results demonstrated the feasibility of rapid discrimination of the Fusarium-infected hulled barley by combining multivariate analysis with the NIR spectroscopic technique, which is utilized as a nondestructive detection method.
Behgar, M.; Ghasemi, S.; Naserian, A.; Borzoie, A.; Fatollahi, H.
2011-09-01
The effect of gamma radiation (10, 20, 30, 40, 50 and 60 kGy) on tannin, total phenolics, antioxidants activity and in vitro digestion of pistachio hulls has been investigated in this study. The possibility of using the radial diffusion method based on software measurement of the rings area has also been investigated in this study. The software based method in radial diffusion method showed a higher r2 (0.995) value when compared to the traditional method. Irradiation reduced the tannin content ( Ppistachio hull extracts but increased the total phenolic content ( Ppistachio hull. Irradiation decreased the digestion rate of the pistachio hull at the dose of 40 kGy when compared to the control. This study showed that gamma irradiation decreased tannin and antioxidants activity of pistachio hull.
The Effect of Hull Biofouling on Parameters Characterising Ship Propulsion System Efficiency
Directory of Open Access Journals (Sweden)
Tarełko Wiesła
2015-01-01
Full Text Available One of most important issues concerning technical objects is the increase of their operating performance. For a ship this performance mainly depends on the efficiency of its main pro-pulsion system and the resistance generated during its motion on water. The overall ship re-sistance, in turn, mainly depends on the hull friction resistance, closely related with the pres-ence of different types of roughness on the hull surface, including underwater part biofouling. The article analyses the effect of hull biofouling on selected parameters characterising the efficiency of the ship propulsion system with adjustable propeller. For this purpose a two-year research experiment was performed on a sailing vessel during its motor navigation phases. Based on the obtained results, three groups of characteristics were worked out for different combinations of engine rotational speed and adjustable propeller pitch settings. The obtained results have revealed that the phenomenon of underwater hull biofouling affects remarkably the parameters characterising propulsion system efficiency. In particular, the development of the biofouling layer leads to significant reduction of the speed of navigation.
Hull Girder Fatigue Damage Estimations of a Large Container Vessel by Spectral Analysis
DEFF Research Database (Denmark)
Andersen, Ingrid Marie Vincent; Jensen, Jørgen Juncher
2013-01-01
This paper deals with fatigue damage estimation from the analysis of full-scale stress measurements in the hull of a large container vessel (9,400 TEU) covering several months of operation. For onboard decision support and hull monitoring sys-tems, there is a need for a fast reliable method...... for esti-mation of fatigue damage in the ship hull. The objective of the study is to investigate whether the higher frequency contributions from the hydroelastic responses (springing and whipping) can satisfactory be included in the fatigue damage estimation by only a few parameters derived from the stress...
maar vandag in 2015 kan hulle gelees word as stories oor mense ...
African Journals Online (AJOL)
8 Apr 2016 ... maar vandag in 2015 kan hulle gelees word as stories oor mense wat leef teen die agtergrond van politieke opstand en sosiale chaos binne 'n groter universele verband. Die verbeeldingspel wat geïn- spireer word deur die teater, bied in die dramatekste van Uys 'n legio visuele moontlikhede van hoe hulle ...
2010-10-01
... 46 Shipping 3 2010-10-01 2010-10-01 false Description of the Alternative Hull Examination (AHE... Description of the Alternative Hull Examination (AHE) Program for certain passenger vessels. The Alternative Hull Examination (AHE) Program provides you with an alternative to a drydock examination by allowing...
2010-10-01
... 46 Shipping 3 2010-10-01 2010-10-01 false Eligibility requirements for the Alternative Hull...-17 Eligibility requirements for the Alternative Hull Examination (AHE) Program for certain passenger... aluminum; (2) It has an effective hull protection system; (3) It has operated exclusively in fresh water...
Genetic Analysis and Mapping of TWH Gene in Rice Twisted Hull Mutant
Directory of Open Access Journals (Sweden)
Jin-bo LI
2009-03-01
Full Text Available A mutant with twisted hulls was found in a breeding population of rice (Oryza sativa L.. The mutant shows less grain weight and inferior grain quality in addition to twisted hulls. Genetic analysis indicated that the phenotype of mutant was controlled by a single recessive gene (temporarily designated as TWH. To map the TWH gene, an F2 population was generated by crossing the twh mutant to R725, an indica rice variety with normal hulls. For bulked segregant analysis, the bulk of mutant plants was prepared by mixing equal amount of plant tissue from 10 twisted-hull plants and the bulk of normal plants was obtained by pooling equal amount tissue of 10 normal-hull plants. Two hundred and seven pairs of simple sequence repeat (SSR primers, which are distributed on 12 rice chromosomes, were used for polymorphism analysis of the parents and the two bulks. The TWH locus was initially mapped close to the SSR marker RM526 on chromosome 2. Therefore, further mapping was performed using 50 pairs of SSR primers around the marker RM526. The TWH was delimited between the SSR markers RM14128 and RM208 on the long arm of chromosome 2 at the genetic distances of 1.4 cM and 2.7 cM, respectively. These results provide the foundation for further fine mapping, cloning and functional analysis of the TWH gene.
Bastos, Milena Patrícia Viana; de Carvalho, Gleidson Giordano Pinto; Pires, Aureliano José Vieira; Silva, Robério Rodrigues; Filho, Antônio Eustáquio; Dos Santos, Edileusa de Jesus; Chagas, Daiane Maria Trindade; Barroso, Daniele Soares; Filho, George Abreu
2014-01-01
The objective of this study was to assess the effect of substituting corn with soybean hulls on the ingestive behavior and nitrogen balance of Santa Ines lambs. A total of 25 lambs with an initial body weight of 20±2 kg at approximately six months of age, sheltered individually in stalls (1.10 m×1.0 m), considering an entirely casual experimental delineation. Soybean hulls were substituted for corn at 0, 250, 500, 750, and 1,000 g/kg of dry matter (DM). The time spent feeding, ruminating, masticating, and resting was not affected by the substitution of corn with soybean hulls. In fact, the feeding efficiency in g DM/h and the rumination efficiency in g DM/bolus increased linearly with soybean hull substitution in the feed. Although the nitrogen balance was not altered by the use of soybean hulls as a substitute for corn in the diets of Santa Ines lambs, the N ingested and N digested expressed in g/d, N retained as a percentage of that ingested, and N retained as a percentage of that digested displayed quadratic behavior. In conclusion, corn can be substituted with soybean hulls up to 1,000 g/kg of dry matter in the concentrate, without changing the ingestive behavior and nitrogen balance.
Mammographer personality traits – elements of the optimal mammogram experience
Directory of Open Access Journals (Sweden)
Amanda Louw
2014-11-01
Doelstellings: Die doel van hierdie studie was om van die faktore wat pasiënte se persepsies beïnvloed, te ondersoek. Pasiënte se persepsies en voorkeure ten opsigte van mammograwe se persoonlikheidseienskappe word in hierdie artikel bespreek. Metode: In dié beskrywende, verkennende studie is ’n nie-waarskynlikheid-gerieflikheidsteekproef-metode gebruik om data van 274 mammogram-pasiënte in vier kliniese opleidingsentrums in Gauteng met behulp van ’n vraelys in te win. Die respondente moes die belangrikheid van 24 persoonlikheidseienskappe van mammograwe beoordeel. Geldigheid, betroubaarheid, geloofwaardigheid en etiese oorwegings is in ag geneem. Resultate: Van al die vraelyste is 91% ingehandig. Die data is met behulp van beskrywende statistiek en faktoranalise geïnterpreteer, en vier faktore is uit die persoonlikheidskaal geïdentifiseer. Gevolgtrekking: Dit blyk dat pasiënte mammograwe beoordeel volgens die vertroue wat hulle inboesem, die sorg wat hulle verleen, hoe veilig hulle pasiënte laat voel, asook hoe goed hulle kommunikeer. Aangesien die mammograaf-pasiënt-verhouding pasiënte se indrukke van mammogramme sterk beïnvloed, kan hierdie vier faktore as fundamentele elemente van ’n optimale mammogram-ondersoek beskou word.
DEFF Research Database (Denmark)
Pedersen, Preben Terndrup; Jensen, Jørgen Juncher
2009-01-01
A simple but rational procedure for prediction of extreme wave-induced hull girder bending moment is presented. The procedure takes into account main ship hull characteristics such as: length, breadth, draught, block coefficient, bow flare coefficient, forward speed and hull flexibility. The wave......-linear strip theory calculations and supplemented with new closed form results for the hogging bending moment. Focus is on the extreme hull girder hogging bending moment. Due to the few input parameters this procedure can be used to estimate the wave-induced bending moments at the conceptual design phase....... Another application area is for novel single hull ship types not presently covered by the rules of the classification societies. As one application example the container ship M/S Napoli is considered....
Energy Technology Data Exchange (ETDEWEB)
Nobukawa, H; Kitamura, M; Kawamura, T [Hiroshima University, Hiroshima (Japan). Faculty of Engineering
1996-04-10
A high-speed hydrofoil catamaran under development has such a structure that an independent cabin is mounted on catamaran hulls, the cabin is connected with the hulls by using four soft springs, and hydrofoils are attached to the front and rear of the cabin. The structural design conception was as follows: the self-weight of the cabin is supported by lifting power of the hydrofoils while the boat is cruising; longitudinal motions of the catamaran hulls are absorbed by soft spring struts to make the motions more difficult to be transmitted into the cabin; and vibration excited by engines rotating at high speeds, attached to rear of the catamaran hulls, is not transmitted directly to the cabin structurally. A towing experiment was carried out by using divided models of about 1/10 scale in counter waves and regular waves to investigate their vibration response characteristics in waves. Furthermore, an experimental boat made of aluminum alloy with about 1/3 scale of the design boat was attached with composite structural struts made of springs and rubber parts to perform cruising experiments on an actual sea area. As a result, it was found that vibration excited by main engines in the catamaran hulls is transmitted very little to the cabin. 2 refs., 10 figs., 1 tab.
FINITE ELEMENT ANALYSIS OF STRUCTURES
Directory of Open Access Journals (Sweden)
PECINGINA OLIMPIA-MIOARA
2015-05-01
Full Text Available The application of finite element method is analytical when solutions can not be applied for deeper study analyzes static, dynamic or other types of requirements in different points of the structures .In practice it is necessary to know the behavior of the structure or certain parts components of the machine under the influence of certain factors static and dynamic . The application of finite element in the optimization of components leads to economic growth , to increase reliability and durability organs studied, thus the machine itself.
Committee VI.1. Extreme Hull Girder Loading
DEFF Research Database (Denmark)
Jensen, Jørgen Juncher
2000-01-01
Committee Mandate. Evaluate and develop direct calculation procedures for extreme wawe loads on ship hull girders. Due consideration shall be given to stochastic and non-linear effects. The procedures shall be assessed by comparison with in-service experiences, model tests and more refined...
Agu, Obiora S; Tabil, Lope G; Dumonceaux, Tim
2017-03-26
The effects of microwave-assisted alkali pre-treatment on pellets' characteristics and enzymatic saccharification for bioethanol production using lignocellulosic biomass of canola straw and oat hull were investigated. The ground canola straw and oat hull were immersed in distilled water, sodium hydroxide and potassium hydroxide solutions at two concentrations (0.75% and 1.5% w/v) and exposed to microwave radiation at power level 713 W and three residence times (6, 12 and 18 min). Bulk and particle densities of ground biomass samples were determined. Alkaline-microwave pre-treated and untreated samples were subjected to single pelleting test in an Instron universal machine, pre-set to a load of 4000 N. The measured parameters, pellet density, tensile strength and dimensional stability were evaluated and the results showed that the microwave-assisted alkali pre-treated pellets had a significantly higher density and tensile strength compared to samples that were untreated or pre-treated by microwave alone. The chemical composition analysis showed that microwave-assisted alkali pre-treatment was able to disrupt and break down the lignocellulosic structure of the samples, creating an area of cellulose accessible to cellulase reactivity. The best enzymatic saccharification results gave a high glucose yield of 110.05 mg/g dry sample for canola straw ground in a 1.6 mm screen hammer mill and pre-treated with 1.5% NaOH for 18 min, and a 99.10 mg/g dry sample for oat hull ground in a 1.6 mm screen hammer mill and pre-treated with 0.75% NaOH for 18 min microwave-assisted alkali pre-treatments. The effects of pre-treatment results were supported by SEM analysis. Overall, it was found that microwave-assisted alkali pre-treatment of canola straw and oat hull at a short residence time enhanced glucose yield.
Genetic Control of a Transition from Black to Straw-White Seed Hull in Rice Domestication1[C][W][OA
Zhu, Bo-Feng; Si, Lizhen; Wang, Zixuan; Jingjie Zhu, Yan Zhou; Shangguan, Yingying; Lu, Danfeng; Fan, Danlin; Li, Canyang; Lin, Hongxuan; Qian, Qian; Sang, Tao; Zhou, Bo; Minobe, Yuzo; Han, Bin
2011-01-01
The genetic mechanism involved in a transition from the black-colored seed hull of the ancestral wild rice (Oryza rufipogon and Oryza nivara) to the straw-white seed hull of cultivated rice (Oryza sativa) during grain ripening remains unknown. We report that the black hull of O. rufipogon was controlled by the Black hull4 (Bh4) gene, which was fine-mapped to an 8.8-kb region on rice chromosome 4 using a cross between O. rufipogon W1943 (black hull) and O. sativa indica cv Guangluai 4 (straw-white hull). Bh4 encodes an amino acid transporter. A 22-bp deletion within exon 3 of the bh4 variant disrupted the Bh4 function, leading to the straw-white hull in cultivated rice. Transgenic study indicated that Bh4 could restore the black pigment on hulls in cv Guangluai 4 and Kasalath. Bh4 sequence alignment of all taxa with the outgroup Oryza barthii showed that the wild rice maintained comparable levels of nucleotide diversity that were about 70 times higher than those in the cultivated rice. The results from the maximum likelihood Hudson-Kreitman-Aguade test suggested that the significant reduction in nucleotide diversity in rice cultivars could be caused by artificial selection. We propose that the straw-white hull was selected as an important visual phenotype of nonshattered grains during rice domestication. PMID:21263038
Evaluation of alternative waste management schemes for LWR hulls and caps
International Nuclear Information System (INIS)
Chaudon, L.; Cecille, L.; Klein, M.; Kowa, S.; Mehling, O.; Thiels, G.
1990-01-01
LWR hulls and caps represent one of the major sources of α bearing solid waste generated in the nuclear fuel cycle. For this reason, the CEC launched a theoretical study to evaluate alternative schemes for the overall management of this waste. Both volume reduction techniques and α decontamination of the hulls were assessed. The study demonstrated that the transport and disposal of the conditioned waste in deep geological formations play a dominant part in the total management costs. Important cost savings can be achieved through the implementation of efficient volume reduction techniques, i.e. melting or compaction. As an alternative approach, exhaustive α decontamination of the hulls appears promising, provided that the conditioned waste can be made to comply with the disposal criteria of mines. Finally, prolongation of the interim storage period for the waste packages from 1 to 30 years may prove beneficial on the transport costs
Directory of Open Access Journals (Sweden)
Milena Patrícia Viana Bastos
2014-01-01
Full Text Available The objective of this study was to assess the effect of substituting corn with soybean hulls on the ingestive behavior and nitrogen balance of Santa Ines lambs. A total of 25 lambs with an initial body weight of 20±2 kg at approximately six months of age, sheltered individually in stalls (1.10 m×1.0 m, considering an entirely casual experimental delineation. Soybean hulls were substituted for corn at 0, 250, 500, 750, and 1,000 g/kg of dry matter (DM. The time spent feeding, ruminating, masticating, and resting was not affected by the substitution of corn with soybean hulls. In fact, the feeding efficiency in g DM/h and the rumination efficiency in g DM/bolus increased linearly with soybean hull substitution in the feed. Although the nitrogen balance was not altered by the use of soybean hulls as a substitute for corn in the diets of Santa Ines lambs, the N ingested and N digested expressed in g/d, N retained as a percentage of that ingested, and N retained as a percentage of that digested displayed quadratic behavior. In conclusion, corn can be substituted with soybean hulls up to 1,000 g/kg of dry matter in the concentrate, without changing the ingestive behavior and nitrogen balance.
International Nuclear Information System (INIS)
Wakid, A.M.; El-Kholy, E.M.S.; Shoman, A.A.; El-Akhdar, E.A.H.; Abdel Rahman, H.A.
1998-01-01
Rice hulls as a new bulking component for the larval rearing of the mediterranean fruit fly, ceratitis capitata wied. Was tested in the laboratory; and 4 formulas of rice hulls and wheat bran were evaluated biologically and financially. When rice hulls and wheat bran were mixed in the ratio of 3:1, all biological aspects and response to gamma radiation (90 Gy) of the produced adults were normal except for male fertility that decreased by about 13% of that of the bran medium (control); while male mating competitiveness was increased. When rice hulls were used without bran, only adult emergece and female fecundity were decreased by about 2% and 20%, respectively as compared to control medium (totally wheat bran); while larval duration increased by one day. The fourth formula consisting of wheat bran and rice hulls in the ratio of 1:1 showed the least favourite bulking component. Calculations showed that one million pupal production costed $26.6,22.2, 20.2 and 21.4 for the bulking ratios (hulls : bran) 0.1, 1:1, 3:1 and 1:0,respectively
Directory of Open Access Journals (Sweden)
Wahid Herchi
2015-03-01
Full Text Available The objective of this research was to determine the effect of five years on physico-chemical characteristics and antioxidant activity of flaxseed hull oils. Oil and protein on flaxseed hull varied between 20.15 and 22.56 and 17.45 and 19.14, respectively. The albumin fraction dominated the seed hull protein composition (44 - 47%. Flaxseed hull oils showed significantly high unsaturated to saturated fatty acid ratios (6.61 - 8.36 and calculated oxidizability (Cox values (10.88 - 12.30. The physiochemical parameters determined included saponification value (SV (174 -182 mg KOH/g, unsaponifiable matter (UM (1.32 - 1.64%, peroxide value (PV (1.70 - 2.20 mequiv/kg, Oxidation value (OV (4.40 - 5.90 and oil stability (1.10 - 1.42 h. The highest content of total phenolic acids and total tocopherols were recorded on hull sample collected in 2008. Flavanoid content ranged from 11 to 19 mg/100 g oil. Antioxidant activity differed significantly; the greatest inhibition (61.38% was for the hull sample collected in 2008.
Study on characteristics of spent PWR cladding hull for categorizing into Non-TRU waste
International Nuclear Information System (INIS)
Jung, In Ha; Kim, Jong Ho; Park, Jang Jin; Shin, Jin Myeong; Lee, Ho Hee; Yang, Myung Seung
2005-01-01
AFCI and GEN-IV programs aim for decreasing the high level radioactive wastes to be disposed. They also try to get valuable materials to recycle as resources such as uranium and plutonium. On the other hand, cladding hull expected to be one-thirds in volume of spent fuel assembly has not studied so much in the point view of recycling to reuse. Since traditional process of reprocessing was wet process, cladding hull generating through the reprocessing process was unavoidably contaminated with TRU by acid solvent during the process. Therefore, cladding hull has been classified into TRU wastes or high level wastes. According to the strategy for TRU high level radioactive wastes of USA as well as Korea, it regulates in two respects. One is activity and the other is heat generation. In respect of activity, TRU waste contains more than 100 nCi/kg of alpha emits with longer half life than 20 years and higher than 92 in atomic number. Also, wastes are categorized into TRU waste when it generates higher than 2kW/m3, in the respect of heat generation. Our results as well as literatures, almost all of TRU nuclides in the cladding hull are responsible for remained uranium and plutonium owing to pellet-cladding interaction. In addition, recoiled fission products on the surface of the cladding hull serve as heat generator. Up to now, decontamination of the cladding hull generating from the reprocessing of wet process is regarded as valueless and un-economic works owing to the amount of second waste produced
International Nuclear Information System (INIS)
Wuerz, H.; Wagner, K.; Becker, H.J.
1990-01-01
In reprocessing plants leached hulls and dissolver sludges represent rather important intermediate level α-waste streams. A control of the Pu content of these waste streams is desirable. The nondestructive assay method to be preferred would be passive neutron counting. However, before any decision on passive neutron monitoring becomes possible, a characterization of hulls and sludges in terms of Pu content and neutron emission is necessary. For the direct determination of Plutonium on hulls and in sludges, as coming from reprocessing, an active neutron measurement is required. A simple, and sufficiently sensitive active neutron method which can easily be installed uses a stationary 252 Cf neutron source. This method was used for the characterization of hulls and sludges in terms of Plutonium content and total neutron emission in the Karlsruhe reprocessing plant WAK
Properties of Moldings Prepared from LDPE-Pumpkin Seed Hulls Blend
Directory of Open Access Journals (Sweden)
Karolina Głogowska
2017-12-01
Full Text Available In recent decades, standard polymer blends for different applications have been more and more often replaced by blends containing raw materials. The use of natural materials as filler in thermoplastics brings both economic and environmental benefits. The use of a given vegetable filler depends on the geographic location and natural occurrence of the vegetables in a given geographic region. In Poland, for instance, the pumpkin is one of such vegetables. They are used for producing oil which is pressed from pumpkin seeds. Pumpkin seeds are then collected, dried and purified to produce waste material in hull form. Particles of ground pumpkin seed hulls with varying sizes and weight-in-weight concentration ranging from 0% to 20% relative to the matrix are used as filler in low-density polyethylene. Pumpkin seed hulls are ground and sieved. Four fractions of hulls with different particle sizes are produced: <0.2mm, 0.2mm-0.4mm, 0.4mm-0.6mm, 0.6mm-0.8mm. The paper reports the results of investigation of the mechanical properties, i.e., strength properties determined by static tensile testing and hardness measurement, of injection molds produced at constant processing parameters. In addition, the cross sections of the obtained products are subjected to microscopic examination. Relationships are determined between tensile modulus, maximum tensile stress, tensile stress at yield, maximum tensile strain, tensile strain at yield as well as Shore hardness and weigh-in-weight concentration of the powdered natural filler and its grain sizes. Finally, relevant conclusions are drawn.
Shah, S. M.; Crawshaw, J. P.; Gray, F.; Yang, J.; Boek, E. S.
2017-06-01
In the last decade, the study of fluid flow in porous media has developed considerably due to the combination of X-ray Micro Computed Tomography (micro-CT) and advances in computational methods for solving complex fluid flow equations directly or indirectly on reconstructed three-dimensional pore space images. In this study, we calculate porosity and single phase permeability using micro-CT imaging and Lattice Boltzmann (LB) simulations for 8 different porous media: beadpacks (with bead sizes 50 μm and 350 μm), sandpacks (LV60 and HST95), sandstones (Berea, Clashach and Doddington) and a carbonate (Ketton). Combining the observed porosity and calculated single phase permeability, we shed new light on the existence and size of the Representative Element of Volume (REV) capturing the different scales of heterogeneity from the pore-scale imaging. Our study applies the concept of the 'Convex Hull' to calculate the REV by considering the two main macroscopic petrophysical parameters, porosity and single phase permeability, simultaneously. The shape of the hull can be used to identify strong correlation between the parameters or greatly differing convergence rates. To further enhance computational efficiency we note that the area of the convex hull (for well-chosen parameters such as the log of the permeability and the porosity) decays exponentially with sub-sample size so that only a few small simulations are needed to determine the system size needed to calculate the parameters to high accuracy (small convex hull area). Finally we propose using a characteristic length such as the pore size to choose an efficient absolute voxel size for the numerical rock.
Impact of total substitution of corn for soybean hulls in diets for lambs
Directory of Open Access Journals (Sweden)
Milena Patricia Viana Bastos
2015-03-01
Full Text Available The experiment was conducted to assess the effect of substituting corn for soybean hulls on the apparent digestibility of nutrients, carcass performance and characteristics, and yield of cuts of 25 non-castrated male Santa Ines lambs with an initial body weight of 20±2 kg, at approximately 6 months of age, sheltered individually in stalls (1.10 × 1.0 m, considering a totally randomized design, fed 600 g/kg of forage and 400 g/kg of concentrate. Soybean hulls replaced corn at 0, 250, 500, 750, and 1,000 g/kg of dry matter. The intake of dry matter (DM, organic matter (OM, neutral detergent fiber (NDF, acid detergent fiber (ADF, NDF corrected for ash and protein (NDFap, total carbohydrates (TC, non-fibrous carbohydrates (NFC and total digestible nutrients (TDN in g/day, and the digestibility of NFC increased linearly with the soybean hull replacement. Crude protein intake displayed a quadratic response, whereas the intake of EE in g/day, the apparent digestibility coefficients of DM, OM, CP, EE, NDF, ADF, NDFap and TC, TDN, average daily gain, carcass characteristics, and yield of cuts were not affected by the soybean hull levels. Soybean hull substitution increased the intake of DM and nutrients, making it possible to replace up to 1,000 g/kg of dry matter in the diets for confined sheep, as it does not compromise performance, digestibility, carcass characteristics, or yield of cuts when used in sheep nutrition.
Characterization of fly ash, slag and glass hull for the obtaining of vitreous materials
Ayala Valderrama, D. M.; Gómez Cuaspud, J. A.
2017-12-01
This article presents the structural and thermal characterization of fly ash, the waste from blast furnace slag and the glass hull, generated as common residues in industry, which cannot be recycled easily or destroyed in a simple and fast way. In the particular case of fly ash, at present are being used as a lightweight aggregate in the production of cement, concrete and additive in the production of glass and glass ceramics. As far as the slag and hull, are being used as additives for the asphalt and concretes, however its use still is restricted, reason why its use in alternative ways are necessary. Initially the chemical composition of residues was established, determining that the fly ashes contains SiO2, Al2O3 and Fe2O3 oxides; 90% of the total composition, was confirmed by X-ray diffraction analysis. As minor constituents, small percentages of Mg, P, S, K, Na and Ti were found. For the slag case, the phases of Fe3O4, Ca3Mg (SiO2)4 and Ca(MgAl)(Si,Al)2O6 were identified, observing the presence of amorphous phase higher than 94% of the total phase of the system. Meanwhile, the glass hull sample showed a higher percentage of 95% amorphicity, mainly identifying a weak signal associated with silicon oxide SiO2. The thermal analyses of the samples, exhibit a decrease in mass for samples between 25-1000°C was observed, which can be attributed to different physical-chemical events that occur in the materials. The heat flow for each sample is related with the removal of the water retained by the physisorption processes around 92-110°C in all cases. With this previous characterization of the precursors, a sample was composed using 70% fly ash, 10% slag and 20% of glass hull was composed and treated at 1200°C/1.5 hours, obtaining a dense black glassy material for potential applications in field of the glass ceramics.
International Nuclear Information System (INIS)
Wuerz, H.; Wagner, K.; Becker, H.J.
1990-01-01
In reprocessing plants leached hulls and dissolver sludges represent rather important intermediate level α-waste streams. A control of the Pu content of these waste streams is desirable. The nondestructive assay method to be preferred would be passive neutron counting. However, before any decision on passive neutron monitoring becomes possible a characterization of hulls and sludges in terms of Pu content and neutron emission is necessary. For the direct determination of plutonium on hulls and in sludges, as coming from reprocessing, an active neutron measurement is required. A simple, and sufficiently sensitive active neutron method which can easily be installed uses as stationary Cf-252 neutron source. This method was used for the characterization of hulls and sludges in terms of plutonium content and total neutron emission in the WAK. Meanwhile a total of 28 batches of leached hulls and 22 batches of dissolver sludges from reprocessing of PWR fuel have been assayed. The paper describes the assay method used and gives an analysis of the error sources together with a discussion of the results and the accuracies obtained in a reprocessing plant. (orig./HP)
Hydrodynamic design of an underwater hull cleaning robot and its evaluation
Directory of Open Access Journals (Sweden)
Man Hyung Lee
2012-12-01
Full Text Available An underwater hull cleaning robot can be a desirable choice for the cleaning of large ships. It can make the cleaning process safe and economical. This paper presents a hydrodynamic design of an underwater cleaning robot and its evaluation for an underwater ship hull cleaning robot. The hydrodynamic design process of the robot body is described in detail. Optimal body design process with compromises among conflicting design requirements is given. Experimental results on the hydrodynamic performance of the robot are given.
Opvoeders se persepsies van hulle werkmotivering: 'n kwalitatiewe ...
African Journals Online (AJOL)
Erna Kinsey
Individue voel dat hulle self geen beheer oor die proses het nie en dat die verandering van buite ...... treatment has a negative influence on their self-esteem and moti- vation. ... tion, especially since the abolishment of corporal punishment.
Structural elements design manual working with Eurocodes
Draycott, Trevor
2009-01-01
Structural Elements Design Manual: Working With Eurocodes is the structural engineers 'companion volume' to the four Eurocodes on the structural use of timber, concrete, masonry and steelwork. For the student at higher technician or first degree level it provides a single source of information on the behaviour and practical design of the main elements of the building structure. With plenty of worked examples and diagrams, it is a useful textbook not only for students of structural and civil engineering, but also for those on courses in related subjects such as
"Keisri hull" kui müstiline fantasy / Siimon Prii
Prii, Siimon
2006-01-01
30. sept. Ugalas esietendunud Jaan Krossi "Keisri hull" (autoridramatiseering), lavastajad Jaak Allik ja Peeter Tammearu. Kunstnik on Jaanus Laagriküll ja muusikaline kujundaja Peeter Konovalov. Peaosas Peeter Tammearu
Rhythmical Alchemy: Village Drumming with Arthur Hull.
Hillerson, Gary R.; Hull, Arthur
As a step toward writing a master's thesis in psychology, the connection between rhythm circles and psychotherapeutic process was explored. Arthur Hull, who experienced and preached about the healing power of rhythm for many years, was interviewed. This article recorded the interview between Arthur and the researcher. The interviewer learned that…
"Keisri hull" pürib taas filmiks
2008-01-01
Eesti Filmi Sihtasutus otsustas anda arendustoetust mängufilmidele "Keisri hull" (režissöör Peeter Simm, arendaja Lege Artis Film), "Rahad ette" (režissöör Jaak Kilmi, arendaja Eetriüksus), "Öölendurid" (režissöör Peeter Urbla, arendaja Exitfilm)
Maintained ship hull girder ultimate strength reliability considering corrosion and fatigue
DEFF Research Database (Denmark)
Hu, Yong; Cui, W.; Pedersen, Preben Terndrup
2004-01-01
The prupose of this paper is to propose a methodology to assess the time-variant ultimate strength of ship hull girder under the degradations of corrosion and fatigue. The effects of fatigue cracks on the tensile and compressive residual ultimate strength of stiffened panels and unstiffened plates......, webs and flanges, respectively. The effects of inspections and repair are taken into account. A minimum net thickness rule is used to determine repair policies. A procedure is proposed to determine the maximum allowable corrosion thickness of different parts of the hull cross section. The procedure...
On the Influence of Hull Girder Flexibility on the Wave
DEFF Research Database (Denmark)
Seng, Sopheak; Andersen, Ingrid Marie Vincent; Jensen, Jørgen Juncher
2012-01-01
Numerical predictions and model test results of the wave induced bending moments in a 9,400 TEU post-Panamax container vessel are presented for two regular wave scenarios. Different numerical procedures have been applied: a linear and non-linear time-domain strip theory and a direct calculation (...... (CFD) solving the Navier-Stokes equations with the free surface captured by a volume-of-fluid (VOF) method. In all procedures the flexibility of the hull girder is modelled as a non-uniform Timoshenko beam. It is observed that the non-linear models agree well with the model tests...... and as there is no occurrence of severe slamming in the cases considered, the inexpensive non-linear strip theory is as accurate as the direct CFD calculation method. In a comparison with the results using the rigid body assumption, the increase in the vertical bending moment (VBM) amidships due to the flexibility of the hull...... girder is found to be approximately 7% (peak-to-peak amplitude) in general. The non-linear responses, however, contain over-harmonic frequencies which may coincide with the natural frequency of the two-node vertical bending mode inducing resonance. In that case the hull girder flexibility causes...
Determination of 93Zr, 107Pd and 135Cs in zircaloy hulls analytical development on inactive samples
International Nuclear Information System (INIS)
Excoffier, E.; Bienvenu, Ph.; Combes, C.; Pontremoli, S.; Delteil, N.; Ferrini, R.
2000-01-01
A study involving the participation of three laboratories of the Direction of the Fuel Cycle has been undertaken within the framework of a common interest program existing between the COGEMA and the CEA. Its purpose is to develop analytical methods for the determination of long-lived radionuclides in zircaloy hulls coming from spent fuel reprocessing operations. Acting as a complement to work carried out at the DRRV in ATALANTE concerning zircaloy dissolution and direct analysis of hull solutions, a study is now being conducted at the DESD/SCCD/LARC in Cadarache on three of these radionuclides, namely: zirconium 93, palladium 107 and caesium 135. It concerns three radioisotopes having very long periods (∼10 6 y), and which stabilize mainly through emission of β particles. The analytical technique chosen for the final measurement is inductively coupled plasma mass spectrometry (ICP/MS). Prior to the measurement, chemical separation processes are used to extract the radionuclides from the matrix and separate them from interfering elements and β emitters. The method developed initially on inactive solutions is being validated on irradiated samples coming from UP2/800 - UP3 reprocessing plants. (authors)
Directory of Open Access Journals (Sweden)
Juan Reyes
1998-04-01
Full Text Available In the present work we reported the study of rice hull enzymatic hydrolysis using a commercial cellulase preparation. The results showed that previous treatment with light and sodium chlorite inhibits the enzymatic process (31.4 and 11.8%, respectively while hydrogen peroxide and ozone favoured the enzymatic production of reducing sugars (5.9 and 54.9%, respectively. Studies performed by quimiluminescence showed that the chlorite treatment produced the most significant change in the structure of rice hull. Nevertheless, this treatment did not favour the subsequent enzymatic process. Photomicrographs obtained from rice hull hydrolysates showed that pre-treatment changed mainly the inner epidermis and parenchyma cell and that they did not change cellular organization of the hull.
Fuel element structure - design, production and operational behaviour
International Nuclear Information System (INIS)
Pott, G.; Dietz, W.
1985-01-01
The lectures held at the meeting of the fuel element section of the Kerntechnische Gesellschaft gives a survey of developments in fuel element structure design for PWR-type, BWR-type and fast breeder reactors. For better utilization of the fuel, concepts have been developed for re-usable, removable and thus repairable fuel elements. Furthermore, the manufacturing methods for fuel element structures were refined to achieve better quality and more efficient manufacturing methods. Statements on the dimensional behaviour and on the mechanical stability of fuel element structures in normal and accident operation could be made on the basis of post-irradiation inspections. Finally, the design, manufacture and irradiation behaviour of graphite reflectors in HTGR-type reactors are described. The 12 lectures have been recorded in the data base separately. (RF) [de
Characterization of spent fuel hulls and dissolution residues
International Nuclear Information System (INIS)
Gue, J.P.; Andriessen, H.
1985-04-01
The main results obtained within the framework of CEC programmes, by KFK, UKAEA and CEA, are reviewed concerning the characterization of dissolution wastes. The contents were determined of the main radioactive emitters contained in the hulls originating in a whole fuel assembly sampled at the La Hague plant, or from Dounreay PFR fuels. Radiochemical characterizations were carried out by different methods including neutron emission measurement, alpha and beta-gamma spectrometry, and mass spectrometry. Decontamination of the hulls by using rinsings and supplementary treatment were also dealt with. The ignition and explosion risks associated with the zircaloy fines formed during the shearing of LWR fuels were examined, and the ignition properties of irradiated and unirradiated zircaloy powders were determined and compared. The physical properties and compositions of the dissolution residues of PFR fuels were defined, in order to conduct tests on the immobilization of these wastes in cement
Guo, Peng; Cao, Jiannong; Zhang, Kui
2015-01-01
In critical event (e.g., fire or gas) monitoring applications of wireless sensor networks (WSNs), convex hull of the event region is an efficient tool in handling the usual tasks like event report, routes reconstruction and human motion planning. Existing works on estimating convex hull of event
Singh, Barinderjit; Singh, Narpinder; Thakur, Sheetal; Kaur, Amritpal
2017-03-01
In this study, extraction of polyphenols using different solvents (acetone, ethanol, methanol and water) with ultrasound and conventional method from whole mung bean (WMB), hull and cotyledon was conducted. Total phenolic content (TPC), total flavonoids content (TFC), total antioxidant activities (TAA), ferric reducing power (FRP) and DPPH radical scavenging activity were determined. Ultrasound treated extracts exhibited higher TPC, TFC, TAA, FRP and DPPH in different mung bean fractions than CSE. Among the solvents, acetone showed better TPC, TFC, TAA, FRP and DPPH. Hull had significantly higher TPC, TFC, TAA, FRP and DPPH than WMB and cotyledon. Sinapic acid (SA) was the major polyphenol in different fractions. Acetone extract of hull showed high polyphenol content. SA, ferulic acid, catechin, p-coumaric acid, resveratrol, quercetin and luteolin were the major contributors to antioxidant activity of acetone extract. Mung bean hull contained the maximum polyphenols and acetone was observed to be the best extraction medium for polyphenols in combination with ultrasound.
Erşan, Sevcan; Güçlü Üstündağ, Özlem; Carle, Reinhold; Schweiggert, Ralf M
2016-07-06
Phenolic constituents of the nonlignified red and green pistachio hulls (exo- and mesocarp) were assessed by HPLC-DAD-ESI-MS(n) as well as by HR-MS. A total of 66 compounds was identified in the respective aqueous methanolic extracts. Among them, gallic acid, monogalloyl glucoside, monogalloyl quinic acid, penta-O-galloyl-β-d-glucose, hexagalloyl hexose, quercetin 3-O-galactoside, quercetin 3-O-glucoside, quercetin 3-O-glucuronide, and (17:1)-, (13:0)-, and (13:1)-anacardic acids were detected at highest signal intensity. The main difference between red and green hulls was the presence of anthocyanins in the former ones. Differently galloylated hydrolyzable tannins, anthocyanins, and minor anacardic acids were identified for the first time. Pistachio hulls were thus shown to be a source of structurally diverse and potentially bioactive phenolic compounds. They therefore represent a valuable byproduct of pistachio processing having potential for further utilization as raw material for the recovery of pharmaceutical, nutraceutical, and chemical products.
DEFF Research Database (Denmark)
Andersen, Ingrid Marie Vincent; Jensen, Jørgen Juncher
2012-01-01
Currently, a number of very large container ships are being built and more are on order, and some concerns have been expressed about the importance of the reduced hull girder stiffness to the wave-induced loads. The main concern is related to the fatigue life, but also a possible increase...... in the global hull girder loads as consequence of the increased hull flexibility must be considered. This is especially so as the rules of the classification societies do not explicitly account for the effect of hull flexibility on the global loads. In the present paper an analysis has been carried out...... in the waves. Slamming forces are determined by a standard momentum formulation. The hull flexibility is modelled as a nonprismatic Timoshenko beam. Generally, good agreement with experimental results and more accurate numerical predictions has previously been obtained in a number of studies. The statistical...
The Causes of Boat Hull Blisters
1987-05-01
blistering. The report is divided into the following sections: Introduction; How Blisters Form; the Hull Material; Manufacturing Processes; Water Diffusion...Term Effects of Water Up-Takeo " The much more detailed and highly technical report of thia-Vsrk is entitled "The Causes of Blistering in Boat Building...Chemical Engineering, ably assisted by several graduate students, and was completed in the fall of 1986. The report itself, d List-ribution/_ Availabilit
Method for hull-less barley transformation and manipulation of grain mixed-linkage beta-glucan.
Lim, Wai Li; Collins, Helen M; Singh, Rohan R; Kibble, Natalie A J; Yap, Kuok; Taylor, Jillian; Fincher, Geoffrey B; Burton, Rachel A
2018-05-01
Hull-less barley is increasingly offering scope for breeding grains with improved characteristics for human nutrition; however, recalcitrance of hull-less cultivars to transformation has limited the use of these varieties. To overcome this limitation, we sought to develop an effective transformation system for hull-less barley using the cultivar Torrens. Torrens yielded a transformation efficiency of 1.8%, using a modified Agrobacterium transformation method. This method was used to over-express genes encoding synthases for the important dietary fiber component, (1,3;1,4)-β-glucan (mixed-linkage glucan), primarily present in starchy endosperm cell walls. Over-expression of the HvCslF6 gene, driven by an endosperm-specific promoter, produced lines where mixed-linkage glucan content increased on average by 45%, peaking at 70% in some lines, with smaller increases in transgenic HvCslH1 grain. Transgenic HvCslF6 lines displayed alterations where grain had a darker color, were more easily crushed than wild type and were smaller. This was associated with an enlarged cavity in the central endosperm and changes in cell morphology, including aleurone and sub-aleurone cells. This work provides proof-of-concept evidence that mixed-linkage glucan content in hull-less barley grain can be increased by over-expression of the HvCslF6 gene, but also indicates that hull-less cultivars may be more sensitive to attempts to modify cell wall composition. © 2017 Institute of Botany, Chinese Academy of Sciences.
Estimating Hull Coating Thickness Distributions Using the EM Algorithm
National Research Council Canada - National Science Library
Corriere, Michael
2000-01-01
The underwater hull coating system on surface ships is comprised anti-corrosive (AC) and anti-fouling (AF) paint The AF layers are designed to wear away, continuously leaching cuprous oxide to inhibit marine growth...
On elastic structural elements for nuclear reactors
International Nuclear Information System (INIS)
Povolo, F.
1978-03-01
The in-pile stress-relaxation behaviour of materials usually employed for the elastic structural elements, in nuclear reactors, is critically reviewed and the results are compared with those obtained in commercial zirconium alloys irradiated under similar conditions. Finally, it is shown that, under certain conditions, some zirconium alloys may be used as an alternative material for these structural elements. (orig.) [de
Efficiency measurement with a non-convex free disposal hull technology
DEFF Research Database (Denmark)
Fukuyama, Hirofumi; Hougaard, Jens Leth; Sekitani, Kazuyuki
2016-01-01
We investigate the basic monotonicity properties of least-distance (in)efficiency measures on the class of non-convex FDH (free disposable hull) technologies. We show that any known FDH least-distance measure violates strong monotonicity over the strongly (Pareto-Koopmans) efficient frontier. Tak....... Taking this result into account, we develop a new class of FDH least-distance measures that satisfy strong monotonicity and show that the developed (in)efficiency measurement framework has a natural profit interpretation.......We investigate the basic monotonicity properties of least-distance (in)efficiency measures on the class of non-convex FDH (free disposable hull) technologies. We show that any known FDH least-distance measure violates strong monotonicity over the strongly (Pareto-Koopmans) efficient frontier...
PIXE Analysis of Metal Hull Bolts From HMB DeBraak
International Nuclear Information System (INIS)
Correll, Francis D.; Cole, Lord K.; Slater, Charles J.; Vanhoy, Jeffrey R.; Fithian, Charles H.
2009-01-01
HMB DeBraak was a 16-gun British brig-sloop that sank in a squall on May 25, 1798 off Cape Henlopen, Delaware. Silt covered the wooden hull shortly after it sank, preserving it until DeBraak was raised in 1986. The items recovered from the ship include metal bolts that held the hull together. We used PIXE to measure the compositions of 45 of the bolts and found that they are nearly pure copper (98.3% on average), with most also containing small amounts of iron (0.87%), nickel (0.039%), arsenic (0.43%), silver (0.089%), lead (0.18%), and bismuth (0.12%). A few contain a little indium, tin, or antimony, but none contain zinc above the quantization level. The compositions are similar to those reported for 18th-century English copper, but different from several copper alloys also used to make hull bolts. We conclude that, when DeBraak was last fitted out in 1795-1797, the Royal Navy was still using bolts similar to William Forbes's mechanically hardened pure copper bolts. Forbes's process represents the successful innovation and application of new technology in Royal Navy ships during the wars of the late 18th century.
PIXE Analysis of Metal Hull Bolts From HMB DeBraak
Correll, Francis D.; Cole, Lord K.; Slater, Charles J.; Vanhoy, Jeffrey R.; Fithian, Charles H.
2009-03-01
HMB DeBraak was a 16-gun British brig-sloop that sank in a squall on May 25, 1798 off Cape Henlopen, Delaware. Silt covered the wooden hull shortly after it sank, preserving it until DeBraak was raised in 1986. The items recovered from the ship include metal bolts that held the hull together. We used PIXE to measure the compositions of 45 of the bolts and found that they are nearly pure copper (98.3% on average), with most also containing small amounts of iron (0.87%), nickel (0.039%), arsenic (0.43%), silver (0.089%), lead (0.18%), and bismuth (0.12%). A few contain a little indium, tin, or antimony, but none contain zinc above the quantization level. The compositions are similar to those reported for 18th-century English copper, but different from several copper alloys also used to make hull bolts. We conclude that, when DeBraak was last fitted out in 1795-1797, the Royal Navy was still using bolts similar to William Forbes's mechanically hardened pure copper bolts. Forbes's process represents the successful innovation and application of new technology in Royal Navy ships during the wars of the late 18th century.
A comparison of methods for evaluating structure during ship collisions
International Nuclear Information System (INIS)
Ammerman, D.J.; Daidola, J.C.
1996-01-01
A comparison is provided of the results of various methods for evaluating structure during a ship-to-ship collision. The baseline vessel utilized in the analyses is a 67.4 meter in length displacement hull struck by an identical vessel traveling at speeds ranging from 10 to 30 knots. The structural response of the struck vessel and motion of both the struck and striking vessels are assessed by finite element analysis. These same results are then compared to predictions utilizing the open-quotes Tanker Structural Analysis for Minor Collisionsclose quotes (TSAMC) Method, the Minorsky Method, the Haywood Collision Process, and comparison to full-scale tests. Consideration is given to the nature of structural deformation, absorbed energy, penetration, rigid body motion, and virtual mass affecting the hydrodynamic response. Insights are provided with regard to the calibration of the finite element model which was achievable through utilizing the more empirical analyses and the extent to which the finite element analysis is able to simulate the entire collision event. 7 refs., 8 figs., 4 tabs
The Effect of Buckwheat Hull Extract on Lipid Oxidation in Frozen-Stored Meat Products.
Hęś, Marzanna; Szwengiel, Artur; Dziedzic, Krzysztof; Le Thanh-Blicharz, Joanna; Kmiecik, Dominik; Górecka, Danuta
2017-04-01
This study investigated the effect of antioxidants on lipid stability of frozen-stored meat products. Buckwheat hull extract was used to enrich fried meatballs made from ground pork. During 180-d storage of meat products, lipid oxidation (peroxide and 2-thiobarbituric acid reactive substances [TBARS] value) was periodically monitored. The results were compared with butylated hydroxytoluene (BHT). The addition of antioxidants decreased lipid oxidation in stored meatballs. The highest ability to control peroxide and TBARS values was demonstrated for buckwheat hull extract. Moreover, buckwheat hull extract showed a higher 2,2-diphenyl-1-picrylhydrazyl free radical scavenging activity as well as higher Fe(II) ion chelating ability, as compared with BHT. The total content of phenolic compounds are highly correlated to the individual polyphenols in extract of buckwheat hull, among which the following were assayed: 3,4-dihydroxybenzoic acid, 4-hydroxybenzoic acid, gallic acid, isovanillic acid and p-coumaric acid, and flavonoids: isoorientin, quercetin, quercetin 3-d-glucoside, rutin, and vitexin. These results indicate that plant extracts can be used to prolong shelf life of products by protecting them against lipid oxidation and deterioration of their nutritional quality. © 2017 Institute of Food Technologists®.
Structural modeling techniques by finite element method
International Nuclear Information System (INIS)
Kang, Yeong Jin; Kim, Geung Hwan; Ju, Gwan Jeong
1991-01-01
This book includes introduction table of contents chapter 1 finite element idealization introduction summary of the finite element method equilibrium and compatibility in the finite element solution degrees of freedom symmetry and anti symmetry modeling guidelines local analysis example references chapter 2 static analysis structural geometry finite element models analysis procedure modeling guidelines references chapter 3 dynamic analysis models for dynamic analysis dynamic analysis procedures modeling guidelines and modeling guidelines.
Water Pressure Distribution on a Flying Boat Hull
Thompson, F L
1931-01-01
This is the third in a series of investigations of the water pressures on seaplane floats and hulls, and completes the present program. It consisted of determining the water pressures and accelerations on a Curtiss H-16 flying boat during landing and taxiing maneuvers in smooth and rough water.
Finite element analysis of structures through unified formulation
Carrera, Erasmo; Petrolo, Marco; Zappino, Enrico
2014-01-01
The finite element method (FEM) is a computational tool widely used to design and analyse complex structures. Currently, there are a number of different approaches to analysis using the FEM that vary according to the type of structure being analysed: beams and plates may use 1D or 2D approaches, shells and solids 2D or 3D approaches, and methods that work for one structure are typically not optimized to work for another. Finite Element Analysis of Structures Through Unified Formulation deals with the FEM used for the analysis of the mechanics of structures in the case of linear elasticity. The novelty of this book is that the finite elements (FEs) are formulated on the basis of a class of theories of structures known as the Carrera Unified Formulation (CUF). It formulates 1D, 2D and 3D FEs on the basis of the same ''fundamental nucleus'' that comes from geometrical relations and Hooke''s law, and presents both 1D and 2D refined FEs that only have displacement variables as in 3D elements. It also covers 1D...
Infinte Periodic Structure of Lightweight Elements
DEFF Research Database (Denmark)
Domadiya, Parthkumar Gandalal; Andersen, Lars Vabbersgaard; Sorokin, Sergey
2013-01-01
Lightweight wooden structures have become more popular as a sustainable, environmental- friendly and cost-effective alternative to concrete, steel and masonry buildings. However, there are certain drawbacks regarding noise and vibration due to the smaller weight and stiffness of wooden buildings....... Furthermore, lightweight building elements are typically periodic structures that behave as filters for sound propagation within certain frequency ranges (stop bands), thus only allowing transmission within the pass bands. Hence, traditional methods based on statistical energy analysis cannot be used...... for proper dynamic assessment of lightweight buildings. Instead, this paper discusses and compares the use of finite element analysis and a wave approach based on Floquet theory. The present analysis has focus on the effect of periodicity on vibration transmission within semi-infinite beam structures. Two...
Optimisation of dilute acid pre-treatment of artisan rice hulls for ethanol production
International Nuclear Information System (INIS)
Lopez, Yoney; Martin, Carlos; Gullon, Beatriz; Parajo, Juan Carlos
2011-01-01
Rice hulls are potential low-cost feedstocks for fuel ethanol production in many countries. In this work, the dilute-acid pre-treatment of artisan rice hulls was investigated using a central composite rotatable experimental design. The experimental variables were temperature (140-210 C), biomass load (5-20%) and sulphuric acid concentration (0.5-1.5 g per 100 g of reaction mixture). A total of 16 experimental runs, including a 23-plan, two replicates at the central point and six star points, were carried out. Low temperatures were found to be favourable for the hydrolysis of xylan and of the easily hydrolyzable glucan fraction. High glucose formation (up to 15.3 g/100 g), attributable to starch hydrolysis, was detected in the hydrolysates obtained under the least severe pre-treatment conditions. Using the experimental results, several models for predicting the effect of the operational conditions on the yield of pretreated solids, xylan and glucan conversion upon pre-treatment, and on enzymatic convertibility of cellulose were developed. Optimum results were predicted for the conversion of easily-hydrolyzable glucan in the material pretreated at 140.7 C, and for the enzymatic saccharification of cellulose in the material pretreated at 169 C. These results suggested the use of two-step acid hydrolysis as future pre-treatment strategy for artisan rice hulls. Key words: Dilute acid hydrolysis, enzymatic hydrolysis, pre-treatment, rice hulls. (author)
European single-hull regulation in force
Energy Technology Data Exchange (ETDEWEB)
Rogers, Michael
2004-07-01
The European Union (EU)has decided that from 21 October 2003 no single-hull tanker carrying heavy grades of oil will be permitted to enter or leave ports or offshore installations or anchor in areas under the jurisdiction of the EU member states. Some of the provisions of the EU regulation will not be in force until 2010. The article looks back on what has led up to to the current regulations, beginning with the Titanic disaster of 1914.
Finite element model updating of natural fibre reinforced composite structure in structural dynamics
Directory of Open Access Journals (Sweden)
Sani M.S.M.
2016-01-01
Full Text Available Model updating is a process of making adjustment of certain parameters of finite element model in order to reduce discrepancy between analytical predictions of finite element (FE and experimental results. Finite element model updating is considered as an important field of study as practical application of finite element method often shows discrepancy to the test result. The aim of this research is to perform model updating procedure on a composite structure as well as trying improving the presumed geometrical and material properties of tested composite structure in finite element prediction. The composite structure concerned in this study is a plate of reinforced kenaf fiber with epoxy. Modal properties (natural frequency, mode shapes, and damping ratio of the kenaf fiber structure will be determined using both experimental modal analysis (EMA and finite element analysis (FEA. In EMA, modal testing will be carried out using impact hammer test while normal mode analysis using FEA will be carried out using MSC. Nastran/Patran software. Correlation of the data will be carried out before optimizing the data from FEA. Several parameters will be considered and selected for the model updating procedure.
Visual hull method for tomographic PIV measurement of flow around moving objects
Energy Technology Data Exchange (ETDEWEB)
Adhikari, D.; Longmire, E.K. [University of Minnesota, Department of Aerospace Engineering and Mechanics, Minneapolis, MN (United States)
2012-10-15
Tomographic particle image velocimetry (PIV) is a recently developed method to measure three components of velocity within a volumetric space. We present a visual hull technique that automates identification and masking of discrete objects within the measurement volume, and we apply existing tomographic PIV reconstruction software to measure the velocity surrounding the objects. The technique is demonstrated by considering flow around falling bodies of different shape with Reynolds number {proportional_to}1,000. Acquired image sets are processed using separate routines to reconstruct both the volumetric mask around the object and the surrounding tracer particles. After particle reconstruction, the reconstructed object mask is used to remove any ghost particles that otherwise appear within the object volume. Velocity vectors corresponding with fluid motion can then be determined up to the boundary of the visual hull without being contaminated or affected by the neighboring object velocity. Although the visual hull method is not meant for precise tracking of objects, the reconstructed object volumes nevertheless can be used to estimate the object location and orientation at each time step. (orig.)
Directory of Open Access Journals (Sweden)
Xiao-biao ZHU
2008-12-01
Full Text Available Distributions of pubescences on leaf blade and hull in japonica rice were observed under an optical microscope. Numbers of leaf and hull pubescences in P1, P2, F1, B1, B2 and F2 generations were investigated in three combinations of japonica rice (Sidao 10A/Wuyujing 3R, Wuyujing 3A/Sidao 10R and Liuyan 189A/HR-122, and genetic analysis for these two traits were conducted by using the joint analysis method of P1, P2, F1, B1, B2 and F2 generations with the mixed major gene plus polygene inheritance models. Leaf pubescences characterized by swollen base and fine tip distributed regularly on the boundary between dark green stripe and light green stripe of leaf blade. Hull pubescences with various lengths distributed irregularly on the whole hull. Numbers of leaf pubescences in the reciprocal combinations of Sidao 10A/Wuyujing 3R and Wuyujing 3A/Sidao 10R and numbers of hull pubescences in all the three combinations were controlled by one pair of additive major genes plus additive-dominant polygenes. In the combination of Liuyan 189A/HR-122, number of leaf pubescences was controlled by one pair of additive-dominant major genes plus additive-dominant polygenes. Both numbers of leaf and hull pubescences were mainly governed by major genes.
Prabowo, A. R.; Cho, H. J.; Byeon, J. H.; Bae, D. M.; Sohn, J. M.
2018-01-01
Predicted loads, such as crew, cargo, and structure have been applied as main inputs during ship design and analysis. However, unexpected events on the sea has high possibility to deliver remarkable losses for ship, industry, and environment. Previous oil spill incident by the Exxon Valdez in Alaska is the perfect example which an environmental damage and industry loss are initiated by an impact phenomenon on the ship, i.e. grounding. Even though hull arrangement has adopted double hull system, grounding may threaten ship safety in various scenarios. This situation pushes society to demand sustainable investigation for impact phenomena on water transportation mode to update understanding in the phenomenon and ensure structural safety during ship operation. This work aimed to study structural behaviour of chemical tanker as a marine structure under impact, namely ship grounding. Bottom raking case was considered to be calculated by virtual experiment. The study was performed using nonlinear finite element (FE) method and an idealised geometry of seabed rock would be deployed to be hard obstruction. Observation on the selected crashworthiness criteria, i.e. internal energy and crushing force indicated that as advanced penetration occurred on the ship structure, the absorbed strain energy continued to increase, while major fluctuation appeared during the initial contact between obstruction and ship happened. Damage extent of several structural members during the crushing process was shown, which concluded that the bottom plating had the largest severity in forms of tearing mode among of all members on the bottom structure.
Directory of Open Access Journals (Sweden)
Hee-Jong Choi
2011-12-01
Full Text Available In the present study, a new hull panel generation algorithm, namely panel cutting method, was developed to predict flow phenomena around a ship using the Rankine source potential based panel method, where the iterative method was used to satisfy the nonlinear free surface condition and the trim and sinkage of the ship was taken into account. Numerical computations were performed to investigate the validity of the proposed hull panel generation algorithm for Series 60 (CB=0.60 hull and KRISO container ship (KCS, a container ship designed by Maritime and Ocean Engineering Research Institute (MOERI. The computational results were validated by comparing with the existing experimental data.
Choi, Hee-Jong; Chun, Ho-Hwan; Park, Il-Ryong; Kim, Jin
2011-12-01
In the present study, a new hull panel generation algorithm, namely panel cutting method, was developed to predict flow phenomena around a ship using the Rankine source potential based panel method, where the iterative method was used to satisfy the nonlinear free surface condition and the trim and sinkage of the ship was taken into account. Numerical computations were performed to investigate the validity of the proposed hull panel generation algorithm for Series 60 (CB=0.60) hull and KRISO container ship (KCS), a container ship designed by Maritime and Ocean Engineering Research Institute (MOERI). The computational results were validated by comparing with the existing experimental data.
Effect of stern hull shape on turning circle of ships
Jaswar, Maimun, A.; Wahid, M. A.; Priyanto, A.; Zamani, Pauzi, Saman
2012-06-01
Many factors such as: stern hull shape, length, draught, trim, propulsion system and external forces affecting the drift angle influence rate of turn and size of turning circle of ships. This paper discusses turning circle characteristics of U and V stern hull shape of Very Large Crude Oil Carrier (VLCC) ships. The ships have same principal dimension such as length, beam, and draught. The turning circle characteristics of the VLCC ships are simulated at 35 degree of rudder angle. In the analysis, firstly, turning circle performance of U-type VLCC ship is simulated. In the simulation, initial ship speed is determined using given power and rpm. Hydrodynamic derivatives coefficients are determined by including effect of fullness of aft run. Using the obtained, speed and hydrodynamic coefficients, force and moment acting on hull, force and moment induced by propeller, force and moment induced by rudder are determined. Finally, ship trajectory, ratio of speed, yaw angle and drift angle are determined. Results of simulation results of the VLCC ship are compared with the experimental one as validation. Using the same method, V-type VLCC is simulated and the simulation results are compared with U-type VLCC ship. Results shows the turning circle of U-type is larger than V-type due to effect stern hul results of simulation are.
Directory of Open Access Journals (Sweden)
Xu Xia
2016-01-01
Full Text Available The accumulation of pigments affects the color of rice hulls while only limited information is known about its underlying mechanisms. In the present study, a rice brown hull 6 (bh6 mutant was isolated from an ethane methyl sulfonate (EMS-induced IR64 mutant bank. Brown pigments started to accumulate in bh6 rice hulls after heading and reached a higher level in mature seeds. Some major agronomic traits including panicle length and 1000-grain weight in bh6 were significantly lower than those in its corresponding wild type IR64, while other agronomic traits such as plant height, growth duration and seed-setting rate were largely similar between the two genotypes. The analysis of pigment content showed that the contents of total flavonoids and anthocyanin in bh6 hulls were significantly higher than those in IR64 hulls. Our results showed that the brown hull phenotype in bh6 was controlled by a single recessive gene which locates on the long arm of chromosome 9. Sequencing analysis detected a single base substitution (G/A at position 1013 of the candidate gene (LOC_Os09g12150 encoding an F-box domain-containing protein (FBX310. Functional complementation experiment using the wild type allele can rescue the phenotype in bh6. Thus, we named this mutated gene as OsFBX310bh6, an allele of OsFBX310 functioning as an inhibitor of brown hull. The isolation of OsFBX310bh6 and its wild type allele can provide useful experimental materials and will facilitate the studies on revealing the mechanisms of flavonoid metabolism in monocot plants.
Moosavi Dolatabadi, Khadijeh Sadat; Dehghan, Gholamreza; Hosseini, Siavash; Jahanban Esfahlan, Ali
2015-01-01
Almond (Prunus amygdalus) hull and shell are agricultural by-products that are a source of phenolic compounds.The processing of almond produce shell and hull, accounts for more than 50% by dry weight of the almond fruits. Recently, more studies have focused on the influence of storage conditions and postharvest handling on the nutritional quality of fruits, especially the antioxidant phenolics. In this study, influence of long-term storage (five years) on the total phenolic and antioxidant capacity of almond hull and shell from different genotypes was evaluated. The fruits of subjected genotypes were collected and their hull and shell were separated. They were dried and reduced to fine powder. This powder stored at room temperature for five years. The total phenolic content (TPC) and bioactivities (antioxidant potential: DPPH and ABTS radical scavenging and reducing power) of extracts were evaluated using spectrophotometric methods. It was found that TPC content and bioactivity levels in the stored almond hull and shell were different, compared to the hulls and shells which were evaluated in 2007. S1-4 genotype had the highest TPC and reducing power in its hull and shell.Low correlation coefficient was observed between phenolic content and the DPPH radical scavenging percentage in hull and shell extract. For the first time, results of this investigation showed that storage can influence the antioxidant and antiradical potential of almond hull and shell.
Directory of Open Access Journals (Sweden)
Kiston Simanihuruk
2009-03-01
Full Text Available Processing of passion fruit (Passiflora edulis Sims f. edulis Deg to produce passion fruit juice produce passion fruit hulls that is potential for feedstuff. Twenty male kacang goats (average initial body weight 17±1.24 kg were used in an experiment to study the effect of utilization of passion fruit hulls as feed component in the complete pellet ration on their growth. The experiment was arranged in completely randomized design consisting of 4 diets and 5 replications. Animal were randomly allocated into 4 diets (0, 15, 30, 45% level of passion fruit hulls. Each diet contained 14% crude protein and 2550 Kcal kg-1 metabolism energy. The ration was offered at 3.8% of body weight based on dry matter. The result of the experiment showed that all variables observed were not affected by level of passion fruit hulls (P>0.05. Average daily gain and feed efficiency tended to decrease with the increase level of passion fruit hulls. The highest dry matter, organic matter and N intake (768,78 g h-1 d-1; 687,37 g h-1 d-1 and 17,22 g h-1 d-1 respectively were found from R1 treatment (15% level of passion fruit hulls. It was concluded that passion fruit hulls can be used till 45% level in the diet of Kacang goat.
Castoldi, Rafael; Correa, Vanesa G; de Morais, Gutierrez Rodrigues; de Souza, Cristina G M; Bracht, Adelar; Peralta, Rosely A; Peralta-Muniz Moreira, Regina F; Peralta, Rosane M
2017-01-01
In this work, liquid nitrogen was used for the first time in the pretreatment of plant biomasses for purposes of enzymatic saccharification. After treatment (cryocrushing), the initial rates of the enzymatic hydrolysis of eucalyptus sawdust and rice hull were increased more than ten-fold. Cryocrushing did not modify significantly the contents of cellulose, hemicellulose and lignin in both eucalyptus sawdust and rice hulls. However, substantial disorganization of the lignocellulosic materials in consequence of the pretreatment could be observed by electron microscopy. Cryocrushing was highly efficient in improving the saccharification of the holocellulose component of the plant biomasses (from 4.3% to 54.1% for eucalyptus sawdust and from 3.9% to 40.6% for rice hull). It is important to emphasize that it consists in a simple operation with low requirements of water and chemicals, no corrosion, no release of products such as soluble phenolics, furfural and hydroxymethylfurfural and no waste generation. Copyright © 2016 Elsevier Ltd. All rights reserved.
Statistical study on the strength of structural materials and elements
International Nuclear Information System (INIS)
Blume, J.A.; Dalal, J.S.; Honda, K.K.
1975-07-01
Strength data for structural materials and elements including concrete, reinforcing steel, structural steel, plywood elements, reinforced concrete beams, reinforced concrete columns, brick masonry elements, and concrete masonry walls were statistically analyzed. Sample statistics were computed for these data, and distribution parameters were derived for normal, lognormal, and Weibull distributions. Goodness-of-fit tests were performed on these distributions. Most data, except those for masonry elements, displayed fairly small dispersion. Dispersion in data for structural materials was generally found to be smaller than for structural elements. Lognormal and Weibull distributions displayed better overall fits to data than normal distribution, although either Weibull or lognormal distribution can be used to represent the data analyzed. (auth)
Conditioning and storage of spent fuel cladding hulls by rolling and embedding in concrete
International Nuclear Information System (INIS)
Spenk, G.; Frotscher, H.; Graebner, H.; Kapulla, H.
1981-01-01
Under a contract with the European Atomic Energy Community the Kernforschungszentrum Karlsruhe, KfK, developed a conditioning process for LWR cladding waste. After compaction of the hulls by rolling they are embedded in a concrete matrix. In addition to basic data of the cladding waste, the compaction process, consisting of a dosage system and a rolling mill, is described. Several embedding techniques are possible, but a final selection has still to be made. Best results will probably be achieved by a vacuum technique. To characterize the waste product, leach tests have been started. The compression strength of compacted hulls embedded in concrete was determined to 2300 N.cm -2 . Hydrogen release due to radiolyses lies around 3 μl.g -1 sub(concrete).Mrad -1 which corresponds to the values expected on account of the water content of the samples. Less hydrogen was determined in samples with Zircaloy added. The tritium release of tritiated Zircaloy hulls embedded in concrete is greatly dependent on temperature and irradiation. At 100 0 C and with γ-irradiation the tritium release is about two orders of magnitude higher compared with experiments without irradiation. The thermal conductivity of samples of Zircaloy hulls embedded in concrete was determined to be 1.4W.m -1 .K -1 . (author)
Phenol metabolism and preservation of fresh in-hull walnut stored in modified atmosphere packaging.
Wang, Jin; Li, Pan; Gong, Bi; Li, Shuying; Ma, Huiling
2017-12-01
The effects of modified atmosphere packaging (MAP) on phenol metabolism and preservation of fresh in-hull walnuts have been investigated. Fruit was packaged under MAP1 (film thickness, 30 μm), MAP2 (45 μm) and MAP3 (50 μm) and stored at -0.5 to 1.0 °C for up to 60 days. Firmness, soluble solid concentration, total phenols, total flavonoids and total antioxidant activity of the green hull were maintained at higher levels under the MAP conditions, whereas decay incidence was lower compared to the control during storage. Green hull of fruit under MAP conditions contained lower polyphenol oxidase activity than the control and the peroxidase activity was at a similar level to the control after 18 days. Phenylalanine ammonialyase activity was enhanced by MAP conditions, with two peaks on days 18 and 36. Until day 60, the peroxide value and acid value of kernel oils under MAP conditions were lower than that of the control. The MAP3 treatment was most effective for maintaining kernel quality. The protective role of MAP conditions on phenolic contents in green hull may contribute to the mitigation of decay and the maintenance of kernel quality. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.
Stochastic Finite Elements in Reliability-Based Structural Optimization
DEFF Research Database (Denmark)
Sørensen, John Dalsgaard; Engelund, S.
Application of stochastic finite elements in structural optimization is considered. It is shown how stochastic fields modelling e.g. the modulus of elasticity can be discretized in stochastic variables and how a sensitivity analysis of the reliability of a structural system with respect to optimi......Application of stochastic finite elements in structural optimization is considered. It is shown how stochastic fields modelling e.g. the modulus of elasticity can be discretized in stochastic variables and how a sensitivity analysis of the reliability of a structural system with respect...
Mäkelä, Miia R; Bouzid, Ourdia; Ruiz-Robleto, J.; Post, Harm|info:eu-repo/dai/nl/341667374; Peng, Mao; Heck, Albert|info:eu-repo/dai/nl/105189332; Altelaar, Maarten|info:eu-repo/dai/nl/304833517; de Vries, Ronald P|info:eu-repo/dai/nl/186324960
2017-01-01
The coprophilic ascomycete fungus Podospora anserina was cultivated on three different plant biomasses, i.e. cotton seed hulls (CSH), soybean hulls (SBH) and acid-pretreated wheat straw (WS) for four days, and the potential of the produced enzyme mixtures was compared in the enzymatic
Directory of Open Access Journals (Sweden)
2011-02-01
Full Text Available Hydrolytic degradations of polylactic acid/rice hulls (PLA/RH composites with various rice hulls contents due to water absorptions at 23, 51 and 69°C were investigated by studying the thermal properties, chemical composition, molecular weight, and morphology of the degraded products. The results have attested that the stability of PLA/RH composites in water depends slightly on rice hulls contents but it is significantly influenced by water temperature. Water absorption in 30 days at 23°C was between 0.87 and 9.25% depending on rice hull contents. However, at thermophilic temperatures, the water absorption and degradation of these products were increased significantly. Saturations were achieved in less than 25 and 9 days at 51°C and 69°C, respectively, while hydrolytic degradation was demonstrated by an increase in fragility and development of crystallinity. At 69°C, there were significant reductions of the decomposition and glass transition temperatures of the polymer by 13°C. These changes were associated with the reduction of the molecular weight of PLA from 153.1 kDa to ~10.7 kDa due to hydrolysis of its ester group.
CYTOTOXIC AND ANTIOXIDANT ACTIVITY OF BUCKWHEAT HULL EXTRACTS
Directory of Open Access Journals (Sweden)
Martina Danihelová
2013-02-01
Full Text Available Buckwheat contains many prophylactic compounds that are concentrated mainly in outer layers of buckwheat grain. The aim of this study was to prepare buckwheat hull extracts. Ten buckwheat cultivars were screened for their antioxidant and anticancer properties. Total polyphenol content was determined using Folin-Ciocalteau's reagent. Antioxidant activity was established by the method of binding free radical DPPH. Cytotoxic properties were measured on human cervical cancer cells HeLa using mitochondrial cytotoxic test (MTT. Total polyphenol content ranged from 166.67 to 635.31 mg GAE/100 g DW. The highest content displayed tartary buckwheat cultivar Madawaska (0.64% of hulls weight. Among common buckwheat the richest in polyphenols were cultivars Bamby and KASHO-2. The best free radical binding antioxidant activity was found for cultivars with highest polyphenol content. This relationship was not observed for cytotoxic action on human cervical cancer cells. The best growth inhibitory activity on HeLa cancer cells displayed common buckwheat cultivars Bamby and KASHO-2 (up to 50%, extract concentration 100 µg/ml. This was not found for tartary buckwheat cultivar Madawaska.
Directory of Open Access Journals (Sweden)
Xiyi Cheng
2016-07-01
Full Text Available Peanut hull residues were considered for the manufacturing of particleboards. Various concentrations of two types of adhesive—polymeric diphenylmethane diisocyanate (MDI and urea-formaldehyde (UF—were separately combined with four types of peanut hull particles (fine, mixed, coarse particles, and peanut hull powder to manufacture particleboards with a certain target density. The confidence level of the effect of the selected production parameters on the physical and mechanical properties of the panels was evaluated. The results showed that increasing the adhesive mass percentage significantly improved the dimensional stability of the boards. A better mechanical performance was achieved for the MDI-bonded boards compared with the UF-bonded boards. Superior bonding between the MDI adhesive and the peanut hulls with different particle geometries was also observed; the peanut hull powder and coarse particles were unsuitable for the manufacturing of panels, due to the risk of an internal blowout. The water resistance of the panels was poor, whereas the mechanical strength of the peanut hull particleboard met the class M-1 requirement of the ANSI A208.1 (2009 standard for wood particleboard.
Soil-Framed Structure Interaction Analysis - A New Interface Element
Directory of Open Access Journals (Sweden)
M. Dalili Shoaei
Full Text Available AbstractInterfacial behavior between soil and shallow foundation has been found so influential to combined soil-footing performance and redistribution of forces in the superstructure. This study introduces a new thin-layer interface element formulated within the context of finite element method to idealize interfacial behavior of soil-framed structure interaction with new combination of degrees of freedom at top and bottom sides of the interface element, compatible with both isoparametric beam and quadrilateral element. This research also tends to conduct a parametric study on respective parameters of the new joint element. Presence of interface element showed considerable changes in the performance of the framed structure under quasi-static loading.
Directory of Open Access Journals (Sweden)
Khadijeh Sadat Moosavi Dolatabadi
2014-12-01
Full Text Available Objectives: Almond (Prunus amygdalus hull and shell are agricultural by-products that are a source of phenolic compounds.The processing of almond produce shell and hull, accounts for more than 50% by dry weight of the almond fruits. Recently, more studies have focused on the influence of storage conditions and postharvest handling on the nutritional quality of fruits, especially the antioxidant phenolics. In this study, influence of long-term storage (five years on the total phenolic and antioxidant capacity of almond hull and shell from different genotypes was evaluated. Materials and Methods: The fruits of subjected genotypes were collected and their hull and shell were separated. They were dried and reduced to fine powder. This powder stored at room temperature for five years. The total phenolic content (TPC and bioactivities (antioxidant potential: DPPH and ABTS radical scavenging and reducing power of extracts were evaluated using spectrophotometric methods. Results: It was found that TPC content and bioactivity levels in the stored almond hull and shell were different, compared to the hulls and shells which were evaluated in 2007. S1-4 genotype had the highest TPC and reducing power in its hull and shell.Low correlation coefficient was observed between phenolic content and the DPPH radical scavenging percentage in hull and shell extract. Conclusions: For the first time, results of this investigation showed that storage can influence the antioxidant and antiradical potential of almond hull and shell.
Prefabricated elements and structures: Developments, tests and experiences
DEFF Research Database (Denmark)
Goltermann, Per
2014-01-01
Danish concrete structures are often built with prefabricated elements, joined together on the site and this provides a large challenge to constantly improve and optimize the elements, the joints and the models. DTU Byg has been active in the development, testing and modelling of new elements...
Hybrid Wireless Hull Monitoring System for Naval Combat Vessels
2010-03-01
Payload Data Acquisition System (SPDAS) is designed by the Technology Management Group, Inc. ( TMG ). In its design, the monitoring system is intended...monitoring system custom designed by TMG for the U.S. Navy. The Scientific Payload Data Acquisition System (SPDAS) is a wired hull monitoring system
A computer program for structural analysis of fuel elements
International Nuclear Information System (INIS)
Hayashi, I.M.V.; Perrotta, J.A.
1988-01-01
It's presented the code ELCOM for the matrix analysis of tubular structures coupled by rigid spacers, typical of PWR's fuel elements. The code ELCOM makes a static structural analysis, where the displacements and internal forces are obtained for each structure at the joints with the spacers, and also, the natural frequencies and vibrational modes of an equivalent integrated structure are obtained. The ELCOM result is compared to a PWR fuel element structural analysis obtained in published paper. (author) [pt
Wang, Shuzhen; Chen, Wenyue; Xiao, Wenfei; Yang, Changdeng; Xin, Ya; Qiu, Jieren; Hu, Weimin; Ying, Wu; Fu, Yaping; Tong, Jianxin; Hu, Guocheng; Chen, Zhongzhong; Fang, Xianping; Yu, Hong; Lai, Wenguo; Ruan, Songlin; Ma, Huasheng
2015-01-01
Rice hull, the outer cover of the rice grain, determines grain shape and size. Changes in the rice hull proteome in different growth stages may reflect the underlying mechanisms involved in grain development. To better understand these changes, isobaric tags for relative and absolute quantitative (iTRAQ) MS/MS was used to detect statistically significant changes in the rice hull proteome in the booting, flowering, and milk-ripe growth stages. Differentially expressed proteins were analyzed to predict their potential functions during development. Gene ontology (GO) terms and pathways were used to evaluate the biological mechanisms involved in rice hull at the three growth stages. In total, 5,268 proteins were detected and characterized, of which 563 were differentially expressed across the development stages. The results showed that the flowering and milk-ripe stage proteomes were more similar to each other (r=0.61) than either was to the booting stage proteome. A GO enrichment analysis of the differentially expressed proteins was used to predict their roles during rice hull development. The potential functions of 25 significantly differentially expressed proteins were used to evaluate their possible roles at various growth stages. Among these proteins, an unannotated protein (Q7X8A1) was found to be overexpressed especially in the flowering stage, while a putative uncharacterized protein (B8BF94) and an aldehyde dehydrogenase (Q9FPK6) were overexpressed only in the milk-ripe stage. Pathways regulated by differentially expressed proteins were also analyzed. Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase (Q9SDJ2), and two magnesium-chelatase subunits, ChlD (Q6ATS0), and ChlI (Q53RM0), were associated with chlorophyll biosynthesis at different developmental stages. The expression of Q9SDJ2 in the flowering and milk-ripe stages was validated by qRT-PCR. The 25 candidate proteins may be pivotal markers for controlling rice hull development at various
INTEGRATION OF SHIP HULL ASSEMBLY SEQUENCE PLANNING, SCHEDULING AND BUDGETING
Directory of Open Access Journals (Sweden)
Remigiusz Romuald Iwańkowicz
2015-02-01
Full Text Available The specificity of the yard work requires the particularly careful treatment of the issues of scheduling and budgeting in the production planning processes. The article presents the method of analysis of the assembly sequence taking into account the duration of individual activities and the demand for resources. A method of the critical path and resource budgeting were used. Modelling of the assembly was performed using the acyclic graphs. It has been shown that the assembly sequences can have very different feasible budget regions. The proposed model is applied to the assembly processes of large-scale welded structures, including the hulls of ships. The presented computational examples have a simulation character. They show the usefulness of the model and the possibility to use it in a variety of analyses.
Une, Satsuki; Nonaka, Koji; Akiyama, Junich
2016-10-01
The effects of hull processing, soaking, and boiling on the content or activity of antinutrients in the red sword bean (RSB; Canavalia gladiata) were investigated. RSB seeds were compared with kidney bean (KB; Phaseolus vulgaris) seeds that are starch based and often used as processed products in Japan. RSB seeds had higher weight, thicker hull, and higher protein content, but lower moisture content compared with KB seeds. Because of the strong and thick hull, the relative water absorption of untreated RSB seeds was very low after soaking. Seeds were soaked after dehulling, scratching, and roasting. The results showed that hull scratching was the optimal method for increasing water absorption during soaking compared with dehulling and roasting. After soaking, the water used for soaking was discarded, since it had a high content of polyphenols and bitter taste, and RSB seeds were boiled in fresh water for 20, 40, and 60 min. The results showed that polyphenol and tannin contents, antioxidant activity, and hemagglutinating activity, as well as maltase, sucrase, and trypsin inhibitor activities in scratched RSB seeds decreased significantly after boiling compared with those in raw seeds, whereas amylase inhibitor activity showed no significant change. Overall, it was concluded that the combination of hull scratching, soaking, and boiling in fresh water can reduce thermal-stable or sensitive antinutrients in RSB and thus, significantly improve its nutritional value. © 2016 Institute of Food Technologists®.
Report of the Committee on the Survey of Hull Bottom of Nuclear Ship Mutsu
International Nuclear Information System (INIS)
1979-01-01
The nuclear ship Mutsu arrived the Sasebo Shipyard, Sasebo Heavy Industries Co., Ltd., in October, 1978, to repair the shielding for the reactor and to inspect generally the safety. The docking works were not carried out since 1972 for the Mutsu, therefore it was decided to admit the Mutsu in a dock to put the hull in order. To prepare for starting the output test again, it is necessary to grasp the state of the hull part below water line and take appropriate measures as occasions demand, therefore the Japan Nuclear Ship Development Agency established the Committee on the Survey of Hull Bottom of Nuclear Ship Mutsu in July, 1979. Three meetings of the committee were held from July 2 to September 19, and the draft of the report was drawn up. The Mutsu entered No. 5 dock of the Sasebo Shipyard on July 9, and left on July 23, and the survey of the hull bottom was carried out during that period. The results of the survey are reported as follows: the state of bottom shell plates, the state of aft part and the propeller, the state of sea chests, the state of the electrical corrosion protection of bottom shell plates and the state of sea valves. The problem to be specially mentioned was not found, and it was recognized that the sound maintenance has been carried out. (Kako, I.)
Leaching behavior of water-soluble carbohydrates from almond hulls
Over 58% of the dry matter content of the hulls from the commercial almond (Prunus dulcis (Miller) D.A. Webb) is soluble in warm water (50-70°C) extraction. The water-soluble extractables include useful amounts of fermentable sugars (glucose, fructose, sucrose), sugar alcohols (inositol and sorbito...
Hull Formula and Standard of Compensation for Expropriation in Postcolonial States
Directory of Open Access Journals (Sweden)
M. Ya’kub Aiyub Kadir
2017-08-01
ABSTRAK: Setelah progam dekolonisasi negara-negara jajahan, salah satu isu yang mencuat dalam hukum internasional adalah perlindungan investasi asing dari nasionalisasi negera negara baru merdeka. Dalam hal ini hull formula yang mulanya didesain oleh negara Amerika terhadap Mexico, digunakan sebagai standar kompensasi dari nasionalisasi. Dari perspektif negara negara poskolonial standar ini dianggap tidak adil, bahkan standar ini digunakan hanya untuk memperkuat dominasi negara negara penjajah di bekas jajahannya. Dengan menggunakan metodologi kajian hukum kritis, tulisan ini ingin mengkaji sejauhmana relevansi hull formula untuk diterapkan dalam konteks negara-negara poskolonial. Tulisan ini diharapkan dapat berkontribusi untuk pemahaman konsep tentang standar kompensasi terhadap nasionalisasi di negara negara poskolonial, dan dapat membuka wacana merumuskan kembali standar secara lebih fair dan adil dari perspektif negara postkolonial.
Bow hull-form optimization in waves of a 66,000 DWT bulk carrier
Directory of Open Access Journals (Sweden)
Jin-Won Yu
2017-09-01
Full Text Available This paper uses optimization techniques to obtain bow hull form of a 66,000 DWT bulk carrier in calm water and in waves. Parametric modification functions of SAC and section shape of DLWL are used for hull form variation. Multi-objective functions are applied to minimize the wave-making resistance in calm water and added resistance in regular head wave of λ/L = 0.5. WAVIS version 1.3 is used to obtain wave-making resistance. The modified Fujii and Takahashi's formula is applied to obtain the added resistance in short wave. The PSO algorithm is employed for the optimization technique. The resistance and motion characteristics in calm water and regular and irregular head waves of the three hull forms are compared. It has been shown that the optimal brings 13.2% reduction in the wave-making resistance and 13.8% reduction in the added resistance at λ/L = 0.5; and the mean added resistance reduces by 9.5% at sea state 5.
Energy Technology Data Exchange (ETDEWEB)
Ueda, Y. [Osaka University, Osaka (Japan). Welding Research Institute; Masaoka, K.; Okada, H. [University of Osaka Prefecture, Osaka (Japan). Faculty of Engineering
1996-12-31
A reliability analysis was performed on ultimate strength of a hull by introducing reliability engineerings into the idealized structural unit method. Elements developed under the present study were applied to a model of an actual structure to indicate that even an analysis requiring much time under the finite element method can be performed in a short time and at high accuracy when this method is used. Analysis acted with bending moment and shear force simultaneously was performed on a model used as a structure in experiments carried out by Nishihara, assuming pure bending moment and longitudinal strength during slamming. Then, a reliability analysis was conducted on the same model based on this analysis method to investigate the ultimate strength. In an analysis of an ultimate strength when bending and shearing that assume slamming act upon simultaneously, axial force in the hull side decreases as loading increases, wherein how the shearing force increases can be identified clearly. Although existence of initial bends reduces the strength, the effect of variance in the vicinity of the average value on the reliability is rather small, while the effect due to variance in yield stress is greater. 27 refs., 14 figs., 4 tabs.
Energy Technology Data Exchange (ETDEWEB)
Ueda, Y [Osaka University, Osaka (Japan). Welding Research Institute; Masaoka, K; Okada, H [University of Osaka Prefecture, Osaka (Japan). Faculty of Engineering
1997-12-31
A reliability analysis was performed on ultimate strength of a hull by introducing reliability engineerings into the idealized structural unit method. Elements developed under the present study were applied to a model of an actual structure to indicate that even an analysis requiring much time under the finite element method can be performed in a short time and at high accuracy when this method is used. Analysis acted with bending moment and shear force simultaneously was performed on a model used as a structure in experiments carried out by Nishihara, assuming pure bending moment and longitudinal strength during slamming. Then, a reliability analysis was conducted on the same model based on this analysis method to investigate the ultimate strength. In an analysis of an ultimate strength when bending and shearing that assume slamming act upon simultaneously, axial force in the hull side decreases as loading increases, wherein how the shearing force increases can be identified clearly. Although existence of initial bends reduces the strength, the effect of variance in the vicinity of the average value on the reliability is rather small, while the effect due to variance in yield stress is greater. 27 refs., 14 figs., 4 tabs.
Tritium distribution between the fuel can and the oxide of fuel elements of light-water reactors
International Nuclear Information System (INIS)
Masson, M.
1986-12-01
The study on the measurement of tritium and other radionuclide contained in zircaloy fuel cans of the water cooled reactor fuel elements had two aims: the first was to estimate with accuracy the distribution of tritium in a fuel element (can + oxide). The measurement of tritium in the zircaloy fuel cans of the BORSSELE fuel elements associated with the measurement of tritium in the oxide allowed the establishment of a complete tritium balance on an industrial spent fuel element. This result has been compared to the values calculated by the code CEA/SEN and will allow to validate or adjust this calculation. The second aim delt with the characterization of the other radionuclides gaseous (Kr85) or not (Cs 134 and 137) contained in the solid zircaloy wastes (hulls) coming from the industrial reprocessing of ''water cooled'' fuel elements. These activity measurements in the hulls allowed to estimate the residual content of tritium, Kr 85 and other radionuclides which may be found in these solid wastes (high-level βγ radioactive wastes). Original experimental methods have been developed to reach these aims (dissolution in ammonium bifluoride medium and quantitative recovery of gases produced, radiochromatography, and liquid scintillation after double distillation). One tries to explain the presence of Kr 85 in the irradiated can [fr
Hexahedral connection element based on hybrid-stress theory for solid structures
International Nuclear Information System (INIS)
Wu, D; Sze, K Y; Lo, S H
2010-01-01
For building structures, high-performance hybrid-stress hexahedral solid elements are excellent choices for modelling joints, beams/columns walls and thick slabs if the exact geometrical representation is required. While it is straight-forward to model beam-column structures of uniform member size with solid hexahedral elements, joining up beams and columns of various cross-sections at a common point proves to be a challenge for structural modelling using hexahedral elements with specified dimensions. In general, the joint has to be decomposed into 27 smaller solid elements to cater for the necessary connection requirements. This will inevitably increase the computational cost and introduce element distortions when elements of different sizes have to be used at the joint. Hexahedral connection elements with arbitrary specified connection interfaces will be an ideal setup to connect structural members of different sizes without increasing the number of elements or introducing highly distorted elements. In this paper, based on the hybrid-stress element theory, a general way to construct hexahedral connection element with various interfaces is introduced. Following this way, a 24-node connection element is presented and discussed in detail. Performance of the 24-node connection element equipped with different number of stress modes will be assessed with worked examples.
Stochastic Finite Elements in Reliability-Based Structural Optimization
DEFF Research Database (Denmark)
Sørensen, John Dalsgaard; Engelund, S.
1995-01-01
Application of stochastic finite elements in structural optimization is considered. It is shown how stochastic fields modelling e.g. the modulus of elasticity can be discretized in stochastic variables and how a sensitivity analysis of the reliability of a structural system with respect to optimi......Application of stochastic finite elements in structural optimization is considered. It is shown how stochastic fields modelling e.g. the modulus of elasticity can be discretized in stochastic variables and how a sensitivity analysis of the reliability of a structural system with respect...... to optimization variables can be performed. A computer implementation is described and an illustrative example is given....
Structural Elements Regulating AAA+ Protein Quality Control Machines.
Chang, Chiung-Wen; Lee, Sukyeong; Tsai, Francis T F
2017-01-01
Members of the ATPases Associated with various cellular Activities (AAA+) superfamily participate in essential and diverse cellular pathways in all kingdoms of life by harnessing the energy of ATP binding and hydrolysis to drive their biological functions. Although most AAA+ proteins share a ring-shaped architecture, AAA+ proteins have evolved distinct structural elements that are fine-tuned to their specific functions. A central question in the field is how ATP binding and hydrolysis are coupled to substrate translocation through the central channel of ring-forming AAA+ proteins. In this mini-review, we will discuss structural elements present in AAA+ proteins involved in protein quality control, drawing similarities to their known role in substrate interaction by AAA+ proteins involved in DNA translocation. Elements to be discussed include the pore loop-1, the Inter-Subunit Signaling (ISS) motif, and the Pre-Sensor I insert (PS-I) motif. Lastly, we will summarize our current understanding on the inter-relationship of those structural elements and propose a model how ATP binding and hydrolysis might be coupled to polypeptide translocation in protein quality control machines.
International Nuclear Information System (INIS)
1978-01-01
A synthesis of the current practices and research and development work in the area of alpha-bearing waste and cladding hulls management is presented in 27 papers. After a review of national programmes, general management aspects of radioactive wastes are presented and different techniques are exposed, mainly incineration, volume reduction, conditioning concepts and cladding hulls
Directory of Open Access Journals (Sweden)
Maryam Asnaashari
2015-01-01
Full Text Available In this study, in order to introduce natural antioxidative vegetable oil in food industry, the kolkhoung hull oil and kernel oil were extracted. To evaluate their antioxidant efficiency, gas chromatography analysis of the composition of kolkhoung hull and kernel oil fatty acids and high–performance liquid chromatography analysis of tocopherols were done. Also, the oxidative stability of the oil was considered based on the peroxide value and anisidine value during heating at 100, 110 and 120 °C. Gas chromatography analysis showed that oleic acid was the major fatty acid of both types of oil (hull and kernel and based on a low content of saturated fatty acids, high content of monounsaturated fatty acids, and the ratio of ω-6 and ω-3 polyunsaturated fatty acids, they were nutritionally well-balanced. Moreover, both hull and kernel oil showed high oxidative stability during heating, which can be attributed to high content of tocotrienols. Based on the results, kolkhoung hull oil acted slightly better than its kernel oil. However, both of them can be added to oxidation–sensitive oils to improve their shelf life.
Directory of Open Access Journals (Sweden)
Shyamchand Mayengbam
2014-08-01
Full Text Available Endogenous sinapic acid (SA, sinapine (SP, sinapoyl glucose (SG and canolol (CAN of canola and mustard seeds are the potent antioxidants in various lipid-containing systems. The study investigated these phenolic antioxidants using different fractions of canola and mustard seeds. Phenolic compounds were extracted from whole seeds and their fractions: hulls and cotyledons, using 70% methanol by the ultrasonication method and quantified using HPLC-DAD. The major phenolics from both hulls and cotyledons extracts were SP, with small amounts of SG, and SA with a significant difference of phenolic contents between the two seed fractions. Cotyledons showed relatively high content of SP, SA, SG and total phenolics in comparison to hulls (p < 0.001. The concentration of SP in different fractions ranged from 1.15 ± 0.07 to 12.20 ± 1.16 mg/g and followed a decreasing trend- canola cotyledons > mustard cotyledons > mustard seeds > canola seeds > mustard hulls > canola hulls. UPLC-tandem Mass Spectrometry confirmed the presence of sinapates and its fragmentation in these extracts. Further, a high degree of correlation (r = 0.93 was noted between DPPH scavenging activity and total phenolic content.
Casca de soja em dietas para ovinos Soybean hulls in sheep diets
Directory of Open Access Journals (Sweden)
José Walter dos Santos
2008-11-01
Full Text Available Objetivou-se avaliar a utilização de quatro níveis de casca de soja (0; 8,0; 16,0 ou 24,0% em substituição ao fubá de milho (0, 25, 50 e 75% em dietas para ovinos em confinamento. Avaliaram-se o consumo e a digestibilidade dos nutrientes, o desempenho animal, a conversão alimentar e os custos com a dieta. Vinte cordeiros da raça Santa Inês com peso vivo médio inicial de 32,96 kg foram distribuídos em delineamento inteiramente casualizado com quatro tratamentos e cinco repetições. A dieta foi composta de 50% de volumoso (50% de silagem de milho e 50% de cana-de-açúcar picada e 50% de concentrado. Os concentrados foram compostos de fubá de milho, farelo de soja, mistura mineral e uréia, de modo que o fubá de milho foi gradativamente substituído pela casca de soja. Os animais foram mantidos em baias individuais com comedouro e bebedouro. Não foram observados efeitos dos níveis de casca de soja da dieta sobre o consumo de nutrientes, exceto o de FDN, que aumentou linearmente de acordo com o nível de casca de soja na dieta. Os níveis de casca de soja não influenciaram a digestibilidade dos nutrientes, o ganho de peso (0,215 kg/animal/dia e a conversão alimentar dos animais (6,20 kg MS/kg peso ganho. O aumento do nível de casca de soja de 0 e 75% na dieta reduziu os gastos com alimentação e aumentou a margem bruta de R$ 10,89 para R$ 18,63 por animal. A substituição de até 75% do fubá de milho por casca de soja na dieta não afeta o desempenho de ovinos em terminação em confinamento.The objective was to evaluate the use of four levels of soybean hulls (0.0, 8.0, 16.0 and 24.0% to replace the corn meal (0.0, 25, 50 and 75% in the diet of sheep in feedlot. Performance, nutrient digestibilities and feeding costs were evaluated. Twenty Santa Inez breed lambs with 32.96 kg BW were distributed to a completely randomized design with four diets and five replications. The diet was composed of 50% forage (50% of corn silage and
Asnaashari, Maryam; Hashemi, Seyed Mohammad Bagher; Mehr, Hamed Mahdavian; Yousefabad, Seyed Hossein Asadi
2015-03-01
In this study, in order to introduce natural antioxidative vegetable oil in food industry, the kolkhoung hull oil and kernel oil were extracted. To evaluate their antioxidant efficiency, gas chromatography analysis of the composition of kolkhoung hull and kernel oil fatty acids and high-performance liquid chromatography analysis of tocopherols were done. Also, the oxidative stability of the oil was considered based on the peroxide value and anisidine value during heating at 100, 110 and 120 °C. Gas chromatography analysis showed that oleic acid was the major fatty acid of both types of oil (hull and kernel) and based on a low content of saturated fatty acids, high content of monounsaturated fatty acids, and the ratio of ω-6 and ω-3 polyunsaturated fatty acids, they were nutritionally well--balanced. Moreover, both hull and kernel oil showed high oxidative stability during heating, which can be attributed to high content of tocotrienols. Based on the results, kolkhoung hull oil acted slightly better than its kernel oil. However, both of them can be added to oxidation-sensitive oils to improve their shelf life.
Nonconforming axisymmetric elements for the analysis of containment structures
International Nuclear Information System (INIS)
Choi, C.K.; Kim, S.Y.
1989-01-01
In this study, the behaviors of the conforming isoparametric quadrilateral 4-node and triangular 3-nod axisymmetric solid elements are improved by adding nonconforming displacement modes. The convergence tests and the irregular mesh tests have been established through the analyses of a primary shield wall typed structure. For example study, a containment wall with internal pressure of 60 ksi has been analyzed. It shows that the nonconforming elements behave better than the conforming elements, especially, in the structurally discontinuous regions
Application of global elements to a reinforced concrete structure
International Nuclear Information System (INIS)
Morand, O.
1994-01-01
The dimensioning of nuclear facilities requires to take into account the possible risk of earthquakes. However such installations are generally complex structures with reinforced concrete poles, walls, beams and porches. In this study, a seismic analysis of such a structure is proposed. The use of the Castem 2000 global element code was attempted to dynamically simulate the behaviour of the reinforced concrete elements. However, no suitable modeling has been found for the storeys, the functioning of which being dominated by carrying walls. Concerning the porch-type storeys, monotonous static loads were simulated and provided information on the local and global behaviour of these structures. Thus, representative global elements could be realized for these structures. Results obtained are satisfactory for these storeys which essentially undergo a bending deformation. (J.S.)
Street as Sustainable City Structural Element
Leyzerova, A. V.; Bagina, E. J.
2017-11-01
Sustainability in architecture is nowadays of particular significance in the course of globalization and information density. The technospehere spontaneous development poses a threat to the sustainability of traditional urban forms where a street is one of the essential forming elements in the urban structure. The article proposes to consider formally compositional street features in relation to one of the traditional streets in the historic center of Ekaterinburg. The study examines the street-planning structure, the development of its skeleton elements, silhouette and fabric elevation characteristics as well as the scale characteristics and visual complexity of objects. The study provided architectural and artistic aspects of street sustainability, and limits of the appropriate scale and composition consistency under which the compatibility of alternative compositional forms existing at different times is possible.
International Nuclear Information System (INIS)
Lee, You Lee; Lee, Jang Hwa; Jeon, Min Ku; Kang, Kweon Ho
2012-01-01
The electrochemical behaviors of 10 g-scale fresh and oxidized Zircaloy-4 cladding hulls were examined in 500 degree C LiCl-KCl molten salts to confirm the feasibility of the electrorefining process for the treatment of hull wastes. In the results of measuring the potential-current response using a stainless steel basket filled with oxidized Zircaloy-4 hull specimens, the oxidation peak of Zr appears to be at -0.7 to -0.8 V vs. Ag/AgCl, which is similar to that of fresh Zircaloy-4 hulls, while the oxidation current is found to be much smaller than that of fresh Zircaloy-4 hulls. These results are congruent with the outcome of current-time curves at -0.78 V and of measuring the change in the average weight and thickness after the electrochemical dissolution process. Although the oxide layer on the surface affects the uniformity and rate of dissolution by decreasing the conductivity of Zircaloy-4 hulls, electrochemical dissolution is considered to occur owing to the defect of the surface and phase properties of the Zr oxide layer.
Superheavy Element Synthesis and Nuclear Structure
International Nuclear Information System (INIS)
Ackermann, D.
2009-01-01
The search for the next closed proton and neutron shells beyond 2 08P b has yielded a number of exciting results in terms of the synthesis of new elements [1,2,3]. The superheavy elements (SHE), however, are a nuclear structure phenomenon. They owe their existence to the quantum mechanical origin of shell correction energies without which they would not be bound. In recent years the development of efficient experimental set-ups including separators and advanced particle and photon detection arrangements allowed for more and more detailed nuclear structure studies for nuclei at and beyond Z=100. A review of those recent achievements is given in ref. [4]. Among the most interesting features is the observation of K-isomeric states. Experimentally about 14 cases have been identified in the region of Z>96 as shown in Fig. 1. K-isomers or indications of their existence have been found for almost all even-Z elements in the region Z=100 to 110. We could recently establish and/or confirm such states in the even-even isotopes 2 52,254N o [5]. The heaviest nucleus where such a state was found is 2 70D s with Z=110 as we reported in 2001 [6]. Those nuclear structure studies lay out the grounds for a detailed understanding of these heavy and high-Z nuclear systems, and contribute at the same time valuable information to preparation of strategies to successfully continue the hunt for the localisation of the next spherical proton and neutron shells after 2 08P b. The recent activities for both SHE synthesis and nuclear structure investigations at GSI will be reported.(author)
Investigation of 144Pr measurements for determination of residual Pu in FBR leached hulls
International Nuclear Information System (INIS)
Yates, A.; Bremner, W.B.
1983-12-01
The measurement of plutonium in leached hulls arising from FBR fuel reprocessing is required for plant control, accountancy and safeguards. At DNPDE these measurements are carried out on the batch of hulls prior to bulking into 200 l drums for retrievable storage and ultimately further treatment for plutonium recovery. The experience to date has related to the use of neutron interrogation using sealed tube neutron generators as the irradiation source. The supply of replacement sealed tubes has become difficult. It was therefore decided to consider, amongst other techniques, the measurement of 144 Pr gamma emission as a possible alternative. The technique has been extensively used for thermal reactor fuels on a routine basis. There has also been a limited amount of work reported from Cap La Hague on applying the technique to FBR fuels as part of an experimental programme. This paper therefore describes the work done at DNPDE which evaluated the technique for use on a batch of hulls arising from a PFR fuel reprocessing campaign. (author)
Holtman, Kevin M; Offeman, Richard D; Franqui-Villanueva, Diana; Bayati, Andre K; Orts, William J
2015-03-11
Almond hulls contain considerable proportions (37% by dry weight) of water-soluble, fermentable sugars (sucrose, glucose, and fructose), which can be extracted for industrial purposes. The maximum optimal solids loading was determined to be 20% for sugar extraction, and the addition of 0.5% (w/v) pectinase aided in maintaining a sufficient free water volume for sugar recovery. A laboratory countercurrent extraction experiment utilizing a 1 h steep followed by three extraction (wash) stages produced a high-concentration (131 g/L fermentable sugar) syrup. Overall, sugar recovery efficiency was 88%. The inner stage washing efficiencies were compatible with solution equilibrium calculations, indicating that efficiency was high. The concentrated sugar syrup was fermented to ethanol at high efficiency (86% conversion), and ethanol concentrations in the broth were 7.4% (v/v). Thin stillage contained 233 g SCOD/L, which was converted to biomethane at an efficiency of 90% with a biomethane potential of 297 mL/g SCODdestroyed. Overall, results suggested that a minima of 49 gal (185 L) ethanol and 75 m(3) methane/t hulls (dry whole hull basis) are achievable.
DEFF Research Database (Denmark)
Rubilar, M.; Pinelo, Manuel; Shene, C.
2007-01-01
Almond hulls and grape pomace are residues abundantly generated by agricultural industries, which could be processed to obtain bioactive products. To this purpose, crude ethanol extracts from both agricultural byproducts were attained and subsequently fractionated in order to obtain an organic....../water fraction (FOW). Extracts and fractions were analyzed for antioxidant power and their phenolic components tentatively identified by HPLC-MS. Chromatographic peaks of almond hull extracts showed the occurrence of hydroxybenzoic and cinnamic acid derivatives, with minor presence of flavan-3-ols (ECG, EGCG...... was assessed by DPPH and TBARS assays. Almond hulls showed inhibition percentages lower than 50% in both assays, while the inhibition percentage ranged from 80% to 90% in pomace extracts. Red grape pomace extract was the most efficient antioxidant, with an EC50 value of 0.91 g/L for TBARS and 0.20 g/L for DPPH...
Correct use of Membrane Elements in Structural Analysis
Directory of Open Access Journals (Sweden)
Rothman Timothy
2016-01-01
Full Text Available Structural analysis of consumer electronic devices such as phones and tablets involves Finite Element Analysis (FEA. Dynamic loading conditions such as device dropping and bending dictate accurate FEA models to reduce design risk in many areas. The solid elements typically used in structural analysis do not have integration points on the surface. The outer surface is of most interest because that is where the cracks start. Analysts employ a post processing trick through using membranes to bring accurate stress/strain results to the surface. This paper explains numerical issues with implementation of membranes and recommends a methodology for accurate structural analysis.
DEFF Research Database (Denmark)
Wang, Xueting; Olsen, S. M.; Andres, E.
Drag resistances of newly applied antifouling coatings and welding seams on ship hull surface have been investigated using a pilot-scale rotary setup. Both conventional biocide-based antifouling (AF) coatings and silicone-based fouling release (FR) coatings have been studied and compared in their......Drag resistances of newly applied antifouling coatings and welding seams on ship hull surface have been investigated using a pilot-scale rotary setup. Both conventional biocide-based antifouling (AF) coatings and silicone-based fouling release (FR) coatings have been studied and compared...
Varadavenkatesan, Thivaharan; Vinayagam, Ramesh; Selvaraj, Raja
2017-11-01
Nanobiotechnology has rapidly become a critical facet of nanotechnology. The green synthesis of silver nanoparticles, making use of the hull of black gram (Vigna mungo), paves the way for a simple and eco-friendly utilization of a domestic waste to a product with antioxidant and anticoagulant activities. The emergence of silver nanoparticles was characterized by a variety of methods UV-visible spectrophotometry, scanning electron microscopy added to energy dispersive spectroscopy, X-ray diffractometry, particle size distribution and FT-IR spectroscopy analyses. A discrete band at 421 nm was obtained from UV-visible spectroscopy of the silver nanoparticle suspension. The extract sourced from the hull of black gram showed evidence of the presence of a variety of functional moieties of phytochemicals using FTIR spectroscopy. These were also deemed responsible for maintaining the stability of silver nanoparticles. SEM and EDAX techniques combined, proved that the zero-valent silver nanoparticles were lesser than 100 nm in size. The crystallinity of the nanoparticles was confirmed, as deduced by the (1 1 1) plane, from XRD analysis. The potential of the phytochemicals in maintaining the steadiness of nanoparticles was implied by the zeta potential value that stood at -30.3 mV. In the current study, we have endeavored to comprehend the antioxidant and anticoagulant nature of the green-synthesized benign silver nanoparticles.
Nysmith, C. Robert; Summers, James L.
1961-01-01
Small pyrex glass spheres, representative of stoney meteoroids, were fired into 2024-T3 aluminum alclad multiple-sheet structures at velocities to 11,000 feet per second to evaluate the effectiveness of multisheet hull construction as a means of increasing the resistance of a spacecraft to meteoroid penetrations. The results of these tests indicate that increasing the number of sheets in a structure while keeping the total sheet thickness constant and increasing the spacing between sheets both tend to increase the penetration resistance of a structure of constant weight per unit area. In addition, filling the space between the sheets with a light filler material was found to substantially increase structure penetration resistance with a small increase in weight. An evaluation of the meteoroid hazard to space vehicles is presented in the form of an illustrative-example for two specific lunar mission vehicles, a single-sheet, monocoque hull vehicle and a glass-wool filled, double-sheet hull vehicle. The evaluation is presented in terms of the "best" and the "worst" conditions that might be expected as determined from astronomical and satellite measurements, high-speed impact data, and hypothesized meteoroid structures and compositions. It was observed that the vehicle flight time without penetration can be increased significantly by use of multiple-sheet rather than single-sheet hull construction with no increase in hull weight. Nevertheless, it is evident that a meteoroid hazard exists, even for the vehicle with the selected multiple-sheet hull.
Electronic structures of elements according to ionization energies.
Zadeh, Dariush H
2017-11-28
The electronic structures of elements in the periodic table were analyzed using available experimental ionization energies. Two new parameters were defined to carry out the study. The first parameter-apparent nuclear charge (ANC)-quantified the overall charge of the nucleus and inner electrons observed by an outer electron during the ionization process. This parameter was utilized to define a second parameter, which presented the shielding ability of an electron against the nuclear charge. This second parameter-electron shielding effect (ESE)-provided an insight into the electronic structure of atoms. This article avoids any sort of approximation, interpolation or extrapolation. First experimental ionization energies were used to obtain the two aforementioned parameters. The second parameter (ESE) was then graphed against the electron number of each element, and was used to read the corresponding electronic structure. The ESE showed spikes/peaks at the end of each electronic shell, providing insight into when an electronic shell closes and a new one starts. The electronic structures of elements in the periodic table were mapped using this methodology. These graphs did not show complete agreement with the previously known "Aufbau" filling rule. A new filling rule was suggested based on the present observations. Finally, a new way to organize elements in the periodic table is suggested. Two earlier topics of effective nuclear charge, and shielding factor were also briefly discussed and compared numerically to demonstrate the capability of the new approach.
Riebe, John M.; Naeseth, Rodger L.
1951-01-01
An investigation was made in the Langley 300 MPH 7- by 10-foot tunnel to determine the aerodynamic characteristics of a flying-boat hull of a length-beam ratio of 15 in the presence of a wing. The investigation was an extension of previous tests made on hulls of length-beam ratios of 6, 9, and 12; these hulls were designed to have approximately the same hydrodynamic performance with respect to spray and resistance characteristics. Comparison with the previous investigation at lower length-beam ratios indicated a reduction in minimum drag coefficients of 0.0006 (10 peroent)with fixed transition when the length-beam ratio was extended from 12 to 15. As with the hulls of lower length-beam ratio, the drag reduction with a length-beam ratio of 15 occurred throughout the range of angle of attack tested and the angle of attack for minimum drag was in the range from 2deg to 3deg. Increasing the length-beam ratio from 12 to 15 reduced the hull longitudinal instability by an mount corresponding to an aerodynamic-center shift of about 1/2 percent of the mean aerodynamic chord of the hypothetical flying boat. At an angle of attack of 2deg, the value of the variation of yawing-moment coefficient with angle of yaw for a length-beam ratio of 15 was 0.00144, which was 0.00007 larger than the value for a length-beam ratio of 12.
Origin of the complex crystal structures of elements at intermediate pressure
International Nuclear Information System (INIS)
Ackland, G J; Macleod, I R
2004-01-01
We present a unifying theory for the observed complex structures of sp-bonded elements under pressure on the basis of nearly free electron picture. In the intermediate pressure regime, the dominant contribution to crystal structure arises from Fermi-surface Brillouin zone interactions-structures which allow this are favoured. This simple theory explains the observed crystal structures, transport properties and the evolution of internal and unit cell parameters with pressure and appears to hold for elements in groups I-VI. We illustrate it with experimental data for these elements and ab initio calculations for Li
International Nuclear Information System (INIS)
Rousseau, J.
2009-07-01
That study focuses on concrete structures submitted to impact loading and is aimed at predicting local damage in the vicinity of an impact zone as well as the global response of the structure. The Discrete Element Method (DEM) seems particularly well suited in this context for modeling fractures. An identification process of DEM material parameters from macroscopic data (Young's modulus, compressive and tensile strength, fracture energy, etc.) will first be presented for the purpose of enhancing reproducibility and reliability of the simulation results with DE samples of various sizes. Then, a particular interaction, between concrete and steel elements, was developed for the simulation of reinforced concrete. The discrete elements method was validated on quasi-static and dynamic tests carried out on small samples of concrete and reinforced concrete. Finally, discrete elements were used to simulate impacts on reinforced concrete slabs in order to confront the results with experimental tests. The modeling of a large structure by means of DEM may lead to prohibitive computation times. A refined discretization becomes required in the vicinity of the impact, while the structure may be modeled using a coarse FE mesh further from the impact area, where the material behaves elastically. A coupled discrete-finite element approach is thus proposed: the impact zone is modeled by means of DE and elastic FE are used on the rest of the structure. An existing method for 3D finite elements was extended to shells. This new method was then validated on many quasi-static and dynamic tests. The proposed approach is then applied to an impact on a concrete structure in order to validate the coupled method and compare computation times. (author)
Finite element analysis of degraded concrete structures - Workshop proceedings
International Nuclear Information System (INIS)
1999-09-01
This workshop is related to the finite element analysis of degraded concrete structures. It is composed of three sessions. The first session (which title is: the use of finite element analysis in safety assessments) comprises six papers which titles are: Historical Development of Concrete Finite Element Modeling for Safety Evaluation of Accident-Challenged and Aging Concrete Structures; Experience with Finite Element Methods for Safety Assessments in Switzerland; Stress State Analysis of the Ignalina NPP Confinement System; Prestressed Containment: Behaviour when Concrete Cracking is Modelled; Application of FEA for Design and Support of NPP Containment in Russia; Verification Problems of Nuclear Installations Safety Software of Strength Analysis (NISS SA). The second session (title: concrete containment structures under accident loads) comprises seven papers which titles are: Two Application Examples of Concrete Containment Structures under Accident Load Conditions Using Finite Element Analysis; What Kind of Prediction for Leak rates for Nuclear Power Plant Containments in Accidental Conditions; Influence of Different Hypotheses Used in Numerical Models for Concrete At Elevated Temperatures on the Predicted Behaviour of NPP Core Catchers Under Severe Accident Conditions; Observations on the Constitutive Modeling of Concrete Under Multi-Axial States at Elevated Temperatures; Analyses of a Reinforced Concrete Containment with Liner Corrosion Damage; Program of Containment Concrete Control During Operation for the Temelin Nuclear Power Plant; Static Limit Load of a Deteriorated Hyperbolic Cooling Tower. The third session (concrete structures under extreme environmental load) comprised five papers which titles are: Shear Transfer Mechanism of RC Plates After Cracking; Seismic Back Calculation of an Auxiliary Building of the Nuclear Power Plant Muehleberg, Switzerland; Seismic Behaviour of Slightly Reinforced Shear Wall Structures; FE Analysis of Degraded Concrete
Shang, Guofeng; Liu, Liang; Chen, Ping; Shen, Guoqing; Li, Qiwu
2016-05-01
The biochar derived from rice hull was evaluated for its abilities to remove hydrogen sulfide (H2S) from gas phase. The surface area and pH of the biochar were compared. The biochar derived from rice hull was evaluated for its abilities to remove hydrogen sulfide (H2S) from gas phase. The surface area and pH of the biochar were compared. The different pyrolysis temperature has great influence on the adsorption of H2S. At the different pyrolysis temperature, the H2S removal efficiency of rice hull-derived biochar was different. The adsorption capacities of biochar were 2.09 mg·g(-1), 2.65 mg·g(-1), 16.30 mg·g(-1), 20.80 mg·g(-1), and 382.70 mg·g(-1), which their pyrolysis temperatures were 100 °C, 200 °C, 300 °C, 400 °C and 500 °C respectively. Based on the Yoon-Nelson model, it analyzed the mass transfer mechanism of hydrogen sulfide adsorption by biochar. The paper focuses on the biochar derived from rice hull-removed hydrogen sulfide (H2S) from gas phase. The surface area and pH of the biochar were compared. The different pyrolysis temperatures have great influence on the adsorption of H2S. At the different pyrolysis temperatures, the H2S removal efficiency of rice hull-derived biohar was different. The adsorption capacities of biochar were 2.09, 2.65, 16.30, 20.80, and 382.70 mg·g(-1), and their pyrolysis temperatures were 100, 200, 300, 400, and 500 °C, respectively. Based on the Yoon-Nelson model, the mass transfer mechanism of hydrogen sulfide adsorption by biochar was analyzed.
Latest Trends in the Monitoring of Ships’s Hull Underwater Part and Analysis of Its Effectiveness
Urbahs, A; Carjova, K; Vulans, P; Straume, R
2012-01-01
Ship operation is not possible without regular maintenance, inspection and certification, established by international and domestic law, where one of the main goals is an effective operation of a ship. To achieve this, it is important to reduce time and costs involved in carrying out the surveys. This paper explores the law under which it’s required for ship to have inspection of underwater part; identifies problems of ship’s hull underwater part; analyze latest trends in ship's hull underwat...
Valence electron structure of cast iron and graphltization behaviour criterion of elements
Institute of Scientific and Technical Information of China (English)
刘志林; 李志林; 孙振国; 杨晓平; 陈敏
1995-01-01
The valence electron structure of common alloy elements in phases of cast iron is calculated- The relationship between the electron structure of alloy elements and equilibrium, non-equilibrium solidification and graphitization is revealed by defining the bond energy of the strongest bond in a phase as structure formation factor S. A criterion of graphitization behaviour of elements is advanced with the critical value of the structure formation factor of graphite and the n of the strongest covalent bond in cementite. It is found that this theory conforms to practice very well when the criterion is applied to the common alloy elements.
Mathematical model of small water-plane area twin-hull and application in marine simulator
Zhang, Xiufeng; Lyu, Zhenwang; Yin, Yong; Jin, Yicheng
2013-09-01
Small water-plane area twin-hull (SWATH) has drawn the attention of many researchers due to its good sea-keeping ability. In this paper, MMG's idea of separation was used to perform SWATH movement modeling and simulation; respectively the forces and moment of SWATH were divided into bare hull, propeller, rudder at the fluid hydrodynamics, etc. Wake coefficient at the propellers which reduces thrust coefficient, and rudder mutual interference forces among the hull and propeller, for the calculation of SWATH, were all considered. The fourth-order Runge-Kutta method of integration was used by solving differential equations, in order to get SWATH's movement states. As an example, a turning test at full speed and full starboard rudder of `Seagull' craft is shown. The simulation results show the SWATH's regular pattern and trend of motion. It verifies the correctness of the mathematical model of the turning movement. The SWATH's mathematical model is applied to marine simulator in order to train the pilots or seamen, or safety assessment for ocean engineering project. Lastly, the full mission navigation simulating system (FMNSS) was determined to be a successful virtual reality technology application sample in the field of navigation simulation.
GOLD HULL AND INTERNODE2 encodes a primarily multifunctional cinnamyl-alcohol dehydrogenase in rice.
Zhang, Kewei; Qian, Qian; Huang, Zejun; Wang, Yiqin; Li, Ming; Hong, Lilan; Zeng, Dali; Gu, Minghong; Chu, Chengcai; Cheng, Zhukuan
2006-03-01
Lignin content and composition are two important agronomic traits for the utilization of agricultural residues. Rice (Oryza sativa) gold hull and internode phenotype is a classical morphological marker trait that has long been applied to breeding and genetics study. In this study, we have cloned the GOLD HULL AND INTERNODE2 (GH2) gene in rice using a map-based cloning approach. The result shows that the gh2 mutant is a lignin-deficient mutant, and GH2 encodes a cinnamyl-alcohol dehydrogenase (CAD). Consistent with this finding, extracts from roots, internodes, hulls, and panicles of the gh2 plants exhibited drastically reduced CAD activity and undetectable sinapyl alcohol dehydrogenase activity. When expressed in Escherichia coli, purified recombinant GH2 was found to exhibit strong catalytic ability toward coniferaldehyde and sinapaldehyde, while the mutant protein gh2 completely lost the corresponding CAD and sinapyl alcohol dehydrogenase activities. Further phenotypic analysis of the gh2 mutant plants revealed that the p-hydroxyphenyl, guaiacyl, and sinapyl monomers were reduced in almost the same ratio compared to the wild type. Our results suggest GH2 acts as a primarily multifunctional CAD to synthesize coniferyl and sinapyl alcohol precursors in rice lignin biosynthesis.
MAO-A inhibitory activity of quercetin from Calluna vulgaris (L.) Hull
DEFF Research Database (Denmark)
Saaby, Lasse; Rasmussen, Hasse Bonde; Jäger, Anna Katharina
2009-01-01
AIM OF THE STUDY: This study investigated MAO-A inhibitory activity of methanol extract of Calluna vulgaris (L.) Hull., which traditionally has been used as a nerve calming remedy. MATERIALS AND METHODS: A methanolic extract of Calluna vulgaris was partitioned against heptane, ethyl acetate...
Mitigation of Flanking Noise Transmission in Periodic Structures of Lightweight Elements
DEFF Research Database (Denmark)
Domadiya, Parthkumar Gandalal
through structural junctions and radiates into neighbouring rooms. To diminish the flanking transmission of sound, frames are usually designed with single or double studs or constructed with layers of foam or another viscoelastic material. This thesis is investigating the behaviour of flanking noise...... transmission in periodic structures of lightweight elements by employing various numerical, analytical and experimental methods. At first, three dimensional finite-element (FE) models of a Z-shaped lightweight panel structure based on various frame designs, inclusion of air and structural coupling between...... elements are considered for describing flanking noise transmission through panels. It is assumed that the ribs are fully fixed to the plates in case of various frame designs, and a parametric study is carried out on the centre panel with regard to various spacing between the ribs. Solid finite elements...
In vitro antibacterial and free radical scavenging activity of green hull of Juglans regia
Directory of Open Access Journals (Sweden)
Pardeep Sharma
2013-08-01
Full Text Available Antioxidant supplements from plants are vital to count the oxidative damage in cells. We assessed the antioxidants and antibacterial activity of green hull of Juglans regia in this study. According to our results the maximum antibacterial activity was observed in ethanolic extract when compared to other extract. So, the ethanolic extract was studied for antioxidant activity which exhibited high antiradical activity against DPPH, hydroxyl, and nitric oxide radicals. In conclusion, green hull of J. regia showed strong reducing power activity and total antioxidant capacity. The results justify the therapeutic application of plant in the indigenous system of medicine. Keywords: Juglans regia, Ethanolic extract, Antioxidants, DPPH, Antibacterial activity
Yang, Wenjie; Guo, Fengling; Wan, Zhengjie
2013-10-01
Oyster mushroom (Pleurotus ostreatus) was cultivated on rice straw basal substrate, wheat straw basal substrate, cotton seed hull basal substrate, and wheat straw or rice straw supplemented with different proportions (15%, 30%, and 45% in rice straw substrate, 20%, 30%, and 40% in wheat straw substrate) of cotton seed hull to find a cost effective substrate. The effect of autoclaved sterilized and non-sterilized substrate on growth and yield of oyster mushroom was also examined. Results indicated that for both sterilized substrate and non-sterilized substrate, oyster mushroom on rice straw and wheat basal substrate have faster mycelial growth rate, comparatively poor surface mycelial density, shorter total colonization period and days from bag opening to primordia formation, lower yield and biological efficiency, lower mushroom weight, longer stipe length and smaller cap diameter than that on cotton seed hull basal substrate. The addition of cotton seed hull to rice straw and wheat straw substrate slowed spawn running, primordial development and fruit body formation. However, increasing the amount of cotton seed hull can increase the uniformity and white of mycelium, yield and biological efficiency, and increase mushroom weight, enlarge cap diameter and shorten stipe length. Compared to the sterilized substrate, the non-sterilized substrate had comparatively higher mycelial growth rate, shorter total colonization period and days from bag opening to primordia formation. However, the non-sterilized substrate did not gave significantly higher mushroom yield and biological efficiency than the sterilized substrate, but some undesirable characteristics, i.e. smaller mushroom cap diameter and relatively long stipe length.
International Nuclear Information System (INIS)
Buchhardt, F.; Brandl, P.
1979-01-01
The BWR Gundremmingen II is the first German nuclear power plant with a concrete containment having a thin steel plate liner directly attached to the interior concrete surface to provide an air-tight seal. Due to this monolithic way of anchorage a bonded system of concrete and metal liner membrane is obtained so that the same deformations of the loading or strain conditions are induced to the very stiff concrete hull as well as to the liner. Because of the complex structural behaviour of the bonded system the evaluation is carried out by the finite element method. The overall system is decoupled in several steps. Due to its considerable stiffness the concrete structure can be regarded as the liner supporting basis. The liner system itself might be subdivided into perfect and imperfect sections discretized by plain or curved elements which are supported by point-wise spring elements representing the stud anchors. (orig.)
Three dimensional finite element linear analysis of reinforced concrete structures
International Nuclear Information System (INIS)
Inbasakaran, M.; Pandarinathan, V.G.; Krishnamoorthy, C.S.
1979-01-01
A twenty noded isoparametric reinforced concrete solid element for the three dimensional linear elastic stress analysis of reinforced concrete structures is presented. The reinforcement is directly included as an integral part of the element thus facilitating discretization of the structure independent of the orientation of reinforcement. Concrete stiffness is evaluated by taking 3 x 3 x 3 Gauss integration rule and steel stiffness is evaluated numerically by considering three Gaussian points along the length of reinforcement. The numerical integration for steel stiffness necessiates the conversion of global coordiantes of the Gaussian points to nondimensional local coordinates and this is done by Newton Raphson iterative method. Subroutines for the above formulation have been developed and added to SAP and STAP routines for solving the examples. The validity of the reinforced concrete element is verified by comparison of results from finite element analysis and analytical results. It is concluded that this finite element model provides a valuable analytical tool for the three dimensional elastic stress analysis of concrete structures like beams curved in plan and nuclear containment vessels. (orig.)
On the convex hull of the simple integer recourse objective function
Klein Haneveld, Willem K.; Stougie, L.; van der Vlerk, Maarten H.
1995-01-01
We consider the objective function of a simple integer recourse problem with fixed technology matrix. Using properties of the expected value function, we prove a relation between the convex hull of this function and the expected value function of a continuous simple recourse program. We present an
Dietary Fiber Extraction from Defatted Corn Hull by Hot-Compressed Water
Directory of Open Access Journals (Sweden)
Wang Li
2018-06-01
Full Text Available Corn hulls were abundant and inexpensive byproducts of the corn dry or wet milling processes, but most of them were discarded as agro-wastes. The aim of this study was to extract the dietary fiber by hot-compressed water (HCW from defatted corn hull and to determine the chemical properties. Results showed that temperature and time played critical roles in extraction efficiency; the maximal yield of dietary fiber A (DFA extracted by HCW reached 33.0% at 150°C for 60 min. The yield of dietary fiber B (DFB increased from 2.0% to 56.9% as the temperature increased from 110 to 180°C, while the yield of solid residue (SR decreased from 88.7% to 27.7%. Fourier transform infrared spectroscopy (FT-IR results demonstrated that C-H, O-H, C=O, COO- occurred in the DFA, SR and DFB. The dietary fiber polysaccharides consisted of arabinose, galactose, glucose, xylose and uronic acid.
An efficient structural finite element for inextensible flexible risers
Papathanasiou, T. K.; Markolefas, S.; Khazaeinejad, P.; Bahai, H.
2017-12-01
A core part of all numerical models used for flexible riser analysis is the structural component representing the main body of the riser as a slender beam. Loads acting on this structural element are self-weight, buoyant and hydrodynamic forces, internal pressure and others. A structural finite element for an inextensible riser with a point-wise enforcement of the inextensibility constrain is presented. In particular, the inextensibility constraint is applied only at the nodes of the meshed arc length parameter. Among the virtues of the proposed approach is the flexibility in the application of boundary conditions and the easy incorporation of dissipative forces. Several attributes of the proposed finite element scheme are analysed and computation times for the solution of some simplified examples are discussed. Future developments aim at the appropriate implementation of material and geometric parameters for the beam model, i.e. flexural and torsional rigidity.
Advanced finite element method in structural engineering
Long, Yu-Qiu; Long, Zhi-Fei
2009-01-01
This book systematically introduces the research work on the Finite Element Method completed over the past 25 years. Original theoretical achievements and their applications in the fields of structural engineering and computational mechanics are discussed.
Parboiled rice hull mulch in containers reduces liverwort and bittercress growth
Use of preemergence herbicides for weed control is not always possible; some crops and many enclosed production sites are not labeled for herbicide applications. The objective of this research was to determine the utility of parboiled rice hull mulch for controlling two of the most common weeds in ...
Parametric roll due to hull instantaneous volumetric changes and speed variations
DEFF Research Database (Denmark)
Vidic-Perunovic, Jelena; Jensen, Jørgen Juncher
2009-01-01
Parametric roll of a containership in head sea condition has been studied in the paper. A time domain routine for GZ righting arm calculation based on exact underwater hull geometry has been implemented into a two-degree-of-freedom procedure for roll response calculation. The speed variation due...
Computer simulation of radiation damage in HTGR elements and structural materials
International Nuclear Information System (INIS)
Gann, V.V.; Gurin, V.A.; Konotop, Yu.F.; Shilyaev, B.A.; Yamnitskij, V.A.
1980-01-01
The problem of mathematical simulation of radiation damages in material and items of HTGR is considered. A system-program complex IMITATOR, intended for imitation of neutron damages by means of charged particle beams, is used. Account of material composite structure and certain geometry of items permits to calculate fields of primary radiation damages and introductions of reaction products in composite fuel elements, microfuel elements, their shells, composite absorbing elements on the base of boron carbide, structural steels and alloys. A good correspondence of calculation and experimental burn-out of absorbing elements is obtained, application of absorbing element as medium for imitation experiments is grounded [ru
Design of high-speed planing hulls for the improvement of resistance and seakeeping performance
Directory of Open Access Journals (Sweden)
Dong Jin Kim
2013-03-01
Full Text Available High-speed vessels require good resistance and seakeeping performance for safe operations in rough seas. The resistance and seakeeping performance of high-speed vessels varies significantly depending on their hull forms. In this study, three planing hulls that have almost the same displacement and principal dimension are designed and the hydrodynamic characteristics of those hulls are estimated by high-speed model tests. All model ships are deep-V type planing hulls. The bows of no.2 and no.3 model ships are designed to be advantageous for wave-piercing in rough water. No. 2 and no. 3 model ships have concave and straight forebody cross-sections, respectively. And length-to-beam ratios of no.2 and no.3 models are larger than that of no.1 model. In calm water tests, running attitude and resistance of model ships are measured at various speeds. And motion tests in regular waves are performed to measure the heave and pitch motion responses of the model ships. The required power of no.1 (VPS model is smallest, but its vertical motion amplitudes in waves are the largest. No.2 (VWC model shows the smallest motion amplitudes in waves, but needs the greatest power at high speed. The resistance and seakeeping performance of no.3 (VWS model ship are the middle of three model ships, respectively. And in regular waves, no.1 model ship experiences ‘fly over’ phenomena around its resonant frequency. Vertical accelerations at specific locations such as F.P., center of gravity of model ships are measured at their resonant frequency. It is necessary to measure accelerations by accelerometers or other devices in model tests for the accurate prediction of vertical accelerations in real ships.
CONSTRUCTION OF THE DISCRETE HULL FOR THE COMBINATORICS OF A REGULAR PENTAGONAL TILING OF THE PLANE
DEFF Research Database (Denmark)
Ramirez-Solano, Maria
2016-01-01
The article A “regular” pentagonal tiling of the plane by P. L. Bowers and K. Stephenson, Conform. Geom. Dyn. 1, 58–86, 1997, defines a conformal pentagonal tiling. This is a tiling of the plane with remarkable combinatorial and geometric properties. However, it doesn’t have finite local complexi...... combinatorial data, which rather automatically has finite local complexity. In this paper we give a construction of the discrete hull just from the combinatorial data. The main result of this paper is that the discrete hull is a Cantor space....
Ageing evaluation model of nuclear reactors structural elements
International Nuclear Information System (INIS)
Ziliukas, A.; Jutas, A.; Leisis, V.
2002-01-01
In this article the estimation of non-failure probability by random faults on the structural elements of nuclear reactors is presented. Ageing is certainly a significant factor in determining the limits of nuclear plant lifetime or life extensions. Usually the non failure probability rates failure intensity, which is characteristic for structural elements ageing in nuclear reactors. In practice the reliability is increased incorrectly because not all failures are fixed and cumulated. Therefore, the methodology with using the fine parameter of the failures flow is described. The comparison of non failure probability and failures flow is carried out. The calculation of these parameters in the practical example is shown too. (author)
Directory of Open Access Journals (Sweden)
V. A. Zverev
2016-01-01
Full Text Available The article objective is to justify the rationale for selecting the multilayer finite element model parameters of the bearing structure of a general-purpose launch complex unit.A typical design element of the launch complex unit, i.e. a mount of the hydraulic or pneumatic cylinder, block, etc. is under consideration. The mount represents a set of the cantilevered axis and external structural cage. The most loaded element of the cage is disk to which a moment is transferred from the cantilevered axis due to actuator effort acting on it.To calculate the stress-strain state of disk was used a finite element method. Five models of disk mount were created. The only difference in models was the number of layers of the finite elements through the thickness of disk. There were models, which had one, three, five, eight, and fourteen layers of finite elements through the thickness of disk. For each model, we calculated the equivalent stresses arising from the action of the test load. Disk models were formed and calculated using the MSC Nastran complex software.The article presents results in the table to show data of equivalent stresses in each of the multi-layered models and graphically to illustrate the changing equivalent stresses through the thickness of disk.Based on these results we have given advice on selecting the proper number of layers in the model allowing a desirable accuracy of results with the lowest run time. In addition, it is concluded that there is a need to use the multi-layer models in assessing the performance of structural elements in case the stress exceeds the allowable one in their surface layers.
Shah, S.; Gray, F.; Yang, J.; Crawshaw, J.; Boek, E.
2016-12-01
Advances in 3D pore-scale imaging and computational methods have allowed an exceptionally detailed quantitative and qualitative analysis of the fluid flow in complex porous media. A fundamental problem in pore-scale imaging and modelling is how to represent and model the range of scales encountered in porous media, starting from the smallest pore spaces. In this study, a novel method is presented for determining the representative elementary volume (REV) of a rock for several parameters simultaneously. We calculate the two main macroscopic petrophysical parameters, porosity and single-phase permeability, using micro CT imaging and Lattice Boltzmann (LB) simulations for 14 different porous media, including sandpacks, sandstones and carbonates. The concept of the `Convex Hull' is then applied to calculate the REV for both parameters simultaneously using a plot of the area of the convex hull as a function of the sub-volume, capturing the different scales of heterogeneity from the pore-scale imaging. The results also show that the area of the convex hull (for well-chosen parameters such as the log of the permeability and the porosity) decays exponentially with sub-sample size suggesting a computationally efficient way to determine the system size needed to calculate the parameters to high accuracy (small convex hull area). Finally we propose using a characteristic length such as the pore size to choose an efficient absolute voxel size for the numerical rock.
Yang, Y; Ferreira, G; Teets, C L; Corl, B A; Thomason, W E; Griffey, C A
2017-05-01
The objectives of this study were to evaluate production performance, milk fatty acid composition, and nutrient digestibility in high-producing dairy cows consuming diets containing corn and hull-less barley (cultivar Amaze 10) in different proportions as the grain source. Eight primiparous and 16 multiparous Holstein cows were assigned to 1 of 4 diets in a replicated 4 × 4 Latin square design with 21-d periods. Cows were fed once daily (1200 h) by means of a Calan gate system (American Calan Inc., Northwood, NH). All diets contained ∼20% grain (dry matter basis). Treatments consisted of 100% corn (0B), 67% corn and 33% hull-less barley (33B), 33% corn and 67% hull-less barley (67B), and 100% hull-less barley (100B) as the grain sources. Total-tract nutrient digestibility was estimated using lanthanum chloride (LaCl 3 ) as an external marker. Dry matter intake differed quadratically among treatments, being lowest for 67B and highest for 0B and 100B. Feeding hull-less barley did not affect milk yield, and milk fat concentration differed cubically among treatments. The cubic response was attributed to the higher milk fat concentration observed for the diet containing 67B. Neither the concentrations in milk of protein and lactose nor the yields of protein and lactose differed among treatments. The proportion of de novo synthesized fatty acids in milk did not differ among treatments. The apparent total-tract digestibility of dry matter, crude protein, and neutral detergent fiber did not differ among treatments. Although a quadratic effect was observed, starch digestibility was minimally affected by treatments. In conclusion, this study indicates that hull-less barley grain is as good as corn grain as an energy source when formulating diets for high-producing dairy cows. Copyright © 2017 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Marco, Antonino Di [International Paint (Akzo Nobel Ltda.), Sao Paulo, SP (Brazil)
2004-07-01
The economic importance of the condition of the immersed hull cannot be underestimated; any increase of the roughness may result in a significant increase in the operational costs of a ship. There are two main types of roughness, biological and physical, each one with its proper characteristics of macro and micro roughness; when an increase in the roughness of the underwater hull occurs, the frictional resistance of the ship or .drag. also increases, resulting in additional power and consequent increase of the fuel consumption to keep the speed of the ship. Keeping the power constant will result in lower speed and greater voyage times. Aiming the better understanding of the effect of the roughness in the performance, costs and operational efficiency of a ship, International Paint developed a new model called 'Hull Roughness Penalty Calculator', a program that predicts the increase of the hull roughness during in service time specified service and combines it with the fouling risk associated with different types of antifoulings. The model compares fuel consumptions and costs of different types of TBT free antifoulings to derive the potential benefit, and also can be used to compare the emissions of carbon dioxide and sulphur oxides. (author)
Directory of Open Access Journals (Sweden)
Carlos José Einicker Lamas
1999-01-01
Full Text Available A cladistic analysis of Euprepina Hull, 1971 (Diptera, Bombyliidae, Bombyliinae, a Neotropical genus that includes ten species, was made. The cladogram was obtained from eight studied species, based on a data matrix with 21 characters, using the program Hennig86. Character states were polarized following outgroup analysis, and an hypothetical ancestor was included in the analysis in order to root the tree. The options used, "ie*" and "xs w", resulted in four most parsimonious trees with ci = 79, ri = 80 and length 115. The monophiletism of Euprepina was supported by two synapomorphies.
Detection of secondary structure elements in proteins by hydrophobic cluster analysis.
Woodcock, S; Mornon, J P; Henrissat, B
1992-10-01
Hydrophobic cluster analysis (HCA) is a protein sequence comparison method based on alpha-helical representations of the sequences where the size, shape and orientation of the clusters of hydrophobic residues are primarily compared. The effectiveness of HCA has been suggested to originate from its potential ability to focus on the residues forming the hydrophobic core of globular proteins. We have addressed the robustness of the bidimensional representation used for HCA in its ability to detect the regular secondary structure elements of proteins. Various parameters have been studied such as those governing cluster size and limits, the hydrophobic residues constituting the clusters as well as the potential shift of the cluster positions with respect to the position of the regular secondary structure elements. The following results have been found to support the alpha-helical bidimensional representation used in HCA: (i) there is a positive correlation (clearly above background noise) between the hydrophobic clusters and the regular secondary structure elements in proteins; (ii) the hydrophobic clusters are centred on the regular secondary structure elements; (iii) the pitch of the helical representation which gives the best correspondence is that of an alpha-helix. The correspondence between hydrophobic clusters and regular secondary structure elements suggests a way to implement variable gap penalties during the automatic alignment of protein sequences.
The Hull Method for Selecting the Number of Common Factors
Lorenzo-Seva, Urbano; Timmerman, Marieke E.; Kiers, Henk A. L.
2011-01-01
A common problem in exploratory factor analysis is how many factors need to be extracted from a particular data set. We propose a new method for selecting the number of major common factors: the Hull method, which aims to find a model with an optimal balance between model fit and number of parameters. We examine the performance of the method in an…
Suciaty, T.; Purnomo, D.; Sakya, A. T.; Supriyadi
2018-03-01
Agriculture is facing a number of challenges included limited water supply, low nutrient use efficiency, etc affected by climate change. Nano-silica is a product of nanotechnology, the frontier technologies to enhance crop productivity under climate change threats. The purpose of the research was to investigate the effects of nano silica concentration and rice hull ash on growth and yield of soybean. The experiment was conducted at Gagasari village, Cirebon, West Java from March until June 2017. The treatments were arranged by using factorial completely randomized block design with two factors. The first factor was a concentration of nano silica fertilizer consisted of four levels i.e., 0, 1.75, 2.5, and 3.75 ml.l‑1. The second factor was doses of rice hull ash consisted of four levels i.e., 0, 1, 2, and 3 ton.ha‑1. Each treatment combinations was repeated three times. The result showed that concentration of nano silica individually affected the number of leaves and number of branches, NAR and RGR, productive branches at 21, 30-45, and 35 daps, respectively. It also affected the seed dry weight plant‑1 and plot‑1. Meanwhile, doses of rice hull ash affected LAI, NAR, and RGR, 15-30, and 30-45 dap, respectively. Dry seed weight plot‑1 was also affected by doses of rice hull ash. There was an interaction effect between nano-silica concentration and doses of rice hull ash on number pods.plant‑1. Combinations of 2.5 ml.l‑1 nano-silica and 3 ton.ha‑1 of rice hull ash gave the highest number pods.plant‑1.
Directory of Open Access Journals (Sweden)
Bekir Atar
2017-02-01
Full Text Available In spite of the low grain yield they produce, the hulled wheat have become even more important in recent years because of their resistance to negative environmental conditions and healthy nutritional content. The research was carry out in order to comparison the yield and yield characteristics of durum (Kiziltan-91 and C-1252, hulled (Einkorn and Emmer and bread wheat (Tir varieties in Isparta ecological conditions in 2013-14 and 2014-15 vegetation periods. In both years, the highest grain yield was obtained in Kiziltan-91 variety (3992 and 3758 kg ha-1 respectively. The grain yield of hulled wheats in the first year (Einkorn 1269 kg ha-1, Emmer 2125 kg ha-1 was around Turkey averages. However, grain yield decreased of commercial wheat varieties due to the negative effect of high amount of rainfall in June in the second year, but considerably increased in (Einkorn 2150 kg ha-1, Emmer 2533 kg ha-1. N uptake was found to be lower in the than durum wheats. In terms of grain protein content, the highest values were obtained in Emmer variety (16.4%-15.3%.
Biofouling and Design of a Biomimetic Hull-Grooming Tool
2007-09-14
have barred the use of organotin compounds such as tributyltin ( TBT ) and copper-based paints, which are currently used by the Navy and have become...copper into the water, killing the fouling organisms. There is new research in biomimetic polymers that deter fouling, but are non- toxic . These polymers...is new research in biomimetic polymers that deter fouling, but are non- toxic . These polymers are rigidly attached to the hull surface extending
SAFE-PLANE, Stress Analysis of Planar Structure by Finite Elements Method
International Nuclear Information System (INIS)
Cornell, D.C.; Reich, Morris
1967-01-01
1 - Description of problem or function: SAFE-PLANE is applied to two- dimensional structures of arbitrary geometry under in-plane loads. Either plane stress or plane strain conditions may be imposed. Mechanical and thermal loads are permitted. 2 - Method of solution: The finite-element method is used to construct a mathematical model by assembling discrete elements. The total potential energy of the structure is determined and subsequently minimized by iteration on components of the displacement field until static equilibrium of the structure is attained. Strains and stresses are computed from the resulting displacements. 3 - Restrictions on the complexity of the problem: Multi-material structures with varying rigidities converge very slowly. Not valid for incompressible materials. Maximum number of nodal points = 675. Maximum number of elements = 1350
International Nuclear Information System (INIS)
Somaki, Takahiro; Miyamoto, Akinori; Nakatogawa, Tetsundo
2003-01-01
In order to realize the concept of a vertical isolation system (common deck system), research and development on the vertical isolation structure is now underway. In its first step, structure plans of each of the isolation element and the damper element will be drawn up, and in the next step, tests on these elements will be planed, executed, analyzed, and evaluated, to be reflected to the structure plan. In this report, the structure plan and test plan of damper element is reported. At first, it was concluded in the previous work that the steel-materials damper which can be evaluated by Ramberg-Osgood type is applicable to the vertical isolation system required performance. Then, based on this results, the form range of a damper which satisfies was surveyed from both cross section thickness and distribution of strain by analysis. Next, in order to check the performance (limit a damping capability, load carrying capacity, fatigue strength, and deformability) of an actual damper element based on this analysis result, the test plan for actual scale model was drawn up. (author)
In this study, we evaluated the capacity of recombinant industrial Saccharomyces cerevisiae YRH 396 and YRH 400 strains to ferment sugars from oat hull and soybean hull hydrolysates into ethanol and xylitol. The strains were genetically modified by chromosomal integration of Pichia stipitis XYLI/XYL...
Microwave-Assisted Extraction of Polyphenols from Camellia oleifera Fruit Hull
Directory of Open Access Journals (Sweden)
Jiahong Chen
2011-05-01
Full Text Available The abundant fruit hulls of tea-oil tree (Camellia oleifera are still underutilized and wastefully discaded to pollute the environment. In order to solve this problem and better utilize the fruit hulls of C. oleifera, a microwave-assisted extraction system was used to extract their polyphenols using water as the extraction solvent. A central composite design (CCD was used to monitor the effects of three extraction processing parameters – liquid:solid ratio (mL/g, extraction time (min and extraction temperature (°C – on the polyphenol yield (%. The results showed that the optimal conditions were liquid:solid ratio of 15.33:1 (mL/g, extraction time of 35 min and extraction temperature of 76 °C. Validation tests indicated that under the optimized conditions the actual yield of polyphenols was 15.05 ± 0.04% with RSD = 0.21% (n = 5, which was in good agreement with the predicted yield. Phenolic compounds in the extracts were analysed by HPLC, and gallic acid was found to be the predominant constituent. The total flavonoid content in the extracts was determined and high total flavonoid content was revealed (140.06 mg/g dry material.
Methylene blue adsorption from aqueous solution by dehydrated peanut hull
Energy Technology Data Exchange (ETDEWEB)
Ozer, Dursun [Department of Chemical Engineering, Firat University, 23279 Elazig (Turkey); Dursun, Guelbeyi [Department of Chemical Engineering, Firat University, 23279 Elazig (Turkey)]. E-mail: gdursun@firat.edu.tr; Ozer, Ahmet [Department of Chemical Engineering, Firat University, 23279 Elazig (Turkey)
2007-06-01
Dyes are colour organic compounds which can colorize the other substances. These substances usually presents in the effluent water of many industries, such as textiles, leather, paper, printing and cosmetics. To observe the potential feasibility of removing colour, peanut hull as an agricultural by-product was dehydrated with sulphuric acid (DPH) and used for adsorption of methylene blue (MB) from aqueous solution. The effects of various parameters such as initial methylene blue concentrations, temperatures and particle sizes were examined and optimal experimental conditions were determined. Adsorption data were well described by the Langmuir model, although they could be modelled by the Freundlich model as well. The adsorption process followed the pseudo-second order kinetic model. The mass transfer model as intraparticle diffusion was applied to the experimental data to examine the mechanisms of rate controlling step. It was found that at the higher initial MB concentration, intraparticle diffusion is becoming significant controlling step. The thermodynamic constants of the adsorption process were also evaluated by using the Langmuir constants related to the equilibrium of adsorption at different temperatures. The results in this study indicated that dehydrated peanut hull was a good adsorbent for removing methylene blue.
Directory of Open Access Journals (Sweden)
Martin Ernesto Kalaw
2016-07-01
Full Text Available Geopolymers are inorganic polymers formed from the alkaline activation of amorphous alumino-silicate materials resulting in a three-dimensional polymeric network. As a class of materials, it is seen to have the potential of replacing ordinary Portland cement (OPC, which for more than a hundred years has been the binder of choice for structural and building applications. Geopolymers have emerged as a sustainable option vis-à-vis OPC for three reasons: (1 their technical properties are comparable if not better; (2 they can be produced from industrial wastes; and (3 within reasonable constraints, their production requires less energy and emits significantly less CO2. In the Philippines, the use of coal ash, as the alumina- and silica- rich geopolymer precursor, is being considered as one of the options for sustainable management of coal ash generation from coal-fired power plants. However, most geopolymer mixes (and the prevalent blended OPC use only coal fly ash. The coal bottom ash, having very few applications, remains relegated to dumpsites. Rice hull ash, from biomass-fired plants, is another silica-rich geopolymer precursor material from another significantly produced waste in the country with only minimal utilization. In this study, geopolymer samples were formed from the mixture of coal ash, using both coal fly ash (CFA and coal bottom ash (CBA, and rice hull ash (RHA. The raw materials used for the geopolymerization process were characterized using X-ray fluorescence spectroscopy (XRF for elemental and X-ray diffraction (XRD for mineralogical composition. The raw materials’ thermal stability and loss on ignition (LOI were determined using thermogravimetric analysis (TGA and reactivity via dissolution tests and inductively-coupled plasma mass spectrometry (ICP analysis. The mechanical, thermal and microstructural properties of the geopolymers formed were analyzed using compression tests, Fourier transform infra-red spectroscopy (FTIR
Kalaw, Martin Ernesto; Culaba, Alvin; Hinode, Hirofumi; Kurniawan, Winarto; Gallardo, Susan; Promentilla, Michael Angelo
2016-07-15
Geopolymers are inorganic polymers formed from the alkaline activation of amorphous alumino-silicate materials resulting in a three-dimensional polymeric network. As a class of materials, it is seen to have the potential of replacing ordinary Portland cement (OPC), which for more than a hundred years has been the binder of choice for structural and building applications. Geopolymers have emerged as a sustainable option vis-à-vis OPC for three reasons: (1) their technical properties are comparable if not better; (2) they can be produced from industrial wastes; and (3) within reasonable constraints, their production requires less energy and emits significantly less CO₂. In the Philippines, the use of coal ash, as the alumina- and silica- rich geopolymer precursor, is being considered as one of the options for sustainable management of coal ash generation from coal-fired power plants. However, most geopolymer mixes (and the prevalent blended OPC) use only coal fly ash. The coal bottom ash, having very few applications, remains relegated to dumpsites. Rice hull ash, from biomass-fired plants, is another silica-rich geopolymer precursor material from another significantly produced waste in the country with only minimal utilization. In this study, geopolymer samples were formed from the mixture of coal ash, using both coal fly ash (CFA) and coal bottom ash (CBA), and rice hull ash (RHA). The raw materials used for the geopolymerization process were characterized using X-ray fluorescence spectroscopy (XRF) for elemental and X-ray diffraction (XRD) for mineralogical composition. The raw materials' thermal stability and loss on ignition (LOI) were determined using thermogravimetric analysis (TGA) and reactivity via dissolution tests and inductively-coupled plasma mass spectrometry (ICP) analysis. The mechanical, thermal and microstructural properties of the geopolymers formed were analyzed using compression tests, Fourier transform infra-red spectroscopy (FTIR), scanning
Electronic structure and chemical properties of superheavy elements
Energy Technology Data Exchange (ETDEWEB)
Pershina, V [Gesellschaft fuer Schwerionenforschung (GSI), Helmholtzzentrum fuer Schwerionenforschung Gmbh (Germany)
2009-12-31
Relativistic electronic structure calculations of superheavy elements (Z>=104) are analyzed. Preference is given to those related to experimental research. The role of relativistic effects is discussed.
Energy Technology Data Exchange (ETDEWEB)
Yukawa, K; Kijima, K [Kyushu University, Fukuoka (Japan). Faculty of Engineering
1997-10-01
With types of general cargo vessel and VLCC vessel as the object of discussion, a method was discussed to estimate fluid force acting theoretically on a hull during maneuvering movement, taking frame line shape into consideration. A vortex model was improved by giving consideration of time-based decay on intensity of discrete vortex lines based on the Rankine vortex. Modeling of flow fields around a hull was attempted to deal with movements in which width and draft are small as compared with the ship length, and turning angle speed and deviation angle are small. It was assumed that the ship speed is slow and effects of waves can be disregarded. Specular images of the hull were taken with regard to free surface, and handled as a double body model. Speed potential to express flow fields around a hull is required to satisfy the following five boundary conditions of Laplace, substance surface, free vortex layers, infinity and exfoliation. The potential may be handled as a two-dimensional problem in a field near the hull by using assumption of a slender and long body and conformal mapping. It was found possible to estimate hull fluid force with relatively good accuracy. Fine linear coefficients derived from the estimation were used to have performed highly accurate determination on course stabilization. 5 refs., 6 figs., 2 tabs.
46 CFR 177.300 - Structural design.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Structural design. 177.300 Section 177.300 Shipping...) CONSTRUCTION AND ARRANGEMENT Hull Structure § 177.300 Structural design. Except as otherwise allowed by this subpart, a vessel must comply with the structural design requirements of one of the standards listed below...
[Cocoa (Theobroma cacao L.) hulls: a posible commercial source of pectins].
Barazarte, Humberto; Sangronis, Elba; Unai, Emaldi
2008-03-01
Commercial exploitation of cocoa (Theobroma cacao L.) generates a volume of hulls that could be used in the production of pectins on an industrial scale. Therefore, pectins from cocoa hulls were extracted at different pH and temperature conditions, and their main chemical characteristics were evaluated. EDTA at 0.5% was used for the extraction at pHs 3, 4 and 5 and temperatures of 60, 75 and 90 degrees C, under a 3 2 factorial design. The response variables were yield, content of anhydrous galacturonic acid (AGA), content of metoxil, degree of esterification and equivalent weight of the pectins extracted. The strength of the pectic gel was determined with a TA-XT2 texturometer. Strawberry jam was made with the pectin extracted, and its acceptability was determined using a 7-point hedonic scale. The results obtained were as follows: an extraction yield from 2.64 to 4.69 g/100 g; an AGA content between 49.8 and 64.06 g/100 g; a content of metoxil between 4.72 and 7.18 g/100 g; a degree of esterification between 37.94 and 52.20%; an equivalent weight from 385.47 to 464.61 g/equivalent of H+, and a degree of gelation between 28.64 and 806.03 g force. The pectin extracted at pH 4 and 90 degrees C showed a gelation power of 422.16 g force, purity 62.26 g/100 g of AGA, and a yield of extraction of 3.89 g/100 g and allowed to prepare ajam with an average level of liking of "like moderately". Pectins from cocoa hulls show potential application in the food industry, but it is necessary to optimize the extraction parameters to increase its yield.
Kim, Hyun-Wook; Lee, Yong Jae; Kim, Yuan H Brad
2016-06-01
The objectives of this study were to determine efficacy of a membrane filtration in soy hull pectin purification and evaluate combined effects of soy hull pectin and pre-emulsified fiber/oil (PE) on chemical composition and technological properties of low fat and low salt meat emulsions. Soy hull pectin was purified through two different methods (alcohol-washed (ASP) and membrane-filtered (MSP)). Insoluble soy hull residues after pectin extraction were incorporated with sunflower oil and water for the PE preparation. Meat emulsion was formulated with 58 % pork, 20 % ice, 20 % pork backfat, and 2 % NaCl as control. A total of six low fat and low salt meat emulsions (1 % NaCl and 10 % backfat) was manufactured with 1 % pectin (with/without ASP or MSP) and 10 % PE (with/without). The pectin content of ASP and MSP was 0.84 and 0.64 g L-galacturonic acid/g dry sample, respectively. The inclusion of soy hull pectin caused similar results on chemical composition, color, cooking loss, and texture of the meat emulsions, regardless of the purification method. In addition, positive impacts of the combined treatments with soy hull pectin and PE compared to single treatments on cooking loss and texture of the meat emulsions were observed. Results suggest that membrane filtration could be an effective alternative method to purify pectin, instead of alcohol-washing, and both soluble pectin and insoluble fiber from soy hulls could be used as a functional non-meat ingredient to manufacture various low fat and low salt meat products.
Numerical Simulation of Galvanic Corrosion Caused by Shaft Grounding Systems in Steel Ship Hulls
National Research Council Canada - National Science Library
Wang, Y
2005-01-01
The shaft grounding systems used on board HMC ships have substantially reduced the shaft-to-hull resistance and, thus, improved the performance of the shipboard impressed current cathodic protection (ICCP) system...
Directory of Open Access Journals (Sweden)
Sung-Hee Kim
2012-06-01
Full Text Available Hull Mounted Sonar (HMS is a long range submerged vehicle's hull-mounted passive sonar system which detects low-frequency noise caused by machineries of enemy ships or submerged vehicles. The HMS needs a sound absorption /insulation multi-layer structure to shut out the self-noise from own machineries and to amplify signals from outside. Therefore, acoustic analysis of the multi-layer system should be performed when the HMS is designed. This paper simplified the HMS multi-layer system to be an infinite planar multi-layer model. Also, main excitations that influence the HMS were classified into mechanical, plane wave and turbulent flow excitation, and the investigations for each excitation were performed for various models. Stiffened multi-layer analysis for mechanical excitation and general multi-layer analysis for turbulent flow excitation were developed. The infinite planar multi-layer analysis was expected to be more useful for preliminary design stage of HMS system than the infinite cylindrical model because of short analysis time and easiness of parameter study.
[Structural elements of critical thinking of nurses in emergency care].
Crossetti, Maria da Graça Oliveira; Bittencourt, Greicy Kelly Gouveia Dias; Lima, Ana Amélia Antunes; de Góes, Marta Georgina Oliveira; Saurin, Gislaine
2014-09-01
The objective of this study was to analyze the structural elements of critical thinking (CT) of nurses in the clinical decision-making process. This exploratory, qualitative study was conducted with 20 emergency care nurses in three hospitals in southern Brazil. Data were collected from April to June 2009, and a validated clinical case was applied from which nurses listed health problems, prescribed care and listed the structural elements of CT. Content analysis resulted in categories used to determine priority structural elements of CT, namely theoretical foundations and practical relationship to clinical decision making; technical and scientific knowledge and clinical experience, thought processes and clinical decision making: clinical reasoning and basis for clinical judgments of nurses: patient assessment and ethics. It was concluded that thinking critically is a skill that enables implementation of a secure and effective nursing care process.
Structural elements of critical thinking of nurses in emergency care
Directory of Open Access Journals (Sweden)
Maria da Graça Oliveira Crossetti
Full Text Available The objective of this study was to analyze the structural elements of critical thinking (CT of nurses in the clinical decision-making process. This exploratory, qualitative study was conducted with 20 emergency care nurses in three hospitals in southern Brazil. Data were collected from April to June 2009, and a validated clinical case was applied from which nurses listed health problems, prescribed care and listed the structural elements of CT. Content analysis resulted in categories used to determine priority structural elements of CT, namely theoretical foundations and practical relationship to clinical decision making; technical and scientific knowledge and clinical experience, thought processes and clinical decision making: clinical reasoning and basis for clinical judgments of nurses: patient assessment and ethics. It was concluded that thinking critically is a skill that enables implementation of a secure and effective nursing care process.
Kink structures induced in nickel-based single crystal superalloys by high-Z element migration
Energy Technology Data Exchange (ETDEWEB)
Sun, Fei; Zhang, Jianxin [Key Laboratory for Liquid Structure and Heredity of Materials, Ministry of Education, Shandong University, Jinan 250061 (China); Mao, Shengcheng [Institute of Microstructure and Property of Advanced Materials, Beijing University of Technology, Beijing 100124 (China); Jiang, Ying [Center of Electron Microscopy and State Key Laboratory of Silicon Materials, Department of Materials Science and Engineering, Zhejiang University, Hangzhou 310027 (China); Feng, Qiang [National Center for Materials Service Safety, University of Science and Technology Beijing, Beijing 100083 (China); State Key Laboratory for Advanced Metals and Materials, University of Science and Technology Beijing, Beijing 100083 (China); Shen, Zhenju; Li, Jixue; Zhang, Ze [Center of Electron Microscopy and State Key Laboratory of Silicon Materials, Department of Materials Science and Engineering, Zhejiang University, Hangzhou 310027 (China); Han, Xiaodong [Institute of Microstructure and Property of Advanced Materials, Beijing University of Technology, Beijing 100124 (China)
2015-01-05
Highlights: • Innovative kink structures generate at the γ/γ′ interfaces in the crept superalloy. • Clusters of heavy elements congregate at the apex of the kinks. • Dislocation core absorbs hexagonal structural high-Z elements. - Abstract: Here, we investigate a new type of kink structure that is found at γ/γ′ interfaces in nickel-based single crystal superalloys. We studied these structures at the atomic and elemental level using aberration corrected high-angle annular dark-field scanning transmission electron microscopy (HAADF-STEM). The core of the dislocation absorbs high-Z elements (i.e., Co and Re) that adopt hexagonal arrangements, and it extrudes elements (i.e., Ni and Al) that adopt face centered cubic (fcc) structures. High-Z elements (i.e., Ta and W) and Cr, which is a low-Z element, are stabilized in body centered cubic (bcc) arrangements; Cr tends to behave like Re. High-Z elements, which migrate and adopt a hexagonal structure, induce kink formation at γ/γ′ interfaces. This process must be analyzed to fully understand the kinetics and dynamics of creep in nickel-based single crystal superalloys.
Experimental evaluation of the structural behaviour of adobe masonry structural elements
Varum, H.; Costa, A.; Pereira, H.; Almeida, J.; Rodrigues, H.; Silveira, D.
2007-01-01
Rehabilitation and strengthening of existing adobe masonry constructions have been neglected during the last decades. In Aveiro, Portugal, many adobe buildings present an important level of structural damage and, in many cases, are even near to ruin, having the majority a high vulnerability to seismic actions. To face the lack of information concerning the mechanical properties and structural behaviour of adobe elements, it was developed an experimental campaign. The composition and mechanica...
46 CFR 116.300 - Structural design.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Structural design. 116.300 Section 116.300 Shipping... Structure § 116.300 Structural design. Except as otherwise allowed by this subpart, a vessel must comply with the structural design requirements of one of the standards listed below for the hull material of...
Dynamic Failure of Composite and Sandwich Structures
Abrate, Serge; Rajapakse, Yapa D S
2013-01-01
This book presents a broad view of the current state of the art regarding the dynamic response of composite and sandwich structures subjected to impacts and explosions. Each chapter combines a thorough assessment of the literature with original contributions made by the authors. The first section deals with fluid-structure interactions in marine structures. The first chapter focuses on hull slamming and particularly cases in which the deformation of the structure affects the motion of the fluid during the water entry of flexible hulls. Chapter 2 presents an extensive series of tests underwater and in the air to determine the effects of explosions on composite and sandwich structures. Full-scale structures were subjected to significant explosive charges, and such results are extremely rare in the open literature. Chapter 3 describes a simple geometrical theory of diffraction for describing the interaction of an underwater blast wave with submerged structures. The second section addresses the problem of...
Mayengbam, Shyamchand; Aachary, Ayyappan; Thiyam-Holländer, Usha
2014-01-01
Endogenous sinapic acid (SA), sinapine (SP), sinapoyl glucose (SG) and canolol (CAN) of canola and mustard seeds are the potent antioxidants in various lipid-containing systems. The study investigated these phenolic antioxidants using different fractions of canola and mustard seeds. Phenolic compounds were extracted from whole seeds and their fractions: hulls and cotyledons, using 70% methanol by the ultrasonication method and quantified using HPLC-DAD. The major phenolics from both hulls and...
GOLD HULL AND INTERNODE2 Encodes a Primarily Multifunctional Cinnamyl-Alcohol Dehydrogenase in Rice1
Zhang, Kewei; Qian, Qian; Huang, Zejun; Wang, Yiqin; Li, Ming; Hong, Lilan; Zeng, Dali; Gu, Minghong; Chu, Chengcai; Cheng, Zhukuan
2006-01-01
Lignin content and composition are two important agronomic traits for the utilization of agricultural residues. Rice (Oryza sativa) gold hull and internode phenotype is a classical morphological marker trait that has long been applied to breeding and genetics study. In this study, we have cloned the GOLD HULL AND INTERNODE2 (GH2) gene in rice using a map-based cloning approach. The result shows that the gh2 mutant is a lignin-deficient mutant, and GH2 encodes a cinnamyl-alcohol dehydrogenase (CAD). Consistent with this finding, extracts from roots, internodes, hulls, and panicles of the gh2 plants exhibited drastically reduced CAD activity and undetectable sinapyl alcohol dehydrogenase activity. When expressed in Escherichia coli, purified recombinant GH2 was found to exhibit strong catalytic ability toward coniferaldehyde and sinapaldehyde, while the mutant protein gh2 completely lost the corresponding CAD and sinapyl alcohol dehydrogenase activities. Further phenotypic analysis of the gh2 mutant plants revealed that the p-hydroxyphenyl, guaiacyl, and sinapyl monomers were reduced in almost the same ratio compared to the wild type. Our results suggest GH2 acts as a primarily multifunctional CAD to synthesize coniferyl and sinapyl alcohol precursors in rice lignin biosynthesis. PMID:16443696
Implementation of advanced finite element technology in structural analysis computer codes
International Nuclear Information System (INIS)
Kohli, T.D.; Wiley, J.W.; Koss, P.W.
1975-01-01
Advances in finite element technology over the last several years have been rapid and have largely outstripped the ability of general purpose programs in the public domain to assimilate them. As a result, it has become the burden of the structural analyst to incorporate these advances himself. This paper discusses the implementation and extension of specific technological advances in Bechtel structural analysis programs. In general these advances belong in two categories: (1) the finite elements themselves and (2) equation solution algorithms. Improvements in the finite elements involve increased accuracy of the elements and extension of their applicability to various specialized modelling situations. Improvements in solution algorithms have been almost exclusively aimed at expanding problem solving capacity. (Auth.)
Adaptive contact elements for three-dimensional fluid-structure interfaces
International Nuclear Information System (INIS)
Kulak, R.F.
1985-01-01
A finite element method is developed for treating the mechanics of contact between two deformable bodies which occurs, for example, at fluid-structure interfaces. The method uses a family of adaptive contact elements, which are based upon the penalty method, to handle all of the possible contact configurations that can occur between the discretized contacting bodies. The contact element's nodal connectivity is allowed to change during the computations in order to accommodate finite sliding. The infusion of these elements in the interface results in satisfying the force equilibrium condition during contact. The methodology has been implemented into the NEPTUNE code. Results are presented for an illustrative problem
Adaptive contact elements for three-dimensional fluid-structure interfaces
Energy Technology Data Exchange (ETDEWEB)
Kulak, R.F.
1985-01-01
A finite element method is developed for treating the mechanics of contact between two deformable bodies which occurs, for example, at fluid-structure interfaces. The method uses a family of adaptive contact elements, which are based upon the penalty method, to handle all of the possible contact configurations that can occur between the discretized contacting bodies. The contact element's nodal connectivity is allowed to change during the computations in order to accommodate finite sliding. The infusion of these elements in the interface results in satisfying the force equilibrium condition during contact. The methodology has been implemented into the NEPTUNE code. Results are presented for an illustrative problem.
Directory of Open Access Journals (Sweden)
Carlos Clayton Oliveira Dantas
2014-05-01
Full Text Available The objective of this experiment was to evaluate the losses of nutrient through gases and effluents, the nutrient recovery, fermentation parameters and the chemical parameters of silages of Brachiaria decumbens with the addition of soybean hulls, testing five levels of inclusion: 0, 10, 20, 30 and 40% (as is, with five replications per treatment. After the standardization cut of the forage, performed at 5 cm from the soil level, the soil was fertilized with nitrogen and potassium in the form of ammonium sulfate and potassium chloride, respectively, at 60 kg/ha. After 60 days, the grass was cut at 10 cm from the soil and ensiled. Experimental silos with capacity of 10 liters with Bunsen valve were used. Silos had 3 kg of sand conditioned at the bottom for retention of the effluents. The results show that the contents of dry matter, crude protein, acid detergent insoluble fiber and total digestible nutrients presented positive linear behavior with the inclusion of soybean hulls. In the grass silages with addition of soybean hulls, there was greater recovery of dry matter in relation to the control silage, which is a reflection of the negative linear behavior for the values of losses of gases and effluent. There was quadratic behavior in the pH values and negative linear behavior for the ammonia N values and buffering capacity with the inclusion of the additive in the grass silage. Inclusion of soybean hulls is sufficient to improve the fermentation pattern and minimize the losses through gases and effluents, contributing to the nutrient recovery, in addition to promoting overall improvement of the nutritional value of Brachiaria grass silages.
Directory of Open Access Journals (Sweden)
Carlos Emanuel Eiras
2016-08-01
Full Text Available This study evaluated the effects of diets composed by cottonseed hull and meat aging on carcass characteristics and meat quality from young bulls fed on a high-concentrate system. Thirty crossbred bulls were assigned in a complete randomized experimental factorial design with three diets (CH21: cottonseed hull 210 g kg-1on a DM basis, CH27: cottonseed hull 270 g kg-1on a DM basis and CH33: cottonseed hull 330 g kg-1on a DM basis and different aging times (24 hours and 3, 7 and 14 days. Meat from CH27 diets presented smaller LM moisture content (p < 0.05. Total lipids were smaller in CH33 diet (p <0.05. At 24 hours, CH21 diet presented smaller LM cooking loss than other diets. The increasing aging time reduced the shear force (p < 0.001 on the LM. Meat from CH27 diet presented the highest luminosity (p < 0.05 and yellowness values (p < 0.001. Three or seven aging days presented smaller values of LM luminosity. Likewise, the increasing aging time presented greater (p < 0.05 yellowness within the LM. Lipid oxidation was lower from CH21 diet (p < 0.001. The fatty acid composition on LM was similar among diets. The use of cottonseed hull could be useful strategies to improve the meat quality and lean beef production.
Directory of Open Access Journals (Sweden)
Ariela Werneck de Carvalho
2013-06-01
Full Text Available The soybean is a protein source of high biological value. However, the presence of anti-nutritional factors affects its protein quality and limits the bioavailability of other nutrients. The effect of heat-treatment, 150 ºC for 30 minutes, on hulled and hull-less soybean flour from the cultivar UFVTN 105AP on urease, trypsin inhibitor activity, protein solubility, amino acid profile, and in vivo protein quality was investigated. The treatment reduced the trypsin inhibitor activity and urease, but it did not affect protein solubility. Protein Efficiency Coefficient (PER values of the flours were similar, and the PER of the hull-less soybean flour did not differ from casein. The Net Protein Ratio (NPR did not differ between the experimental groups. The True Digestibility (TD of the flours did not differ, but both were lower in casein and the Protein Digestibility Corrected Amino Acid Score (PDCCAS was lower than the TD, due to limited valine determined by the chemical score. Therefore, the flours showed reduced anti-nutritional phytochemicals and similar protein quality, and therefore the whole flours can be used as a source of high quality protein.
Kim, Chae-Yun; Chung, Kyung-Sook; Cheon, Se-Yun; Lee, Jong-Hyun; Park, Youn-Bum; An, Hyo-Jin
2016-08-01
Even though rice hull has various physiological functions with high antioxidant potential, the molecular mechanism(s) underlying the effects of rice hull on benign prostatic hyperplasia (BPH) have not been evaluated. The aim of this study was to determine the protective effect of rice hull water extract (RHE) against BPH, which is a common disorder in elderly men and involves inflammation that induces an imbalance between cell proliferation and cell death. In this study, RHE-treated mice exhibited lower prostate weights and ratios of prostate weight to body weight compared to those for the BPH-induced group. In addition, RHE-treated mice had lower serum levels of dihydrotestosterone, mRNA expression of 5α-reductase2, and protein expressions of proliferating cell nuclear antigen (PCNA). Furthermore, RHE treatment significantly decreased cell proliferation by regulating the expression levels of inflammatory-related proteins (iNOS and COX-2) and apoptosis-associated proteins (Fas, FADD, procaspase-8, -3, and Bcl-2 family proteins). These results suggest that RHE could protect against the development of BPH through its anti-inflammatory and apoptotic properties and has good potential as a treatment for BPH.
Energy Technology Data Exchange (ETDEWEB)
Kataoka, K; Ando, J; Nakatake, K [Kyushu University, Fukuoka (Japan). Faculty of Engineering
1996-04-10
For the high-speed ship with hydrofoil, it is important to grasp the mutual interference between its hydrofoil and hull. In this study, effects of the state of hydrofoils and velocity on the hull were fluid-dynamically investigated through the numerical calculation by means of Rankine source method using a Wigley model with two hydrofoils. Before considering the model with hydrofoils, the attitude change of a hull without hydrofoils during traveling in high-speed was examined. For the high-speed ship, various measuring systems have been conceived due to the large change in its attitude. The Wigley model has been used for the numerical calculation when considering the attitude change in the medium- and low-speed regions. In this study, resistance tests without constraining the sinkage and trim were conducted using a Wigley model in the high-speed region around Fn=1.0, which have not been usually conducted. The attitude changes were compared with the numerical calculation results by the Rankine source method. The wave making resistance and attitude change of the Wigley model with hydrofoils were also calculated. 12 refs., 10 figs.
National Research Council Canada - National Science Library
Baumann, Gregg
1997-01-01
... (Integrated Design Engineering Analysis Software) software. The term 'shadow zone' refers to areas of low stress concentrations that are caused by lines of stress bending around structural discontinuities...
Essentials of the finite element method for mechanical and structural engineers
Pavlou, Dimitrios G
2015-01-01
Fundamental coverage, analytic mathematics, and up-to-date software applications are hard to find in a single text on the finite element method (FEM). Dimitrios Pavlou's Essentials of the Finite Element Method: For Structural and Mechanical Engineers makes the search easier by providing a comprehensive but concise text for those new to FEM, or just in need of a refresher on the essentials. Essentials of the Finite Element Method explains the basics of FEM, then relates these basics to a number of practical engineering applications. Specific topics covered include linear spring elements, bar elements, trusses, beams and frames, heat transfer, and structural dynamics. Throughout the text, readers are shown step-by-step detailed analyses for finite element equations development. The text also demonstrates how FEM is programmed, with examples in MATLAB, CALFEM, and ANSYS allowing readers to learn how to develop their own computer code. Suitable for everyone from first-time BSc/MSc students to practicing mechanic...
Infinite elements for soil-structure interaction analysis in multi-layered halfspaces
International Nuclear Information System (INIS)
Yun, Chung Bang; Kim, Jae Min; Yang, Shin Chu
1994-01-01
This paper presents the theoretical aspects of a computer code (KIESSI) for soil-structure interaction analysis in a multi-layered halfspace using infinite elements. The shape functions of the infinite elements are derived from approximate expressions of the analytical solutions. Three different infinite elements are developed. They are the horizontal, the vertical and the comer infinite elements (HIE, VIE and CIE). Numerical example analyses are presented for demonstrating the effectiveness of the proposed infinite elements
2016-03-07
planning hulls and plan for N62909-15-1-2052 collaboration studies between NSWC and KRISO - Washington DC Sb. GRANT NUMBER N62909-15-1-2052 Sc. PROGRAM...be carried out in MASK’s facilities. We discussed common interests on planing hulls, and made plans for collaboration studies between NSWC and KRISO ...Presentation of USV project in KRISO 8/19/2015 (Wed) • Discussion of common interests about planing hu lls • Planning for collaboration studies
Wongputtisin, P; Khanongnuch, C; Kongbuntad, W; Niamsup, P; Lumyong, S; Sarkar, P K
2014-09-01
Soya bean hull (SBH) is a cheap and high-fibre content feed ingredient that obtained after soya bean oil extraction. Microbial fermentation was expected to improve SBH qualities before applying to animals, especially monogastric animals. Two bacterial strains, Bacillus subtilis MR10 and TK8 that were isolated from Tua-nao, a traditional fermented soya bean in northern Thailand, were used for fermented soya bean hull (FSBH) production. Both could easily grow at 37°C in SBH as the sole substrate. MR10 produced the highest β-mannanase activity (400 U g(-1) SBH) on day 2, while TK8 produced the highest cellulase activity (14·5 U g(-1) SBH) on day 3. After fermentation, the nutritional quality of SBH was obviously improved by an increase in soluble sugars, soluble proteins, crude protein and crude lipid, and a decrease in the content of raffinose family oligosaccharides. Scavenging activity (%) of SBH against ABTS radical cation was also increased from 14 to 27 and 20% by MR10 and TK8 fermentation, respectively. According to the GRAS property of these both strains and various improvements of nutritional values, the fermented SBH proved to be a potential feed ingredient, especially for the monogastric animals. Normally, soya bean hull has been recognized as only a worthless by-product from soya bean oil production process because of its low utilizable nutrients. Our study introduced an alternative way to utilize this worthless residue using biotechnological knowledge. The nutritional quality of soya bean hull was improved by microbial fermentation. Fermented soya bean hull can be used as a cheap, safe and high-nutrient feed ingredient for livestock production, especially monogastric animals, to promote their growth performances, instead of using antibiotics in some regions of the world. © 2014 The Society for Applied Microbiology.
Nuclear structure notes on element 115 decay chains
International Nuclear Information System (INIS)
Rudolph, D.; Sarmiento, L. G.; Forsberg, U.
2015-01-01
Hitherto collected data on more than hundred α-decay chains stemming from element 115 are combined to probe some aspects of the underlying nuclear structure of the heaviest atomic nuclei yet created in the laboratory
Nuclear structure notes on element 115 decay chains
Energy Technology Data Exchange (ETDEWEB)
Rudolph, D., E-mail: Dirk.Rudolph@nuclear.lu.se; Sarmiento, L. G.; Forsberg, U. [Department of Physics, Lund University, 22100 Lund (Sweden)
2015-10-15
Hitherto collected data on more than hundred α-decay chains stemming from element 115 are combined to probe some aspects of the underlying nuclear structure of the heaviest atomic nuclei yet created in the laboratory.
Energy Technology Data Exchange (ETDEWEB)
Takimoto, T; Yamamoto, A; Kasuda, T; Yanagi, K [Mitsubishi Heavy Industries, Ltd., Tokyo (Japan)
1996-04-10
Demand for reduction in vibration and noise in large-size ferry boats has been severer in recent years. On the other hand, vibration exciting force in main engines and propellers is on an increasing trend in association with increase in speed and horsepower. A large-size ferry boat uses an intermediate-speed diesel engine which has high vibration exciting frequency. Therefore, discussions were given on characteristics of response to nodal vibration in a main hull induced by primary internal moment in a main engine in a large-size ferry boat mounting an intermediate speed main engine. Results of detailed vibration calculations, vibration experiments using an actual ship, and results of measurements were used for the discussions. Natural frequency for two-node vibration above and below the main hull was set for an equation of estimation such that the whole ship is hypothesized to have been structured with beams having the same cross section according to the Todd`s equation, and effect of rigidity of the long structure can be evaluated. Parameters were derived by using the minimum square method that uses the measured natural frequency of the ship A through the ship E among large-size ferry boats. The derived result may be summarized as follows: this equation of estimation has an estimation error of about 5% against the natural frequency for nodal vibration above and below the main hull; and this equation of estimation has an estimation error of about 30% against the acceleration in the vertical direction at the end of the stern. 2 refs., 11 figs., 1 tab.
On Linear Hulls, Statistical Saturation Attacks, PRESENT and a Cryptanalysis of PUFFIN
DEFF Research Database (Denmark)
Leander, Gregor
2011-01-01
which breaks the cipher for at least a quarter of the keys with a complexity less than 258. In the case of PRESENT we show that the design is sound. The design criteria are sufficient to ensure the resistance against linear attacks, taking into account the notion of linear hulls. Finally, we show...
Directory of Open Access Journals (Sweden)
Christopher Uchechukwu Sonde
2015-09-01
Full Text Available The ability of an economically cheap adsorbent material of natural origin, African breadfruit seed hull, was assessed for Cu(II and Cd(II ions’ adsorption from aqueous solutions. The effects of adsorbent dose, particle size and initial metal ion concentrations were investigated in a batch adsorption process. The experimental data were analyzed using five two-parameter isotherm equations (i.e., Langmuir, Freundlich, Temkin, Harkins-Jura and Halsey isotherm models. Freundlich and Halsey models provided the best description for the adsorption data while the other three models gave fairly good interpretation to the experimental adsorption data. The maximum adsorption capacity corresponding to saturation of sites (qmax, obtained from the Langmuir plots, were 7.76 and 8.06 mg g-1 for Cu(II and Cd(II onto the unmodified breadfruit seed hull (UBSH and 12.67 and 13.97 mg g-1, respectively for Cu(II and Cd(II adsorption onto the modified breadfruit seed hull (MBSH. The experimental results showed that there was an enhancement in the removal of the metal ions by the mercaptoacetic acid-modified breadfruit seed hull. DOI: http://dx.doi.org/10.17807/orbital.v7i3.625
Energy Technology Data Exchange (ETDEWEB)
Lee, Sang Jin; Seo, Jeong Moon
2000-08-01
The main goal of this research is to establish a methodology of finite element analysis of containment building predicting not only global behaviour but also local failure mode. In this report, we summerize some existing numerical analysis techniques to be improved for containment building. In other words, a complete description of the standard degenerated shell finite element formulation is provided for nonlinear stress analysis of nuclear containment structure. A shell finite element is derived using the degenerated solid concept which does not rely on a specific shell theory. Reissner-Mindlin assumptions are adopted to consider the transverse shear deformation effect. In order to minimize the sensitivity of the constitutive equation to structural types, microscopic material model is adopted. The four solution algorithms based on the standard Newton-Raphson method are discussed. Finally, two numerical examples are carried out to test the performance of the adopted shell medel.
International Nuclear Information System (INIS)
Lee, Sang Jin; Seo, Jeong Moon
2000-08-01
The main goal of this research is to establish a methodology of finite element analysis of containment building predicting not only global behaviour but also local failure mode. In this report, we summerize some existing numerical analysis techniques to be improved for containment building. In other words, a complete description of the standard degenerated shell finite element formulation is provided for nonlinear stress analysis of nuclear containment structure. A shell finite element is derived using the degenerated solid concept which does not rely on a specific shell theory. Reissner-Mindlin assumptions are adopted to consider the transverse shear deformation effect. In order to minimize the sensitivity of the constitutive equation to structural types, microscopic material model is adopted. The four solution algorithms based on the standard Newton-Raphson method are discussed. Finally, two numerical examples are carried out to test the performance of the adopted shell medel
DEFF Research Database (Denmark)
2009-01-01
The invention relates to a light-weight load-bearing structure, reinforced by core elements (2) of a strong material constituting one or more compression or tension zones in the structure to be cast, which core (2) is surrounded by or adjacent to a material of less strength compared to the core (2......), where the core (2) is constructed from segments (1) of core elements (2) assembled by means of one or more prestressing elements (4). The invention further relates to a method of casting of light-weight load-bearing structures, reinforced by core elements (2) of a strong material constituting one...... or more compression or tension zones in the structure to be cast, which core (2) is surrounded by or adjacent to a material of less strength compared to the core (2), where the core (2) is constructed from segments (1) of core elements (2) assembled and hold together by means of one or more prestressing...
Testing for change in structural elements of forest inventories
Melinda Vokoun; David Wear; Robert Abt
2009-01-01
In this article we develop a methodology to test for changes in the underlying relationships between measures of forest productivity (structural elements) and site characteristics, herein referred to as structural changes, using standard forest inventories. Changes in measures of forest growing stock volume and number of trees for both...
Study on the preparation of furfural from rice hull
Energy Technology Data Exchange (ETDEWEB)
Lu, M.F; Li, P.H.
1980-01-01
Furfural (I) was prepared from rice hull by digestion with HCl, H/sub 2/SO4, or H/sub 3/PO4. I formation in the presence of 5N HCl (the optimum concentration) increased with increasing time of digestion up to 5 hours and then decreased. The optimum concentration and time with H/sub 2/SO4 were the same, but digestion with H/sub 3/PO4 was neither concentration nor time dependent. Under optimal conditions, I formation was highest in digestion with HCl.
Structural weights analysis of advanced aerospace vehicles using finite element analysis
Bush, Lance B.; Lentz, Christopher A.; Rehder, John J.; Naftel, J. Chris; Cerro, Jeffrey A.
1989-01-01
A conceptual/preliminary level structural design system has been developed for structural integrity analysis and weight estimation of advanced space transportation vehicles. The system includes a three-dimensional interactive geometry modeler, a finite element pre- and post-processor, a finite element analyzer, and a structural sizing program. Inputs to the system include the geometry, surface temperature, material constants, construction methods, and aerodynamic and inertial loads. The results are a sized vehicle structure capable of withstanding the static loads incurred during assembly, transportation, operations, and missions, and a corresponding structural weight. An analysis of the Space Shuttle external tank is included in this paper as a validation and benchmark case of the system.
Numerical investigation of soil and buried structures using finite element analysis
Directory of Open Access Journals (Sweden)
Meysam Shirzad Shahrivar
2017-02-01
Full Text Available Today the important of studying soil effect on behavior of soil contacted structures such as foundations, piles, retaining wall and other similar structures is so much that neglecting of soil-structure interaction effect can cause to untrue results. In this paper soil-structure interaction simulation was done by using Finite element method analysis with ABAQUS version 6.13-14.The results has been presented based on pile function in contact with soil, vertical stresses in soil and structures, pore pressure in drained and undrained condition and underground water level.Final conclusions revealed that pore pressure effect is not uniform on all parts of pile and amount of pore pressure increment in top elements is lower than down elements of pile.Further it was proven that average amount of vertical stress on end of pile is of this stress on top of the pile. thus it was concluded that 70% of pile bearing capacity is depend on friction of soil and pile contact surface.
The characterization of activities associated with irradiated fuel element claddings
International Nuclear Information System (INIS)
Jenkins, I.L.; Bolus, D.J.; Glover, K.M.; Haynes, J.W.; Mapper, D.; Marwick, A.D.; Waterman, M.J.
1982-01-01
The object of the present work was to characterise the natures and amounts of the various α and βγ activities associated with cladding hulls. The claddings studied were stainless steel from a Fast Reactor and from an Advanced Gas Reactor and Zircaloy from a Boiling Water Reactor, from a Pressurized Water Reactor and from a Steam Generating Heavy Water Reactor. The hulls were examined by the following methods: alpha spectrometry to identify and quantify the α emitters and to estimate their depths of penetration, partial and complete dissolution of hulls followed by gross α counting, α spectrometry and γ spectrometry, fission track autoradiography to determine the distribution of fissile material associated with hulls, neutron activation to determine the total fissile content of the hulls, chemical separations followed by β counting and chemical treatment with various reagents to examine the ease of decontamination
Structural analysis of a ship on global aspect using ANSYS
Rahman, M. Muzibur; Kamol, Rajia Sultana; Islam, Reyana
2017-12-01
Ship is a complex geometry which undergoes a combination of loadings such as hydrostatic, hydrodynamic, wind, wave etc. at sea and thus adequate strength in a ship has always been one of the most challenging tasks for the ship designers. International Maritime Organization (IMO) and classification societies are providing the standards to ensure the adequacy of strength for the ship against all demands throughout its service life. Thus, structural analysis is needed to assess the overall strength of hull, and the means in this regard are based on finite element method which may be applied either local or global aspect of the ship. This paper is an attempt to carry out the structural analysis of a ship in global aspect using ANSYS software to locate the most stress concentration and deformed area, which will have ultimate effect on fatigue fracture.
Engineering Hydrodynamic AUV Hulls
Allen, J.
2016-12-01
AUV stands for autonomous underwater vehicle. AUVs are used in oceanography and are similar to gliders. MBARIs AUVs as well as other AUVs map the ocean floor which is very important. They also measure physical characteristics of the water, such as temperature and salinity. My science fair project for 4th grade was a STEM activity in which I built and tested 3 different AUV bodies. I wanted to find out which design was the most hydrodynamic. I tested three different lengths of AUV hulls to see which AUV would glide the farthest. The first was 6 inches. The second was 12 inches and the third was 18 inches. I used clay for the nosecone and cut a ruler into two and made it the fin. Each AUV used the same nosecone and fin. I tested all three designs in a pool. I used biomimicry to create my hypothesis. When I was researching I found that long slim animals swim fastest. So, my hypothesis is the longer AUV will glide farthest. In the end I was right. The longer AUV did glide the farthest.
Molecules and Models The molecular structures of main group element compounds
Haaland, Arne
2008-01-01
This book provides a systematic description of the molecular structures and bonding in simple compounds of the main group elements with particular emphasis on bond distances, bond energies and coordination geometries. The description includes the structures of hydrogen, halogen and methyl derivatives of the elements in each group, some of these molecules are ionic, some polar covalent. The survey of molecules whose structures conform to well-established trends is followed byrepresentative examples of molecules that do not conform. We also describe electron donor-acceptor and hydrogen bonded co
International Nuclear Information System (INIS)
Marimuthu, R.; Nageswara Rao, B.
2013-01-01
Solid propellant rocket motors (SRM) are regularly used in the satellite launch vehicles which consist of mainly three different structural materials viz., solid propellant, liner, and casing materials. It is essential to assess the structural integrity of solid propellant grains under the specified gravity, thermal and pressure loading conditions. For this purpose finite elements developed following the Herrmann formulation are: twenty node brick element (BH20), eight node quadrilateral plane strain element (PH8) and, eight node axi-symmetric solid of revolution element (AH8). The time-dependent nature of the solid propellant grains is taken into account utilizing the direct inverse method of Schepary to specify the effective Young's modulus and Poisson's ratio. The developed elements are tested considering various problems prior to implementation in the in-house software package (viz., Finite Element Analysis of STructures, FEAST). Several SRM configurations are analyzed to assess the structural integrity under different loading conditions. Finite element analysis results are found to be in good agreement with those obtained earlier from MARC software. -- Highlights: • Developed efficient Herrmann elements. • Accuracy of finite elements demonstrated solving several known solution problems. • Time dependent structural response obtained using the direct inverse method of Schepary. • Performed structural analysis of grains under gravity, thermal and pressure loads
Electronic structure theory of the superheavy elements
Energy Technology Data Exchange (ETDEWEB)
Eliav, Ephraim, E-mail: ephraim@tau.ac.il [School of Chemistry, Tel Aviv University, 6997801 Tel Aviv (Israel); Fritzsche, Stephan, E-mail: s.fritzsche@gsi.de [Helmholtz-Institut Jena, Fröbelstieg 3, D-07743 Jena (Germany); Theoretisch-Physikalisches Institut, Friedrich-Schiller-Universität Jena, D-07743 Jena (Germany); Kaldor, Uzi, E-mail: kaldor@tau.ac.il [School of Chemistry, Tel Aviv University, 6997801 Tel Aviv (Israel)
2015-12-15
High-accuracy calculations of atomic properties of the superheavy elements (SHE) up to element 122 are reviewed. The properties discussed include ionization potentials, electron affinities and excitation energies, which are associated with the spectroscopic and chemical behavior of these elements, and are therefore of considerable interest. Accurate predictions of these quantities require high-order inclusion of relativity and electron correlation, as well as large, converged basis sets. The Dirac–Coulomb–Breit Hamiltonian, which includes all terms up to second order in the fine-structure constant α, serves as the framework for the treatment; higher-order Lamb shift terms are considered in some selected cases. Electron correlation is treated by either the multiconfiguration self-consistent-field approach or by Fock-space coupled cluster theory. The latter is enhanced by the intermediate Hamiltonian scheme, allowing the use of larger model (P) spaces. The quality of the calculations is assessed by applying the same methods to lighter homologs of the SHEs and comparing with available experimental information. Very good agreement is obtained, within a few hundredths of an eV, and similar accuracy is expected for the SHEs. Many of the properties predicted for the SHEs differ significantly from what may be expected by straightforward extrapolation of lighter homologs, demonstrating that the structure and chemistry of SHEs are strongly affected by relativity. The major scientific challenge of the calculations is to find the electronic structure and basic atomic properties of the SHE and assign its proper place in the periodic table. Significant recent developments include joint experimental–computational studies of the excitation spectrum of Fm and the ionization energy of Lr, with excellent agreement of experiment and theory, auguring well for the future of research in the field.
Finite element modeling of nanotube structures linear and non-linear models
Awang, Mokhtar; Muhammad, Ibrahim Dauda
2016-01-01
This book presents a new approach to modeling carbon structures such as graphene and carbon nanotubes using finite element methods, and addresses the latest advances in numerical studies for these materials. Based on the available findings, the book develops an effective finite element approach for modeling the structure and the deformation of grapheme-based materials. Further, modeling processing for single-walled and multi-walled carbon nanotubes is demonstrated in detail.
Model Reduction in Dynamic Finite Element Analysis of Lightweight Structures
DEFF Research Database (Denmark)
Flodén, Ola; Persson, Kent; Sjöström, Anders
2012-01-01
models may be created by assembling models of floor and wall structures into large models of complete buildings. When assembling the floor and wall models, the number of degrees of freedom quickly increases to exceed the limits of computer capacity, at least in a reasonable amount of computational time...... Hz. Three different methods of model reduction were investigated; Guyan reduction, component mode synthesis and a third approach where a new finite element model was created with structural elements. Eigenvalue and steady-state analyses were performed in order to compare the errors...
Multiobjective optimization of classifiers by means of 3D convex-hull-based evolutionary algorithms
Zhao, J.; Basto, Fernandes V.; Jiao, L.; Yevseyeva, I.; Asep, Maulana A.; Li, R.; Bäck, T.H.W.; Tang, T.; Michael, Emmerich T. M.
2016-01-01
The receiver operating characteristic (ROC) and detection error tradeoff(DET) curves are frequently used in the machine learning community to analyze the performance of binary classifiers. Recently, the convex-hull-based multiobjective genetic programming algorithm was proposed and successfully
CROWDED HYBRID PANEL MANUFACTURED WITH PEANUT HULLS REINFORCED WITH ITAÚBA WOOD PARTICLES
Directory of Open Access Journals (Sweden)
Guilherme Barbirato
2014-09-01
Full Text Available http://dx.doi.org/10.5902/1980509815726In this paper, it was considered the study of the potential use of peanut hulls and wood particles of itaúba (Mezilaurus itauba species in order to add value to these materials through the manufacture of hybrid particle board in order to compare the physical and mechanical performances as well as durability. For these procedures, it was used the bi-component polyurethane resin based on castor beans (mammon oil and urea-formaldehyde. The product quality was evaluated based on the requirements of the standards NBR 14.810:2006 APA PRP and 108, through physico-mechanical and microstructural durability. The results indicate that the incorporation of wood particles warrants an increase in physical-mechanical properties of the particleboard manufactured with peanut hulls, the polyurethane resin based on castor oil was effective as a particle adhesive binder and the durability assay indicated that the material should be used under conditions of low exposure to moisture.
Anti-Melanogenic Activity and Cytotoxicity of Pistacia vera Hull on Human Melanoma SKMEL-3 Cells.
Sarkhail, Parisa; Salimi, Mona; Sarkheil, Pantea; Mostafapour Kandelous, Hirsa
2017-07-01
Pistacia vera seed is a common food and medicinal seed in Iran. It's hull (outer skin) as a significant byproduct of pistachio, is traditionally used as tonic, sedative and antidiarrheal and has been shown to be a rich source of antioxidants. The aim of the present study is to evaluate the anti-melanogenic activity of the pistachio hulls in order to discover a new alternative herbal agent to treat skin hyperpigmentation disorders. In this work, antioxidant and anti-tyrosinase activity of MeOH extract from Pistacia vera hull (MPH) were evaluated in vitro, respectively, by DPPH radical scavenging and mushroom tyrosinase activity assays. Then the effect of MPH on the melanin content, cellular tyrosinase activity and cytotoxicity (MTT assay) on human melanoma SKMEL-3 cell were determined followed by 72 h incubation. The results indicated that MPH had valuable DPPH radical scavenging effect and weak anti-tyrosinase activity when compared to the well-known antioxidant (BHT) and tyrosinase inhibitor (kojic acid), respectively. MPH, at a high dose (0.5 mg/mL), showed significant cytotoxic activity (~63%) and strong anti-melanogenic effect (~57%) on SKMEL-3 cells. The effect of MPH in the reduction of melanin content may be related to its cytotoxicity. The results obtained suggest that MPH can be used as an effective agent in the treatment of some skin hyperpigmentation disorders such as melanoma.
Finite element analysis of adanced composite structures containing mechanically fastened joints
International Nuclear Information System (INIS)
Baumann, E.
1982-01-01
Although the usual engineering practice is to ignore joint effects in finite element models of overall structures, there are times when the inclusion of fastener effects in a model is necessary for accurate analysis. This paper describes some simple but accurate methods for accommodating this modeling requirement. The approach involves correlation of test results from a few composite mechanically fastened joints with finite element analyses of joints. It is assumed that if the fastener actions in the test articles can be properly predicted by simple finite element techniques, then these same techniques can be applied to large overall structure models. During the course of this test-analysis effort it was determined that it is possible to obtain correct results for overall structure-joint analyses by using simple modeling concepts provided special care is employed. Also, some emphasis is given in this paper to the importance of properly reducing test data in order to obtain meaningful correlations with finite element analysis. Finally, for those interested, the appendix contains brief descriptions of the test results and failure modes explored in the test program. (orig.)
Efficient Analysis of Structures with Rotatable Elements Using Model Order Reduction
Directory of Open Access Journals (Sweden)
G. Fotyga
2016-04-01
Full Text Available This paper presents a novel full-wave technique which allows for a fast 3D finite element analysis of waveguide structures containing rotatable tuning elements of arbitrary shapes. Rotation of these elements changes the resonant frequencies of the structure, which can be used in the tuning process to obtain the S-characteristics desired for the device. For fast commutations of the response as the tuning elements are rotated, the 3D finite element method is supported by multilevel model-order reduction, orthogonal projection at the boundaries of macromodels and the operation called macromodels cloning. All the time-consuming steps are performed only once in the preparatory stage. In the tuning stage, only small parts of the domain are updated, by means of a special meshing technique. In effect, the tuning process is performed extremely rapidly. The results of the numerical experiments confirm the efficiency and validity of the proposed method.
Turbulence modeling of transverse flow on ship hulls in shallow water
Energy Technology Data Exchange (ETDEWEB)
Jakobsen, Ken-Robert Gjelstad
2010-09-15
The hydrodynamic forces acting on a ship that travels in restricted water vary greatly with water depth and the geometry of the ship hull. This will affect the ship maneuverability in terms of various flow effects like for instance squat, when the ship is sucked down towards the seabed due to a pressure drop on the hull at forward speed. It is, thus, important to gain detailed knowledge on these aspects of marine engineering. The problem is in the present work addressed through a numerical investigation of turbulent transverse flow on two-dimensional ship sections in shallow water. The numerical code is validated against traditional flow problems in the literature. Namely, the Backward-facing step (BFS) and the Smoothly-contoured ramp (SCR). 2D and 3D laminar flows and 2D low Reynolds number turbulent flows are calculated, and the results are found to be in good agreement with the previous numerical and experimental comparison data. The turbulence model used in the calculations is the one-equation Spalart-Allmaras model. The overall goal of achieving more efficient and accurate numerical schemes will always be in focus of code development. Adaptive mesh refinement (AMR) is then a very helpful tool to save both time for grid generation prior to the calculations in question and the CPU hours needed to solve the governing equations. The latter is even more evident in a parallel environment. These aspects are included in the present investigation as part of the process to adapt and investigate a CFD tool suitable to handle turbulent flows on a ship hull in shallow water. Several physical and numerical parameters are included in the present study and the Plackett-Burman screening design is utilized to efficiently analyze the results. With the latter method, a simple function for calculating the drag force on a two-dimensional ship section as function of the given parameters has been obtained. (Author)
Ab initio random structure search for 13-atom clusters of fcc elements
International Nuclear Information System (INIS)
Chou, J P; Hsing, C R; Wei, C M; Cheng, C; Chang, C M
2013-01-01
The 13-atom metal clusters of fcc elements (Al, Rh, Ir, Ni, Pd, Pt, Cu, Ag, Au) were studied by density functional theory calculations. The global minima were searched for by the ab initio random structure searching method. In addition to some new lowest-energy structures for Pd 13 and Au 13 , we found that the effective coordination numbers of the lowest-energy clusters would increase with the ratio of the dimer-to-bulk bond length. This correlation, together with the electronic structures of the lowest-energy clusters, divides the 13-atom clusters of these fcc elements into two groups (except for Au 13 , which prefers a two-dimensional structure due to the relativistic effect). Compact-like clusters that are composed exclusively of triangular motifs are preferred for elements without d-electrons (Al) or with (nearly) filled d-band electrons (Ni, Pd, Cu, Ag). Non-compact clusters composed mainly of square motifs connected by some triangular motifs (Rh, Ir, Pt) are favored for elements with unfilled d-band electrons. (paper)
Anti-diabetic effects of rice hull smoke extract in alloxan-induced diabetic mice
We investigated the protective effect of a liquid rice hull smoke extract (RHSE) against diabetes in alloxan-induced diabetic mice. Anti-diabetic effects of RHSE were evaluated in both the rat insulinoma-1 cell line (INS-1) and diabetic ICR mice induced by inraperitoneal (ip) injection of alloxan. ...
Energy Technology Data Exchange (ETDEWEB)
Aoyama, K.; Sawada, K. [The University of Tokyo, Tokyo (Japan)
1996-12-31
Considering integrated hull and piping design in shipbuilding industry as a good example for concurrent engineering (CE), discussions were given on a computer aided method to perform integrated hull and piping design smoothly. When CE aiding by means of a computer is considered, it is important to discuss a method for information management not only for `utilization of product models`, but also for `maintaining consistency between items of product information` and `concurrent utilization and production of product information` in concurrent designs. For the CE aided information management, utilization and production of the product information is effective if restrictive relationship between items of product information, and design functions are made clear. Definitions were given on the restrictive relationship between items of product information and `restrictive relationship information` that has `decision/provisional decision`, `date and time`, `designer` and `design functions`. Furthermore, `comprehensive relationship between items of product information` that can be produced from the restrictive relationship information was defined as a `restrictive network`. Utilizing the restrictive relationship between items of product information for CE aiding is effective. 9 refs., 14 figs.
Energy Technology Data Exchange (ETDEWEB)
Aoyama, K; Sawada, K [The University of Tokyo, Tokyo (Japan)
1997-12-31
Considering integrated hull and piping design in shipbuilding industry as a good example for concurrent engineering (CE), discussions were given on a computer aided method to perform integrated hull and piping design smoothly. When CE aiding by means of a computer is considered, it is important to discuss a method for information management not only for `utilization of product models`, but also for `maintaining consistency between items of product information` and `concurrent utilization and production of product information` in concurrent designs. For the CE aided information management, utilization and production of the product information is effective if restrictive relationship between items of product information, and design functions are made clear. Definitions were given on the restrictive relationship between items of product information and `restrictive relationship information` that has `decision/provisional decision`, `date and time`, `designer` and `design functions`. Furthermore, `comprehensive relationship between items of product information` that can be produced from the restrictive relationship information was defined as a `restrictive network`. Utilizing the restrictive relationship between items of product information for CE aiding is effective. 9 refs., 14 figs.
Directory of Open Access Journals (Sweden)
Sudadi
2014-07-01
Full Text Available The application of chemical fertilizer for long time may adverse soil environment. Organic agriculture, for example combination use of azolla based-organic fertilizer, phosphate rock and rice hull ash, was one of ways that able to recover it. Research was conducted in Sukosari, Jumantono, Karanganyar while soi chemical properties analysis was analysed in Soil Chemistry and Fertility Laboratory, Fac. of Agriculture, Sebelas Maret University April to November 2013. Research design used was RAKL with 5 treatments, each repeated 5 times. The treatments applied were P0 (control, P1 ( azola inoculum dosage 250 g/m2 + phosphate rock + rice hull ash equal to 150 kg/ha KCl, P2 (azola inoculum dosage 500 g/m2 + phosphate rock equal to 150kg/ha, SP-36 + rice hull ash equal to 100 kg/ha KCl, P3 (manure dosage of 5 ton/ha,P4 (Urea 250 kg/ha + SP-36 150 kg/ha + KCl 100 kg/ha. Data analysed statistically by F test (Fisher test with level of confident 95% followed by DMRT (Duncan Multiple Range Test if any significant differences. The result showed that the treatment combination of azolla, phosphate rock and rice hull ash increase soil organic matter content, cation exchange capacity, available-P and exchangeable-K as well as rice yield ( (at harvest-dry grain weight and milled-dry grain weight.
Finite elements for the thermomechanical calculation of massive structures
International Nuclear Information System (INIS)
Argyris, J.H.; Szimmat, J.; Willam, K.J.
1978-01-01
The paper examines the fine element analysis of thermal stress and deformation problems in massive structures. To this end compatible idealizations are utilized for heat conduction and static analysis in order to minimize the data transfer. For transient behaviour due to unsteady heat flow and/or inelastics material processes the two computational parts are interwoven in form of an integrated software package for finite element analysis of thermomechanical problems in space and time. (orig.) [de
Baking sunflower hulls within an aluminum envelope in a common laboratory oven yields charcoal.
Arnal, Pablo Maximiliano
2015-01-01
Charcoals have been widely used by scientist to research the removal of contaminants from water and air. One key feature of charcoal is that it keeps macropores from the parent material - though anisotropically contracted - and can even develop meso- and micropores. However, the controlled thermochemical conversion of biomass into charcoal at laboratory scale normally requires special setups which involve either vacuum or inert gas. Those setups may not be affordable in research groups or educational institutions where the research of charcoals would be highly welcome. In this work, I propose a simple and effective method to steer the thermochemical process that converts sunflower hulls (SFH) into charcoal with basic laboratory resources. The carbonization method: •Place SFH in an airtight aluminum envelope.•Thermally treat SFH within the envelope in a common laboratory oven.•Open the envelope to obtain the carbonized sunflower hulls.
A Study on the Saving Method of Plate Jigs in Hull Block Butt Welding
Ko, Dae-Eun
2017-11-01
A large amount of plate jigs is used for alignment of welding line and control of welding deformations in hull block assembly stage. Besides material cost, the huge working man-hours required for working process of plate jigs is one of the obstacles in productivity growth of shipyard. In this study, analysis method was proposed to simulate the welding deformations of block butt joint with plate jigs setting. Using the proposed analysis method, an example simulation was performed for actual panel block joint to investigate the saving method of plate jigs. Results show that it is possible to achieve two objectives of quality accuracy of the hull block and saving the plate jig usage at the same time by deploying the plate jigs at the right places. And the proposed analysis method can be used in establishing guidelines for the proper use of plate jigs in block assembly stage.
Structural elements recognized by abacavir-induced T cells
DEFF Research Database (Denmark)
Yerly, Daniel; Pompeu, Yuri Andreiw; Schutte, Ryan J.
2017-01-01
of autoimmune destruction. The structural elements recognized by drug-specific T cell receptors (TCRs) in vivo are poorly defined. Drug-stimulated T cells express TCRs specific for peptide/HLA complexes, but the characteristics of peptides (sequence, or endogenous or exogenous origin) presented in the context...
Energy Technology Data Exchange (ETDEWEB)
Morshed, Nader [University of California, Berkeley, CA 94720 (United States); Lawrence Berkeley National Laboratory, Berkeley, CA 94720 (United States); Echols, Nathaniel, E-mail: nechols@lbl.gov [Lawrence Berkeley National Laboratory, Berkeley, CA 94720 (United States); Adams, Paul D., E-mail: nechols@lbl.gov [Lawrence Berkeley National Laboratory, Berkeley, CA 94720 (United States); University of California, Berkeley, CA 94720 (United States)
2015-05-01
A method to automatically identify possible elemental ions in X-ray crystal structures has been extended to use support vector machine (SVM) classifiers trained on selected structures in the PDB, with significantly improved sensitivity over manually encoded heuristics. In the process of macromolecular model building, crystallographers must examine electron density for isolated atoms and differentiate sites containing structured solvent molecules from those containing elemental ions. This task requires specific knowledge of metal-binding chemistry and scattering properties and is prone to error. A method has previously been described to identify ions based on manually chosen criteria for a number of elements. Here, the use of support vector machines (SVMs) to automatically classify isolated atoms as either solvent or one of various ions is described. Two data sets of protein crystal structures, one containing manually curated structures deposited with anomalous diffraction data and another with automatically filtered, high-resolution structures, were constructed. On the manually curated data set, an SVM classifier was able to distinguish calcium from manganese, zinc, iron and nickel, as well as all five of these ions from water molecules, with a high degree of accuracy. Additionally, SVMs trained on the automatically curated set of high-resolution structures were able to successfully classify most common elemental ions in an independent validation test set. This method is readily extensible to other elemental ions and can also be used in conjunction with previous methods based on a priori expectations of the chemical environment and X-ray scattering.
Validation of structural design of JHR fuel element
International Nuclear Information System (INIS)
Brisson, S.; Miras, G.; Le Bourdonnec, L.; Lemoine, P.; Anselmet, M.C.; Marelle, V.
2010-01-01
The validation of the structural design of the Jules Horowitz Reactor fuel element was made by the Finite Element Method, starting from the Computer Aided Design. The JHR fuel element is a cylindrical assembly of three sectors composed of eight rolled fuel plates. A roll-swaging process is used to join the fuel plates to three aluminium stiffeners. The hydraulic gap between each plate is 1.95 mm. The JHR fuel assembly is fastened at both ends to the upper and lower endfittings by riveting. The main stresses are essentially thermal loads, imposed on the fuel zone of the plates. These thermal loads result from the nuclear heat flux (W/cm 2 ). The mechanical loads are mainly hydraulic thrust forces. The average coolant velocity is 15 m/s. Seismic effects are also studied. The fuel assembly is entirely modelled by thin shells. The model takes into account asymmetric thermal loads which often appear in Research Reactors. The mechanics of the fuel plates vary in function of the burn up. These mechanical properties are derived from the data sets used in the MAIA code, and the validity of the structure is demonstrable at throughout the life of the fuel. Results concerning displacement are compared to functional criteria, while results concerning stress are compared to RCC-MX criteria. The results of this analysis show that the mechanical and geometrical integrity of the JHR fuel elements is respected for Operating Categories 1 and 2. This paper presents the methodology of this demonstration for the results obtained. (author)
Three separate studies were conducted to investigate the life-long effect of creep feeding, creep feeding energy source (soybean hulls, SC, or corn, CC) and interactive effects of creep feed with backgrounding dietary energy source (soybean hulls, SBR, or corn, CBR) on calf growth performance, carca...
with rice hulls on pH and ammonia emissions from poultry houses
African Journals Online (AJOL)
The use of aluminum sulfate [alum; Al2(SO3)4·14H2O] as top dressing to poultry litter has been proven in reducing ammonia (NH3) volatilization under both laboratory and field tests; however, there has been no information of alum application in mixing methods from poultry litter or rice hulls. The aim of the experiment was ...
Struijs, K.; Vincken, J.P.; Verhoef, R.P.; Oostveen, van W.H.M.; Voragen, A.G.J.; Gruppen, H.
2007-01-01
Lignans in flaxseed are known to be part of a macromolecule in which they are connected through the linker-molecule hydroxy-methyl-glutaric acid (HMGA). In this study, the lignan macromolecule was extracted from flaxseed hulls and degraded to its monomeric constituents by complete saponification.
Examination of arrangement of alloy structural elements in models of metallographic structures
International Nuclear Information System (INIS)
Radwan, M.; Gibas, K.; Lybacka, K.; Narbantowicz, E.
1986-01-01
To verify the structure description method taking the probability of component concentration distributions in alloys into account, it is necessary to answer the following question: do the geometrical shapes of component arrangement which are visible on the autoradiographs as dark spots determine the type and parameters of the probability distribution. To solve the problem, 14 autoradiographic models representing different shapes of labelled compounds have been prepared and measured. The results show that different structures have a different distribution of the same element
Finite element analysis of ARPS structures
International Nuclear Information System (INIS)
Ruhkamp, J.D.; McDougal, J.R.; Kramer, D.P.
1998-01-01
Algor finite element software was used to determine the stresses and deflections in the metallic walls of Advanced Radioisotope Power Systems (ARPS) designs. The preliminary design review of these systems often neglects the structural integrity of the design which can effect fabrication and the end use of the design. Before finite element analysis (FEA) was run on the canister walls of the thermophotovoltaic (TPV) generator, hand calculations were used to approximate the stresses and deflections in a flat plate. These results compared favorably to the FEA results of a similar size flat plate. The AMTEC (Alkali Metal Thermal-to-Electric Conversion) cells were analyzed by FEA and the results compared to two cells that were mechanically tested. The mechanically tested cells buckled in the thin sections, one at the top and one in the lower section. The FEA predicted similar stress and shape results but the critical buckling load was found to be very shape dependent
Inverse boundary element calculations based on structural modes
DEFF Research Database (Denmark)
Juhl, Peter Møller
2007-01-01
The inverse problem of calculating the flexural velocity of a radiating structure of a general shape from measurements in the field is often solved by combining a Boundary Element Method with the Singular Value Decomposition and a regularization technique. In their standard form these methods sol...
Incommensurate host-guest structures in compressed elements: Hume—Rothery effects as origin
International Nuclear Information System (INIS)
Degtyareva, V F
2015-01-01
Discovery of the incommensurate structure in the element Ba under pressure 15 years ago was followed by findings of a series of similar structures in other compressed elements. Incommensurately modulated structures of the host-guest type consist of a tetragonal host structure and a guest structure. The guest structure forms chains of atoms embedded in the channels of host atoms so that the axial ratio of these subcells along the c axis is not rational. Two types of the host-guest structures have been found so far: with the host cells containing 8 atoms and 16 atoms; in these both types the guest cells contain 2 atoms. These crystal structures contain a non-integer number of atoms in their unit cell: tI11* in Bi, Sb, As, Ba, Sr, Sc and tI19* in Na, K, Rb. We consider here a close structural relationship of these host-guest structures with the binary alloy phase Au 3 Cd 5 -tI32. This phase is related to the family of the Hume-Rothery phases that is stabilized by the Fermi sphere-Brillouin zone interaction. From similar considerations for alkali and alkaline-earth elements a necessary condition for structural stability emerges in which the valence electrons band overlaps with the upper core electrons and the valence electron count increases under compression. (paper)
The state-of-the-art and problems of fuel element structural analysis
International Nuclear Information System (INIS)
Lassmann, K.
1980-02-01
This study of fuel element structural analysis is arranged in two parts: In the first, self-contained, part the general basic principles of deterministic computer programs for structural analysis of fuel elements are reviewed critically and an approach is shown which can be used to expand the system with respect to statistical investigations. The second part contains technical details summarized in 11 publications, all of which appeared in periodicals with reviewer teams. The major aspects of this study are thought to be the following ones: Contributions to the 'philosophy' of fuel element structural analysis. Critical analysis of the basic structure of computer programs. Critical analysis of the mechanical concept of integral fuel rod computer programs. Establishment of a comprehensive computer program system (URANUS). Expansion from purely deterministic information by statistical analyses. Methodological and computer program developments for the analysis of fast accidents. (orig.) 891 HP/orig. 892 MKO [de
Lower bound plane stress element for modelling 3D structures
DEFF Research Database (Denmark)
Herfelt, Morten Andersen; Poulsen, Peter Noe; Hoang, Linh Cao
2017-01-01
In-plane action is often the primary load-carrying mechanism of reinforced concrete structures. The plate bending action will be secondary, and the behaviour of the structure can be modelled with a reasonable accuracy using a generalised three-dimensional plane stress element. In this paper...
Application of ADINA fluid element for transient response analysis of fluid-structure system
International Nuclear Information System (INIS)
Sakurai, Y.; Kodama, T.; Shiraishi, T.
1985-01-01
Pressure propagation and Fluid-Structure Interaction (FSI) in 3D space were simulated by general purpose finite element program ADINA using the displacement-based fluid element which presumes inviscid and compressible fluid with no net flow. Numerical transient solution was compared with the measured data of an FSI experiment and was found to fairly agree with the measured. In the next step, post analysis was conducted for a blowdown experiment performed with a 1/7 scaled reactor pressure vessel and a flexible core barrel and the code performance was found to be satisfactory. It is concluded that the transient response of the core internal structure of a PWR during the initial stage of LOCA can be analyzed by the displacement-based finite fluid element and the structural element. (orig.)
Ha, Sang Keun; Sung, Jeehye; Choi, Inwook; Kim, Yoonsook
2016-01-01
Rice ( Oryza sativa ) is a major cereal crop in many Asian countries and an important staple food source. Rice hulls have been reported to possess antioxidant activities. In this study, we evaluated the antiinflammatory effects of rice hull extract and associated signal transduction mechanisms in lipopolysaccharide (LPS)-stimulated RAW 264.7 macrophages. We found that rice hull extract inhibited nitric oxide (NO) and prostaglandin E 2 by suppressing the expression of inducible NO synthase and cyclooxygenase-2, respectively. The release of interleukin-1β and tumor necrosis factor-α was also reduced in a dose-dependent manner. Furthermore, rice hull extract attenuated the activation of nuclear factor-kappa B (NF-κB), as well as the phosphorylation of mitogen-activated protein kinases, extracellular signal-regulated kinase (ERK), and c-Jun N-terminal kinase (JNK), in LPS-stimulated RAW264.7 cells. This suggests that rice hull extract decreases the production of inflammatory mediators by downregulating ERK and JNK and the NF-κB signal pathway in RAW 264.7 cells. Rice hull extract inhibits the lipopolysaccharide-induced inflammatory response in RAW264.7 macrophages.Rice hull extract inhibited nitric oxide and prostaglandin E 2 by suppressing the expression of inducible NO synthase and cyclooxygenase-2, respectively.Rice hull extract exerted anti-inflammatory effect through inhibition of nuclear factor-kappa B, extracellular signal-regulated kinase and c-Jun N-terminal kinase signaling pathways.Rice hull extract may provide a potential therapeutic approach for inflammatory diseases. Abbreviations used: COX-2: cyclooxygenase-2, ERK: extracellular signal-regulated kinase, IκB: inhibitory kappa B, IL-1β: interleukin-1β, iNOS: inducible NO synthase, JNK: c-Jun N-terminal kinase, LPS: lipopolysaccharide, MAPKs: mitogen-activated protein kinases, NF-κB: nuclear factor-κB, NO: nitric oxide, PGE2: prostaglandin E2, RHE: rice hull extract, ROS: reactive oxygen species
Economic and Environmental Impact Trade-Offs Related to In-Water Hull Cleanings of Merchant Vessels
DEFF Research Database (Denmark)
Pagoropoulos, Aris; Kjær, Louise Laumann; Dong, Yan
2017-01-01
they are an established practice, their associated environmental and economic trade-offs and conflicts have remained largely unexplored. The purpose of this article is to quantitatively assess both economic and environmental impacts of hull management schemes on the operation of tanker vessels. After identifying induced...... and avoided costs and environmental impacts from the hull management system, we used both temporally and spatially distributed models to capture the degradation of the antifouling system as well as the global sailing profile of the vessels. Last, we analyzed how each of the modeled impacts varied...... of the service are likely to offset the savings—especially if fuel prices are low. In regards to climate change, avoided emissions due to fuel savings are likely to outweigh the limited impacts from the service itself. Last, while ecosystem impacts from marine, terrestrial, and freshwater eco-toxicity are likely...
Effect of Large Negative Phase of Blast Loading on Structural Response of RC Elements
Directory of Open Access Journals (Sweden)
Syed Zubair Iman
2016-01-01
Full Text Available Structural response of reinforced concrete (RC elements for analysis and design are often obtained using the positive phase of the blast pressure curve disregarding the negative phase assuming insignificant contribution from the negative phase of the loading. Although, some insight on the effect of negative phase of blast pressure based on elastic single-degree-of-freedom (SDOF analysis was presented before, the influence of negative phase on different types of resistance functions of SDOF models and on realistic finite element analysis has not been explored. In this study, the effects of inclusion of pulse negative phase on structural response of RC elements from SDOF analysis and from more detailed finite element analysis have been investigated. Investigation of SDOF part has been conducted using MATLAB code that utilizes non-linear resistance functions of SDOF model. Detailed numerical investigation using finite element code DIANA was conducted on the significance of the negative phase on structural response. In the FE model, different support stiffness was used to explore the effect of support stiffness on the structural response due to blast negative phase. Results from SDOF and FE analyses present specific situations where the effect of large negative phase was found to be significant on the structural response of RC elements.
Honorio, Jacqueline Ferandin; Veit, Márcia Teresinha; Gonçalves, Gilberto da Cunha; de Campos, Élvio Antonio; Fagundes-Klen, Márcia Regina
2016-01-01
The textile industry is known for the high use of chemicals, such as dyes, and large volumes of effluent that contaminate waters, a fact that has encouraged research and improved treatment techniques. In this study, we used unprocessed soybean hulls for the removal of reactive blue BF-5G dye. The point of zero charge of soybean hulls was 6.76. Regarding the speed of agitation in the adsorption process, the resistance to mass transfer that occurs in the boundary layer was eliminated at 100 rpm. Kinetics showed an experimental amount of dye adsorbed at equilibrium of 57.473 mg g(-1) obtained under the following conditions: dye initial concentration = 400 mg L(-1); diameter of particle = 0.725 mm; dosage = 6 g L(-1); pH 2; 100 rpm; temperature = 30 °C; and duration of 24 hours. The pseudo-second order best showed the dye removal kinetics. The adsorption isotherms performed at different temperatures (20, 30, 40 and 50 °C) showed little variation in the concentration range assessed, being properly adjusted by the Langmuir isotherm model. The maximum capacity of dye adsorption was 72.427 mg g(-1) at 30 °C. Since soybean hull is a low-cost industrial byproduct, it proved to be a potential adsorbent for the removal of the textile dye assessed.
Structure of nuclear transition matrix elements for neutrinoless ...
Indian Academy of Sciences (India)
Abstract. The structure of nuclear transition matrix elements (NTMEs) required for the study of neutrinoless double- decay within light Majorana neutrino mass mechanism is disassembled in the PHFB model. The NTMEs are calculated using a set of HFB intrinsic wave functions, the reliability of which has been previously ...
Advanced immobilization processes for fuel hulls and dissolver residues
International Nuclear Information System (INIS)
Hebel, W.; Boehme, G.; Findlay, J.R.; Sombret, C.
1984-08-01
Various research and development projects for the conditioning of cladding scraps and dissolver residues are pursued within the scope of the R and D programme on nuclear waste Management of the European Community. They include the characterization of the waste materials arising from industrial fuel reprocessing and the development of different waste immobilization techniques. These concern the embedment of scraps and residues into inert matrices like cement, metal alloys, compacted graphite and sintered ceramics as well as the treatment of the fuel hulls by melting or chemical conversion. The conditioned waste forms are tested as to their relevant properties for activity enclosure
Advanced immobilization processes for fuel hulls and dissolver residues
International Nuclear Information System (INIS)
Hebel, W.; Boehme, G.; Findlay, J.R.; Sombert, C.
1984-01-01
Various research and development projects for the conditioning of cladding scraps and dissolver residues are pursued within the scope of the R and D programme on nuclear waste Management of the European Community. They include the characterization of the waste materials arising from industrial fuel reprocessing and the development of different waste immobilization techniques. These concern the embedment of the scraps and residues into inert matrices like cement, metal alloys, compacted graphite and sintered ceramics as well as the treatment of the fuel hulls by melting or chemical conversion. The conditioned waste forms are tested as to their relevant properties for activity enclosure
Similitude and scaling of large structural elements: Case study
Directory of Open Access Journals (Sweden)
M. Shehadeh
2015-06-01
Full Text Available Scaled down models are widely used for experimental investigations of large structures due to the limitation in the capacities of testing facilities along with the expenses of the experimentation. The modeling accuracy depends upon the model material properties, fabrication accuracy and loading techniques. In the present work the Buckingham π theorem is used to develop the relations (i.e. geometry, loading and properties between the model and a large structural element as that is present in the huge existing petroleum oil drilling rigs. The model is to be designed, loaded and treated according to a set of similitude requirements that relate the model to the large structural element. Three independent scale factors which represent three fundamental dimensions, namely mass, length and time need to be selected for designing the scaled down model. Numerical prediction of the stress distribution within the model and its elastic deformation under steady loading is to be made. The results are compared with those obtained from the full scale structure numerical computations. The effect of scaled down model size and material on the accuracy of the modeling technique is thoroughly examined.
Non-Linear Three Dimensional Finite Elements for Composite Concrete Structures
Directory of Open Access Journals (Sweden)
O. Kohnehpooshi
Full Text Available Abstract The current investigation focused on the development of effective and suitable modelling of reinforced concrete component with and without strengthening. The modelling includes physical and constitutive models. New interface elements have been developed, while modified constitutive law have been applied and new computational algorithm is utilised. The new elements are the Truss-link element to model the interaction between concrete and reinforcement bars, the interface element between two plate bending elements and the interface element to represent the interfacial behaviour between FRP, steel plates and concrete. Nonlinear finite-element (FE codes were developed with pre-processing. The programme was written using FORTRAN language. The accuracy and efficiency of the finite element programme were achieved by analyzing several examples from the literature. The application of the 3D FE code was further enhanced by carrying out the numerical analysis of the three dimensional finite element analysis of FRP strengthened RC beams, as well as the 3D non-linear finite element analysis of girder bridge. Acceptable distributions of slip, deflection, stresses in the concrete and FRP plate have also been found. These results show that the new elements are effective and appropriate to be used for structural component modelling.
Removal of Neutral Red from aqueous solution by adsorption on spent cottonseed hull substrate
International Nuclear Information System (INIS)
Zhou Qi; Gong Wenqi; Xie Chuanxin; Yang Dongjiang; Ling Xiaoqing; Yuan Xiao; Chen Shaohua; Liu Xiaofang
2011-01-01
Cottonseed hull, a low-cost widely available agricultural waste in China, after used as substrate for the white rot fungus Pleurotus ostreatus cultivation, was tested for the removal of Neutral Red (NR), a cationic dye, from aqueous solution. A batch adsorption study was carried out with varied solution pH, adsorbent dosage, reaction time and initial NR concentration. The results show that the kinetics of dye removal by the spent cottonseed hull substrate (SCHS) is prompt in the first 5 min and the adsorption equilibrium can be attained after 240 min. The biosorption kinetics and equilibrium follow typical pseudo-second-order and Langmuir adsorption models. Thermodynamic parameters of ΔG o , ΔH o and ΔS o show that the adsorption is a spontaneous and endothermic process. Fourier transform infrared (FTIR) spectroscopy was used for the characterization of possible dye-biosorbent interaction. This study provides a facile method to produce low-cost biosorbent for the purification of dye contaminated water.
Effects of hull form parameters on seakeeping for YTU gulet series with cruiser stern
Directory of Open Access Journals (Sweden)
Cakici Ferdi
2014-09-01
Full Text Available This study aims to identify the relations between seakeeping characteristics and hull form parameters for YTU Gulet series with cruiser stern. Seakeeping analyses are carried out by means of a computer software which is based on the strip theory and statistical short term response prediction method. Multiple regression analysis is used for numerical assessment through a computer software. RMS heave-pitch motions and absolute vertical accelerations on passenger saloon for Sea State 3 at head waves are investigated for this purpose. It is well known that while ship weight and the ratios of main dimensions are the primary factors on ship motions, other hull form parameters (CP, CWP, CVP, etc. are the secondary factors. In this study, to have an idea of geometric properties on ship motions of gulets three different regression models are developed. The obtained outcomes provide practical predictions of seakeeping behavior of gulets with a high level of accuracy that would be useful during the concept design stage
SAFE-AXISYM, Stress Analysis of Axisymmetric Composite Structure by Finite Elements Method
International Nuclear Information System (INIS)
Cornell, D.C.
1967-01-01
1 - Nature of physical problem solved: SAFE-AXISYM is a program for the analysis of multi-material axisymmetric composite structures. It is designed for the analysis of heterogeneous structures such as reinforced and/or prestressed concrete vessels. The structure is assumed to be linearly elastic, and only bodies of revolution subjected to axisymmetric loading can be treated. 2 - Method of solution: SAFE-AXISYM uses a finite element method with a modified Gauss-Seidel iteration scheme. A reference grid subdivides the structure into ring-like small, finite elements, the vertices of which are called nodes. The grid may be generated by hand, by the computer or by a combination of the two methods. Each node has two degrees of freedom, translation in the and in the axial direction. Both zero and non-zero fixed displacement constraints may be assumed, and the loading condition may be mechanical and/or thermal. 3 - Restrictions on the complexity of the problem: Multi-material structures with varying rigidities converge very slowly. Not valid for incompressible materials. Maximum number of nodes = 475. Maximum number of elements = 1100
Križan, Peter; Matúš, Miloš; Beniak, Juraj; Šooš, Ľubomír
2018-01-01
During the biomass densification can be recognized various technological variables and also material parameters which significantly influences the final solid biofuels (pellets) quality. In this paper, we will present the research findings concerning relationships between technological and material variables during densification of sunflower hulls. Sunflower hulls as an unused source is a typical product of agricultural industry in Slovakia and belongs to the group of herbaceous biomass. The main goal of presented experimental research is to determine the impact of compression pressure, compression temperature and material particle size distribution on final biofuels quality. Experimental research described in this paper was realized by single-axis densification, which was represented by experimental pressing stand. The impact of mentioned investigated variables on the final briquettes density and briquettes dilatation was determined. Mutual interactions of these variables on final briquettes quality are showing the importance of mentioned variables during the densification process. Impact of raw material particle size distribution on final biofuels quality was also proven by experimental research on semi-production pelleting plant.
International Nuclear Information System (INIS)
Hirano, Fumio; Sato, Seichi; Kozaki, Tamotsu
2012-01-01
The thermal impacts of hull and end piece wastes from the reprocessing of MOX spent fuels burned in LWRs on repository performance were investigated. The heat generation rates in MOX spent fuels and the resulting heat generation rates in hull and end piece wastes change depending on the history of MOX fuels. This history includes the burn-up of UO 2 spent fuels from which the Pu is obtained, the cooling period before reprocessing, the storage period of fresh MOX fuels before being loaded into an LWR, as well as the burn-up of the MOX fuels. The heat generation rates in hull and end piece wastes from the reprocessing of MOX spent fuels with any of those histories are significantly larger than those from UO 2 spent fuels with burn-ups of 45 GWd/THM. If a temperature below 80degC is specified for cement-based materials used in waste packages after disposal, the allowable number of canisters containing compacted hull and end pieces in a package for 45 and 70 GWd-MOX needs to be limited to a value of 0.4-1.6, which is significantly lower than 4.0 for 45 GWd-UO 2 . (author)
International Nuclear Information System (INIS)
Lv Shuangshuang; Chen Xuegang; Ye Ying; Yin Suhang; Cheng Jipeng; Xia Meisheng
2009-01-01
Adsorbent/ferrite composites can adsorb and degrade organics in the organic wastewater treatment. In this study, a rice hull/MnFe 2 O 4 composite (RHM) was prepared via calcination under nitrogen atmosphere and was used to treat organic wastewater with the assistance of microwave radiation. Rice hull was pyrolysed to a porous substrate that consisted of silica and activated carbon under high temperature. Monodisperse spinel MnFe 2 O 4 nanoparticles whose mean diameter is around 59 nm are distributed on the substrate. With the assistance of microwave radiation, RHM was motivated to a hotspot of adsorption and catalysis which could remove more than 70% COD of wastewater within 6 min. The maximum COD removal was 73.5% when the concentration of RHM was 15 mg mL -1 and the irradiation time of microwave radiation was 6 min. Although the BET surface area and iodine value of RHM are half of rice hull ash (RHA), the COD removal of RHM is 7-20% higher than that of RHA. It is attributed to the presence of MnFe 2 O 4 , which enhances the catalytic activity of RHM. RHM can be regenerated via water washing. However, the surface area and the maximum COD removal of RHM decrease for each regeneration cycle. With the advantages of low cost and rapid processing, this novel rice hull/MnFe 2 O 4 composite could gain promising application in wastewater treating-agent.
Structure of nuclear transition matrix elements for neutrinoless ...
Indian Academy of Sciences (India)
Abstract. The structure of nuclear transition matrix elements (NTMEs) required for the study of neutrinoless double-β decay within light Majorana neutrino mass mechanism is disassembled in the PHFB model. The NTMEs are calculated using a set of HFB intrinsic wave functions, the reliability of which has been previously ...