WorldWideScience

Sample records for hu jaotus kopsudes

  1. Jingtao Hu

    Indian Academy of Sciences (India)

    Jingtao Hu. Articles written in Journal of Biosciences. Volume 40 Issue 2 June 2015 pp 269-279 Articles. Anti-tumour immune effect of oral administration of Lactobacillus plantarum to CT26 tumour-bearing mice · Jingtao Hu Chunfeng Wang Liping Ye Wentao Yang Haibin Huang Fei Meng Shaohua Shi Zhuang Ding.

  2. yongsong hu

    Indian Academy of Sciences (India)

    YONGSONG HU. Articles written in Journal of Genetics. Volume 96 Issue 4 September 2017 pp 673-679 RESEARCH ARTICLE. Genetic effect of Myf5 gene in rabbit meat quality traits · JIE WANG YONGSONG HU MAURICIO A. ELZO YU SHI XIANBO JIA SHIYI CHEN SONGJIA LAI · More Details Abstract Fulltext PDF.

  3. Riigi haldusterritoriaalse jaotuse Gordioni sõlm / Janno Reiljan, Aivo Ülper

    Index Scriptorium Estoniae

    Reiljan, Janno, 1951-2018

    2011-01-01

    Analüüsitakse Eesti riigi haldusterritoriaalse jaotuse teoreetilisi, poliitilisi ja korralduslikke aluseid, tehakse võrdlusi Põhjamaadega ning sellest lähtuvalt pakutakse välja suund sisulise lahenduse otsimiseks. Omavalitsusüksuste suuruse empiiriline analüüs toetub Viljandi maakonna andmetele.

  4. keling hu

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics. KELING HU. Articles written in Journal of Genetics. Volume 96 Issue 2 June 2017 pp 235-249 RESEARCH ARTICLE. Expression analysis of argonaute, Dicer-like, and RNA-dependent RNA polymerase genes in cucumber ( Cucumis sativus L.) in response to abiotic stress · DEFANG ...

  5. Ming-Kuan Hu

    Indian Academy of Sciences (India)

    Ming-Kuan Hu. Articles written in Journal of Biosciences. Volume 37 Issue 1 March 2012 pp 157-165 Review. Autophagy: A double-edged sword in Alzheimer's disease · Ying-Tsen Tung Bo-Jeng Wang Ming-Kuan Hu Wen-Ming Hsu Hsinyu Lee Wei-Pang Huang Yung-Feng Liao · More Details Abstract Fulltext PDF.

  6. Pengenalan Pose Tangan Menggunakan HuMoment

    Directory of Open Access Journals (Sweden)

    Dina Budhi Utami

    2017-02-01

    Full Text Available Computer vision yang didasarkan pada pengenalan bentuk memiliki banyak potensi dalam interaksi manusia dan komputer. Pose tangan dapat dijadikan simbol interaksi manusia dengan komputer seperti halnya pada penggunaan berbagai pose tangan pada bahasa isyarat. Berbagai pose tangan dapat digunakan untuk menggantikan fungsi mouse, untuk mengendalikan robot, dan sebagainya. Penelitian ini difokuskan pada pembangunan sistem pengenalan pose tangan menggunakan HuMoment. Proses pengenalan pose tangan dimulai dengan melakukan segmentasi citra masukan untuk menghasilkan citra ROI (Region of Interest yaitu area telapak tangan. Selanjutnya dilakukan proses deteksi tepi. Kemudian dilakukan ekstraksi nilai HuMoment. Nilai HuMoment dikuantisasikan ke dalam bukukode yang dihasilkan dari proses pelatihan menggunakan K-Means. Proses kuantisasi dilakukan dengan menghitung nilai Euclidean Distance terkecil antara nilai HuMomment citra masukan dan bukukode. Berdasarkan hasil penelitian, nilai akurasi sistem dalam mengenali pose tangan adalah 88.57%.

  7. Hu on poolel teel / James Miles

    Index Scriptorium Estoniae

    Miles, James

    2006-01-01

    2007. aastal toimuv kommunistliku partei 17. kongress tähistab Hiina presidendi Hu Jintao jaoks oma võimuaja poole peale jõudmist, ees ootavad sellised väljakutsed nagu olümpiamängude korraldamine, valimiskeeris Taiwanis ning hullunud majanduse stabiliseerimine. Vt samas: Hiina avanemise pidu

  8. Infecciones en huéspedes inmunocomprometidos

    Directory of Open Access Journals (Sweden)

    Luis Ernesto Cuéllar Ponce de León

    2013-04-01

    Full Text Available Las infecciones son causa frecuente de morbimortalidad en huéspedes inmunocomprometidos. La frecuencia y diversidad de infecciones en esta población dependerá del tipo de inmunocompromiso, tratamiento recibido y aspecto epidemiológico. Los huéspedes con neutropenia desarrollan infecciones por bacterias extracelulares no encapsuladas y hongos levaduriformes y filamentosos; el diagnóstico precoz y tratamiento oportuno de las mismas son considerados una emergencia por su severidad y gran mortalidad asociada. El compromiso de la inmunidad humoral se relaciona con infecciones por microorganismos encapsulados (bacterias extracelulares y hongos; la secuencia clínica presentada en estas infecciones es neumonía aguda-bacteremia/fungemia-meningoencefalitis aguda/crónica. Muchas de estas infecciones son inmunoprevenibles. Los huéspedes con compromiso de la inmunidad celular desarrollan infecciones por microorganismos intracelulares y también por algunos extracelulares; muchas de las infecciones ocurren por reactivación; a menudo requieren profilaxis antimicrobiana tanto primaria como secundaria. El tratamiento medicamentoso (quimioterapia, drogas inmunosupresoras, etc. y los procedimientos invasivos facilitan el desarrollo de determinadas infecciones. El aspecto epidemiológico, que incluye el estilo de vida, ocupación, viajes previos, etc. permite evaluar y determinar el riesgo de potenciales infecciones. En conclusión, la prevención de las infecciones y el uso racional de antimicrobianos son los pilares fundamentales en el manejo efectivo de los huéspedes inmunocomprometidos.

  9. Hu Huanyong: father of China's population geography.

    Science.gov (United States)

    She, W

    1998-08-01

    Professor Hu Huanyong died of an illness on April 30, 1998, in Shanghai, China. The professor was a forefather of modern Chinese demography and the founder of China's population geography. He drew the "Aihui-Tengchong Line," which was known internationally as the "Hu Line," in 1934; the line marked a striking difference in the distribution of China's population. He was born in 1901, in Yixing, Jiangsu Province. He studied literature, history, and geography at Nanjing Normal School (later named the Southeast University of China); he continued his education at the University of Paris from 1926 to 1928. Upon his return to China, he began teaching at the Nanjing Central University and was later appointed dean of the Department of Geography and president of the China Geographical Association. During this time, he wrote "Distribution of China's Population," a paper in which he drew China's first population density contour chart based on the 1933 national census data by county; this produced the "Hu Line." The professor began teaching at East-China Normal University in Shanghai in 1953; in 1957, he became director of the research office of population geography (which he helped to establish), the first demographic research institution in China. In 1958, he focused on the population geography of Jiangsu Province. In 1983, the office expanded to become a population research institute; Professor Hu became its president. During the 1980s, he described a geographic division of China's population based on differences in population density, ecological environment, socioeconomic conditions, and historical development. This resulted in 8 regions: 1) the lower parts of the Yellow River region; 2) the Liaoning-Jilin-Heilongjiang region; 3) the middle and lower parts of the Yangtze River region; 4) the southeast coastal region; 5) the Shanxi-Shaanxi-Gansu-Ningxia region; 6) the Sichuan-Guizhou-Yunnan region; 7) the Inner Mongolia-Xinjiang region; and 8) the Qinghai-Tibet region. This

  10. Elliptical Undulators HU256 for Synchrotron SOLEIL

    Science.gov (United States)

    Batrakov, A.; Briquez, F.; Chubar, O.; Churkin, I.; Dael, A.; Ilyin, I.; Kolokolnikov, Yu.; Marcouile, O.; Marteau, F.; Roux, G.; Rouvinski, E.; Semenov, E.; Steshov, A.; Valleau, M.; Vobly, P.

    2007-01-01

    Three elliptical undulators HU256 of electromagnetic type were produced, tested and magnetically measured by the Budker Institute of Nuclear Physics (Russia) for Synchrotron Soleil (France). The undulators have a new design of a Bx & Bz closed structure for insertion vacuum chamber. In the elliptical undulator HU256 with period of the magnetic fields of 256 mm, the vertical magnetic field (Bzmax=0.44 T) formed by 27 Bz laminated dipole magnets is symmetric, and the horizontal magnetic field (Bxmax=0.33 T) formed by 28 Bx laminated dipole magnets is asymmetric. The undulator can work in standard mode as well as in a quasi-periodical mode. The vertical magnetic field may be modulated by switching on the modulation coils placed on the Bz dipoles. Two power supply systems allow us to modulate the horizontal magnetic field, and change the radiation spectrum. The magnetic calculations of the individual dipoles and dipoles in "undulator" environment were executed by means of Mermaid 3D Code. The magnetic measurements of the individual dipoles had confirmed the magnetic calculations. On basis of semiempirical dependences from the mechanical characteristics the estimates of the magnetic parameters for all dipoles were calculated. Sorting of dipoles in the undulators have been done, and it has improved the magnetic parameters of the assembled undulators in comparison with the statistical estimations. The magnetic measurements of the undulators HU256 were carried out at Budker INP by Hall probes and at Soleil by Hall probes and Stretched Wire. Now the 1st undulator HU256 is installed at Soleil Storage Ring.

  11. The fungal natural product azaphilone-9 binds to HuR and inhibits HuR-RNA interaction in vitro.

    Directory of Open Access Journals (Sweden)

    Kawaljit Kaur

    Full Text Available The RNA-binding protein Hu antigen R (HuR binds to AU-rich elements (ARE in the 3'-untranslated region (UTR of target mRNAs. The HuR-ARE interactions stabilize many oncogenic mRNAs that play important roles in tumorigenesis. Thus, small molecules that interfere with the HuR-ARE interaction could potentially inhibit cancer cell growth and progression. Using a fluorescence polarization (FP competition assay, we identified the compound azaphilone-9 (AZA-9 derived from the fungal natural product asperbenzaldehyde, binds to HuR and inhibits HuR-ARE interaction (IC50 ~1.2 μM. Results from surface plasmon resonance (SPR verified the direct binding of AZA-9 to HuR. NMR methods mapped the RNA-binding interface of HuR and identified the involvement of critical RNA-binding residues in binding of AZA-9. Computational docking was then used to propose a likely binding site for AZA-9 in the RNA-binding cleft of HuR. Our results show that AZA-9 blocks key RNA-binding residues of HuR and disrupts HuR-RNA interactions in vitro. This knowledge is needed in developing more potent AZA-9 derivatives that could lead to new cancer therapy.

  12. China’s Politics under Hu Jintao

    Directory of Open Access Journals (Sweden)

    Mathieu Duchâtel

    2009-10-01

    Full Text Available This special issue focuses on Hu Jintao’s first mandate in power, between the Sixteenth and the Seventeenth Party Congress (2002-2007. It considers two intertwined issues: power viewed through the lens of party politics, and actual policy changes that may have emanated from a mandate initially loaded with expectations. Besides the domestic dimensions of elite politics and ideological change, two central aspects of Chinese politics, the key question tackled in this issue is the ability of a new general secretary to transform past policies, especially in the realms of foreign affairs and national security since they are by tradition – and constitutionally – the responsibility of China’s paramount leader.

  13. Notas sobre el paisaje de Huánuco Pampa

    OpenAIRE

    Román Godines, Oscar; Ministerio de Cultura

    2013-01-01

    El complejo arqueológico Huánuco Pampa se encuentra ubicado en la provincia Dos de Mayo en el departamento de Huánuco y en la actualidad es quizás el principal vestigio de la cosmovisión y la planificación urbana inca.

  14. HU-446 and HU-465, Derivatives of the Non-psychoactive Cannabinoid Cannabidiol, Decrease the Activation of Encephalitogenic T Cells.

    Science.gov (United States)

    Kozela, Ewa; Haj, Christeene; Hanuš, Lumir; Chourasia, Mukesh; Shurki, Avital; Juknat, Ana; Kaushansky, Nathali; Mechoulam, Raphael; Vogel, Zvi

    2016-01-01

    Cannabidiol (CBD), the non-psychoactive cannabinoid, has been previously shown by us to decrease peripheral inflammation and neuroinflammation in mouse experimental autoimmune encephalomyelitis (EAE) model of multiple sclerosis (MS). Here we have studied the anti-inflammatory effects of newly synthesized derivatives of natural (-)-CBD ((-)-8,9-dihydro-7-hydroxy-CBD; HU-446) and of synthetic (+)-CBD ((+)-8,9-dihydro-7-hydroxy-CBD; HU-465) on activated myelin oligodendrocyte glycoprotein (MOG)35-55-specific mouse encephalitogenic T cells (T(MOG) ) driving EAE/MS-like pathologies. Binding assays followed by molecular modeling revealed that HU-446 has negligible affinity toward the cannabinoid CB1 and CB2 receptors while HU-465 binds to both CB1 and CB2 receptors at the high nanomolar concentrations (Ki = 76.7 ± 5.8 nm and 12.1 ± 2.3 nm, respectively). Both, HU-446 and HU-465, at 5 and 10 μm (but not at 0.1 and 1 μm), inhibited the MOG35-55-induced proliferation of autoreactive T(MOG) cells via CB1/CB2 receptor independent mechanisms. Moreover, both HU-446 and HU-465, at 5 and 10 μm, inhibited the release of IL-17, a key autoimmune cytokine, from MOG35-55-stimulated T(MOG) cells. These results suggest that HU-446 and HU-465 have anti-inflammatory potential in inflammatory and autoimmune diseases. © 2015 John Wiley & Sons A/S.

  15. Pelger-Huët anomaly in a cat.

    Science.gov (United States)

    Deshuillers, Pierre; Raskin, Rose; Messick, Joanne

    2014-09-01

    A 14-year-old, spayed female Domestic Shorthair cat was referred to the Purdue University Veterinary Teaching Hospital (PUVTH) for iodine 131 treatment of hyperthyroidism. Upon arrival, a biochemistry profile and a CBC were performed. Approximately 50% of the neutrophils and all the eosinophils observed were hyposegmented with a mature, condensed chromatin pattern. Nuclei had a band to "dumbbell" shape, and rarely a round shape, suggesting a Pelger-Huët anomaly or a pseudo Pelger-Huët. Based on both a negative FeLV and FIV tests, the absence of any clinical signs to support an inflammatory process, and the persistence of this granulocytic morphology 6 months after its previous admission to the PUVTH, a diagnosis of Pelger-Huët anomaly was established in this cat. © 2014 American Society for Veterinary Clinical Pathology and European Society for Veterinary Clinical Pathology.

  16. The abundant and essential HU proteins in Deinococcus deserti and Deinococcus radiodurans are translated from leaderless mRNA.

    Science.gov (United States)

    Bouthier de la Tour, Claire; Blanchard, Laurence; Dulermo, Rémi; Ludanyi, Monika; Devigne, Alice; Armengaud, Jean; Sommer, Suzanne; de Groot, Arjan

    2015-12-01

    HU proteins have an important architectural role in nucleoid organization in bacteria. Compared with HU of many bacteria, HU proteins from Deinococcus species possess an N-terminal lysine-rich extension similar to the eukaryotic histone H1 C-terminal domain involved in DNA compaction. The single HU gene in Deinococcus radiodurans, encoding DrHU, is required for nucleoid compaction and cell viability. Deinococcus deserti contains three expressed HU genes, encoding DdHU1, DdHU2 and DdHU3. Here, we show that either DdHU1 or DdHU2 is essential in D. deserti. DdHU1 and DdHU2, but not DdHU3, can substitute for DrHU in D. radiodurans, indicating that DdHU3 may have a non-essential function different from DdHU1, DdHU2 and DrHU. Interestingly, the highly abundant DrHU and DdHU1 proteins, and also the less expressed DdHU2, are translated in Deinococcus from leaderless mRNAs, which lack a 5'-untranslated region and, hence, the Shine-Dalgarno sequence. Unexpectedly, cloning the DrHU or DdHU1 gene under control of a strong promoter in an expression plasmid, which results in leadered transcripts, strongly reduced the DrHU and DdHU1 protein level in D. radiodurans compared with that obtained from the natural leaderless gene. We also show that the start codon position for DrHU and DdHU1 should be reannotated, resulting in proteins that are 15 and 4 aa residues shorter than initially reported. The expression level and start codon correction were crucial for functional characterization of HU in Deinococcus.

  17. Eesti Kultuurkapital : 1997. aasta toetuse teine jaotus

    Index Scriptorium Estoniae

    1997-01-01

    Helikunsti sihtkapitalilt Aurika Gergelezhiule osalemiseks IAMLi aastakonverentsil Genfis; Kirjanduse sihtkapitalilt EKM Arhiivraamatukogule ajakirjanduse sisu retrospektiivse bibliograafia koostamiseks, TÜ Raamatukogule maali "Pent Nurmekund" (1977) ostmiseks; Valdkondadevaheliselt sihtkapitalilt Urve Koldele restaureerimisalaseks praktikaks Saksamaal, Kaie Kuslapile ja Anneli Sepale osalemiseks IAMLi aastakonverentsi Genfis, EAR-ile noorte infotöötajate täiendõppeks Helsingis ja kataloogi "Köiteuunikume EARis" trükikuludeks, ERÜ-le ajakirja "Raamatukogu" honorarifondiks, Eesti Raamatuühingule VI Viljandi vanaraamatupäevade läbiviimiseks, Holstre ja Rõngu Raamatukogule arvuti ja tarkvara ostmiseks, Räpina Linna Keskraamatukogule raamatukogutarkvara ostmiseks, Vana-Vigala Raamatukogule paljundusmasina ostmiseks, Varbola Raamatukogule arvuti ja printeri ning Vastemõisa Külaraamatukogule arvuti ja modemi ostmiseks

  18. Eesti Kultuurkapital : 1997. aasta toetuse III jaotus

    Index Scriptorium Estoniae

    1997-01-01

    Kirjanduse sihtkapitali toetus Sillamäe Põhikoolile ilukirjanduse muretsemiseks raamatukogule; kultuurivaldkondadevahelised eraldused ERÜ-le konverentsi "Eesti trükis" materjalide väljaandmiseks, Haanja Raamatukogule arvuti ja printeri ostmiseks, Kareda, Kivi-Vigala ja Valtu Raamatukogule paljundusmasina ostmiseks, Meremäe Raamatukogule arvuti, printeri ja tarkvara Kirjasto 3000 ostmiseks, Narva Eesti Gümnaasiumile perioodiliste väljaannete ja raamatute ostmiseks raamatukogule, Turba Raamatukogule eesti rahva- ja süvamuusikat tutvustavate CDde ostmiseks, Võrumaa Keskraamatukogule heliraamatute ostmiseks, Vahtseliina Raamatukogule arvuti ja tarkvara Kirjasto 3000 ostmiseks; Vaime Kaburile elutöötoetus

  19. Abundances of the planetary nebula Hu 1-2

    NARCIS (Netherlands)

    Pottasch, [No Value; Hyung, S; Aller, LH; Beintema, DA; Bernard-Salas, J; Feibelman, WA; Klockner, HR

    The ISO and IUE spectra of the "elliptical" nebula Hu 1-2 are presented. These spectra are combined with new, high resolution spectra in the visual wavelength region to obtain a complete, extinction corrected, spectrum. The chemical composition of the nebula is then calculated and compared to

  20. Targeting Mycobacterium tuberculosis nucleoid-associated protein HU with structure-based inhibitors

    Science.gov (United States)

    Bhowmick, Tuhin; Ghosh, Soumitra; Dixit, Karuna; Ganesan, Varsha; Ramagopal, Udupi A.; Dey, Debayan; Sarma, Siddhartha P.; Ramakumar, Suryanarayanarao; Nagaraja, Valakunja

    2014-06-01

    The nucleoid-associated protein HU plays an important role in maintenance of chromosomal architecture and in global regulation of DNA transactions in bacteria. Although HU is essential for growth in Mycobacterium tuberculosis (Mtb), there have been no reported attempts to perturb HU function with small molecules. Here we report the crystal structure of the N-terminal domain of HU from Mtb. We identify a core region within the HU-DNA interface that can be targeted using stilbene derivatives. These small molecules specifically inhibit HU-DNA binding, disrupt nucleoid architecture and reduce Mtb growth. The stilbene inhibitors induce gene expression changes in Mtb that resemble those induced by HU deficiency. Our results indicate that HU is a potential target for the development of therapies against tuberculosis.

  1. File list: ALL.Liv.20.AllAg.HuH-7 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.Liv.20.AllAg.HuH-7 hg19 All antigens Liver HuH-7 SRX159089,SRX159090,SRX159091,...SRX159095,SRX159096,SRX159093,SRX159092,SRX159094,SRX100918,SRX100898 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/ALL.Liv.20.AllAg.HuH-7.bed ...

  2. Molecular analysis of the HuD gene in neuroendocrine lung cancers

    NARCIS (Netherlands)

    D'Alessandro, Vito; Muscarella, Lucia Anna; la Torre, Annamaria; Bisceglia, Michele; Parrella, Paola; Scaramuzzi, Gerardo; Storlazzi, Clelia Tiziana; Trombetta, Domenico; Kok, Klaas; De Cata, Angelo; Sperandeo, Marco; Zelante, Leopoldo; Carella, Massimo; Vendemiale, Gianluigi

    n-ELAV (neuronal-Embryonic Lethal, Abnormal Vision)-like genes belong to a family codifying for onconeural RNA-binding proteins, also called Hu antigens. Anti-Hu-antibodies (anti-Hu-Ab) are typically associated with paraneoplastic encephalomyelitis/sensory neuropathy (PEM/PSN) and low titres of

  3. Magnetic design and manufacture of elliptical undulators HU256

    Science.gov (United States)

    Batrakov, A.; Briquez, F.; Chubar, O.; Churkin, I.; Couprie, M.-E.; Dael, A.; Ilyin, I.; Kolokolnikov, Yu.; Roux, G.; Rouvinski, E.; Semenov, E.; Steshov, A.; Valleau, M.; Vobly, P.

    2007-05-01

    Three elliptical undulators HU256 (period 256 mm) of electromagnetic type were produced, tested and magnetically measured by the Budker Institute of Nuclear Physics (Russia) for Synchrotron SOLEIL (France). The undulators have a new design of a Bx and Bz closed structure for insertion vacuum chamber. The magnetic calculations of the individual dipoles and undulator structures were executed by means of Mermaid 3D Code. The expected magnetic parameters for all manufactured dipoles were fulfilled on basis of these model dependences from the mechanical characteristics (pole gap, yoke width, and coil position). The estimated 1st integral of all dipoles had been used in an optimal arrangement of the dipoles in undulators (sorting). Owing to the realized sorting, the 1st integral of the magnetic field and phase error of the assembled undulators had been decreased in comparison with the statistic estimations. The special Hall probes systems for the magnetic measurements of the undulators HU256 were designed and manufactured by the BINP. All three HU256 undulators were magnetically measured at the BINP and re-measured at the SOLEIL after transportation. The results of magnetic measurements and model estimates are compared and analyzed.

  4. IHF and HU: flexible architects of bent DNA.

    Science.gov (United States)

    Swinger, Kerren K; Rice, Phoebe A

    2004-02-01

    The energetic cost of bending short segments of DNA is very high. This bending is critical for the packaging of DNA and is exploited to regulate many cellular processes. In prokaryotes, IHF and HU are key architectural proteins present at high concentrations. New protein-DNA co-crystal structures, and the adaptation of advanced biophysical and biochemical techniques have led to an improved understanding of how these proteins interact with DNA. These techniques include time-resolved synchrotron X-ray footprinting, differential scanning calorimetry, isothermal titration calorimetry and single-molecule experiments.

  5. HuPSON: the human physiology simulation ontology.

    Science.gov (United States)

    Gündel, Michaela; Younesi, Erfan; Malhotra, Ashutosh; Wang, Jiali; Li, Hui; Zhang, Bijun; de Bono, Bernard; Mevissen, Heinz-Theodor; Hofmann-Apitius, Martin

    2013-11-22

    Large biomedical simulation initiatives, such as the Virtual Physiological Human (VPH), are substantially dependent on controlled vocabularies to facilitate the exchange of information, of data and of models. Hindering these initiatives is a lack of a comprehensive ontology that covers the essential concepts of the simulation domain. We propose a first version of a newly constructed ontology, HuPSON, as a basis for shared semantics and interoperability of simulations, of models, of algorithms and of other resources in this domain. The ontology is based on the Basic Formal Ontology, and adheres to the MIREOT principles; the constructed ontology has been evaluated via structural features, competency questions and use case scenarios.The ontology is freely available at: http://www.scai.fraunhofer.de/en/business-research-areas/bioinformatics/downloads.html (owl files) and http://bishop.scai.fraunhofer.de/scaiview/ (browser). HuPSON provides a framework for a) annotating simulation experiments, b) retrieving relevant information that are required for modelling, c) enabling interoperability of algorithmic approaches used in biomedical simulation, d) comparing simulation results and e) linking knowledge-based approaches to simulation-based approaches. It is meant to foster a more rapid uptake of semantic technologies in the modelling and simulation domain, with particular focus on the VPH domain.

  6. SUPPORT FOR HU CFRT SUMMER HIGH SCHOOL FUSION WORKSHOP

    Energy Technology Data Exchange (ETDEWEB)

    Punjabi, Alkesh

    2010-02-09

    Nine summer fusion science research workshops for minority and female high school students were conducted at the Hampton University Center for Fusion Research and Training from 1996 to 2005. Each workshop was of the duration of eight weeks. In all 35 high school students were mentored. The students presented 28 contributed papers at the annual meetings of the American Physical Society Division of Plasma Physics. These contributed papers were very well received by the plasma physics and fusion science research community. The students won a number of prestigious local, state, and national honors, awards, prizes, and scholarships. The notable among these are the two regional finalist positions in the 1999 Siemens-Westinghouse Science and Technology Competitions; 1st Place U.S. Army Award, 2006; 1st Place U.S. Naval Science Award, 2006; Yale Science and Engineering Association Best 11th Grade Project, 2006; Society of Physics Students Book Award, 2006; APS Corporate Minority Scholarship and others. This workshop program conducted by the HU CFRT has been an exemplary success, and served the minority and female students exceptionally fruitfully. The Summer High School Fusion Science Workshop is an immensely successful outreach activity conducted by the HU CFRT. In this workshop, we train, motivate, and provide high quality research experiences to young and talented high school scholars with emphasis on under-represented minorities and female students in fusion science and related areas. The purpose of this workshop is to expose minority and female students to the excitement of research in science at an early stage in their academic lives. It is our hope that this may lead the high school students to pursue higher education and careers in physical sciences, mathematics, and perhaps in fusion science. To our knowledge, this workshop is the first and only one to date, of fusion science for under-represented minorities and female high school students at an HBCU. The faculty

  7. Understanding and recognizing the Pelger-Huët anomaly.

    Science.gov (United States)

    Colella, Rita; Hollensead, Sandra C

    2012-03-01

    The Pelger-Huët anomaly (PHA) is a recognized morphologic variant affecting all granulocytes but is most evident in polymorphonuclear neutrophils (PMNs). PHA is caused by a decreased amount of the lamin B receptor (LBR). Recognition of PHA morphologic features serves as a marker for mutations in the LBR gene. This review summarizes the history of PHA and the current knowledge of the functions of the LBR. Guidance is given for distinguishing PHA from other hematologic disorders in which granulocytes may show similar changes. Recognition of PHA in the laboratory should prompt communication to the patient's physician about the possible clinical significance of this finding and the recommended screening for the anomaly in other family members by CBC and review of a peripheral blood smear.

  8. El monolingüismo del huésped

    Directory of Open Access Journals (Sweden)

    Jerade, Miriam

    2015-12-01

    Full Text Available In a footnote to Derrida’s Monolingualism of the Other (originally published in French in 1996, the French philosopher introduces his concept of “monolingualism of the guest”. Derrida’s monolingualism of the guest revises the notion of mother tongue as distinctively described by Hannah Arendt. In this article, I will investigate Derrida’s “monolingualism of the guest” by relying on his notion of “idiom” and on his thinking about translation. My aim will be to demonstrate how Derrida’s ideas can help exploring the relationship between language and hospitality, a key concept embedded in his concept of “monolingualism of the guest”.En una nota a pie de página de su El monolingüismo del otro (publicado originalmente en francés en 1996, Derrida presenta una reflexión sobre la lengua que denomina “el monolingüismo del huésped”. Este “monolingüismo del otro” se contrapone a la noción de lengua materna que había propuesto Hannah Arendt. El presente artículo pretende ahondar en ese “monolingüismo del huésped” tomando como punto de partida el concepto derridiano de “idioma” y su reflexión sobre el acto de traducir. Buscamos demostrar cómo las ideas de Derrida pueden servir para repensar la relación entre lengua y hospitalidad, noción esta crucial dentro del concepto del “monolingüismo del otro”.

  9. Tolerance to the neuron-specific paraneoplastic HuD antigen.

    Directory of Open Access Journals (Sweden)

    Ilana DeLuca

    2009-06-01

    Full Text Available Experiments dating back to the 1940's have led to the hypothesis that the brain is an immunologically privileged site, shielding its antigens from immune recognition. The paraneoplastic Hu syndrome provides a powerful paradigm for addressing this hypothesis; it is believed to develop because small cell lung cancers (SCLC express the neuron-specific Hu protein. This leads to an Hu-specific tumor immune response that can develop into an autoimmune attack against neurons, presumably when immune privilege in the brain is breached. Interestingly, all SCLC express the onconeural HuD antigen, and clinically useful tumor immune responses can be detected in up to 20% of patients, yet the paraneoplastic neurologic syndrome is extremely rare. We found that HuD-specific CD8+ T cells are normally present in the mouse T cell repertoire, but are not expanded upon immunization, although they can be detected after in vitro expansion. In contrast, HuD-specific T cells could be directly activated in HuD null mice, without the need for in vitro expansion. Taken together, these results demonstrate robust tolerance to the neuronal HuD antigen in vivo, and suggest a re-evaluation of the current concept of immune privilege in the brain.

  10. HuD Regulates Coding and Noncoding RNA to Induce APP→Aβ Processing

    Directory of Open Access Journals (Sweden)

    Min-Ju Kang

    2014-06-01

    Full Text Available The primarily neuronal RNA-binding protein HuD is implicated in learning and memory. Here, we report the identification of several HuD target transcripts linked to Alzheimer’s disease (AD pathogenesis. HuD interacted with the 3′ UTRs of APP mRNA (encoding amyloid precursor protein and BACE1 mRNA (encoding β-site APP-cleaving enzyme 1 and increased the half-lives of these mRNAs. HuD also associated with and stabilized the long noncoding (lncRNA BACE1AS, which partly complements BACE1 mRNA and enhances BACE1 expression. Consistent with HuD promoting production of APP and APP-cleaving enzyme, the levels of APP, BACE1, BACE1AS, and Aβ were higher in the brain of HuD-overexpressing mice. Importantly, cortex (superior temporal gyrus from patients with AD displayed significantly higher levels of HuD and, accordingly, elevated APP, BACE1, BACE1AS, and Aβ than did cortical tissue from healthy age-matched individuals. We propose that HuD jointly promotes the production of APP and the cleavage of its amyloidogenic fragment, Aβ.

  11. Dual architectural roles of HU: Formation of flexible hinges and rigid filaments

    NARCIS (Netherlands)

    van Noort, J.M.; Verbrugge, S.; Goosen, N.; Dekker, C.; Dame, R.T.

    2004-01-01

    The nucleoid-associated protein HU is one of the most abundant proteins in Escherichia coli and has been suggested to play an important role in bacterial nucleoid organization and regulation. Although the regulatory aspects of HU have been firmly established, much less is understood about the role

  12. A Meta Analysis and Hierarchical Classification of HU-Based Atherosclerotic Plaque Characterization Criteria

    NARCIS (Netherlands)

    Kristanto, Wisnumurti; van Ooijen, Peter M. A.; Jansen-van der Weide, Marijke C.; Vliegenthart, Rozemarijn; Oudkerk, Matthijs

    2013-01-01

    Background: Many computed tomography (CT) studies have reported that lipid-rich, presumably rupture-prone atherosclerotic plaques can be characterized according to their Hounsfield Unit (HU) value. However, the published HU-based characterization criteria vary considerably. The present study aims to

  13. Draft Genome Sequences of Two Streptococcus pneumoniae Serotype 19A Sequence Type 226 Clinical Isolates from Hungary, Hu17 with High-Level Beta-Lactam Resistance and Hu15 of a Penicillin-Sensitive Phenotype.

    Science.gov (United States)

    Rieger, Martin; Denapaite, Dalia; Brückner, Reinhold; Maurer, Patrick; Hakenbeck, Regine

    2017-05-18

    The draft genome sequences of two multiple-antibiotic-resistant Streptococcus pneumoniae isolates from Hungary, Hu15 and Hu17, are reported here. Strain Hu15 is penicillin susceptible, whereas Hu17 is a high-level-penicillin-resistant strain. Both isolates belong to the serotype 19A sequence type 226, a single-locus variant (in the ddl locus) of the Hungary(19A)-6 clone. Copyright © 2017 Rieger et al.

  14. On Possibility of Sorting of Electromagnetic Undulators HU256

    Science.gov (United States)

    Churkin, I.; Steshov, A.

    2007-01-01

    It is known that the magnetic parameters of the permanent and hybrid magnet undulators may be improved by sorting on basis of the magnetic measurements of individual magnetic blocks and applying of the optimization criteria. The procedure of sorting for the electromagnetic undulators HU256 is described in the article. The magnetic calculations of the individual dipoles and dipoles in "undulator environment" executed by means of Mermaid 3D Code and the magnetic measurements of the representative dipoles confirmed these magnetic calculations, and it allows us to get the main dependencies of the magnetic parameters of all dipoles from the mechanical characteristics (pole gap, yoke width, coil position). The criteria of optimization were conditions of weak influence of the insertion device on electron beam in the Storage Ring and high quality of undulator radiation. The 1st integral of the magnetic field and phase error have been minimized for sorting of the dipoles in undulators. The limitation of sorting connected with accuracy of mechanical measurements of individual dipoles is discussed.

  15. Metabolic aspects of growth in HU-treated crown-gall tissue cultures. II. Helianthus annuus

    Directory of Open Access Journals (Sweden)

    Aldona Rennert

    2015-01-01

    Full Text Available The dynamics of growth and changes in nucleic acid and protein contents in sunflower calluses and tumours cultured in hydroxyurea (HU containing media were examined. HU-induced changes in healthy tissues ran in parallel always in the same direction, in tumourous ones however an uncoupling between DNA synthesis and tissue growth on one hand and RNA and protein synthesis on the other took place. A detailed analysis of the results allows to suppose that the specific activity of HU on tumourous tissue could be an index of: 1 quantitative disturbances in its genes function (2 degree of the lass of sensitivity to the factors of regulation.

  16. Zebrafish transgenic line huORFZ is an effective living bioindicator for detecting environmental toxicants.

    Directory of Open Access Journals (Sweden)

    Hung-Chieh Lee

    Full Text Available Reliable animal models are invaluable for monitoring the extent of pollution in the aquatic environment. In this study, we demonstrated the potential of huORFZ, a novel transgenic zebrafish line that harbors a human upstream open reading frame of the chop gene fused with GFP reporter, as an animal model for monitoring environmental pollutants and stress-related cellular processes. When huORFZ embryos were kept under normal condition, no leaked GFP signal could be detected. When treated with hazardous chemicals, including heavy metals and endocrine-disrupting chemicals near their sublethal concentrations (LC50, huORFZ embryos exhibited different tissue-specific GFP expression patterns. For further analysis, copper (Cu2+, cadmium (Cd2+ and Chlorpyrifos were applied. Cu2+ triggered GFP responses in skin and muscle, whereas Cd2+ treatment triggered GFP responses in skin, olfactory epithelium and pronephric ducts. Moreover, fluorescence intensity, as exhibited by huORFZ embryos, was dose-dependent. After surviving treated embryos were returned to normal condition, survival rates, as well as TUNEL signals, returned to pretreatment levels with no significant morphological defects observed. Such results indicated the reversibility of treatment conditions used in this study, as long as embryos survived such conditions. Notably, GFP signals decreased along with recovery, suggesting that GFP signaling of huORFZ embryos likely reflected the overall physiological condition of the individual. To examine the performance of the huORFZ line under real-world conditions, we placed huORFZ embryos in different river water samples. We found that the huORFZ embryos correctly detected the presence of various kinds of pollutants. Based on these findings, we concluded that such uORFchop-based system can be integrated into a first-line water alarm system monitoring the discharge of hazardous pollutants.

  17. The HuRef Browser: a web resource for individual human genomics.

    Science.gov (United States)

    Axelrod, Nelson; Lin, Yuan; Ng, Pauline C; Stockwell, Timothy B; Crabtree, Jonathan; Huang, Jiaqi; Kirkness, Ewen; Strausberg, Robert L; Frazier, Marvin E; Venter, J Craig; Kravitz, Saul; Levy, Samuel

    2009-01-01

    The HuRef Genome Browser is a web application for the navigation and analysis of the previously published genome of a human individual, termed HuRef. The browser provides a comparative view between the NCBI human reference sequence and the HuRef assembly, and it enables the navigation of the HuRef genome in the context of HuRef, NCBI and Ensembl annotations. Single nucleotide polymorphisms, indels, inversions, structural and copy-number variations are shown in the context of existing functional annotations on either genome in the comparative view. Demonstrated here are some potential uses of the browser to enable a better understanding of individual human genetic variation. The browser provides full access to the underlying reads with sequence and quality information, the genome assembly and the evidence supporting the identification of DNA polymorphisms. The HuRef Browser is a unique and versatile tool for browsing genome assemblies and studying individual human sequence variation in a diploid context. The browser is available online at http://huref.jcvi.org.

  18. Pertussis toxin B-oligomer inhibits HIV infection and replication in hu-PBL-SCID mice.

    Science.gov (United States)

    Lapenta, Caterina; Spada, Massimo; Santini, Stefano M; Racca, Sara; Dorigatti, Fernanda; Poli, Guido; Belardelli, Filippo; Alfano, Massimo

    2005-04-01

    Bordetella pertussis toxin B-oligomer (PTX-B) has been shown to inhibit HIV infection and replication in vitro. The potential anti-viral effect of PTX-B was tested here in an in vivo surrogate model of HIV infection, i.e. SCID mice reconstituted with human peripheral blood leukocytes (PBL) (hu-PBL-SCID) and infected with a CCR5-dependent (R5) HIV-1 strain. SCID mice inoculated intra-peritoneal (i.p.) with PTX-B and then infected with the R5 strain SF-162 were sacrificed 7 days later and analyzed for human PBL (hu-PBL) lymphoid tissue reconstitution, infection of hu-PBL, plasma viremia and viral rescue from ex vivo-cultivated i.p. hu-PBL. Unlike mice treated with 500 ng per animal of PTX-B showing no evidence of viral inhibition, daily administration of PTX-B (50 ng per mouse) strongly inhibited virus infection and replication, as determined by undetectable viremia, absence of infected hu-PBL and lack of rescue of infectious HIV in most animals. Furthermore, PTX-B injection 2 h before and twice after infection prevented HIV-1 infection and replication in all (10/10) tested animals. Thus, PTX-B potently inhibited virus infection and replication in hu-PBL-SCID mice, supporting the hypothesis that it may represent a new pharmacological agent against HIV-1 infection.

  19. Functional characterization of the HuR:CD83 mRNA interaction.

    Directory of Open Access Journals (Sweden)

    Dorothea Pieper

    Full Text Available Maturation of dendritic cells (DC is characterized by expression of CD83, a surface protein that appears to be necessary for the effective activation of naïve T-cells and T-helper cells by DC. Lately it was shown that CD83 expression is regulated on the posttranscriptional level by interaction of the shuttle protein HuR with a novel posttranscriptional regulatory RNA element (PRE, which is located in the coding region of the CD83 transcript. Interestingly, this interaction commits the CD83 mRNA to efficient nuclear export via the CRM1 pathway. To date, however, the structural basis of this interaction, which potentially involves three distinct RNA recognition motifs (RRM1-3 in HuR and a complex three-pronged RNA stem-loop element in CD83 mRNA, has not been investigated in detail. In the present work we analyzed this interaction in vitro and in vivo using various HuR- and CD83 mRNA mutants. We are able to demonstrate that both, RRM1 and RRM2 are crucial for binding, whereas RRM3 as well as the HuR hinge region contributed only marginally to this protein:RNA interaction. Furthermore, mutation of uridine rich patches within the PRE did not disturb HuR:CD83 mRNA complex formation while, in contrast, the deletion of specific PRE subfragments from the CD83 mRNA prevented HuR binding in vitro and in vivo. Interestingly, the observed inhibition of HuR binding to CD83 mRNA does not lead to a nuclear trapping of the transcript but rather redirected this transcript from the CRM1- towards the NXF1/TAP-specific nuclear export pathway. Thus, the presence of a functional PRE permits nucleocytoplasmic trafficking of the CD83 transcript via the CRM1 pathway.

  20. Estudo da anomalia de Pelger-Huët em núcleo familiar Pelger-Huët anomaly study in a family

    Directory of Open Access Journals (Sweden)

    Patrícia H. O. Calderan

    2008-02-01

    Full Text Available The Pelger-Huët anomaly is a dominant autosomal disease, characterized by the incomplete segmentation of the granulocytes nucleus without lost of the cellular function. The heterozygotes form of this anomaly is assintomatic and it did not possess physic meant, while the homozygote form is rare and can be lethal, being therefore, important differentiates of other infectious alterations. The pseudo-anomaly can occasionally be observed in cases of granulocitic leukemia, mieloproliferatives Diseases, some infections and after exposition the determined drugs. We evaluate eleven members of a familiar nucleus and, after the blood cells analysis, six of then had presented neutrophils and eosinophils with nuclei characteristic of the heterozygotes form of the Pelger-Huët anomaly. The recognition of this leukocyte anomaly, mainly in patients without infection and presenting great number of not segmented neutrophils, can prevent wrong interpretations of the blood cells count and unnecessary clinical and therapeutically behaviors.

  1. Lamin B-receptor mutations in Pelger-Huët anomaly.

    Science.gov (United States)

    Best, Steve; Salvati, Filippo; Kallo, Juraj; Garner, Chad; Height, Sue; Thein, Swee Lay; Rees, David C

    2003-11-01

    Pelger-Huët anomaly is an inherited abnormality of neutrophils, characterized by reduced nuclear segmentation and an apparently looser chromatin structure. Following linkage studies in two families, the lamin B-receptor (LBR) was sequenced and mutations found: CCG-->CTG causing proline-->leucine in codon 119 of exon 3, and IVS11-9 A-->G, disrupting the splice acceptor site. The LBR gene (LBR) was also sequenced from a single English man with Pelger-Huët anomaly and a heterozygous C-->G mutation was found in codon 569 of exon 14, predicted to cause a proline-->arginine. Our results confirm recently published findings that LBR mutations cause Pelger-Huët.

  2. Targeting the mRNA-binding protein HuR impairs malignant characteristics of pancreatic ductal adenocarcinoma cells

    Science.gov (United States)

    Jimbo, Masaya; Blanco, Fernando F.; Screnci, Brad A.; Cosma, Gabriela L.; Alexeev, Vitali; Gonye, Gregory E.; Yeo, Charles J.; Sawicki, Janet A.; Winter, Jordan M.; Brody, Jonathan R.

    2015-01-01

    Post-transcriptional regulation is a powerful mediator of gene expression, and can rapidly alter the expression of numerous transcripts involved in tumorigenesis. We have previously shown that the mRNA-binding protein HuR (ELAVL1) is elevated in human pancreatic ductal adenocarcinoma (PDA) specimens compared to normal pancreatic tissues, and its cytoplasmic localization is associated with increased tumor stage. To gain a better insight into HuR’s role in PDA biology and to assess it as a candidate therapeutic target, we altered HuR expression in PDA cell lines and characterized the resulting phenotype in preclinical models. HuR silencing by short hairpin and small interfering RNAs significantly decreased cell proliferation and anchorage-independent growth, as well as impaired migration and invasion. In comparison, HuR overexpression increased migration and invasion, but had no significant effects on cell proliferation and anchorage-independent growth. Importantly, two distinct targeted approaches to HuR silencing showed marked impairment in tumor growth in mouse xenografts. NanoString nCounter® analyses demonstrated that HuR regulates core biological processes, highlighting that HuR inhibition likely thwarts PDA viability through post-transcriptional regulation of diverse signaling pathways (e.g. cell cycle, apoptosis, DNA repair). Taken together, our study suggests that targeted inhibition of HuR may be a novel, promising approach to the treatment of PDA. PMID:26314962

  3. First International Workshop on Human Factors in Modeling (HuFaMo 2015)

    DEFF Research Database (Denmark)

    Störrle, Harald; Chaudron, Michel R. V.; Amaral, Vasco

    2015-01-01

    Modeling is a human-intensive enterprise. As such, many research questions related to modeling can only be answered by empirical studies employing human factors. The International Workshop Series on Human Factors in Modeling (HuFaMo) is dedicated to the discussion of empirical research involving......, the workshop organizers explicitly encouraged researchers new to empirical methods to discuss study designs before conducting their empirical evaluations. The rationale was to create a constructive environment where the HuFaMo participants could contribute to improving the proposed study designs so...

  4. [Kultuurkapitali 2006. aasta I jaotus : tõlkestipendiumiprogrammi "Traducta" eraldused

    Index Scriptorium Estoniae

    2006-01-01

    Irja Dittmann-Grönholm - Eesti kirjanduse antoloogia sarja "Estnische Bibliothek" tõlkimine saksa keelde; Maima Grinberga-Preisa - Sass Henno raamatu "Mina olin siin" 1. osa tõlkimine läti keelde; Nadezhda Ptshelovodova - Marie Underi "Tähetund" ja Juhan Liivi "Sinuga ja sinuta" luulekogude tõlkimine udmurdi keelde; Monika Segesdi - Andrus Kivirähki raamatu "Sirli, Siim ja saladused" tõlkimine ungari keelde

  5. Supercoiling and denaturation in Gal repressor/heat unstable nucleoid protein (HU)-mediated DNA looping

    Science.gov (United States)

    Lia, Giuseppe; Bensimon, David; Croquette, Vincent; Allemand, Jean-Francois; Dunlap, David; Lewis, Dale E. A.; Adhya, Sankar; Finzi, Laura

    2003-09-01

    The overall topology of DNA profoundly influences the regulation of transcription and is determined by DNA flexibility as well as the binding of proteins that induce DNA torsion, distortion, and/or looping. Gal repressor (GalR) is thought to repress transcription from the two promoters of the gal operon of Escherichia coli by forming a DNA loop of 40 nm of DNA that encompasses the promoters. Associated evidence of a topological regulatory mechanism of the transcription repression is the requirement for a supercoiled DNA template and the histone-like heat unstable nucleoid protein (HU). By using single-molecule manipulations to generate and finely tune tension in DNA molecules, we directly detected GalR/HU-mediated DNA looping and characterized its kinetics, thermodynamics, and supercoiling dependence. The factors required for gal DNA looping in single-molecule experiments (HU, GalR and DNA supercoiling) correspond exactly to those necessary for gal repression observed both in vitro and in vivo. Our single-molecule experiments revealed that negatively supercoiled DNA, under slight tension, denatured to facilitate GalR/HU-mediated DNA loop formation. Such topological intermediates may operate similarly in other multiprotein complexes of transcription, replication, and recombination.

  6. The outcome of PIE *#Hi- and *#Hu- in Germanic

    DEFF Research Database (Denmark)

    Hansen, Bjarne Simmelkjær Sandgaard

    2015-01-01

    It has been established with a great amount of certainty that PIE *#Hu- > Gr. #Vὐ- and that PIE *#Hi- > Gr. #ἰ-. It still remains to be demonstrated what happens in other Western Indo-European branches, including Germanic. In this article , I reject the statement by Ringe (1988: 433) that PIE *#H...

  7. Rare Association of Anti-Hu Antibody Positive Paraneoplastic Neurological Syndrome and Transitional Cell Bladder Carcinoma

    Directory of Open Access Journals (Sweden)

    S. Lukacs

    2012-01-01

    Full Text Available Introduction. Paraneoplastic encephalomyelitis (PEM and subacute sensory neuronopathy (SSN are remote effects of cancer, usually associated with small-cell lung carcinoma and positive anti-Hu antibody. We describe the rare association of bladder transitional cell carcinoma (TCC with anti-Hu antibody positivity resulting in this paraneoplastic neurological syndrome. Patient. A 76-year-old female presented with bilateral muscle weakness and paraesthesia of the upper and lower limbs in a length-dependent “glove and stocking” distribution. Central nervous system symptoms included cognitive problems, personality change, and truncal ataxia. Case notes and the literature were reviewed. Result. Autoantibody screening was positive for anti-Hu antibody (recently renamed antineuronal nuclear antibody 1, ANNA-1. The diagnosis of PEM and SSN was supported by MRI and lumbar puncture results. A superficial bladder TCC was demonstrated on CT and subsequently confirmed on histology. No other primary neoplasm was found on full-body imaging. The neurological symptoms were considered to be an antibody-mediated paraneoplastic neurological syndrome and improved after resection of the tumour. Discussion. The association of anti-Hu positive paraneoplastic neurological syndrome and TCC has not been described in the literature previously. We emphasize the need for detailed clinical examination and the importance of a multidisciplinary thought process and encourage further awareness of this rare association.

  8. Optical Monitoring of OT 546 in 2009 Difu Guo , Shaoming Hu & Xu ...

    Indian Academy of Sciences (India)

    Shaoming Hu & Xu Chen. School of Space Science and Physics, Shandong University Weihai,. 180 Cultural West Road, Weihai, Shandong 264209, China. ∗ e-mail: difu@sdu.edu.cn. Abstract. We reported the monitoring results of OT 546 in V, R and I bands, observed on 22 nights from February 16 to July 1 in 2009 at ...

  9. Variability of OI 090.4 ShaoMing Hu , Xu Chen & DiFu Guo

    Indian Academy of Sciences (India)

    2009-12-20

    Dec 20, 2009 ... ShaoMing Hu. ∗. , Xu Chen & DiFu Guo. School of Space Science and Physics, Shandong University, Weihai,. 180 Cultural West Road, Shandong 264209, China. ∗ e-mail: husm@sdu.edu.cn. Abstract. OI 090.4 was monitored on 21 nights from 2006 to 2012 for studying the variability. Strong variations ...

  10. NEDDylation in liver cancer: The regulation of the RNA binding protein Hu antigen R.

    Science.gov (United States)

    Fernández-Ramos, David; Martínez-Chantar, María L

    2015-07-01

    Hepatocellular carcinoma (HCC) is the fifth most common cancer worldwide and the third leading cause of cancer death. The current view of cancer progression and malignancy supports the notion that cancer cells must undergo through a post-translational modification (PTM) regulation and a metabolic switch or reprogramming in order to progress in an unfriendly environment. NEDDylation is a post-translational modification of the proteins involved in several processes such as cell growth, viability and development. A ground-breaking knowledge on a new critical aspect of HCC research has been to identify that NEDDylation plays a role in HCC by regulating the liver oncogenic driver Hu antigen R (HuR). HuR is a RNA-binding protein that stabilizes target mRNAs involved in cell dedifferentiation, proliferation, and survival, all well-established hallmarks of cancer. And importantly, HuR levels were found to be highly representative in liver and colon cancer. These findings open a completely new area of research, exploring the impact that NEDDylation plays in liver diseases and paving the way for novel therapeutical approaches. Copyright © 2015 IAP and EPC. Published by Elsevier B.V. All rights reserved.

  11. The herbal mixture Xiao-Chai-Hu Tang (XCHT) induces apoptosis of ...

    African Journals Online (AJOL)

    The herbal mixture Xiao-Chai-Hu Tang (XCHT) induces apoptosis of human hepatocellular carcinoma huh7 cells in vitro and in vivo. ... To identify a potential mechanism of action, the gene and protein expression levels of Bax, Bcl-2, CDK4 and cyclin-D1 were measured in XCHT-treated Huh7 cells. Results: We found that ...

  12. DNA condensation by TmHU studied by optical tweezers, AFM and molecular dynamics simulations

    Science.gov (United States)

    Olbrich, Carsten; Brutzer, Hergen; Salomo, Mathias; Kleinekathöfer, Ulrich; Keyser, Ulrich F.; Kremer, Friedrich

    2010-01-01

    The compaction of DNA by the HU protein from Thermotoga maritima (TmHU) is analysed on a single-molecule level by the usage of an optical tweezers-assisted force clamp. The condensation reaction is investigated at forces between 2 and 40 pN applied to the ends of the DNA as well as in dependence on the TmHU concentration. At 2 and 5 pN, the DNA compaction down to 30% of the initial end-to-end distance takes place in two regimes. Increasing the force changes the progression of the reaction until almost nothing is observed at 40 pN. Based on the results of steered molecular dynamics simulations, the first regime of the length reduction is assigned to a primary level of DNA compaction by TmHU. The second one is supposed to correspond to the formation of higher levels of structural organisation. These findings are supported by results obtained by atomic force microscopy. PMID:22210966

  13. Pathogenesis of primary R5 human immunodeficiency virus type 1 clones in SCID-hu mice

    NARCIS (Netherlands)

    Scoggins, R. M.; Taylor, J. R.; Patrie, J.; van't Wout, A. B.; Schuitemaker, H.; Camerini, D.

    2000-01-01

    We studied the replication and cytopathicity in SCID-hu mice of R5 human immunodeficiency virus type 1 (HIV-1) biological clones from early and late stages of infection of three patients who never developed MT-2 cell syncytium-inducing (SI; R5X4 or X4) viruses. Several of the late-stage non-MT-2

  14. The HU regulon is composed of genes responding to anaerobiosis, acid stress, high osmolarity and SOS induction.

    Directory of Open Access Journals (Sweden)

    Jacques Oberto

    Full Text Available BACKGROUND: The Escherichia coli heterodimeric HU protein is a small DNA-bending protein associated with the bacterial nucleoid. It can introduce negative supercoils into closed circular DNA in the presence of topoisomerase I. Cells lacking HU grow very poorly and display many phenotypes. METHODOLOGY/PRINCIPAL FINDINGS: We analyzed the transcription profile of every Escherichia coli gene in the absence of one or both HU subunits. This genome-wide in silico transcriptomic approach, performed in parallel with in vivo genetic experimentation, defined the HU regulon. This large regulon, which comprises 8% of the genome, is composed of four biologically relevant gene classes whose regulation responds to anaerobiosis, acid stress, high osmolarity, and SOS induction. CONCLUSIONS/SIGNIFICANCE: The regulation a large number of genes encoding enzymes involved in energy metabolism and catabolism pathways by HU explains the highly pleiotropic phenotype of HU-deficient cells. The uniform chromosomal distribution of the many operons regulated by HU strongly suggests that the transcriptional and nucleoid architectural functions of HU constitute two aspects of a unique protein-DNA interaction mechanism.

  15. Immunostimulatory effects of natural human interferon-alpha (huIFN-alpha) on carps Cyprinus carpio L.

    Science.gov (United States)

    Watanuki, Hironobu; Chakraborty, Gunimala; Korenaga, Hiroki; Kono, Tomoya; Shivappa, R B; Sakai, Masahiro

    2009-10-15

    Human interferon-alpha (huIFN-alpha) is an important immunomodulatory substance used in the treatment and prevention of numerous infectious and immune-related diseases in animals. However, the immunostimulatory effects of huIFN-alpha in fish remain to be investigated. In the current study, the immune responses of the carp species Cyprinus carpio L. to treatment with huIFN-alpha were analyzed via measurement of superoxide anion production, phagocytic activity and the expression of cytokine genes including interleukin-1beta, tumor necrosis factor-alpha and interleukin 10. Low doses of huIFN-alpha were administered orally once a day for 3 days, and sampling was carried out at 1, 3 and 5 days post-treatment. Our results indicate that a low dose of huIFN-alpha significantly increased phagocytic activity and superoxide anion production in the carp kidney. The huIFN-alpha-treated fish also displayed a significant upregulation in cytokine gene expression. The current study demonstrates the stimulatory effects of huIFN-alpha on the carp immune system and highlights the immunomodulatory role of huIFN-alpha in fish.

  16. Drug Transporter Expression and Activity in Human Hepatoma HuH-7 Cells

    Directory of Open Access Journals (Sweden)

    Elodie Jouan

    2016-12-01

    Full Text Available Human hepatoma cells may represent a valuable alternative to the use of human hepatocytes for studying hepatic drug transporters, which is now a regulatory issue during drug development. In the present work, we have characterized hepatic drug transporter expression, activity and regulation in human hepatoma HuH-7 cells, in order to determine the potential relevance of these cells for drug transport assays. HuH-7 cells displayed notable multidrug resistance-associated protein (MRP activity, presumed to reflect expression of various hepatic MRPs, including MRP2. By contrast, they failed to display functional activities of the uptake transporters sodium taurocholate co-transporting polypeptide (NTCP, organic anion-transporting polypeptides (OATPs and organic cation transporter 1 (OCT1, and of the canalicular transporters P-glycoprotein and breast cancer resistance protein (BCRP. Concomitantly, mRNA expressions of various sinusoidal and canalicular hepatic drug transporters were not detected (NTCP, OATP1B1, organic anion transporter 2 (OAT2, OCT1 and bile salt export pump or were found to be lower (OATP1B3, OATP2B1, multidrug and toxin extrusion protein 1, BCRP and MRP3 in hepatoma HuH-7 cells than those found in human hepatocytes, whereas other transporters such as OAT7, MRP4 and MRP5 were up-regulated. HuH-7 cells additionally exhibited farnesoid X receptor (FXR- and nuclear factor erythroid 2-related factor 2 (Nrf2-related up-regulation of some transporters. Such data indicate that HuH-7 cells, although expressing rather poorly some main hepatic drug transporters, may be useful for investigating interactions of drugs with MRPs, notably MRP2, and for studying FXR- or Nrf2-mediated gene regulation.

  17. dNTP deficiency induced by HU via inhibiting ribonucleotide reductase affects neural tube development.

    Science.gov (United States)

    Guan, Zhen; Wang, Xiuwei; Dong, Yanting; Xu, Lin; Zhu, Zhiqiang; Wang, Jianhua; Zhang, Ting; Niu, Bo

    2015-02-03

    Exposure to environmental toxic chemicals in utero during the neural tube development period can cause developmental disorders. To evaluate the disruption of neural tube development programming, the murine neural tube defects (NTDs) model was induced by interrupting folate metabolism using methotrexate in our previous study. The present study aimed to examine the effects of dNTP deficiency induced by hydroxyurea (HU), a specific ribonucleotide reductase (RNR) inhibitor, during murine neural tube development. Pregnant C57BL/6J mice were intraperitoneally injected with various doses of HU on gestation day (GD) 7.5, and the embryos were checked on GD 11.5. RNR activity and deoxynucleoside triphosphate (dNTP) levels were measured in the optimal dose. Additionally, DNA damage was examined by comet analysis and terminal deoxynucleotidyl transferase mediated dUTP nick end-labeling (TUNEL) assay. Cellular behaviors in NTDs embryos were evaluated with phosphorylation of histone H3 (PH-3) and caspase-3 using immunohistochemistry and western blot analysis. The results showed that NTDs were observed mostly with HU treatment at an optimal dose of 225 mg/kg b/w. RNR activity was inhibited and dNTP levels were decreased in HU-treated embryos with NTDs. Additionally, increased DNA damage, decreased proliferation, and increased caspase-3 were significant in NTDs embryos compared to the controls. Results indicated that HU induced murine NTDs model by disturbing dNTP metabolism and further led to the abnormal cell balance between proliferation and apoptosis. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

  18. Redox behaviors of the neurotoxic portion in human prion protein, HuPrP(106-126)

    Science.gov (United States)

    Yamamoto, Norifumi; Kuwata, Kazuo

    2010-09-01

    A peptide fragment of human prion protein, HuPrP(106-126), has been reported to mimic the pathological features underlying prion diseases. Although the actual neurotoxic mechanism of HuPrP(106-126) has not been elucidated, several hypotheses has been proposed based on the role for copper. In this study, to understand the toxic function of HuPrP(106-126) from a viewpoint of electrochemical competence, we investigated redox properties of copper ion complexes with four different binding motifs of a model of HuPrP(106-126) based on density functional theory calculations. We found that the HuPrP(106-126)-derived models exhibited diverse redox activities that depended on copper-binding conformations.

  19. Transcriptomic-Wide Discovery of Direct and Indirect HuR RNA Targets in Activated CD4+ T Cells.

    Directory of Open Access Journals (Sweden)

    Patsharaporn Techasintana

    Full Text Available Due to poor correlation between steady state mRNA levels and protein product, purely transcriptomic profiling methods may miss genes posttranscriptionally regulated by RNA binding proteins (RBPs and microRNAs (miRNAs. RNA immunoprecipitation (RIP methods developed to identify in vivo targets of RBPs have greatly elucidated those mRNAs which may be regulated via transcript stability and translation. The RBP HuR (ELAVL1 and family members are major stabilizers of mRNA. Many labs have identified HuR mRNA targets; however, many of these analyses have been performed in cell lines and oftentimes are not independent biological replicates. Little is known about how HuR target mRNAs behave in conditional knock-out models. In the present work, we performed HuR RIP-Seq and RNA-Seq to investigate HuR direct and indirect targets using a novel conditional knock-out model of HuR genetic ablation during CD4+ T activation and Th2 differentiation. Using independent biological replicates, we generated a high coverage RIP-Seq data set (>160 million reads that was analyzed using bioinformatics methods specifically designed to find direct mRNA targets in RIP-Seq data. Simultaneously, another set of independent biological replicates were sequenced by RNA-Seq (>425 million reads to identify indirect HuR targets. These direct and indirect targets were combined to determine canonical pathways in CD4+ T cell activation and differentiation for which HuR plays an important role. We show that HuR may regulate genes in multiple canonical pathways involved in T cell activation especially the CD28 family signaling pathway. These data provide insights into potential HuR-regulated genes during T cell activation and immune mechanisms.

  20. WE-AB-202-06: Correlating Lung CT HU with Transformation-Based and Xe-CT Derived Ventilation

    Energy Technology Data Exchange (ETDEWEB)

    Du, K; Patton, T; Bayouth, J [University of Wisconsin, Madison, WI (United States); Reinhardt, J; Christensen, G [The University of Iowa, Iowa City, IA (United States)

    2016-06-15

    Purpose: Regional lung ventilation is useful to reduce radiation-induced function damage during lung cancer radiation therapy. Recently a new direct HU (Hounsfield unit)-based method was proposed to estimate the ventilation potential without image registration. The purpose of this study is to examine if there is a functional dependence between HU values and transformation-based or Xe-CT derived ventilation. Methods: 4DCT images acquired from 13 patients prior to radiation therapy and 4 mechanically ventilated sheep subjects which also have associated Xe-CT images were used for this analysis. Transformation-based ventilation was computed using Jacobian determinant of the transformation field between peak-exhale and peak-inhale 4DCT images. Both transformation and Xe-CT derived ventilation was computed for each HU bin. Color scatter plot and cumulative histogram were used to compare and validate the direct HU-based method. Results: There was little change of the center and shape of the HU histograms between free breathing CT and 4DCT average, with or without smoothing, and between the repeated 4DCT scans. HU of −750 and −630 were found to have the greatest transformation-based ventilation for human and sheep subjects, respectively. Maximum Xe-CT derived ventilation was found to locate at HU of −600 in sheep subjects. The curve between Xe-CT ventilation and HU was noisy for tissue above HU −400, possibly due to less intensity change of Xe gas during wash-out and wash-in phases. Conclusion: Both transformation-based and Xe-CT ventilation demonstrated that lung tissues with HU values in the range of (-750, −600) HU have the maximum ventilation potential. The correlation between HU and ventilation suggests that HU might be used to help guide the ventilation calculation and make it more robust to noise and image registration errors. Research support from NIH grants CA166703 and CA166119 and a gift from Roger Koch.

  1. Interaction of RNA-binding protein HuR and miR-466i regulates GM-CSF expression.

    Science.gov (United States)

    Chen, Jing; Adamiak, William; Huang, Ganlei; Atasoy, Ulus; Rostami, Abdolmohamad; Yu, Shiguang

    2017-12-08

    Granulocyte-macrophage colony-stimulating factor (GM-CSF) produced by T helper 17 (Th17) cells plays an essential role in autoimmune diseases. Transcriptional regulation of Th17 cell differentiation has been extensively studied, but post-transcriptional regulation of Th17 cell differentiation has remained less well characterized. The RNA-binding protein HuR functions to promote the stability of target mRNAs via binding the AU-rich elements of the 3' untranslated region (3'UTR) of numerous pro-inflammatory cytokines including IL-4, IL-13, IL-17 and TNF-α. However, whether HuR regulates GM-CSF expression in Th17 cells has not been fully investigated. Here we showed that HuR conditional knockout (KO) Th17 cells have decreased GM-CSF mRNA in comparison with wild-type (WT) Th17 cells, and that HuR binds directly to GM-CSF mRNA 3'UTR. Interestingly, HuR deficiency increased the levels of certain microRNA expression in Th17 cells; for example, miR-466i functioned to mediate GM-CSF and IL-17 mRNA decay, which was confirmed by in vitro luciferase assay. Furthermore, we found that HuR promoted Mxi1 expression to inhibit certain miRNA expression. Taken together, these findings indicate that interaction of HuR and miR-466i orchestrates GM-CSF expression in Th17 cells.

  2. SU-E-T-470: Importance of HU-Mass Density Calibration Technique in Proton Pencil Beam Dose Calculation

    Energy Technology Data Exchange (ETDEWEB)

    Penfold, S; Miller, A [University of Adelaide, Adelaide, SA (Australia)

    2015-06-15

    Purpose: Stoichiometric calibration of Hounsfield Units (HUs) for conversion to proton relative stopping powers (RStPs) is vital for accurate dose calculation in proton therapy. However proton dose distributions are not only dependent on RStP, but also on relative scattering power (RScP) of patient tissues. RScP is approximated from material density but a stoichiometric calibration of HU-density tables is commonly neglected. The purpose of this work was to quantify the difference in calculated dose of a commercial TPS when using HU-density tables based on tissue substitute materials and stoichiometric calibrated ICRU tissues. Methods: Two HU-density calibration tables were generated based on scans of the CIRS electron density phantom. The first table was based directly on measured HU and manufacturer quoted density of tissue substitute materials. The second was based on the same CT scan of the CIRS phantom followed by a stoichiometric calibration of ICRU44 tissue materials. The research version of Pinnacle{sup 3} proton therapy was used to compute dose in a patient CT data set utilizing both HU-density tables. Results: The two HU-density tables showed significant differences for bone tissues; the difference increasing with increasing HU. Differences in density calibration table translated to a difference in calculated RScP of −2.5% for ICRU skeletal muscle and 9.2% for ICRU femur. Dose-volume histogram analysis of a parallel opposed proton therapy prostate plan showed that the difference in calculated dose was negligible when using the two different HU-density calibration tables. Conclusion: The impact of HU-density calibration technique on proton therapy dose calculation was assessed. While differences were found in the calculated RScP of bony tissues, the difference in dose distribution for realistic treatment scenarios was found to be insignificant.

  3. España una, grande y huérfana

    OpenAIRE

    Souto, Luz Celestina

    2014-01-01

    En este trabajo me referiré a los huérfanos fantasmas que hunden sus raíces en lo gótico de la cultura española pero que lo resignifican otorgándole un sentido político a la orfandad. A la tragedia que conlleva toda muerte, a la separación ya de por sí traumática de padres e hijos se anexa la vinculación de un Estado que se representa a ojos de los narradores como demoniaco. A algunos de estos huérfanos les tocó ser educados al margen del sistema, en asilos del Auxilio Social o en orfanatos a...

  4. Metabolic aspects of growth in HU-treated crown-gall tissue cultures. I. Nicotiana tabacum

    Directory of Open Access Journals (Sweden)

    Aldona Rennert

    2015-01-01

    Full Text Available An influence of hydroxyurea (HU on the growth, DNA and RNA contents and protein synthesis in the tobacco tumour tissue culture was studied in comparison with a homologous callus tissue. In conformity with expectations considerable decrease of DNA level in both tissues is a primary effect of HU activity. This results in the growth inhibition and in the secondary metabolic effects; these effects depend not only on the concentration of inhibitor but also on the age of tissue. In spite of some common features the character of these changes shows a distinct differentiation depending on the tissue type. TMs points to specific modifications of the biochemical regulation of growth in a tumour.

  5. Islet xenograft destruction in the hu-PBL-severe combined immunodeficient (SCID) mouse necessitates anti-CD3 preactivation of human immune cells

    Science.gov (United States)

    Gysemans, C; Waer, M; Laureys, J; Depovere, J; Pipeleers, D; Bouillon, R; Mathieu, C

    2000-01-01

    Introduction of the hu-PBL-SCID mouse model has yielded a potentially useful tool for research in transplantation. The aim of this study was to define the conditions necessary for a reconstituted human immune system to destroy in a consistent manner rat islet xenografts in the alloxan-diabetic hu-PBL-SCID mouse. We examined different time points of hu-PBL reconstitution, different transplantation sites of the islets and several hu-PBL reconstitution protocols. Major differences in graft destruction were observed between the different hu-PBL reconstitution protocols, irrespective of timing of hu-PBL reconstitution or site of transplantation. Although preactivation of hu-PBL did not improve the level of hu-PBL chimerism, histological and immunohistochemical analysis of the grafts revealed a severe human lymphocytic infiltration and β cell destruction only in the grafts of mice receiving preactivated hu-PBL. This β cell injury resulted in impaired glucose tolerance, with in some animals recurrence of hyperglycaemia, and decreased insulin and C-peptide levels after glucose stimulation. Therefore, we conclude that activation of hu-PBL prior to transfer is essential in achieving xenograft infiltration and destruction in hu-PBL-SCID mice. The need for immune manipulation suggests that interactions between hu-PBL and xenografts in this model may be hampered by incompatibilities in cross-species adhesion and/or activation signals. PMID:10971525

  6. Identification of a Calcium Signalling Pathway of S-[6]-Gingerol in HuH-7 Cells

    Directory of Open Access Journals (Sweden)

    Xiao-Hong Li

    2013-01-01

    Full Text Available Calcium signals in hepatocytes control cell growth, proliferation, and death. Members of the transient receptor potential (TRP cation channel superfamily are candidate calcium influx channels. NFκB activation strictly depends on calcium influx and often induces antiapoptotic genes favouring cell survival. Previously, we reported that S-[6]-gingerol is an efficacious agonist of the transient receptor potential cation channel subfamily V member 1 (TRPV1 in neurones. In this study, we tested the effect of S-[6]-gingerol on HuH-7 cells using the Fluo-4 calcium assay, RT-qPCR, transient cell transfection, and luciferase measurements. We found that S-[6]-gingerol induced a transient rise in [Ca2+]i in HuH-7 cells. The increase in [Ca2+]i induced by S-[6]-gingerol was abolished by preincubation with EGTA and was also inhibited by the TRPV1 channel antagonist capsazepine. Expression of TRPV1 in HuH-7 cells was confirmed by mRNA analysis as well as a test for increase of [Ca2+]i by TRPV1 agonist capsaicin and its inhibition by capsazepine. We found that S-[6]-gingerol induced rapid NFκB activation through TRPV1 in HuH-7 cells. Furthermore, S-[6]-gingerol-induced NFκB activation was dependent on the calcium gradient and TRPV1. The rapid NFκB activation by S-[6]-gingerol was associated with an increase in mRNA levels of NFκB-target genes: cIAP-2, XIAP, and Bcl-2 that encode antiapoptotic proteins.

  7. Effects of animal class and genotype on beef muscle nanostructure, pHu, colour and tenderness

    Directory of Open Access Journals (Sweden)

    Amanda Y. Chulayo

    2016-07-01

    Full Text Available The objective of the study was to determine the effects of animal class and genotype of cattle on Muscularis longissimus thoracis et lumborum (LTL nanostructure, ultimate pH (pHu, colour and tenderness of beef. We found significant positive relationships between distance travelled (DT and meat temperature (Tm (p"less than"0.01; lairage duration (LDhr and lightness of colour (L* (p"less than"0.01; ambient temperature (Ta and L* (p"less than"0.05 and LDhr and yellowness (b* (p"less than"0.05 of beef from Bonsmara cattle. Positive linear relationships were observed between DT and Tm (p"less than"0.05 and DT and L* (p"less than"0.01 of the non-descript cattle. There were no significant relationships between pre-slaughter stress and other beef quality parameters (pHu, Warner– Bratzler shear force [WBSF], redness [a*] and b* of Bonsmara, Nguni and non-descript cattle. Muscle fibres differed among class and genotype and had an effect on meat quality. The Bonsmara, non-descript and Nguni cows and heifers had visible skeletal muscle fibres which were thin and long, promising improved tenderness of beef. Genotype and class had significant effects on meat quality parameters (Tm, pHu, L*, a*, b* and WBSF. The first important principal components as they appeared from the analysis were pHu, Tm, L*, a*, b* and WBSF. Therefore, animal class did not affect the nanostructure of beef; instead, meat tenderness was enhanced by the longer and visible muscle fibres. Nguni cattle produced meat of superior quality to that of the Bonsmara and the non-descript cattle.

  8. Planet-mediated precision reconstruction of the evolution of the cataclysmic variable HU Aquarii

    Science.gov (United States)

    Portegies Zwart, S.

    2013-02-01

    Cataclysmic variables (CVs) are binaries in which a compact white dwarf accretes material from a low-mass companion star. The discovery of two planets in orbit around the CV HU Aquarii (HU Aqr) opens unusual opportunities for understanding the formation and evolution of this system. In particular, the orbital parameters of the planets constrain the past and enable us to reconstruct the evolution of the system through the common-envelope phase. During this dramatic event, the entire hydrogen envelope of the primary star is ejected, passing the two planets on the way. The observed eccentricities and orbital separations of the planets in HU Aqr enable us to limit the common-envelope parameter αλ = 0.45 ± 0.17 or γ = 1.77 ± 0.02 and measure the rate at which the common envelope is ejected, which turns out to be copious. The mass in the common envelope is ejected from the binary system at a rate of {dot{m}} = 1.9± 0.3 M_{⊙} yr^{-1}. The reconstruction of the initial conditions for HU Aqr indicates that the primary star had a mass of MZAMS = 1.6 ± 0.2 M⊙ and a mZAMS = 0.47 ± 0.04 M⊙ companion in a a = 25-160 R⊙ (best value a = 97 R⊙) binary. The two planets were born with an orbital separation of aa = 541 ± 44 R⊙ and ab = 750 ± 72 R⊙, respectively. After the common envelope, the primary star turns into a 0.52 ± 0.01 M⊙ helium white dwarf, which subsequently accretes ˜0.30 M⊙ from its Roche lobe filling companion star, grinding it down to its current observed mass of 0.18 M⊙.

  9. Planet-Mediated Precision-Reconstruction of the Evolution of the Cataclysmic Variable HU Aquarius

    OpenAIRE

    Zwart, Simon Portegies

    2012-01-01

    Cataclysmic variables (CVs) are binaries in which a compact white dwarf accretes material from a low-mass companion star. The discovery of two planets in orbit around the CV HU Aquarii opens unusual opportunities for understanding the formation and evolution of this system. In particular the orbital parameters of the planets constrains the past and enables us to reconstruct the evolution of the system through the common-envelope phase. During this dramatic event the entire hydrogen envelope o...

  10. La plaza central de Huánuco Pampa: espacio y transformación

    OpenAIRE

    Morris, Craig; Covey, Alan

    2012-01-01

    The Central Plaza of Huánuco Pampa: Space and TransformationInka urban planning provided the contexts in which social organization could be re-configured. The central plazas of Inka cities were spaces where various groups from the region could come together, celebrating their relationships of complementarity and opposition through dances, processions and ritual battles. The archaeological evidence suggests that the central plaza of Huanuco Pampa was a space used for feasting. Many of the buil...

  11. PKC Activation Counteracts ADAM10 Deficit in HuD-Silenced Neuroblastoma Cells.

    Science.gov (United States)

    Marchesi, Nicoletta; Amadio, Marialaura; Colombrita, Claudia; Govoni, Stefano; Ratti, Antonia; Pascale, Alessia

    2016-09-06

    Neuronal ELAV/Hu (nELAV) are RNA-binding proteins that mainly regulate gene expression by increasing the stability and/or translation rate of target mRNAs bearing ARE (adenine and uracil-rich elements) sequences. Among nELAV target transcripts there is ADAM10, an α-secretase involved in the non-amyloidogenic processing of the amyloid-β protein precursor (AβPP) which leads to the production of the neuroprotective sAβPPα peptide. The aim of this study was to evaluate if nELAV depletion affects ADAM10 expression in human SH-SY5Y neuroblastoma cells. We also studied the effects of Bryostatin-1, a molecule able to activate nELAV protein cascade. The specific HuD/nELAV gene silencing decreased both nELAV and ADAM10 protein contents; similar results were obtained by Aβ40 treatment in wild-type SH-SY5Y cells. In HuD-silenced cells, the exposure to Bryostatin-1 counteracted both nELAV and ADAM10 proteins downregulation, by restoring nELAV/ADAM10 basal levels. We also found that sAβPPα release, which seemed not to be compromised by Aβ40 challenge or HuD-silencing, was favored by Bryostatin-1. Overall, these findings strongly suggest that a deficiency in nELAV content negatively affects ADAM10 expression and may play a role in neurodegenerative diseases, which may benefit by molecules activating ELAV cascade.

  12. Phase II trial of hu14.18-IL2 for patients with metastatic melanoma.

    Science.gov (United States)

    Albertini, Mark R; Hank, Jacquelyn A; Gadbaw, Brian; Kostlevy, Jordan; Haldeman, Jennifer; Schalch, Heidi; Gan, Jacek; Kim, KyungMann; Eickhoff, Jens; Gillies, Stephen D; Sondel, Paul M

    2012-12-01

    Phase I testing of the hu14.18-IL2 immunocytokine in melanoma patients showed immune activation, reversible toxicities, and a maximal tolerated dose of 7.5 mg/m(2)/day. In this phase II study, 14 patients with measurable metastatic melanoma were scheduled to receive hu14.18-IL2 at 6 mg/m(2)/day as 4-h intravenous infusions on Days 1, 2, and 3 of each 28 day cycle. Patients with stable disease (SD) or regression following cycle 2 could receive two additional treatment cycles. The primary objective was to evaluate antitumor activity and response duration. Secondary objectives evaluated adverse events and immunologic activation. All patients received two cycles of treatment. One patient had a partial response (PR) [1 PR of 14 patients = response rate of 7.1 %; confidence interval, 0.2-33.9 %], and 4 patients had SD and received cycles 3 and 4. The PR and SD responses lasted 3-4 months. All toxicities were reversible and those resulting in dose reduction included grade 3 hypotension (2 patients) and grade 2 renal insufficiency with oliguria (1 patient). Patients had a peripheral blood lymphocytosis on Day 8 and increased C-reactive protein. While one PR in 14 patients met protocol criteria to proceed to stage 2 and enter 16 additional patients, we suspended stage 2 due to limited availability of hu14.18-IL2 at that time and the brief duration of PR and SD. We conclude that subsequent testing of hu14.18-IL2 should involve melanoma patients with minimal residual disease based on compelling preclinical data and the confirmed immune activation with some antitumor activity in this study.

  13. Expression of HuR and Cyclooxygenase-2 in Nodular Fasciitis and Low-Grade Sarcoma: An Immunohistochemical Study

    OpenAIRE

    Son, Hyun-Jin; Baek, Tae-Hwa; Lee, Seung Yun; Kim, Joo-Heon; Kang, Dong-Wook; Lee, Hye-Kyung; Park, Mee-Ja

    2014-01-01

    Background Nodular fasciitis is the most common reactive mesenchymal lesion to be misidentified as a type of sarcoma. HuR is an mRNA-binding protein that can stabilize cyclooxygenase-2 (COX-2) mRNA leading to COX-2 overexpression. The aim of this study is a comparison of the expressions of COX-2 and HuR and the relationships between their expressions and the clinicopathological parameters in nodular fasciitis and low-grade sarcoma. Methods We measured the expression of HuR and COX-2 in 21 cas...

  14. Bisphosphonate prodrugs: synthesis and biological evaluation in HuH7 hepatocarcinoma cells.

    Science.gov (United States)

    Monteil, Maelle; Migianu-Griffoni, Evelyne; Sainte-Catherine, Odile; Di Benedetto, Mélanie; Lecouvey, Marc

    2014-04-22

    We investigated the biological effects of new synthesized bisphosphonates (BPs) on HuH7 hepatocarcinoma cells. BPs containing p-bromophenyl (R1 = p-Br, Ph, 2) in their side chain were the more potent to inhibit HuH7 cell viability. In addition, phenyl diesterified analogues (R2 = R3 = Ph, 2a) were more potent than methyl (R2 = R3 = Me, 2b) or non-esterified BPs (2) inducing more necrosis suggesting that they better entered into cells. Phosphodiesterase inhibitor (IBMX) reversed the effect of the esterified BPs and not that of non-esterified ones suggesting role of cell phosphodiesterases to release active BPs. BP analogues inhibited HuH7 cell migration but esterified ones had no effect on invasion due to the hiding of phosphonic groups. All together, these results indicated the therapeutic interest of these new BP prodrugs. Copyright © 2014 Elsevier Masson SAS. All rights reserved.

  15. Downregulation of β-Adrenoceptors in Isoproterenol-Induced Cardiac Remodeling through HuR.

    Directory of Open Access Journals (Sweden)

    Qian Yin

    Full Text Available β-adrenergic receptors (β-ARs play an important role in cardiac remodeling, which is the key pathological process in various heart diseases and leads to heart failure. However, the regulation of β-AR expression in remodeling hearts is still unclear. This study aims to clarify the possible mechanisms underlying the regulation of β1- and β2-AR expression in cardiac remodeling. The rat model of cardiac remodeling was established by subcutaneous injection of isoproterenol(ISO at the dose of 0.25 mg·kg(-1·d(-1 for 7 days. We found that the expression of β1- and β2-ARs decreased in the remodeling heart. The mechanisms may include the inhibition of DNA transcription and the increase of mRNA degradation. cAMP-response element binding protein(CREB is a well-known transcription factor of β-AR. However, the expression and activation of CREB was not changed in the remodeling heart. Further, human Antigen-R (HuR, a RNA binding protein, which binds to the 3'-untranslated region of the β-AR mRNA and promotes RNA degradation, was increased in the remodeling model. And in vitro, HuR deficiency reversed the reduction of β-AR mRNA induced by ISO. Therefore, the present findings indicate that HuR, but not CREB, is responsible for the reduction of β-AR expression in ISO induced cardiac remodeling.

  16. Effect of synthetic cannabinoid HU210 on memory deficits and neuropathology in Alzheimer's disease mouse model.

    Science.gov (United States)

    Chen, B; Bromley-Brits, K; He, G; Cai, F; Zhang, X; Song, W

    2010-05-01

    Cannabinoids have been shown to increase neurogenesis in adult brain, as well as protect neurons from excitotoxicity, calcium influx, inflammation, and ischemia. Recent studies have shown that synthetic cannabinoids can alleviate water maze impairments in rats treated with intracranial amyloid beta protein (Abeta); however it is unknown whether this effect is due to the cannabinoids' anti-inflammatory properties or whether it affects Abeta processing. Here we investigate whether cannabinoids have any effect on Alzheimer's disease in vivo. We found that HU210, a potent synthetic cannabinoid, did not improve water maze performance or a contextual fear conditioning task in an APP23/PS45 double transgenic mouse model of AD. HU210 had no effect on APP processing and Abeta generation, as well as neuritic plaque formation in the brains of AD transgenic mice. Our study showed that synthetic cannabinoid HU210 had no beneficial effects on AD neuropathology and behavioral deficits of AD model mice, which advises caution of such drug's application in AD therapies.

  17. The cytoskeletal inhibitors latrunculin A and blebbistatin exert antitumorigenic properties in human hepatocellular carcinoma cells by interfering with intracellular HuR trafficking

    Energy Technology Data Exchange (ETDEWEB)

    Doller, Anke; Badawi, Amel [Pharmazentrum Frankfurt/ZAFES, Klinikum der Goethe-Universität Frankfurt, Frankfurt/Main (Germany); Schmid, Tobias; Brauß, Thilo [Institut für Biochemie I (Pathobiochemie), Klinikum der Goethe-Universität Frankfurt, Frankfurt/Main (Germany); Pleli, Thomas [Medizinische Klinik 1, Schwerpunkt Gastroenterologie und Hepatologie, Klinikum der Goethe-Universität Frankfurt, Frankfurt/Main (Germany); Meyer zu Heringdorf, Dagmar [Pharmazentrum Frankfurt/ZAFES, Klinikum der Goethe-Universität Frankfurt, Frankfurt/Main (Germany); Piiper, Albrecht [Medizinische Klinik 1, Schwerpunkt Gastroenterologie und Hepatologie, Klinikum der Goethe-Universität Frankfurt, Frankfurt/Main (Germany); Pfeilschifter, Josef [Pharmazentrum Frankfurt/ZAFES, Klinikum der Goethe-Universität Frankfurt, Frankfurt/Main (Germany); Eberhardt, Wolfgang, E-mail: w.eberhardt@em.uni-frankfurt.de [Pharmazentrum Frankfurt/ZAFES, Klinikum der Goethe-Universität Frankfurt, Frankfurt/Main (Germany)

    2015-01-01

    The impact of the RNA-binding protein HuR for the post-transcriptional deregulation of tumor-relevant genes is well established. Despite of elevations in HuR expression levels, an increase in cytoplasmic HuR abundance in many cases correlates with a high grade of malignancy. Here, we demonstrated that administration of the actin-depolymerizing macrolide latrunculin A, or blebbistatin, an inhibitor of myosin II ATPase activity, caused a dose- and time-dependent reduction in the high cytoplasmic HuR content of HepG2 and Huh7 hepatocellular carcinoma (HCC) cells. Subcellular fractionation revealed that in addition, both inhibitors strongly attenuated cytoskeletal and membrane-bound HuR abundance and conversely increased the HuR amount in nuclear cell fractions. Concomitant with changes in intracellular HuR localization, both cytoskeletal inhibitors markedly decreased the half-lives of cyclooxygenase-2 (COX-2), cyclin A and cyclin D{sub 1} encoding mRNAs resulting in a significant reduction in their expression levels in HepG2 cells. Importantly, a similar reduction in the expression of these HuR targets was achieved by a RNA interference (RNAi)-mediated knockdown of either HuR or nonmuscle myoin IIA. Using polysomal fractionation, we further demonstrate that the decrease in cytoplasmic HuR by latrunculin A or blebbistatin is accompanied by a marked change in the allocation of HuR and its mRNA cargo from polysomes to ribonucleoprotein (RNP) particles. Functionally, the basal migration and prostaglandin E{sub 2} synthesis are similarly impaired in inhibitor-treated and stable HuR-knockdown HepG2 cells. Our data demonstrate that interfering with the actomyosin-dependent HuR trafficking may comprise a valid therapeutic option for antagonizing pathologic posttranscriptional gene expression by HuR and furthermore emphasize the potential benefit of HuR inhibitory strategies for treatment of HCC. - Highlights: • We tested the effects of latrunculin A and blebbistatin on

  18. HuR interacts with human immunodeficiency virus type 1 reverse transcriptase, and modulates reverse transcription in infected cells

    Directory of Open Access Journals (Sweden)

    Ennifar Eric

    2008-06-01

    Full Text Available Abstract Reverse transcription of the genetic material of human immunodeficiency virus type 1 (HIV-1 is a critical step in the replication cycle of this virus. This process, catalyzed by reverse transcriptase (RT, is well characterized at the biochemical level. However, in infected cells, reverse transcription occurs in a multiprotein complex – the reverse transcription complex (RTC – consisting of viral genomic RNA associated with viral proteins (including RT and, presumably, as yet uncharacterized cellular proteins. Very little is known about the cellular proteins interacting with the RTC, and with reverse transcriptase in particular. We report here that HIV-1 reverse transcription is affected by the levels of a nucleocytoplasmic shuttling protein – the RNA-binding protein HuR. A direct protein-protein interaction between RT and HuR was observed in a yeast two-hybrid screen and confirmed in vitro by homogenous time-resolved fluorescence (HTRF. We mapped the domain interacting with HuR to the RNAse H domain of RT, and the binding domain for RT to the C-terminus of HuR, partially overlapping the third RRM RNA-binding domain of HuR. HuR silencing with specific siRNAs greatly impaired early and late steps of reverse transcription, significantly inhibiting HIV-1 infection. Moreover, by mutagenesis and immunoprecipitation studies, we could not detect the binding of HuR to the viral RNA. These results suggest that HuR may be involved in and may modulate the reverse transcription reaction of HIV-1, by an as yet unknown mechanism involving a protein-protein interaction with HIV-1 RT.

  19. Immunogenicity of the hu14.18-IL2 immunocytokine molecule in adults with melanoma and children with neuroblastoma.

    Science.gov (United States)

    Hank, Jacquelyn A; Gan, Jacek; Ryu, Hyunji; Ostendorf, Amy; Stauder, Michael C; Sternberg, Adam; Albertini, Mark; Lo, Kin-Ming; Gillies, Stephen D; Eickhoff, Jens; Sondel, Paul M

    2009-09-15

    Immunocytokine (IC) hu14.18-IL2 is a fusion protein of humanized antidisialoganglioside (GD2) antibody (hu14.18) and interleukin (IL)-2. Sixty-one melanoma and neuroblastoma patients received IC in phase I/Ib studies. Patient sera were examined in ELISA to determine if an anti-IC antibody response occurred during treatment. Serum was assayed for anti-idiotypic antibody (anti-id Ab) based on ability to bridge biotinylated hu14.18 to plate-bound hu14.18 and ability to inhibit binding of hu14.18 to GD2 antigen and/or murine anti-idiotypic antibody. ELISA was also used to detect antibodies to the Fc-IL2 end of hu14.18-IL2. Thirty-two patients (52%) developed an anti-idiotypic antibody response (absorbance, >0.7) in the bridge ELISA. Twelve patients (20%) had an intermediate response, whereas 17 patients (28%) were negative (adsorbance, IL2 detected in the bridge ELISA was not related to the dose of hu14.18-IL2. Twenty of 33 adult patients (61%) demonstrated an anti-idiotypic antibody response based on binding inhibition ELISA. The anti-idiotypic response was inversely correlated (P IL2. All patients developed some inhibitory activity in the binding inhibition assay designed to detect antibodies to the Fc-IL2 region of the IC. There was a positive correlation between the peak serum level of IC in course 1 and the anti-Fc-IL2 response. Patients treated with hu14.18-IL2 developed anti-idiotypic antibodies and anti Fc-IL2 antibodies. No association was seen between development of anti-IC antibodies and clinical toxicity.

  20. A Review of the Pharmacological Effects of the Dried Root of Polygonum cuspidatum (Hu Zhang and Its Constituents

    Directory of Open Access Journals (Sweden)

    Huan Zhang

    2013-01-01

    Full Text Available Traditional Chinese medicine (TCM has been widely used in China for thousands of years to treat and prevent diseases. TCM has been proven safe and effective, and it is being considered as one of the important types of complementary and alternative medicine and receives increasing attention worldwide. The dried root of Polygonum cuspidatum Sieb. et Zucc. (also known as “Hu Zhang” in Chinese is one of the medicinal herbs listed in the Pharmacopoeia of the People's Republic of China. Hu Zhang is widely distributed in the world. It can be found in Asia and North America and is used as folk medicine in countries such as Japan and Korea. In China, Hu Zhang is usually used in combination with other TCM herbs. The therapeutic uses of those Hu Zhang-containing TCM prescriptions or formulations are for treating cough, hepatitis, jaundice, amenorrhea, leucorrhea, arthralgia, burns and snake bites. Recent pharmacological and clinical studies have indicated that Hu Zhang has antiviral, antimicrobial, anti-inflammatory, neuroprotective, and cardioprotective functions. This review gives a summary of the reported therapeutic effects of the active compounds and the different extracts of Hu Zhang.

  1. Studies of early-type variable stars. XIV. Spectroscopic orbit and absolute parameters of HU Tauri.

    Science.gov (United States)

    Maxted, P. F. L.; Hill, G.; Hilditch, R. W.

    1995-09-01

    We present a new spectroscopic orbit for the Algol-type eclipsing binary system HU Tau (HD 29365, P=2.0563 days α(2000.0) = 04 38 15.80, δ= +20 41 05.3, V=5.87-6.8, B8V + G2). We find : m_1_ sin^3^i=4.17+/-0.09Msun_, m_2_ sin^3^i=1.07+/-0.025Msun_, (a_p_+a_s_)sin i=11.8 +/-0.1Rsun_, m_1_/m_2_=3.90+/-0.07. The spectroscopic orbit includes corrections for non-Keplerian effects derived from the solutions of the BV light curves of Ito (1988). We have been able to derive much improved absolute parameters for this system as follows: M_1_=4.43+/-0.09Msun_, M_2_=1.14+/-0.03Msun_, R _1_=2.57+/-0.03Rsun_, R _2_=4.21+/-0.03Rsun_, log(L_1_/Lsun_)= 2.09+/-0.15, log(L_2_/Lsun_)= 0.92+/-0.05. Comparison of HU Tau with non-conservative case B evolution models of De Greve (1993) suggests that the system evolved from an initial mass ratio <~0.5. However, the orbital period of HU Tau is more than 3 days shorter than any of the model systems, and the observed secondary luminosity of order 10 times less than a model star of the same mass during the slow mass transfer phase.

  2. Prevalence and factors determining psychoactive substance (PAS) use among Hawassa University (HU) undergraduate students, Hawassa Ethiopia.

    Science.gov (United States)

    Kassa, Andargachew; Taddesse, Fiker; Yilma, Aweke

    2014-10-07

    Use of psychoactive substances (PAS) early in school age implies drug dependence in later life. Although no studies have been conducted on undergraduate students of Hawassa University, a few studies in Ethiopia have reported that alcohol, khat, and cigarette are the commonly abused PASs among young high school/undergraduate university students. Therefore, this study was designed to establish the prevalence of and predictors for PAS use among undergraduate HU Students. An institution-based quantitative cross-sectional study using the self-administered WHO Model Core Questionnaire to collect information on use of various Psychoactive Substances (PASs) was conducted from June to July 2011. A multistage stratified sampling method was employed to select a total of 586 undergraduate HU students as study participants. Bivariate and multivariate logistic regression analysis were done to determine factors affecting PAS use. Lifetime, past 12 months, and current prevalence rate for overall PAS were 53.6%, 45.7%, and 35.5% respectively. The study depicted that in the past 12 months of the study period 40.8% used alcohol, 20.3% chewed khat, 11.9% smoked cigarettes, and 0.9% used marijuana. The prevalence of other illicit PASs such as Ecstasy, lysergic diethylamide (LSD), cocaine, crack, heroin, solvents or inhalants and un-prescribed psycho active medications was found zero percent (0%). Having family members who used PAS, peer influence, being male, and living alone during school age were found to be positively associated with overall PAS use in the past 12 months. The prevalence of PAS use among undergraduate HU students is high. Designing effective strategies to reduce PAS use should be everyone's priority.

  3. 'Hu Hong' (bad thing): parental perceptions of teenagers' sexuality in urban Vietnam.

    Science.gov (United States)

    Do, Lan Anh Thi; Boonmongkon, Pimpawun; Paek, Seung Chun; Guadamuz, Thomas E

    2017-02-28

    Teenagers under 18 years old in Vietnam are considered as minors who usually lack the autonomy to make decisions. They are also sometimes viewed as contributors to social evils including crime, violence and substance use. Moreover, most Vietnamese teenagers have unsafe sex before marriage. The objective of this study is to explore the parental perceptions relating to their teenagers' sexuality, particularly the social and cultural forces, that may hinder access to sexuality information. Guided by a Community Advisory Board (CAB), this qualitative study uses four focus group discussions (FGDs) consisting of 12 mothers and 12 fathers, as well as twelve individual in-depth interviews (IDIs) with a diverse sample of parents of teens in Ho Chi Minh City (HCMC), Vietnam. Content and discourse analysis were conducted, based on Foucauldian concepts. Four themes emerged: 1) Meanings of sexuality and sexuality education, 2) Early sexual intercourse destroys teenagers' future, 3) Teenagers are not hu hong (spoil/bad thing), are innocent and virgin, and 4) Policing and controlling of sexual intercourse among teens. Parents did not view their teenage children as sexual beings; those who are sexual are considered hu hong. Parents believed that teens need to be policed and controlled to prevent them from becoming hu hong, particularly girls. Controlling of sexuality information by parents was therefore common in HCMC, but differed by gender and educational levels of parents. For example, fathers more than mothers were not comfortable teaching their teenage children about sex and sexuality. Parents with higher education police their teenage children's usage of the Internet and social media, while parents with lower education control who can be friends with their teenage children. Vietnamese parents in general have negative views of sex and sexuality education for their teenage children. Recognizing that many Vietnamese teenagers have unsafe sex before marriage, parents need to

  4. Effects of weaning age on growth, nutrient digestibility and metabolism, and serum parameters in Hu lambs

    Directory of Open Access Journals (Sweden)

    Jianmin Chai

    2015-12-01

    Full Text Available This study was conducted to investigate the effect of weaning age on growth performance, nutrient digestion and metabolism, and serological indicators, and to obtain an optimal weaning age in Hu lambs. Forty-eight newborn Hu lambs (birth weight, 2.53 ± 0.14 kg were randomly divided into 4 groups. The lambs in control group (ER suckled their dams. The lambs in other three experimental groups were weaned on milk replacer at 10, 20, and 30 days of age (EW10, EW20, and EW30 groups, respectively. The results were as follows: 1 lambs in EW10 and EW30 groups had a lower (P  0.05 among groups; however, the apparent digestibility and deposition of calcium in early weaned lambs were lower (P < 0.05 than those in ewe-reared lambs. 4 The albumin content in EW30 group was lower (P < 0.05 than that in ER group; the globulin content in EW30 group was higher (P < 0.05 than that in other groups; the content of serum insulin-like growth factor-Ⅰ in weaned lambs tended to increase compared with lambs in ER group. Finally, the growth rate of lambs decreased within 10 days post-weaning, but early weaning boosted creep feed intake, leading to better growth and health later in life. The Hu lambs can be weaned on milk replacer and creep feed at 10 days of age.

  5. Hormonal replacement therapy with HCG and HU-FSH in thalassaemic patients affected by hypogonadotropic hypogonadism.

    Science.gov (United States)

    Cisternino, M; Manzoni, S M; Coslovich, E; Autelli, M

    1998-01-01

    Gonadotropin (Gn) replacement therapy using HCG plus HU-FSH was administered to 24 patients affected by beta-thalassaemia major with hypogonadotropic hypogonadism aged 18-40 years (25.2 +/- 5.4 yr, m +/- SEM). The age range at the start of treatment was 14.5-24.5 years (16.7 +/- 2.6 yr); the mean duration of Gn treatment was 8.6 +/- 3.9 years (range 1-15.2 yr). Gn therapy was begun with HCG alone, the dosage being initially 500 IU twice a week and then increased to a maximum of 3000 IU twice a week, according to the individual serum testosterone levels obtained. HU-FSH (75 IU twice a week) was added to initiate spermatogenesis in all cases when the HCG-induced testosterone serum levels normalized. The duration of HU-FSH treatment ranged from 1-2 years and then therapy was continued with HCG alone. In nine patients Gn therapy was discontinued after 6-14 years and was replaced by testosterone depot therapy, 75-100 mg i.m. twice a month, for a period ranging from 1-1.5 years. Using Gn therapy, the testosterone levels normalized. The compliant patients obtained good virilization and normal sexual function; testicular volume increased within the normal adult range and spermatogenesis was achieved. When Gn therapy was replaced by testosterone-depot therapy, a marked decrease in testicular volume and sperm count was observed, but the patients complied better and showed a slight increase in coarse hair. In conclusion gonadotropins are an effective replacement therapy for male hypogonadism in thalassaemic patients. If we consider the advantages and disadvantages of this therapy, the former seem to outweigh the latter. Finally, it should be emphasized that physicians caring for these patients must foster compliance during frequent check-ups and examinations.

  6. Effects of animal class and genotype on beef muscle nanostructure, pHu, colour and tenderness

    OpenAIRE

    Amanda Y. Chulayo; Voster Muchenje

    2016-01-01

    The objective of the study was to determine the effects of animal class and genotype of cattle on Muscularis longissimus thoracis et lumborum (LTL) nanostructure, ultimate pH (pHu), colour and tenderness of beef. We found significant positive relationships between distance travelled (DT) and meat temperature (Tm) (p"less than"0.01); lairage duration (LDhr) and lightness of colour (L*) (p"less than"0.01); ambient temperature (Ta) and L* (p"less than"0.05) and LDhr and yellowness (b*) (p"less t...

  7. Pelger-Huët anomaly: a critical review of the literature.

    Science.gov (United States)

    Speeckaert, M M; Verhelst, C; Koch, A; Speeckaert, R; Lacquet, F

    2009-01-01

    Pelger-Huët anomaly (PHA), an autosomal dominant haematological trait is characterised by neutrophil nuclear hypolobulation and modified chromatin distribution. Mutations in the lamin B receptor gene, a member of the sterol reductase family have been identified as the underlying cause. Due to its asymptomatic nature or lack of observer familiarity, PHA is often overlooked. In this review, we give an overview of the main pathophysiological, clinical, morphological and functional aspects of PHA. Furthermore, we highlight the importance of a comprehensive approach to the assessment of this laminopathy. Copyright (c) 2009 S. Karger AG, Basel.

  8. Combining wavelets transform and Hu moments with self-organizing maps for medical image categorization

    Science.gov (United States)

    Silva, Leandro A.; Del-Moral-Hernandez, Emilio; Moreno, Ramon A.; Furuie, Sérgio S.

    2011-10-01

    Images are fundamental sources of information in modern medicine. The images stored in a database and divided in categories are an important step for image retrieval. For an automatic categorization process, detailed analysis is done regarding image representation and generalization method. The baseline method for this process, in the medical image context, is using thumbnails and K-nearest neighbor (KNN), which is easily implemented and has had satisfactory results in literature. This work addresses an alternative method for automatic categorization, which jointly uses discrete wavelet transform with Hu's moments for image representation and self-organizing maps (SOM) neural networks combined with the KNN classifier (SOM-KNN), for medical image categorization. Furthermore, extensive experiments are conducted, to define the best wavelet family and to select the best coefficients set, to consider the remaining wavelet coefficients set (not selected as the best ones) through their Hu's moments, and to carry out a contrastive study with other successful approaches for categorization. The categorization result from a database with 10,000 images in 116 categories yielded 81.8% of correct rate, which is much better than the 67.9% obtained by the baseline method; and the time consumed in classification processing with SOM-KNN is 100 times shorter than KNN.

  9. HU histone-like DNA-binding protein from Thermus thermophilus: structural and evolutionary analyses.

    Science.gov (United States)

    Papageorgiou, Anna C; Adam, Panagiotis S; Stavros, Philemon; Nounesis, George; Meijers, Rob; Petratos, Kyriacos; Vorgias, Constantinos E

    2016-09-01

    The histone-like DNA-binding proteins (HU) serve as model molecules for protein thermostability studies, as they function in different bacteria that grow in a wide range of temperatures and show sequence diversity under a common fold. In this work, we report the cloning of the hutth gene from Thermus thermophilus, the purification and crystallization of the recombinant HUTth protein, as well as its X-ray structure determination at 1.7 Å. Detailed structural and thermodynamic analyses were performed towards the understanding of the thermostability mechanism. The interaction of HUTth protein with plasmid DNA in solution has been determined for the first time with MST. Sequence conservation of an exclusively thermophilic order like Thermales, when compared to a predominantly mesophilic order (Deinococcales), should be subject, to some extent, to thermostability-related evolutionary pressure. This hypothesis was used to guide our bioinformatics and evolutionary studies. We discuss the impact of thermostability adaptation on the structure of HU proteins, based on the detailed evolutionary analysis of the Deinococcus-Thermus phylum, where HUTth belongs. Furthermore, we propose a novel method of engineering thermostable proteins, by combining consensus-based design with ancestral sequence reconstruction. Finally, through the structure of HUTth, we are able to examine the validity of these predictions. Our approach represents a significant advancement, as it explores for the first time the potential of ancestral sequence reconstruction in the divergence between a thermophilic and a mainly mesophilic taxon, combined with consensus-based engineering.

  10. Genes on a Wire: The Nucleoid-Associated Protein HU Insulates Transcription Units in Escherichia coli

    Science.gov (United States)

    Berger, Michael; Gerganova, Veneta; Berger, Petya; Rapiteanu, Radu; Lisicovas, Viktoras; Dobrindt, Ulrich

    2016-01-01

    The extent to which chromosomal gene position in prokaryotes affects local gene expression remains an open question. Several studies have shown that chromosomal re-positioning of bacterial transcription units does not alter their expression pattern, except for a general decrease in gene expression levels from chromosomal origin to terminus proximal positions, which is believed to result from gene dosage effects. Surprisingly, the question as to whether this chromosomal context independence is a cis encoded property of a bacterial transcription unit, or if position independence is a property conferred by factors acting in trans, has not been addressed so far. For this purpose, we established a genetic test system assessing the chromosomal positioning effects by means of identical promoter-fluorescent reporter gene fusions inserted equidistantly from OriC into both chromosomal replichores of Escherichia coli K-12. Our investigations of the reporter activities in mutant cells lacking the conserved nucleoid associated protein HU uncovered various drastic chromosomal positional effects on gene transcription. In addition we present evidence that these positional effects are caused by transcriptional activity nearby the insertion site of our reporter modules. We therefore suggest that the nucleoid-associated protein HU is functionally insulating transcription units, most likely by constraining transcription induced DNA supercoiling. PMID:27545593

  11. Acetylome of Acinetobacter baumannii SK17 Reveals a Highly-Conserved Modification of Histone-Like Protein HU

    Directory of Open Access Journals (Sweden)

    Jiahn-Haur Liao

    2017-11-01

    Full Text Available Lysine acetylation is a prevalent post-translational modification in both eukaryotes and prokaryotes. Whereas this modification is known to play pivotal roles in eukaryotes, the function and extent of this modification in prokaryotic cells remain largely unexplored. Here we report the acetylome of a pair of antibiotic-sensitive and -resistant nosocomial pathogen Acinetobacter baumannii SK17-S and SK17-R. A total of 145 lysine acetylation sites on 125 proteins was identified, and there are 23 acetylated proteins found in both strains, including histone-like protein HU which was found to be acetylated at Lys13. HU is a dimeric DNA-binding protein critical for maintaining chromosomal architecture and other DNA-dependent functions. To analyze the effects of site-specific acetylation, homogenously Lys13-acetylated HU protein, HU(K13ac was prepared by genetic code expansion. Whilst not exerting an obvious effect on the oligomeric state, Lys13 acetylation alters both the thermal stability and DNA binding kinetics of HU. Accordingly, this modification likely destabilizes the chromosome structure and regulates bacterial gene transcription. This work indicates that acetyllysine plays an important role in bacterial epigenetics.

  12. HuR-Regulated mRNAs Associated with Nuclear hnRNP A1-RNP Complexes

    Directory of Open Access Journals (Sweden)

    Apostolia Guialis

    2013-10-01

    Full Text Available Post-transcriptional regulatory networks are dependent on the interplay of many RNA-binding proteins having a major role in mRNA processing events in mammals. We have been interested in the concerted action of the two RNA-binding proteins hnRNP A1 and HuR, both stable components of immunoselected hnRNP complexes and having a major nuclear localization. Specifically, we present here the application of the RNA-immunoprecipitation (RIP-Chip technology to identify a population of nuclear transcripts associated with hnRNP A1-RNPs as isolated from the nuclear extract of either HuR WT or HuR-depleted (KO mouse embryonic fibroblast (MEF cells. The outcome of this analysis was a list of target genes regulated via HuR for their association (either increased or reduced with the nuclear hnRNP A1-RNP complexes. Real time PCR analysis was applied to validate a selected number of nuclear mRNA transcripts, as well as to identify pre-spliced transcripts (in addition to their mature mRNA counterpart within the isolated nuclear hnRNP A1-RNPs. The differentially enriched mRNAs were found to belong to GO categories relevant to biological processes anticipated for hnRNP A1 and HuR (such as transport, transcription, translation, apoptosis and cell cycle indicating their concerted function in mRNA metabolism.

  13. Post-Transcriptional Up-Regulation of PDGF-C by HuR in Advanced and Stressed Breast Cancer

    Directory of Open Access Journals (Sweden)

    Nian-An Luo

    2014-11-01

    Full Text Available Breast cancer is a heterogeneous disease characterized by multiple genetic alterations leading to the activation of growth factor signaling pathways that promote cell proliferation. Platelet-derived growth factor-C (PDGF-C is overexpressed in various malignancies; however, the involvement of PDGF-C in breast cancers and the mechanisms underlying PDGF-C deregulation remain unclear. Here, we show that PDGF-C is overexpressed in clinical breast cancers and correlates with poor prognosis. PDGF-C up-regulation was mediated by the human embryonic lethal abnormal vision-like protein HuR, which stabilizes the PDGF-C transcript by binding to two predicted AU-rich elements (AREs in the 3'-untranslated region (3'-UTR. HuR is up-regulated in hydrogen peroxide-treated or ultraviolet-irradiated breast cancer cells. Clinically, HuR levels are correlated with PDGF-C expression and histological grade or pathological tumor-node-metastasis (pTNM stage. Our findings reveal a novel mechanism underlying HuR-mediated breast cancer progression, and suggest that HuR and PDGF-C are potential molecular candidates for targeted therapy of breast cancers.

  14. Anti-solar differential rotation on the active sub-giant HU Virginis

    Science.gov (United States)

    Harutyunyan, G.; Strassmeier, K. G.; Künstler, A.; Carroll, T. A.; Weber, M.

    2016-08-01

    Context. Measuring surface differential rotation (DR) on different types of stars is important when characterizing the underlying stellar dynamo. It has been suggested that anti-solar DR laws can occur when strong meridional flows exist. Aims: We aim to investigate the differential surface rotation on the primary star of the RS CVn binary, HU Vir, by tracking its starspot distribution as a function of time. We also aim to recompute and update the values for several system parameters of the triple system HU Vir (close and wide orbits). Methods: Time-series high-resolution spectroscopy for four continuous months was obtained with the 1.2-m robotic STELLA telescope. Nine consecutive Doppler images were reconstructed from these data, using our line-profile inversion code iMap. An image cross-correlation method was applied to derive the surface differential-rotation law for HU Vir. New orbital elements for the close and the wide orbits were computed using our new STELLA radial velocities (RVs) combined with the RV data available in the literature. Photometric observations were performed with the Amadeus Automatic Photoelectric Telescope (APT), providing contemporaneous Johnson-Cousins V and I data for approximately 20 yrs. This data was used to determine the stellar rotation period and the active longitudes. Results: We confirm anti-solar DR with a surface shear parameter α of -0.029 ± 0.005 and -0.026 ± 0.009, using single-term and double-term differential rotation laws, respectively. These values are in good agreement with previously claimed results. The best fit is achieved assuming a solar-like double-term law with a lap time of ≈400 d. Our orbital solutions result in a period of 10.387678 ± 0.000003 days for the close orbit and 2726 ± 7 d (≈7.5 yr) for the wide orbit. A Lomb-Scarge (L-S) periodogram of the pre-whitened V-band data reveals a strong single peak providing a rotation period of 10.391 ± 0.008 d, well synchronized to the short orbit. Based on

  15. Hu Hong’ (bad thing: parental perceptions of teenagers’ sexuality in urban Vietnam

    Directory of Open Access Journals (Sweden)

    Lan Anh Thi Do

    2017-02-01

    Full Text Available Abstract Background Teenagers under 18 years old in Vietnam are considered as minors who usually lack the autonomy to make decisions. They are also sometimes viewed as contributors to social evils including crime, violence and substance use. Moreover, most Vietnamese teenagers have unsafe sex before marriage. The objective of this study is to explore the parental perceptions relating to their teenagers’ sexuality, particularly the social and cultural forces, that may hinder access to sexuality information. Methods Guided by a Community Advisory Board (CAB, this qualitative study uses four focus group discussions (FGDs consisting of 12 mothers and 12 fathers, as well as twelve individual in-depth interviews (IDIs with a diverse sample of parents of teens in Ho Chi Minh City (HCMC, Vietnam. Content and discourse analysis were conducted, based on Foucauldian concepts. Results Four themes emerged: 1 Meanings of sexuality and sexuality education, 2 Early sexual intercourse destroys teenagers’ future, 3 Teenagers are not hu hong (spoil/bad thing, are innocent and virgin, and 4 Policing and controlling of sexual intercourse among teens. Parents did not view their teenage children as sexual beings; those who are sexual are considered hu hong. Parents believed that teens need to be policed and controlled to prevent them from becoming hu hong, particularly girls. Controlling of sexuality information by parents was therefore common in HCMC, but differed by gender and educational levels of parents. For example, fathers more than mothers were not comfortable teaching their teenage children about sex and sexuality. Parents with higher education police their teenage children’s usage of the Internet and social media, while parents with lower education control who can be friends with their teenage children. Conclusions Vietnamese parents in general have negative views of sex and sexuality education for their teenage children. Recognizing that many

  16. ExHuME 1.3: A Monte Carlo event generator for exclusive diffraction

    Science.gov (United States)

    Monk, J.; Pilkington, A.

    2006-08-01

    We have written the Exclusive Hadronic Monte Carlo Event (ExHuME) generator. ExHuME is based around the perturbative QCD calculation of Khoze, Martin and Ryskin of the process pp→p+X+p, where X is a centrally produced colour singlet system. Program summaryTitle of program:ExHuME Catalogue identifier:ADYA_v1_0 Program summary URL:http://cpc.cs.qub.ac.uk/summaries/ADYA_v1_0 Program obtainable from:CPC Program Library, Queen's University of Belfast, N. Ireland Licensing provisions:None Programming language used:C++, some FORTRAN Computer:Any computer with UNIX capability. Users should refer to the README file distributed with the source code for further details Operating system:Linux, Mac OS X No. of lines in distributed program, including test data, etc.:111 145 No. of bytes in distributed program, including test data, etc.: 791 085 Distribution format:tar.gz RAM:60 MB External routines/libraries:LHAPDF [ http://durpdg.dur.ac.uk/lhapdf/], CLHEP v1.8 or v1.9 [L. Lönnblad, Comput. Phys. Comm. 84 (1994) 307; http://wwwinfo.cern.ch/asd/lhc++/clhep/] Subprograms used:Pythia [T. Sjostrand et al., Comput. Phys. Comm. 135 (2001) 238], HDECAY [A. Djouadi, J. Kalinowski, M. Spira, HDECAY: A program for Higgs boson decays in the standard model and its supersymmetric extension, Comput. Phys. Comm. 108 (1998) 56, hep-ph/9704448]. Both are distributed with the source code Nature of problem:Central exclusive production offers the opportunity to study particle production in a uniquely clean environment for a hadron collider. This program implements the KMR model [V.A. Khoze, A.D. Martin, M.G. Ryskin, Prospects for New Physics observations in diffractive processes at the LHC and Tevatron, Eur. Phys. J. C 23 (2002) 311, hep-ph/0111078], which is the only fully perturbative model of exclusive production. Solution method:Monte Carlo techniques are used to produce the central exclusive parton level system. Pythia routines are then used to develop a realistic hadronic system

  17. HuR-targeted nanotherapy in combination with AMD3100 suppresses CXCR4 expression, cell growth, migration and invasion in lung cancer.

    Science.gov (United States)

    Muralidharan, R; Panneerselvam, J; Chen, A; Zhao, Y D; Munshi, A; Ramesh, R

    2015-12-01

    The CXCR4 chemokine receptor has an important role in cancer cell metastasis. The CXCR4 antagonist, AMD3100, has limited efficacy in controlling metastasis. HuR, an RNA-binding protein, regulates CXCR4 in cancer cells. We therefore investigated whether targeting HuR using a siRNA-based nanoparticle plus AMD3100 would suppress CXCR4 and inhibit lung cancer metastasis. We treated human H1299 lung cancer cells with HuR-specific siRNA contained in a folate-targeted lipid nanoparticle (HuR-FNP) plus AMD3100, and compared this with AMD3100 alone, HuR-FNP alone and no treatment. HuR-FNP plus AMD3100 treatment produced a G1 phase cell cycle arrest and reduced cell viability above and beyond the effects of AMD3100 alone. HuR and CXCR4 mRNA and protein expression levels were markedly reduced in all treatment groups. Phosphorylated (p) AKT(S473) protein was also reduced. P27 protein expression increased with HuR-FNP and combination treatment. Promoter-based reporter studies showed that the combination inhibited CXCR4 promoter activity more than did either treatment alone. Cell migration and invasion was significantly reduced with all treatments; the combination provided the most inhibition. Reduced matrix metalloprotease (MMP)-2 and -9 expression was associated with reduced invasion in all treatment groups. Thus, we found that combined HuR and CXCR4 targeting effectively controlled lung cancer metastasis.

  18. HuCAL PLATINUM, a synthetic Fab library optimized for sequence diversity and superior performance in mammalian expression systems.

    Science.gov (United States)

    Prassler, Josef; Thiel, Stefanie; Pracht, Catrin; Polzer, Andrea; Peters, Solveig; Bauer, Marion; Nörenberg, Stephanie; Stark, Yvonne; Kölln, Johanna; Popp, Andreas; Urlinger, Stefanie; Enzelberger, Markus

    2011-10-14

    This article describes the design of HuCAL (human combinatorial antibody library) PLATINUM, an optimized, second-generation, synthetic human Fab antibody library with six trinucleotide-randomized complementarity-determining regions (CDRs). Major improvements regarding the optimized antibody library sequence space were implemented. Sequence space optimization is considered a multistep process that includes the analysis of unproductive antibody sequences in order to, for example, avoid motifs such as potential N-glycosylation sites, which are undesirable in antibody production. Gene optimization has been used to improve expression of the antibody master genes in the library context. As a result, full-length IgGs derived from the library show both significant improvements in expression levels and less undesirable glycosylation sites when compared to the previous HuCAL GOLD library. Additionally, in-depth analysis of sequences from public databases revealed that diversity of CDR-H3 is a function of loop length. Based upon this analysis, the relatively uniform diversification strategy used in the CDR-H3s of the previous HuCAL libraries was changed to a length-dependent design, which replicates the natural amino acid distribution of CDR-H3 in the human repertoire. In a side-by-side comparison of HuCAL GOLD and HuCAL PLATINUM, the new library concept led to isolation of about fourfold more unique sequences and to a higher number of high-affinity antibodies. In the majority of HuCAL PLATINUM projects, 100-300 antibodies each having different CDR-H3s are obtained against each antigen. This increased diversity pool has been shown to significantly benefit functional antibody profiling and screening for superior biophysical properties. Copyright © 2011 Elsevier Ltd. All rights reserved.

  19. Antonio Rodríguez Huéscar y José Ortega y Gasset: Tres cartas

    OpenAIRE

    Esteban Enguita, José Emilio; Lasaga Medina, José

    2015-01-01

    El objetivo principal de este artículo es comentar las cartas que se enviaron Antonio Rodríguez Huéscar y José Ortega y Gasset entre 1942 y 1943. Dichas cartas se incluyen en el artículo. The principal aim of this paper is to comment on the letters which Antonio Rodríguez Huéscar and José Ortega y Gasset sent each other between 1942 and 1943. The above said letters are included in the paper

  20. Flight Testing Surfaces Engineered for Mitigating Insect Adhesion on a Falcon HU-25C

    Science.gov (United States)

    Shanahan, Michelle; Wohl, Chris J.; Smith, Joseph G., Jr.; Connell, John W.; Siochi, Emilie J.; Doss, Jereme R.; Penner, Ronald K.

    2015-01-01

    Insect residue contamination on aircraft wings can decrease fuel efficiency in aircraft designed for natural laminar flow. Insect residues can cause a premature transition to turbulent flow, increasing fuel burn and making the aircraft less environmentally friendly. Surfaces, designed to minimize insect residue adhesion, were evaluated through flight testing on a Falcon HU-25C aircraft flown along the coast of Virginia and North Carolina. The surfaces were affixed to the wing leading edge and the aircraft remained at altitudes lower than 1000 feet throughout the flight to assure high insect density. The number of strikes on the engineered surfaces was compared to, and found to be lower than, untreated aluminum control surfaces flown concurrently. Optical profilometry was used to determine insect residue height and areal coverage. Differences in results between flight and laboratory tests suggest the importance of testing in realistic use environments to evaluate the effectiveness of engineered surface designs.

  1. VizieR Online Data Catalog: HU Aqr planetary system mid-egress moments (Gozdziewski+, 2015)

    Science.gov (United States)

    Gozdziewski, K.; Slowikowska, A.; Dimitrov, D.; Krzeszowski, K.; Zejmo, M.; Kanbach, G.; Burwitz, V.; Rau, A.; Irawati, P.; Richichi, A.; Gawronski, M.; Nowak, G.; Nasiroglu, I.; Kubicki, D.

    2017-11-01

    In this paper, we gathered the new measurements in the originally submitted manuscript and the new observations published by Bours et al. (2014MNRAS.445.1924B). We verified that the results obtained without and with their measurements, respectively, differ only up to quantitative sense (i.e. the best-fitting parameters are slightly altered). With the aim of publishing the most up-to-date results possible, we re-analysed available timing data of the HU Aqr eclipses, which are collected in the appendix. Table A1 in this appendix collects mid-egress moments published in the literature, as well as our new data, which were used for the analysis of (O-C) in this paper. (1 data file).

  2. La voz y la letra en "Un huésped", de Yoko Tawada

    Directory of Open Access Journals (Sweden)

    María Lucía Correa

    2009-05-01

    Full Text Available Los textos de Yoko Tawada, escritorajaponesa residente en Alemania,hacen presente el desgarramientode quien vive fuera de la lenguamaterna. Es una obra que se balanceasobre el límite entre loscódigos, donde nada hay evidente,donde la palabra parece tener vidapropia. Entre los textos que tomanesta extrañeza del lenguaje comosustrato, se encuentra el relato"Un huésped", cuya particular referenciaa la voz y a la letra comodos registros que se entrelazan yse repelen alternativamente, loconvierte en una valiosa fuente dereflexiones sobre lo oral, la voz, laletra, la lectura y la escritura.Palabras clave: Yoko Tawada, literaturajaponesa contemporánea, voz,letra, escritura.

  3. Current Understanding on Antihepatocarcinoma Effects of Xiao Chai Hu Tang and Its Constituents

    Directory of Open Access Journals (Sweden)

    Ningning Zheng

    2013-01-01

    Full Text Available Xiao Chai Hu Tang (XCHT, a compound formula originally recorded in an ancient Chinese medical book Shanghanlun, has been used to treat chronic liver diseases for a long period of time in China. Although extensive studies have been demonstrated the efficacy of this formula to treat chronic hepatitis, hepatic fibrosis, and hepatocarcinoma, how it works against these diseases still awaits full understanding. Here, we firstly present an overview arranging from the entire formula to mechanism studies of single herb in XCHT and their active components, from a new perspective of “separation study,” and we tried our best to both detailedly and systematically organize the antihepatocarcinoma effects of it, hoping that the review will facilitate the strive on elucidating how XCHT elicits its antihepatocarcinoma role.

  4. ZASTOSOWANIE FUNKCJONAŁU HU-WASHIZU W PLASTYCZNEJ ANALIZIE MES PŁYT GRUBYCH

    OpenAIRE

    Lewandowski, Jakub; Kazimierz MYŚLECKI

    2016-01-01

    W pracy sformułowano oryginalny, autorski funkcjonał dla zagadnień teorii plastyczności. Podstawą był funkcjonał Hu-Washizu z teorii sprężystości. Przyrostowa postać funkcjonału pozwala w prosty sposób budować algorytmy MES. Zastosowanie funkcjonału przedstawiono na przykładzie płyty grubej. Zastosowano model warstwowy aby uwzględnić częściowe uplastycznienie przekroju płyty. Algorytm MES dla płyty grubej zbudowano w oparciu o trójkątny trzy węzłowy element skończony z liniowymi funkcjami ksz...

  5. Energy restriction affect liver development in Hu sheep ram lambs through Hippo signaling pathway.

    Science.gov (United States)

    Zhang, Ting-Ting; Zhang, Guo-Min; Jin, Yu-Hang; Guo, Yi-Xuan; Wang, Zhen; Fan, Yi-Xuan; El-Samahy, M A; Wang, Feng

    2017-10-01

    This study aimed to evaluate the effects of dietary energy restriction on postnatal liver development in Hu sheep ram lambs. A total of 16 ram lambs were randomly divided into two groups: 100% energy requirements diet and 55% energy requirements diet, which were fed for 75 d. Results showed that the final body and liver weights decreased with energy restriction (p Energy restriction caused a significant decrease in the levels of circulating insulin-like growth factor 1 (IGF1) and an increase in growth hormone secretion (p energy restriction, respectively (p energy restriction group (p energy restriction group (p energy restriction in ram lambs impairs liver development by increasing apoptosis, which may occur via the Hippo signaling pathway. Copyright © 2017 Elsevier Ltd. All rights reserved.

  6. The SCID-hu mouse as a tool in immunotoxicological risk assessment: Effects of 2-acetyl-4(5)-tetrahydroxybutyl-imidazole (THI) and di-n-butyltin dichloride (DBTC) on the human thymus in SCID-hu mice

    NARCIS (Netherlands)

    Heer, C. de; Schuurman, H.J.; Houben, G.F.; Pieters, R.H.H.; Penninks, A.H.; Loveren, H. van

    1995-01-01

    SCID mice engrafted with human fetal thymus and liver tissue fragments (SCID-hu mice) are currently considered as a new tool in human immunotoxicological risk assessment. Testing of various immunotoxicants exerting thymotoxicity via different intrathymic target cell types is necessary for validation

  7. Isolation and characterization of a catalase gene "HuCAT3" from pitaya (Hylocereus undatus) and its expression under abiotic stress.

    Science.gov (United States)

    Nie, Qiong; Gao, Guo-Li; Fan, Qing-jie; Qiao, Guang; Wen, Xiao-Peng; Liu, Tao; Peng, Zhi-Jun; Cai, Yong-Qiang

    2015-05-25

    Abiotic stresses usually cause H2O2 accumulation, with harmful effects, in plants. Catalase may play a key protective role in plant cells by detoxifying this excess H2O2. Pitaya (Hylocereus undatus) shows broad ecological adaptation due to its high tolerance to abiotic stresses, e.g. drought, heat and poor soil. However, involvement of the pitaya catalase gene (HuCAT) in tolerance to abiotic stresses is unknown. In the present study, a full-length HuCAT3 cDNA (1870 bp) was isolated from pitaya based on our previous microarray data and RACE method. The cDNA sequence and deduced amino acid sequence shared 73-77% and 75-80% identity with other plant catalases, respectively. HuCAT3 contains conserved catalase family domain and catalytic sites. Pairwise comparison and phylogenetic analysis indicated that HuCAT3 is most similar to Eriobotrya japonica CAT, followed by Dimocarpus longan CAT and Nicotiana tabacum CAT1. Expression profile analysis demonstrated that HuCAT3 is mainly expressed in green cotyledons and mature stems, and was regulated by H2O2, drought, cold and salt stress, whereas, its expression patterns and maximum expression levels varied with stress types. HuCAT activity increased as exposure to the tested stresses, and the fluctuation of HuCAT activity was consistent with HuCAT3 mRNA abundance (except for 0.5 days upon drought stress). HuCAT3 mRNA elevations and HuCAT activities changes under cold stress were also in conformity with the cold tolerances among the four genotypes. The obtained results confirmed a major role of HuCAT3 in abiotic stress response of pitaya. This may prove useful in understanding pitaya's high tolerance to abiotic stresses at molecular level. Copyright © 2015 Elsevier B.V. All rights reserved.

  8. Loss of Scribble Promotes Snail Translation through Translocation of HuR and Enhances Cancer Drug Resistance.

    Science.gov (United States)

    Zhou, Yi; Chang, Renxu; Ji, Weiwei; Wang, Na; Qi, Meiyan; Xu, Yi; Guo, Jingyu; Zhan, Lixing

    2016-01-01

    Drug resistance of cancer cells to various therapeutic agents and molecular targets is a major problem facing current cancer research. The tumor suppressor gene Scribble encodes a polarity protein that is conserved between Drosophila and mammals; loss of the locus disrupts cell polarity, inhibits apoptosis, and mediates cancer process. However, the role of Scribble in drug resistance remains unknown. We show here that knockdown of Scribble enhances drug resistance by permitting accumulation of Snail, which functions as a transcription factor during the epithelial-mesenchymal transition. Then, loss of Scribble activates the mRNA-binding protein human antigen R (HuR) by facilitating translocation of HuR from the nucleus to the cytoplasm. Furthermore, we demonstrate HuR can recognize AU-rich elements of the Snail-encoding mRNA, thereby regulating Snail translation. Moreover, loss of Scribble-induced HuR translocation mediates the accumulation of Snail via activation of the p38 MAPK pathway. Thus, this work clarifies the role of polarity protein Scribble, which is directly implicated in the regulation of developmental transcription factor Snail, and suggesting a mechanism for Scribble mediating cancer drug resistance. © 2016 by The American Society for Biochemistry and Molecular Biology, Inc.

  9. Comparison of the Debye–Hückel and the Mean Spherical Approximation Theories for Electrolyte Solutions

    DEFF Research Database (Denmark)

    Maribo-Mogensen, Bjørn; Kontogeorgis, Georgios M.; Thomsen, Kaj

    2012-01-01

    The thermodynamics of electrolyte solutions has been investigated by many scientists throughout the last century. While several theories have been presented, the most popular models for the electrostatic interactions are based on the Debye–Hückel and mean spherical approximation (MSA) theories...

  10. Draft Genome Sequence of Holospora undulata Strain HU1, a Micronucleus-Specific Symbiont of the Ciliate Paramecium caudatum.

    Science.gov (United States)

    Dohra, Hideo; Suzuki, Haruo; Suzuki, Tomohiro; Tanaka, Kenya; Fujishima, Masahiro

    2013-08-22

    Holospora undulata is a micronucleus-specific symbiont of the ciliate Paramecium caudatum. We report here the draft genome sequence of H. undulata strain HU1. This genome information will contribute to the study of symbiosis between H. undulata and the host P. caudatum.

  11. Antidepressant effects of curcumin and HU-211 coencapsulated solid lipid nanoparticles against corticosterone-induced cellular and animal models of major depression.

    Science.gov (United States)

    He, Xiaolie; Zhu, Yanjing; Wang, Mei; Jing, Guoxin; Zhu, Rongrong; Wang, Shilong

    Major depression is a complex neuropsychiatric disorder with few treatment approaches. The use of nontargeted antidepressants induced many side effects with their low efficacy. A more precise targeting strategy is to develop nanotechnology-based drug delivery systems; hence, we employed solid lipid nanoparticles (SLNs) to encapsulate HU-211 and curcumin (Cur). The antidepressant effects of the dual-drug nanoparticles (Cur/SLNs-HU-211) for major depression treatment were investigated in corticosterone-induced cellular and animal models of major depression. Cur/SLNs-HU-211 can effectively protect PC12 cells from corticosterone-induced apoptosis and can release more dopamine, which may be associated with the higher uptake of Cur/SLNs-HU-211 shown by cellular uptake behavior analysis. Additionally, Cur/SLNs-HU-211 significantly reduced the immobility time in forced swim test, enhanced fall latency in rotarod test, and improved the level of dopamine in mice blood. Cur/SLNs-HU-211 can deliver more Cur to the brain and thus produce a significant increase in neurotransmitters level in brain tissue, especially in the hippocampus and striatum. The results of Western blot and immunofluorescence revealed that Cur/SLNs-HU-211 can significantly enhance the expression of CB1, p-MEK1, and p-ERK1/2. Our study suggests that Cur/SLNs-HU-211 may have great potential for major depression treatment.

  12. Striatal synaptic dysfunction and hippocampal plasticity deficits in the Hu97/18 mouse model of Huntington disease.

    Directory of Open Access Journals (Sweden)

    Karolina Kolodziejczyk

    Full Text Available Huntington disease (HD is a fatal neurodegenerative disorder caused by a CAG repeat expansion in the gene (HTT encoding the huntingtin protein (HTT. This mutation leads to multiple cellular and synaptic alterations that are mimicked in many current HD animal models. However, the most commonly used, well-characterized HD models do not accurately reproduce the genetics of human disease. Recently, a new 'humanized' mouse model, termed Hu97/18, has been developed that genetically recapitulates human HD, including two human HTT alleles, no mouse Hdh alleles and heterozygosity of the HD mutation. Previously, behavioral and neuropathological testing in Hu97/18 mice revealed many features of HD, yet no electrophysiological measures were employed to investigate possible synaptic alterations. Here, we describe electrophysiological changes in the striatum and hippocampus of the Hu97/18 mice. At 9 months of age, a stage when cognitive deficits are fully developed and motor dysfunction is also evident, Hu97/18 striatal spiny projection neurons (SPNs exhibited small changes in membrane properties and lower amplitude and frequency of spontaneous excitatory postsynaptic currents (sEPSCs; however, release probability from presynaptic terminals was unaltered. Strikingly, these mice also exhibited a profound deficiency in long-term potentiation (LTP at CA3-to-CA1 synapses. In contrast, at 6 months of age we found only subtle alterations in SPN synaptic transmission, while 3-month old animals did not display any electrophysiologically detectable changes in the striatum and CA1 LTP was intact. Together, these data reveal robust, progressive deficits in synaptic function and plasticity in Hu97/18 mice, consistent with previously reported behavioral abnormalities, and suggest an optimal age (9 months for future electrophysiological assessment in preclinical studies of HD.

  13. PKC-mediated HuD-GAP43 pathway activation in a mouse model of antiretroviral painful neuropathy.

    Science.gov (United States)

    Sanna, M D; Quattrone, A; Ghelardini, C; Galeotti, N

    2014-03-01

    Patients treated with nucleoside reverse transcriptase inhibitors (NRTIs) develop painful neuropathies that lead to discontinuation of antiretroviral therapy thus limiting viral suppression strategies. The mechanisms by which NRTIs contribute to the development of neuropathy are not known. In order to elucidate the mechanisms underlying this drug-induced neuropathy, we have characterized cellular events in the central nervous system following antiretroviral treatment. Systemic administration of the antiretroviral agent, 2',3'-dideoxycytidine (ddC) considerably increased the expression and phosphorylation of protein kinase C (PKC) γ and ɛ, enzymes highly involved in pain processes, within periaqueductal grey matter (PAG), and, to a lesser extent, within thalamus and prefrontal cortex. These events appeared in coincidence with thermal and mechanical allodynia, but PKC blockade did not prevent the antiretroviral-induced pain hypersensitivity, ruling out a major involvement of PKC in the ddC-induced nociceptive behaviour. An increased expression of GAP43, a marker of neuroregeneration, and decreased levels of ATF3, a marker of neuroregeneration, were detected in all brain areas. ddC treatment also increased the expression of HuD, a RNA-binding protein target of PKC known to stabilize GAP43 mRNA. Pharmacological blockade of PKC prevented HuD and GAP43 overexpression. Silencing of both PKCγ and HuD reduced GAP43 levels in control mice and prevented the ddC-induced GAP43 enhanced expression. Present findings illustrate the presence of a supraspinal PKC-mediated HuD-GAP43 pathway activated by ddC. Based on our results, we speculate that antiretroviral drugs may recruit the HuD-GAP43 pathway, potentially contributing to a response to the antiretroviral neuronal toxicity. Copyright © 2014 Elsevier Ltd. All rights reserved.

  14. {sup 89}Zr-huJ591 immuno-PET imaging in patients with advanced metastatic prostate cancer

    Energy Technology Data Exchange (ETDEWEB)

    Pandit-Taskar, Neeta; Solomon, Stephen B.; Durack, Jeremy C.; Carrasquillo, Jorge A.; Lefkowitz, Robert A.; Osborne, Joseph R. [Memorial Sloan Kettering Cancer Center, Department of Radiology, New York, NY (United States); Weill Cornell Medical College, Department of Radiology, New York, NY (United States); O' Donoghue, Joseph A. [Memorial Sloan Kettering Cancer Center, Department of Medical Physics, New York, NY (United States); Beylergil, Volkan; Ruan, Shutian; Cheal, Sarah M. [Memorial Sloan Kettering Cancer Center, Department of Radiology, New York, NY (United States); Lyashchenko, Serge [Memorial Sloan Kettering Cancer Center, Department of Radiochemistry and Molecular Imaging Probes Core, New York, NY (United States); Gonen, Mithat [Memorial Sloan Kettering Cancer Center, Department of Epidemiology and Biostatistics, New York, NY (United States); Lewis, Jason S. [Memorial Sloan Kettering Cancer Center, Department of Radiology, New York, NY (United States); Memorial Sloan Kettering Cancer Center, Department of Radiochemistry and Molecular Imaging Probes Core, New York, NY (United States); Memorial Sloan Kettering Cancer Center, Program in Molecular Pharmacology and Chemistry, New York, NY (United States); Weill Cornell Medical College, Department of Radiology, New York, NY (United States); Holland, Jason P. [Memorial Sloan Kettering Cancer Center, Department of Radiology, New York, NY (United States); Harvard Medical School, Department of Radiology of Massachusetts General Hospital, Boston, MA (United States); Reuter, Victor E. [Memorial Sloan Kettering Cancer Center, Department of Pathology, New York, NY (United States); Weill Cornell Medical College, Department of Pathology, New York, NY (United States); Loda, Massimo F. [Dana-Farber Cancer Institute, Boston, MA (United States); Broad Institute of Harvard and MIT, Cambridge, MA (United States); Smith-Jones, Peter M. [Memorial Sloan Kettering Cancer Center, Department of Radiology, New York, NY (United States); Department of Psychiatry and Behavioral Science of Stony Brook University, Stony Brook, NY (United States); Weber, Wolfgang A.; Larson, Steven M. [Memorial Sloan Kettering Cancer Center, Department of Radiology, New York, NY (United States); Memorial Sloan Kettering Cancer Center, Program in Molecular Pharmacology and Chemistry, New York, NY (United States); Weill Cornell Medical College, Department of Radiology, New York, NY (United States); Bander, Neil H. [Memorial Sloan Kettering Cancer Center, Department of Surgery, New York, NY (United States); Weill Cornell Medical College, Department of Urology, New York, NY (United States); Scher, Howard I.; Morris, Michael J. [Memorial Sloan Kettering Cancer Center, Department of Medicine, New York, NY (United States); Weill Cornell Medical College, Department of Medicine, New York, NY (United States)

    2014-11-15

    Given the bone tropism of prostate cancer, conventional imaging modalities poorly identify or quantify metastatic disease. {sup 89}Zr-huJ591 positron emission tomography (PET) imaging was performed in patients with metastatic prostate cancer to analyze and validate this as an imaging biomarker for metastatic disease. The purpose of this initial study was to assess safety, biodistribution, normal organ dosimetry, and optimal imaging time post-injection for lesion detection. Ten patients with metastatic prostate cancer received 5 mCi of {sup 89}Zr-huJ591. Four whole-body scans with multiple whole-body count rate measurements and serum activity concentration measurements were obtained in all patients. Biodistribution, clearance, and lesion uptake by {sup 89}Zr-huJ591 immuno-PET imaging was analyzed and dosimetry was estimated using MIRD techniques. Initial assessment of lesion targeting of {sup 89}Zr-huJ591 was done. Optimal time for imaging post-injection was determined. The dose was well tolerated with mild chills and rigors seen in two patients. The clearance of {sup 89}Zr-huJ591 from serum was bi-exponential with biological half-lives of 7 ± 4.5 h (range 1.1-14 h) and 62 ± 13 h (range 51-89 h) for initial rapid and later slow phase. Whole-body biological clearance was 219 ± 48 h (range 153-317 h). The mean whole-body and liver residence time was 78.7 and 25.6 h, respectively. Dosimetric estimates to critical organs included liver 7.7 ± 1.5 cGy/mCi, renal cortex 3.5 ± 0.4 cGy/mCi, and bone marrow 1.2 ± 0.2 cGy/mCi. Optimal time for patient imaging after injection was 7 ± 1 days. Lesion targeting of bone or soft tissue was seen in all patients. Biopsies were performed in 8 patients for a total 12 lesions, all of which were histologically confirmed as metastatic prostate cancer. One biopsy-proven lesion was not positive on {sup 89}Zr-huJ591, while the remaining 11 lesions were {sup 89}Zr-huJ591 positive. Two biopsy-positive nodal lesions were noted only on

  15. Optimization of anti-CD20 humanized antibody hu8E4 by site-directed mutation based on epitope analysis.

    Science.gov (United States)

    Chen, Yalin; Chen, Lin; Lu, Qiong; Meng, Yanchun; Wang, Chao; Wang, Linfei; Wang, Huajing; Yu, Xiaojie; Zhang, Yajun; Zhao, Lei; Li, Bohua; Guo, Yajun

    2015-04-17

    Despite the effectiveness of the anti-CD20 chimeric antibody (mAb), rituximab, in treating B-cell lymphomas, its efficacy remains variable and often modest. Hu8E4 is an anti-CD20 humanized antibody which exhibits markedly higher antitumor activity compared with rituximab. Previous studies have indicated that rituximab and almost all known anti-CD20 murine mAbs recognize the A170/P172 motif within the large extracellular loop of CD20. In this study, we demonstrated that hu8E4 also recognized the A170/P172 motif, suggesting that the epitopes recognized by rituximab and hu8E4 are very similar. Based on this, three single mutations (D57E, Y102K and Y102T) at the heavy chain variable region that can improve the affinity of rituximab were transferred to hu8E4. The results showed that D57E and Y102T but not Y102K successfully enhanced the binding of hu8E4 to CD20. Out of these hu8E4 mutants, hu8E4D57E exhibited the highest affinity. The in vitro and in vivo antitumor activity of hu8E4D57E was further investigated. Our data indicated that hu8E4D57E was as effective as hu8E4 in mediating CDC and inducing apoptosis in B-lymphoma cells, but it was more potent in ADCC than hu8E4. Importantly, hu8E4D57E was shown to be significantly more effective than Hu8E4 in prolonging the survival of SCID mice bearing disseminated B-lymphoma cells, suggesting that it might be a promising therapeutic agent for B-cell lymphomas. Moreover, this study also suggests that the mutations that can improve the affinity of rituximab may be transferred to other anti-CD20 murine mAbs to enhance their binding to CD20. Copyright © 2015 Elsevier Inc. All rights reserved.

  16. Physical changes and physiological characteristics of red and green peel during nectarine (cv. Hu018) maturation.

    Science.gov (United States)

    Su, Mingshen; Chen, Kunsong; Ye, Zhengwen; Zhang, Bo; Guo, Juan; Xu, Changjie; Sun, Chongde; Zhang, Jiukai; Li, Xian; Wu, Aizhong; Xi, Wanpeng

    2012-05-01

    The aim of this study was to determine physical changes in nectarine and distinctive physiological characteristics related to red and green peel under stresses occurring during fruit maturation, information on which is currently not available. Fruit firmness increased from 4 to 6 weeks after blooming (WAB) then decreased from 6 WAB until ripening. Anthocyanins in red and green peel during nectarine maturation were identified by high-performance liquid chromatography as cyanidin 3-glucoside together and, at a much lower level, cyanidin 3-rutinoside. Cyanidins in red and green peel decreased from 4 to 8 WAB then increased from 8 to 12 WAB. Anthocyanin contents were positively correlated with PAL, POD, A*, MDA and O2(·-) values and inversely correlated with L* and B* values. Red and green peel during maturation could be separated by hierarchical cluster analysis of the tested data. This study has provided an overview of red and green peel characteristics during nectarine (cv. Hu018) maturation. Values of A*, anthocyanins, O2(·-), MDA, PAL, PPO and POD in red peel were higher than those in green peel, while values of L*, B* and chroma in red peel were lower than those in green peel throughout fruit maturation. Copyright © 2011 Society of Chemical Industry.

  17. A dynamical system approach to Bianchi III cosmology for Hu-Sawicki type f( R) gravity

    Science.gov (United States)

    Banik, Sebika Kangsha; Banik, Debika Kangsha; Bhuyan, Kalyan

    2018-02-01

    The cosmological dynamics of spatially homogeneous but anisotropic Bianchi type-III space-time is investigated in presence of a perfect fluid within the framework of Hu-Sawicki model. We use the dynamical system approach to perform a detailed analysis of the cosmological behaviour of this model for the model parameters n=1, c_1=1, determining all the fixed points, their stability and corresponding cosmological evolution. We have found stable fixed points with de Sitter solution along with unstable radiation like fixed points. We have identified a matter like point which act like an unstable spiral and when the initial conditions of a trajectory are very close to this point, it stabilizes at a stable accelerating point. Thus, in this model, the universe can naturally approach to a phase of accelerated expansion following a radiation or a matter dominated phase. It is also found that the isotropisation of this model is affected by the spatial curvature and that all the isotropic fixed points are found to be spatially flat.

  18. China’s Foreign- and Security-policy Decision-making Processes under Hu Jintao

    Directory of Open Access Journals (Sweden)

    Jean-Pierre Cabestan

    2009-10-01

    Full Text Available Since 1979, foreign- and security-policy-making and implementation processes have gradually and substantially changed. New modes of operation that have consolidated under Hu Jintao, actually took shape under Jiang Zemin in the 1990s, and some, under Deng Xiaoping. While the military’s role has diminished, that of diplomats, experts, and bureaucracies dealing with trade, international economic relations, energy, propaganda and education has increased. Decision making in this area has remained highly centralized and concentrated in the supreme leading bodies of the Chinese Communist Party (CCP. However, China’s globalization and decentralization, as well as the increasing complexity of its international interests, have intensified the need to better coordinate the activities of the various CCP and state organs involved in foreign and security policy; hence, the growing importance of the CCP leading small groups (foreign affairs, national security, Taiwan, etc.. But the rigidity of the current institutional pattern has so far foiled repeated attempts to establish a National Security Council.

  19. Managing Stability in the Taiwan Strait: Non-Military Policy towards Taiwan under Hu Jintao

    Directory of Open Access Journals (Sweden)

    Wu-ueh Chang

    2009-10-01

    Full Text Available China’s Taiwan policy has been one of coupling intimidation (the “stick” approach with coercion (the “carrot” approach, a policy mix which, in the near term, is not likely to change, as is evidenced by the passage of the “Anti-Secession Law” in March, 2005. However, under Hu Jintao, the focus has been on pragmatism. The warm atmosphere that presently reigns in the Taiwan Strait area is unprecedented. Further talks are expected before the two cross-Strait leaders are slated to step down, simultaneously, in 2012. An era of reconciliation and negotiations has dawned. For the first time there is consensus regarding norms of interaction between the two sides. Cross-Strait relations have stabilized after years of tumult. More open, stable and predictable cross-Strait relations are in the interests of both sides. Difficulties surely lie ahead, but they will be dealt with in a different manner than what has been witnessed in the past.

  20. Distinct roles for hu li tai shao and swallow in cytoskeletal organization during Drosophila oogenesis.

    Science.gov (United States)

    Pokrywka, Nancy Jo; Zhang, Huadi; Raley-Susman, Kathleen

    2014-07-01

    Cytoskeletal organization is essential for localization of developmentally significant molecules during Drosophila oogenesis. Swallow (Swa) and an isoform of Hu li tai shao (Ovhts-RC) have been implicated in the organization of actin filaments in developing oocytes but their precise roles have been obscured by the dependence of hts RNA localization on swa function. The functional significance of hts RNA localization in the oocyte has not been established. In this study we examine Ovhts-RC distribution and cytoskeletal organization under conditions in which Swa protein and/or hts RNA localization are perturbed. We find Swa is required for overall actin organization and for the maintenance of a distinct subset of microtubules in the oocyte. hts RNA localization modulates the distribution of Ovhts-RC in the oocyte and, in turn, local actin filament proliferation. Our results support separate contributions of Swa and hts RNA localization to actin organization during oogenesis. Swa is crucial for the organization of actin networks that lead to the formation of a specialized microtubule population, while Ovhts-RC acts to modulate spatially restricted actin filament growth at the oocyte cortex. This suggests RNA localization can lead to modifications of both the actin and microtubule cytoskeletons at specific subcellular locales. © 2014 The Authors Developmental Dynamics published by Wiley Periodicals, Inc. on behalf of American Association of Anatomists.

  1. Molecularly Imprinted Polymers for Selective Extraction of Oblongifolin C from Garcinia yunnanensis Hu.

    Science.gov (United States)

    Wang, Liping; Fu, Wenwei; Shen, Yunhui; Tan, Hongsheng; Xu, Hongxi

    2017-03-23

    Molecularly imprinted polymers (MIPs) were synthesized and applied for the selective extraction of oblongifolin C (OC) from fruit extracts of Garcinia yunnanensis Hu. A series of experiments and computational approaches were employed to improve the efficiency of screening for optimal MIP systems in the study. The molar ratio (1:4) was eventually chosen based on the comparison of the binding energy of the complexes between the template (OC) and the functional monomers using density functional theory (DFT) at the RI-PBE-D3-gCP/def2-TZVP level of theory. The binding characterization and the molecular recognition mechanism of MIPs were further explained using the molecular modeling method along with NMR and IR spectra data. The reusability of this approach was demonstrated in over 20 batch rebinding experiments. A mass of 140.5 mg of OC (>95% purity) was obtained from the 5 g extracts, with 2 g of MIPs with the best binding properties, through a gradient elution program from 35% to 70% methanol-water solution. At the same time, another structural analog, 46.5 mg of guttiferone K (GK) (>88% purity), was also obtained by the gradient elution procedure. Our results showed that the structural analogs could be separated from the crude extracts by the molecularly imprinted solid-phase extraction (MISPE) using a gradient elution procedure for the first time.

  2. Systematics of a kleptoplastidal dinoflagellate, Gymnodinium eucyaneum Hu (Dinophyceae), and its cryptomonad endosymbiont.

    Science.gov (United States)

    Xia, Shuang; Zhang, Qi; Zhu, Huan; Cheng, Yingyin; Liu, Guoxiang; Hu, Zhengyu

    2013-01-01

    New specimens of the kleptoplastidal dinoflagellate Gymnodinium eucyaneum Hu were collected in China. We investigated the systematics of the dinoflagellate and the origin of its endosymbiont based on light morphology and phylogenetic analyses using multiple DNA sequences. Cells were dorsoventrally flattened with a sharply acute hypocone and a hemispherical epicone. The confusion between G. eucyaneum and G. acidotum Nygaard still needs to be resolved. We found that the hypocone was conspicuously larger than the epicone in most G. eucyaneum cells, which differed from G. acidotum, but there were a few cells whose hypocone and epicone were of nearly the same size. In addition, there was only one site difference in the partial nuclear LSU rDNA sequences of a sample from Japan given the name G. acidotum and G. eucyaneum in the present study, which suggest that G. eucyaneum may be a synonym of G. acidotum. Spectroscopic analyses and phylogenetic analyses based on nucleomorph SSU rDNA sequences and chloroplast 23 s rDNA sequences suggested that the endosymbiont of G. eucyaneum was derived from Chroomonas (Cryptophyta), and that it was most closely related to C. coerulea Skuja. Moreover, the newly reported kleptoplastidal dinoflagellates G. myriopyrenoides and G. eucyaneum in our study were very similar, and the taxonomy of kleptoplastidal dinoflagellates was discussed.

  3. An in vitro model for Pelger-Huët anomaly

    Science.gov (United States)

    Olins, Ada L; Ernst, Aurélie; Zwerger, Monika; Herrmann, Harald

    2010-01-01

    The principal human blood granulocyte (neutrophil) possesses a lobulated and deformable nucleus, important to facilitate rapid egress from blood vessels as these cells migrate to sites of bacterial or fungal infection. This unusual nuclear shape is a product of elevated levels of an integral membrane protein of the nuclear envelope lamin B receptor (LBR) and of decreased amounts of lamin A/C. In humans, a genetic deficiency of LBR produces Pelger-Huët anomaly, resulting in blood neutrophils that exhibit hypolobulated nuclei with redistributed heterochromatin. Structural changes in nuclear architecture occur during granulopoiesis within bone marrow. The exact mechanisms of this nuclear shape change and of heterochromatin redistribution remain largely unknown. As a tool to facilitate analysis of these mechanisms, a stable LBR knockdown subline of HL-60 cells was established. During in vitro granulopoiesis induced with retinoic acid, the LBR knockdown cells retain an ovoid shaped nucleus with reduced levels of lamin A/C; while, the parent cells develop highly lobulated nuclei. In contrast, macrophage forms induced in LBR knockdown cells by in vitro treatment with phorbol ester were indistinguishable from the parent cells, judged by both nuclear shape and attached cell morphology. The capability of differentiation of LBR knockdown HL-60 cells should facilitate a detailed analysis of the molecular relationship between LBR levels, granulocyte nuclear shape and heterochromatin distribution. PMID:21327094

  4. Smaller Neuroblastoma Tumors in Mice Intratumorally Treated with Hu14.18-IL2 Have More Activated Tumor-Infiltrating Lymphocytes and Better Outcome

    Science.gov (United States)

    Yang, Richard K.; Kalogriopoulos, Nicholas A.; Rakhmilevich, Alexander L.; Ranheim, Erik A.; Seo, Songwon; Kim, KyungMann; Alderson, Kory L.; Gan, Jacek; Reisfeld, Ralph A.; Gillies, Stephen D.; Hank, Jacquelyn A.; Sondel, Paul M.

    2013-01-01

    Hu14.18-IL2 is an immunocytokine (IC) consisting of human IL-2 linked to hu14.18 mAb, which recognizes GD2 disialoganglioside. Phase II clinical trials of intravenous-hu14.18-IL2 (IV-IC) in neuroblastoma and melanoma are underway, and have already demonstrated activity in neuroblastoma. In our Phase II trial, lower neuroblastoma burden at the time of treatment was associated with a greater likelihood of clinical response to IV-IC. We have previously shown that intratumoral-hu14.18-IL2 (IT-IC) compared to IV-IC results in enhanced local and systemic antitumor activity in tumor-bearing mice. We utilized a mouse model to investigate the impact of tumor burden on hu14.18-IL2 treatment efficacy in IV vs IT treated animals. Studies presented here describe analyses of tumor burden at initiation of treatment and its effects on treatment efficacy, survival and tumor-infiltrating leukocytes in A/J mice bearing subcutaneous NXS2 neuroblastoma. We show that smaller tumor burden at treatment initiation is associated with increased infiltration of NK and CD8+T cells and increased overall survival. NXS2 tumor shrinkage shortly after completion of the 3 days of hu14.18-IL2 treatment is necessary for long-term survival. This model demonstrates that tumor size is a strong predictor of hu14.18-IL2-induced lymphocyte infiltration and treatment outcome. PMID:23661160

  5. Construction of a eukaryotic expression plasmid pcDNA3.1-HuR-FLAG and its transient expression in NIH3T3 cells

    Directory of Open Access Journals (Sweden)

    Tao LI

    2011-04-01

    Full Text Available Objective To construct a eukaryotic expression vector for HuR and analyze its expression and biological function in NIH3T3 cells.Methods The total RNA was extracted from NIH3T3 cells and reverse transcribed to cDNAs.The coding region sequence of mouse HuR was then amplified by PCR and subcloned into the pcDNA3.1-FLAG plasmid.The recombinant plasmid pcDNA3.1-HuR-FLAG was verified by PCR and restriction endonuclease analysis,confirmed by DNA sequence analysis,and then transiently transfected into NIH3T3 cells with Lipofectamine LTX.The expression of HuR protein was determined by Western blotting,and the mRNA level of HuR and DUSP1 were analyzed by using real-time PCR.Result The recombinant plasmid pcDNA3.1-HuR-FLAG was correctly constructed.Twenty-four hours after transfection of the recombinant plasmid into NIH3T3 cells,the fusion protein was found to have highly expressed in the cells as revealed by Western blotting.Real-time PCR results detected that the over-expression of HuR could up-regulate the expression of DUSP1.Conclusion The eukaryotic expression vector for HuR-FLAG fusion protein has been successfully constructed and transiently expressed in NIH3T3 cells.It can be used in further analysis of the posttranscriptional regulation of DUSP1 by HuR in cancer cells.

  6. HuD and the Survival Motor Neuron Protein Interact in Motoneurons and Are Essential for Motoneuron Development, Function, and mRNA Regulation.

    Science.gov (United States)

    Hao le, Thi; Duy, Phan Q; An, Min; Talbot, Jared; Iyer, Chitra C; Wolman, Marc; Beattie, Christine E

    2017-11-29

    Motoneurons establish a critical link between the CNS and muscles. If motoneurons do not develop correctly, they cannot form the required connections, resulting in movement defects or paralysis. Compromised development can also lead to degeneration because the motoneuron is not set up to function properly. Little is known, however, regarding the mechanisms that control vertebrate motoneuron development, particularly the later stages of axon branch and dendrite formation. The motoneuron disease spinal muscular atrophy (SMA) is caused by low levels of the survival motor neuron (SMN) protein leading to defects in vertebrate motoneuron development and synapse formation. Here we show using zebrafish as a model system that SMN interacts with the RNA binding protein (RBP) HuD in motoneurons in vivo during formation of axonal branches and dendrites. To determine the function of HuD in motoneurons, we generated zebrafish HuD mutants and found that they exhibited decreased motor axon branches, dramatically fewer dendrites, and movement defects. These same phenotypes are present in animals expressing low levels of SMN, indicating that both proteins function in motoneuron development. HuD binds and transports mRNAs and one of its target mRNAs, Gap43, is involved in axonal outgrowth. We found that Gap43 was decreased in both HuD and SMN mutants. Importantly, transgenic expression of HuD in motoneurons of SMN mutants rescued the motoneuron defects, the movement defects, and Gap43 mRNA levels. These data support that the interaction between SMN and HuD is critical for motoneuron development and point to a role for RBPs in SMA.SIGNIFICANCE STATEMENT In zebrafish models of the motoneuron disease spinal muscular atrophy (SMA), motor axons fail to form the normal extent of axonal branches and dendrites leading to decreased motor function. SMA is caused by low levels of the survival motor neuron (SMN) protein. We show in motoneurons in vivo that SMN interacts with the RNA binding

  7. Alginate hydrogel protects encapsulated hepatic HuH-7 cells against hepatitis C virus and other viral infections.

    Directory of Open Access Journals (Sweden)

    Nhu-Mai Tran

    Full Text Available Cell microencapsulation in alginate hydrogel has shown interesting applications in regenerative medicine and the biomedical field through implantation of encapsulated tissue or for bioartificial organ development. Although alginate solution is known to have low antiviral activity, the same property regarding alginate gel has not yet been studied. The aim of this work is to investigate the potential protective effect of alginate encapsulation against hepatitis C virus (HCV infection for a hepatic cell line (HuH-7 normally permissive to the virus. Our results showed that alginate hydrogel protects HuH-7 cells against HCV when the supernatant was loaded with HCV. In addition, alginate hydrogel blocked HCV particle release out of the beads when the HuH-7 cells were previously infected and encapsulated. There was evidence of interaction between the molecules of alginate hydrogel and HCV, which was dose- and incubation time-dependent. The protective efficiency of alginate hydrogel towards HCV infection was confirmed against a variety of viruses, whether or not they were enveloped. This promising interaction between an alginate matrix and viruses, whose chemical mechanisms are discussed, is of great interest for further medical therapeutic applications based on tissue engineering.

  8. A Conjugated Aptamer-Gold Nanoparticle Fluorescent Probe for Highly Sensitive Detection of rHuEPO-α

    Directory of Open Access Journals (Sweden)

    Zhaoyang Zhang

    2011-11-01

    Full Text Available We present here a novel conjugated aptamer-gold nanoparticle (Apt-AuNPs fluorescent probe and its application for specific detection of recombinant human erythropoietin-α (rHuEPO-α. In this nanobiosensor, 12 nm AuNPs function as both a nano-scaffold and a nano-quencher (fluorescent energy acceptor, on the surface of which the complementary sequences are linked (as cODN-AuNPs and pre-hybridized with carboxymethylfluorescein (FAM-labeled anti-rHuEPO-α aptamers. Upon target protein binding, the aptamers can be released from the AuNP surface and the fluorescence signal is restored. Key variables such as the length of linker, the hybridization site and length have been designed and optimized. Full performance evaluation including sensitivity, linear range and interference substances are also described. This nanobiosensor provides a promising approach for a simple and direct quantification of rHuEPO-α concentrations as low as 0.92 nM within a few hours.

  9. Cannabinoid HU210 Protects Isolated Rat Stomach against Impairment Caused by Serum of Rats with Experimental Acute Pancreatitis

    Science.gov (United States)

    Cao, Ming-hua; Li, Yong-yu; Xu, Jing; Feng, Ya-jing; Lin, Xu-hong; Li, Kun; Han, Tong; Chen, Chang-Jie

    2012-01-01

    Acute pancreatitis (AP), especially severe acute pancreatitis often causes extra-pancreatic complications, such as acute gastrointestinal mucosal lesion (AGML) which is accompanied by a considerably high mortality, yet the pathogenesis of AP-induced AGML is still not fully understood. In this report, we investigated the alterations of serum components and gastric endocrine and exocrine functions in rats with experimental acute pancreatitis, and studied the possible contributions of these alterations in the pathogenesis of AGML. In addition, we explored the intervention effects of cannabinoid receptor agonist HU210 and antagonist AM251 on isolated and serum-perfused rat stomach. Our results showed that the AGML occurred after 5 h of AP replication, and the body homeostasis was disturbed in AP rat, with increased levels of pancreatic enzymes, lipopolysaccharide (LPS), proinflammtory cytokines and chemokines in the blood, and an imbalance of the gastric secretion function. Perfusing the isolated rat stomach with the AP rat serum caused morphological changes in the stomach, accompanied with a significant increment of pepsin and [H+] release, and increased gastrin and decreased somatostatin secretion. HU210 reversed the AP-serum-induced rat pathological alterations, including the reversal of transformation of the gastric morphology to certain degree. The results from this study prove that the inflammatory responses and the imbalance of the gastric secretion during the development of AP are responsible for the pathogenesis of AGML, and suggest the therapeutic potential of HU210 for AGML associated with acute pancreatitis. PMID:23285225

  10. Effect of route of infection on outcome of Toxoplasma gondii infection in hu-PBL SCID mice.

    Science.gov (United States)

    Meyer, Desiree J; Allan, Jane E; Beaman, Miles H

    2013-03-01

    Toxoplasma gondii (T. gondii) causes serious infection, especially in immunocompromised hosts. The relevance of animal models of toxoplasmosis to human disease is unclear, but have indicated that the route of Toxoplasma infection may affect the outcome. A humanized model of toxoplasmosis of immunocompromised mice (i.e. hu-PBL SCID), using the intraperitoneal (IP) route demonstrated long-term engraftment of human cells and worsening of inflammation compared to controls. In this study, we examined the effect of route of infection on this hu-PBL SCID model using a Toxoplasma strain (i.e. DAG) isolated from an immunocompromised human. Oral infection led to an asymptomatic infection, whereas animals infected by the IP route succumbed more quickly to infection. Human cells, detected through species-specific β-actin mRNA, were not as prominent in IP-infected animals as compared to orally infected and uninfected animals. There was evidence of control of toxoplasmosis in some orally infected animals, and this was associated with the presence of human cells in multiple tissues. Thus, the route of infection dramatically affects the outcome of infection, either by affecting parasite replication or expansion of human immune cells. Further studies of oral Toxoplasma infection using hu-PBL SCID mice may help in developing chemotherapies and immunotherapeutic strategies for toxoplasmosis.

  11. Comment on "Tropospheric temperature response to stratospheric ozone recovery in the 21st century" by Hu et al. (2011

    Directory of Open Access Journals (Sweden)

    C. McLandress

    2012-03-01

    Full Text Available In a recent paper Hu et al. (2011 suggest that the recovery of stratospheric ozone during the first half of this century will significantly enhance free tropospheric and surface warming caused by the anthropogenic increase of greenhouse gases, with the effects being most pronounced in Northern Hemisphere middle and high latitudes. These surprising results are based on a multi-model analysis of CMIP3 model simulations with and without prescribed stratospheric ozone recovery. Hu et al. suggest that in order to properly quantify the tropospheric and surface temperature response to stratospheric ozone recovery, it is necessary to run coupled atmosphere-ocean climate models with stratospheric ozone chemistry. The results of such an experiment are presented here, using a state-of-the-art chemistry-climate model coupled to a three-dimensional ocean model. In contrast to Hu et al., we find a much smaller Northern Hemisphere tropospheric temperature response to ozone recovery, which is of opposite sign. We suggest that their result is an artifact of the incomplete removal of the large effect of greenhouse gas warming between the two different sets of models.

  12. Bone and muscle assessment in patients undergoing total hip arthroplasty using HU based analysis

    Directory of Open Access Journals (Sweden)

    Þröstur Pétursson

    2012-09-01

    Full Text Available Total hip arthroplasty (THA is performed with or without the use of bone cement. The lack of reliable clinical guidelines for deciding which one to implement has encouraged this approach of joint clinical and engineering with the following objectives: 1. Validate quadriceps muscles and femur bone atrophy by extracting the mineral density from Computer Tomographic (CT images. 2. Validate computational processes based on 3-D modeling and Finite Element Methods (FEM. A clinical trial was started, where 36 volunteer patients underwent THA surgery for the first time: 18 receiving cemented implant and 18 receiving uncemented implant. The patients were CT scanned prior-, immediately after and 12 months post-surgery. The CT data are further processed to segment muscles and bones and to create 3D-models for the simulation and for calculating bone mineral density (BMD. Furthermore quadriceps muscle density Hounsfield (HU based value is calculated from the segmented file on healthy and operated leg. These preliminary results indicate computational tools and methods that are able to quantitatively analyse patient’s condition pre and post-surgery. The BMD and muscle density measurement in correlation with the fracture risk analysis display a potential method for eligibility to receive non-cemented implant; the preliminary results show that also elderly that according with current clinical evaluation receives a cemented implant are suitable for the non-cemented type. The risk for structural failure during THA surgery is estimated by calculating femoral bone fracture risk index (FRI as a ratio between compressive stress during surgery and estimated failure stress on bone. The correlations with the BMD observations during the clinical trial will assess and validate this potential predictor tool.

  13. Effects of Bai-Hu decoction on fever induced by lipopolysaccharide

    Directory of Open Access Journals (Sweden)

    Li-Long Jia

    2013-03-01

    Full Text Available This study was designed to investigate the antifebrile effect and mechanisms of Bai-Hu decoction (BHD, a traditional Chinese medical (TCM prescription. The rabbits used in this study received an intravenous injection of lipopolysaccharide (LPS after being orally administered with BHD, ibuprofen, or saline, and their rectal temperatures were monitored by a copper–constantan thermocouple. Concentrations of interleukin-1 beta (IL-1β and tumor necrosis factor alpha (TNF-α in serum and hypothalamus were assayed using the commercially available rabbit IL-1β and TNF-α enzyme-linked immunosorbent assay kits following the manufacturer’s instructions. The BHD treatment group exhibited a significant fall in body temperature in both peaks compared with the LPS group (p<0.05. BHD reduced the concentrations of IL-1β and TNF-α in serum, and of TNF-α in hypothalamus to control the febrile responses at 1 hour. Besides the levels of IL-1β in hypothalamus and serum, the concentration of TNF-α in hypothalamus was decreased remarkably in the BHD group than in the LPS group at 3 hours. The main findings, the partial mechanisms of BHD in reducing biphasic fever elicited by LPS, were that treatments with the crude extract of BHD could remarkably reduce the increased concentrations of IL-1β and TNF-α, not only in serum but also in hypothalamus. The results indicated that BHD would be a valuable candidate for further investigation as a traditional antifebrile and anti-inflammatory natural drug.

  14. ZASTOSOWANIE FUNKCJONAŁU HU-WASHIZU W PLASTYCZNEJ ANALIZIE MES PŁYT GRUBYCH

    Directory of Open Access Journals (Sweden)

    Jakub LEWANDOWSKI

    2016-07-01

    Full Text Available W pracy sformułowano oryginalny, autorski funkcjonał dla zagadnień teorii plastyczności. Podstawą był funkcjonał Hu-Washizu z teorii sprężystości. Przyrostowa postać funkcjonału pozwala w prosty sposób budować algorytmy MES. Zastosowanie funkcjonału przedstawiono na przykładzie płyty grubej. Zastosowano model warstwowy aby uwzględnić częściowe uplastycznienie przekroju płyty. Algorytm MES dla płyty grubej zbudowano w oparciu o trójkątny trzy węzłowy element skończony z liniowymi funkcjami kształtu dla wszystkich przemieszczeń uogólnionych. Naprężenia i odkształcenia w tego typu elemencie przyjmuje się jako stałe. Przedstawiony algorytm nie wymaga żadnych dodatkowych równań teorii plastyczności i jest równoważny stowarzyszonemu prawu płynięcia plastycznego. Algorytm prowadzi do nieliniowego, przyrostowego układu równań algebraicznych, który rozwiązuje się metodą Newtona. Kilka prostych przykładów pozytywnie weryfikuje przyjęte założenia i stosowane algorytmy.

  15. Publicidad y consumo de alimentos en estudiantes de Huánuco (Perú

    Directory of Open Access Journals (Sweden)

    María Luisa Sevillano García

    2012-10-01

    Full Text Available Las importantes carencias nutritivas apreciadas en estudiantes del distrito de Huánuco (Perú, junto con la publicidad televisiva de productos de dudosa calidad nutricional observada, nos llevó a plantear y desarrollar una investigación con el objeto de analizar la relación entre ambos fenómenos titulada: Influencia de los anuncios televisivos en el consumo de alimentos publicitados durante el 2010, cuyo resumen se presenta en este artículo. En la investigación planteamos un estudio correlacional con una muestra de 120 escolares de diversas instituciones educativas, a quienes se aplicaron satisfactoriamente encuestas, entrevistas y guía de evaluación física; también se analizó la publicidad emitida por los canales de televisión sobre alimentos y su contenido nutricional. El análisis inferencial aplicado fue Ji cuadrado (?2. Con esta investigación se ha demostrado que el estado de salud de los escolares está afectado, siendo muy agudo respecto a la caries dental, problema que se atribuye al consumo de ciertos alimentos. Se constata que existe relación positiva, con alta significancia estadística, entre la adherencia a los anuncios televisivos y el consumo de alimentos publicitados de alto contenido en sodio, calcio, azúcar y de calorías por los escolares estudiados; así mismo, se prueba la interdependencia entre la exposición a los anuncios televisivos y el consumo de alimentos con productos de alto contenido en grasa que merecen ser vigilados y controlados por los responsables.

  16. HuMiTar: A sequence-based method for prediction of human microRNA targets

    Directory of Open Access Journals (Sweden)

    Chen Ke

    2008-12-01

    Full Text Available Abstract Background MicroRNAs (miRs are small noncoding RNAs that bind to complementary/partially complementary sites in the 3' untranslated regions of target genes to regulate protein production of the target transcript and to induce mRNA degradation or mRNA cleavage. The ability to perform accurate, high-throughput identification of physiologically active miR targets would enable functional characterization of individual miRs. Current target prediction methods include traditional approaches that are based on specific base-pairing rules in the miR's seed region and implementation of cross-species conservation of the target site, and machine learning (ML methods that explore patterns that contrast true and false miR-mRNA duplexes. However, in the case of the traditional methods research shows that some seed region matches that are conserved are false positives and that some of the experimentally validated target sites are not conserved. Results We present HuMiTar, a computational method for identifying common targets of miRs, which is based on a scoring function that considers base-pairing for both seed and non-seed positions for human miR-mRNA duplexes. Our design shows that certain non-seed miR nucleotides, such as 14, 18, 13, 11, and 17, are characterized by a strong bias towards formation of Watson-Crick pairing. We contrasted HuMiTar with several representative competing methods on two sets of human miR targets and a set of ten glioblastoma oncogenes. Comparison with the two best performing traditional methods, PicTar and TargetScanS, and a representative ML method that considers the non-seed positions, NBmiRTar, shows that HuMiTar predictions include majority of the predictions of the other three methods. At the same time, the proposed method is also capable of finding more true positive targets as a trade-off for an increased number of predictions. Genome-wide predictions show that the proposed method is characterized by 1.99 signal

  17. miR-29b, miR-205 and miR-221 enhance chemosensitivity to gemcitabine in HuH28 human cholangiocarcinoma cells.

    Directory of Open Access Journals (Sweden)

    Kinya Okamoto

    Full Text Available BACKGROUND AND AIMS: Cholangiocarcinoma (CCA is highly resistant to chemotherapy, including gemcitabine (Gem treatment. MicroRNAs (miRNAs are endogenous, non-coding, short RNAs that can regulate multiple genes expression. Some miRNAs play important roles in the chemosensitivity of tumors. Here, we examined the relationship between miRNA expression and the sensitivity of CCA cells to Gem. METHODS: Microarray analysis was used to determine the miRNA expression profiles of two CCA cell lines, HuH28 and HuCCT1. To determine the effect of candidate miRNAs on Gem sensitivity, expression of each candidate miRNA was modified via either transfection of a miRNA mimic or transfection of an anti-oligonucleotide. Ontology-based programs were used to identify potential target genes of candidate miRNAs that were confirmed to affect the Gem sensitivity of CCA cells. RESULTS: HuCCT1 cells were more sensitive to Gem than were HuH28 cells, and 18 miRNAs were differentially expressed whose ratios over ± 2log2 between HuH28 and HuCCT1. Among these 18 miRNAs, ectopic overexpression of each of three downregulated miRNAs in HuH28 (miR-29b, miR-205, miR-221 restored Gem sensitivity to HuH28. Suppression of one upregulated miRNA in HuH28, miR-125a-5p, inhibited HuH28 cell proliferation independently to Gem treatment. Selective siRNA-mediated downregulation of either of two software-predicted targets, PIK3R1 (target of miR-29b and miR-221 or MMP-2 (target of miR-29b, also conferred Gem sensitivity to HuH28. CONCLUSIONS: miRNA expression profiling was used to identify key miRNAs that regulate Gem sensitivity in CCA cells, and software that predicts miRNA targets was used to identify promising target genes for anti-tumor therapies.

  18. PKCε promotes HuD-mediated neprilysin mRNA stability and enhances neprilysin-induced Aβ degradation in brain neurons.

    Directory of Open Access Journals (Sweden)

    Chol Seung Lim

    Full Text Available Amyloid-beta (Aβ peptide accumulation in the brain is a pathological hallmark of all forms of Alzheimer's disease. An imbalance between Aβ production and clearance from the brain may contribute to accumulation of neurotoxic Aβ and subsequent synaptic loss, which is the strongest correlate of the extent of memory loss in AD. The activity of neprilysin (NEP, a potent Aβ-degrading enzyme, is decreased in the AD brain. Expression of HuD, an mRNA-binding protein important for synaptogenesis and neuronal plasticity, is also decreased in the AD brain. HuD is regulated by protein kinase Cε (PKCε, and we previously demonstrated that PKCε activation decreases Aβ levels. We hypothesized that PKCε acts through HuD to stabilize NEP mRNA, modulate its localization, and support NEP activity. Conversely, loss of PKCε-activated HuD in AD leads to decreased NEP activity and accumulation of Aβ. Here we show that HuD is associated with NEP mRNA in cultures of human SK-N-SH cells. Treatment with bryostatin, a PKCε-selective activator, enhanced NEP association with HuD and increased NEP mRNA stability. Activation of PKCε also increased NEP protein levels, increased NEP phosphorylation, and induced cell surface expression. In addition, specific PKCε activation directly stimulated NEP activity, leading to degradation of a monomeric form of Aβ peptide and decreased Aβ neuronal toxicity, as measured by cell viability. Bryostatin treatment also rescued Aβ-mediated inhibition of HuD-NEP mRNA binding, NEP protein expression, and NEP cell membrane translocation. These results suggest that PKCε activation reduces Aβ by up-regulating, via the mRNA-binding protein HuD, Aβ-degrading enzymes such as NEP. Thus, PKCε activation may have therapeutic efficacy for AD by reducing neurotoxic Aβ accumulation as well as having direct anti-apoptotic and synaptogenic effects.

  19. Changes in Cellular mRNA Stability, Splicing, and Polyadenylation through HuR Protein Sequestration by a Cytoplasmic RNA Virus

    Directory of Open Access Journals (Sweden)

    Michael D. Barnhart

    2013-11-01

    Full Text Available The impact of RNA viruses on the posttranscriptional regulation of cellular gene expression is unclear. Sindbis virus causes a dramatic relocalization of the cellular HuR protein from the nucleus to the cytoplasm in infected cells. This is to the result of the expression of large amounts of viral RNAs that contain high-affinity HuR binding sites in their 3′ UTRs effectively serving as a sponge for the HuR protein. Sequestration of HuR by Sindbis virus is associated with destabilization of cellular mRNAs that normally bind HuR and rely on it to regulate their expression. Furthermore, significant changes can be observed in nuclear alternative polyadenylation and splicing events on cellular pre-mRNAs as a result of sequestration of HuR protein by the 3′ UTR of transcripts of this cytoplasmic RNA virus. These studies suggest a molecular mechanism of virus-host interaction that probably has a significant impact on virus replication, cytopathology, and pathogenesis.

  20. Innate Immune Activation Can Trigger Experimental Spondyloarthritis in HLA-B27/Huβ2m Transgenic Rats.

    Science.gov (United States)

    van Tok, Melissa N; Satumtira, Nimman; Dorris, Martha; Pots, Desirée; Slobodin, Gleb; van de Sande, Marleen G; Taurog, Joel D; Baeten, Dominique L; van Duivenvoorde, Leonie M

    2017-01-01

    Spondyloarthritis (SpA) does not display the typical features of auto-immune disease. Despite the strong association with MHC class I, CD8(+) T cells are not required for disease induction in the HLA-B27/Huβ2m transgenic rats. We used Lewis HLA-B27/Huβ2m transgenic rats [21-3 × 283-2]F1, HLA-B7/Huβ2m transgenic rats [120-4 × 283-2]F1, and wild-type rats to test our hypothesis that SpA may be primarily driven by the innate immune response. In vitro, splenocytes were stimulated with heat-inactivated Mycobacterium tuberculosis and cytokine expression and production was measured. In vivo, male and female rats were immunized with 30, 60, or 90 µg of heat-inactivated M. tuberculosis and clinically monitored for spondylitis and arthritis development. After validation of the model, we tested whether prophylactic and therapeutic TNF targeting affected spondylitis and arthritis. In vitro stimulation with heat-inactivated M. tuberculosis strongly induced gene expression of pro-inflammatory cytokines such as TNF, IL-6, IL-1α, and IL-1β, in the HLA-B27 transgenic rats compared with controls. In vivo immunization induced an increased spondylitis and arthritis incidence and an accelerated and synchronized onset of spondylitis and arthritis in HLA-B27 transgenic males and females. Moreover, immunization overcame the protective effect of orchiectomy. Prophylactic TNF targeting resulted in delayed spondylitis and arthritis development and reduced arthritis severity, whereas therapeutic TNF blockade did not affect spondylitis and arthritis severity. Collectively, these data indicate that innate immune activation plays a role in the initiation of HLA-B27-associated disease and allowed to establish a useful in vivo model to study the cellular and molecular mechanisms of disease initiation and progression.

  1. Innate Immune Activation Can Trigger Experimental Spondyloarthritis in HLA-B27/Huβ2m Transgenic Rats

    Directory of Open Access Journals (Sweden)

    Melissa N. van Tok

    2017-08-01

    Full Text Available Spondyloarthritis (SpA does not display the typical features of auto-immune disease. Despite the strong association with MHC class I, CD8+ T cells are not required for disease induction in the HLA-B27/Huβ2m transgenic rats. We used Lewis HLA-B27/Huβ2m transgenic rats [21-3 × 283-2]F1, HLA-B7/Huβ2m transgenic rats [120-4 × 283-2]F1, and wild-type rats to test our hypothesis that SpA may be primarily driven by the innate immune response. In vitro, splenocytes were stimulated with heat-inactivated Mycobacterium tuberculosis and cytokine expression and production was measured. In vivo, male and female rats were immunized with 30, 60, or 90 µg of heat-inactivated M. tuberculosis and clinically monitored for spondylitis and arthritis development. After validation of the model, we tested whether prophylactic and therapeutic TNF targeting affected spondylitis and arthritis. In vitro stimulation with heat-inactivated M. tuberculosis strongly induced gene expression of pro-inflammatory cytokines such as TNF, IL-6, IL-1α, and IL-1β, in the HLA-B27 transgenic rats compared with controls. In vivo immunization induced an increased spondylitis and arthritis incidence and an accelerated and synchronized onset of spondylitis and arthritis in HLA-B27 transgenic males and females. Moreover, immunization overcame the protective effect of orchiectomy. Prophylactic TNF targeting resulted in delayed spondylitis and arthritis development and reduced arthritis severity, whereas therapeutic TNF blockade did not affect spondylitis and arthritis severity. Collectively, these data indicate that innate immune activation plays a role in the initiation of HLA-B27-associated disease and allowed to establish a useful in vivo model to study the cellular and molecular mechanisms of disease initiation and progression.

  2. Propuesta para mejorar la calidad estructural de los ladrillos artesanales de arcilla cocida de Huánuco

    OpenAIRE

    Arquíñigo Trujillo, Wilson Néstor

    2011-01-01

    info:eu-repo/semantics/openAccess info:eu-repo/semantics/openAccess Incentivado por los cursos de la Maestría en Ingeniería Civil (1994 y 1995), decidí estudiar las construcciones de albañilería en la ciudad de Huánuco. Durante este proceso me propuse mejorar la calidad estructural de ladrillos de arcilla manteniendo su condición de producción artesanal, ya que la industrialización implica grandes inversiones y eleva su precio de venta. Se observaba y aun hoy es así, que los princip...

  3. Návrh ekologického monitoringu revitalizované nivy Hučiny (NP Šumava)

    OpenAIRE

    SLÁMA, Miroslav

    2012-01-01

    The aim of this work was to design long-term monitoring of vegetation and environmental factors which would document the effect of the planned revitalization of Hučina brook floodplain. In order to monitor the dynamics of plant communities the system of permanent plots have been designed and established. Visual estimation of cover or graphical methods were proposed for the monitoring of the development of the moss and herb layers. The method of basal cover is considered best for the monitorin...

  4. Caracterización sociodemográfica de las enfermedades huérfanas en Colombia

    OpenAIRE

    Pérez Zauner, Ana María

    2016-01-01

    Las enfermedades huérfanas en Colombia, se definen como aquellas crónicamente debilitantes, que amenazan la vida, de baja prevalencia (menor 1/5000) y alta complejidad. Se estima que a nivel mundial existen entre 6000 a 8000 enfermedades raras diferentes(1). Varios países a nivel mundial individual o colectivamente, en los últimos años han creado políticas e incentivos para la investigación y protección de los pacientes con enfermedades raras. Sin embargo, a pesar del creciente número de publ...

  5. Factores dependientes del microorganismo y del huésped en la patogenia de las infecciones urinarias

    OpenAIRE

    Smithson Amat, Alejandro

    2009-01-01

    A pesar de los importantes avances en el conocimiento de la patogenia de las infecciones del tracto urinario (ITU) que se han producido en los últimos años, persisten aún numerosas incógnitas por despejar. A modo de ejemplo cabe señalar que desconocemos gran parte de los mecanismos por los que algunos gérmenes consiguen acantonarse en la próstata, si existen o no factores de virulencia bacterianos y/o del huésped adicionales a los ya conocidos implicados en la aparición de infecciones urinari...

  6. Pelger-Huët anomaly in a child with 1q42.3-44 deletion.

    Science.gov (United States)

    Kalfa, Theodosia A; Zimmerman, Sherri A; Goodman, Barbara K; McDonald, Marie T; Ware, Russell E

    2006-05-01

    Congenital Pelger-Huët anomaly (PHA) is an autosomal dominant disorder characterized by hypolobulated neutrophils with coarse clumping of the nuclear chromatin. PHA has been recently linked to the gene encoding the lamin B receptor, located at chromosome 1q41-43. The authors report a case of PHA in a child with interstitial deletion of the 1q subtelomeric region (1q42.3-44), providing supportive evidence to this linkage. All neutrophils in the peripheral blood smear had the characteristic unsegmented or bilobed appearance. Additional features in this child included failure to thrive, developmental delay, cleft palate, seizure disorder, and dysmorphic facial features.

  7. GC-MS-Based Metabonomic Profiling Displayed Differing Effects of Borna Disease Virus Natural Strain Hu-H1 and Laboratory Strain V Infection in Rat Cortical Neurons.

    Science.gov (United States)

    Liu, Siwen; Bode, Liv; Zhang, Lujun; He, Peng; Huang, Rongzhong; Sun, Lin; Chen, Shigang; Zhang, Hong; Guo, Yujie; Zhou, Jingjing; Fu, Yuying; Zhu, Dan; Xie, Peng

    2015-08-17

    Borna disease virus (BDV) persists in the central nervous systems of a wide variety of vertebrates and causes behavioral disorders. Previous studies have revealed that metabolic perturbations are associated with BDV infection. However, the pathophysiological effects of different viral strains remain largely unknown. Rat cortical neurons infected with human strain BDV Hu-H1, laboratory BDV Strain V, and non-infected control (CON) cells were cultured in vitro. At day 12 post-infection, a gas chromatography coupled with mass spectrometry (GC-MS) metabonomic approach was used to differentiate the metabonomic profiles of 35 independent intracellular samples from Hu-H1-infected cells (n = 12), Strain V-infected cells (n = 12), and CON cells (n = 11). Partial least squares discriminant analysis (PLS-DA) was performed to demonstrate discrimination between the three groups. Further statistical testing determined which individual metabolites displayed significant differences between groups. PLS-DA demonstrated that the whole metabolic pattern enabled statistical discrimination between groups. We identified 31 differential metabolites in the Hu-H1 and CON groups (21 decreased and 10 increased in Hu-H1 relative to CON), 35 differential metabolites in the Strain V and CON groups (30 decreased and 5 increased in Strain V relative to CON), and 21 differential metabolites in the Hu-H1 and Strain V groups (8 decreased and 13 increased in Hu-H1 relative to Strain V). Comparative metabonomic profiling revealed divergent perturbations in key energy and amino acid metabolites between natural strain Hu-H1 and laboratory Strain V of BDV. The two BDV strains differentially alter metabolic pathways of rat cortical neurons in vitro. Their systematic classification provides a valuable template for improved BDV strain definition in future studies.

  8. GC–MS-Based Metabonomic Profiling Displayed Differing Effects of Borna Disease Virus Natural Strain Hu-H1 and Laboratory Strain V Infection in Rat Cortical Neurons

    Science.gov (United States)

    Liu, Siwen; Bode, Liv; Zhang, Lujun; He, Peng; Huang, Rongzhong; Sun, Lin; Chen, Shigang; Zhang, Hong; Guo, Yujie; Zhou, Jingjing; Fu, Yuying; Zhu, Dan; Xie, Peng

    2015-01-01

    Borna disease virus (BDV) persists in the central nervous systems of a wide variety of vertebrates and causes behavioral disorders. Previous studies have revealed that metabolic perturbations are associated with BDV infection. However, the pathophysiological effects of different viral strains remain largely unknown. Rat cortical neurons infected with human strain BDV Hu-H1, laboratory BDV Strain V, and non-infected control (CON) cells were cultured in vitro. At day 12 post-infection, a gas chromatography coupled with mass spectrometry (GC–MS) metabonomic approach was used to differentiate the metabonomic profiles of 35 independent intracellular samples from Hu-H1-infected cells (n = 12), Strain V-infected cells (n = 12), and CON cells (n = 11). Partial least squares discriminant analysis (PLS-DA) was performed to demonstrate discrimination between the three groups. Further statistical testing determined which individual metabolites displayed significant differences between groups. PLS-DA demonstrated that the whole metabolic pattern enabled statistical discrimination between groups. We identified 31 differential metabolites in the Hu-H1 and CON groups (21 decreased and 10 increased in Hu-H1 relative to CON), 35 differential metabolites in the Strain V and CON groups (30 decreased and 5 increased in Strain V relative to CON), and 21 differential metabolites in the Hu-H1 and Strain V groups (8 decreased and 13 increased in Hu-H1 relative to Strain V). Comparative metabonomic profiling revealed divergent perturbations in key energy and amino acid metabolites between natural strain Hu-H1 and laboratory Strain V of BDV. The two BDV strains differentially alter metabolic pathways of rat cortical neurons in vitro. Their systematic classification provides a valuable template for improved BDV strain definition in future studies. PMID:26287181

  9. GC–MS-Based Metabonomic Profiling Displayed Differing Effects of Borna Disease Virus Natural Strain Hu-H1 and Laboratory Strain V Infection in Rat Cortical Neurons

    Directory of Open Access Journals (Sweden)

    Siwen Liu

    2015-08-01

    Full Text Available Borna disease virus (BDV persists in the central nervous systems of a wide variety of vertebrates and causes behavioral disorders. Previous studies have revealed that metabolic perturbations are associated with BDV infection. However, the pathophysiological effects of different viral strains remain largely unknown. Rat cortical neurons infected with human strain BDV Hu-H1, laboratory BDV Strain V, and non-infected control (CON cells were cultured in vitro. At day 12 post-infection, a gas chromatography coupled with mass spectrometry (GC–MS metabonomic approach was used to differentiate the metabonomic profiles of 35 independent intracellular samples from Hu-H1-infected cells (n = 12, Strain V-infected cells (n = 12, and CON cells (n = 11. Partial least squares discriminant analysis (PLS-DA was performed to demonstrate discrimination between the three groups. Further statistical testing determined which individual metabolites displayed significant differences between groups. PLS-DA demonstrated that the whole metabolic pattern enabled statistical discrimination between groups. We identified 31 differential metabolites in the Hu-H1 and CON groups (21 decreased and 10 increased in Hu-H1 relative to CON, 35 differential metabolites in the Strain V and CON groups (30 decreased and 5 increased in Strain V relative to CON, and 21 differential metabolites in the Hu-H1 and Strain V groups (8 decreased and 13 increased in Hu-H1 relative to Strain V. Comparative metabonomic profiling revealed divergent perturbations in key energy and amino acid metabolites between natural strain Hu-H1 and laboratory Strain V of BDV. The two BDV strains differentially alter metabolic pathways of rat cortical neurons in vitro. Their systematic classification provides a valuable template for improved BDV strain definition in future studies.

  10. Bioactive coating of titanium surfaces with recombinant human β-defensin-2 (rHuβD2) may prevent bacterial colonization in orthopaedic surgery.

    Science.gov (United States)

    Pfeufer, Nadine Y; Hofmann-Peiker, Karsten; Mühle, Mike; Warnke, Patrick H; Weigel, Martin C; Kleine, Michael

    2011-05-04

    A promising strategy to prevent infections around orthopaedic titanium implants is to use naturally occurring cationic antimicrobial peptides (CAMPs) such as the human β-defensin-2 as antibacterial coatings. Human antimicrobial peptides represent a part of the innate immune system and have a broad antimicrobial spectrum against bacteria, fungi, and viruses. In the present study, titanium surfaces were functionalized by four different self-assembled monolayers (SAMs) forming methoxy silanes: (1) hexadecyltrimethoxysilane, (2) dimethoxymethyloctylsilane, (3) allyltrimethylsilane, and (4) 3-aminopropyltrimethoxysilane. In addition, calf skin type-I collagen was cross-linked to the SAM surface 3-aminopropyltrimethoxysilane by means of two different treatments: (1) N-hydroxysuccinimide and (2) glutaraldehyde. The functionalized titanium surfaces were coated with recombinant human β-defensin-2 (rHuβD2), an antimicrobial peptide, and were tested for antibacterial activity against Escherichia coli. The release of rHuβD2 was quantified by means of enzyme-linked immunosorbent assay (ELISA). The coating of functionalized titanium surfaces with rHuβD2 was successful. Recombinant HuβD2 was eluted from the titanium surfaces continuously, yielding antimicrobial activity up to several hours. Antimicrobial activity with a killing rate of 100% was observed for all functionalized titanium surfaces after two hours of incubation. The dimethoxymethyloctylsilane-functionalized titanium surface delivered 0.65 μg of rHuβD2 after six hours with a 60% bacterial killing rate. The silane-functionalized surfaces exhibited a faster release of antimicrobially active rHuβD2 compared with collagen modifications. Natural antibiotics such as rHuβD2 integrated into the metal surface of titanium implants may be a promising tool to prevent and control infections around orthopaedic implants.

  11. pp32 (ANP32A expression inhibits pancreatic cancer cell growth and induces gemcitabine resistance by disrupting HuR binding to mRNAs.

    Directory of Open Access Journals (Sweden)

    Timothy K Williams

    Full Text Available The expression of protein phosphatase 32 (PP32, ANP32A is low in poorly differentiated pancreatic cancers and is linked to the levels of HuR (ELAV1, a predictive marker for gemcitabine response. In pancreatic cancer cells, exogenous overexpression of pp32 inhibited cell growth, supporting its long-recognized role as a tumor suppressor in pancreatic cancer. In chemotherapeutic sensitivity screening assays, cells overexpressing pp32 were selectively resistant to the nucleoside analogs gemcitabine and cytarabine (ARA-C, but were sensitized to 5-fluorouracil; conversely, silencing pp32 in pancreatic cancer cells enhanced gemcitabine sensitivity. The cytoplasmic levels of pp32 increased after cancer cells are treated with certain stressors, including gemcitabine. pp32 overexpression reduced the association of HuR with the mRNA encoding the gemcitabine-metabolizing enzyme deoxycytidine kinase (dCK, causing a significant reduction in dCK protein levels. Similarly, ectopic pp32 expression caused a reduction in HuR binding of mRNAs encoding tumor-promoting proteins (e.g., VEGF and HuR, while silencing pp32 dramatically enhanced the binding of these mRNA targets. Low pp32 nuclear expression correlated with high-grade tumors and the presence of lymph node metastasis, as compared to patients' tumors with high nuclear pp32 expression. Although pp32 expression levels did not enhance the predictive power of cytoplasmic HuR status, nuclear pp32 levels and cytoplasmic HuR levels associated significantly in patient samples. Thus, we provide novel evidence that the tumor suppressor function of pp32 can be attributed to its ability to disrupt HuR binding to target mRNAs encoding key proteins for cancer cell survival and drug efficacy.

  12. The human gut chip "HuGChip", an explorative phylogenetic microarray for determining gut microbiome diversity at family level.

    Science.gov (United States)

    Tottey, William; Denonfoux, Jeremie; Jaziri, Faouzi; Parisot, Nicolas; Missaoui, Mohiedine; Hill, David; Borrel, Guillaume; Peyretaillade, Eric; Alric, Monique; Harris, Hugh M B; Jeffery, Ian B; Claesson, Marcus J; O'Toole, Paul W; Peyret, Pierre; Brugère, Jean-François

    2013-01-01

    Evaluating the composition of the human gut microbiota greatly facilitates studies on its role in human pathophysiology, and is heavily reliant on culture-independent molecular methods. A microarray designated the Human Gut Chip (HuGChip) was developed to analyze and compare human gut microbiota samples. The PhylArray software was used to design specific and sensitive probes. The DNA chip was composed of 4,441 probes (2,442 specific and 1,919 explorative probes) targeting 66 bacterial families. A mock community composed of 16S rRNA gene sequences from intestinal species was used to define the threshold criteria to be used to analyze complex samples. This was then experimentally verified with three human faecal samples and results were compared (i) with pyrosequencing of the V4 hypervariable region of the 16S rRNA gene, (ii) metagenomic data, and (iii) qPCR analysis of three phyla. When compared at both the phylum and the family level, high Pearson's correlation coefficients were obtained between data from all methods. The HuGChip development and validation showed that it is not only able to assess the known human gut microbiota but could also detect unknown species with the explorative probes to reveal the large number of bacterial sequences not yet described in the human gut microbiota, overcoming the main inconvenience encountered when developing microarrays.

  13. Diarylethenes Display In Vitro Anti-TB Activity and Are Efficient Hits Targeting the Mycobacterium tuberculosis HU Protein

    Directory of Open Access Journals (Sweden)

    María Angélica Suarez

    2017-07-01

    Full Text Available Tuberculosis continues to be a great source of concern in global health because of the large reservoir of humans infected with the bacilli and the appearance of clinical isolates resistant to a wide array of anti-tuberculosis drugs. New drugs with novel mechanisms of action on new targets are urgently required to reduce global tuberculosis burden. Mycobacterium tuberculosis nucleoid associated protein (NAP HU has been shown to be druggable and essential for the organism’s survival. In this study, four diarylethenes were synthesized using a one-pot decarboxylated Heck-coupling of coumaric acids with iodoanisoles. The prepared compounds 1–4 were tested for their in vitro growth inhibition of M. tuberculosis H37Rv using the spot culture growth inhibition assay, displaying minimum inhibitory concentrations between 9 and 22 µM. Their cytotoxicity against BHK-21 cell line showed half inhibition at concentrations between 98 and 729 µM. The most selective hit (SI = 81, demonstrated inhibition of M. tuberculosis HU protein involved in maintaining bacterial genome architecture.

  14. Chemical identification and quantification of Hu-Gu capsule by UHPLC–Q-TOF-MS and HPLC-DAD

    Directory of Open Access Journals (Sweden)

    Qiang Ren

    Full Text Available Abstract Hu-Gu capsule is a traditional Chinese medical formula for preventing glucocorticoid-induced osteoporosis. In this work, an ultra-high performance liquid chromatography coupled with electrospray ionization quadrupole time-of-flight mass spectrometry was developed for chemical identification of the phytochemical compositions in positive ion mode. A total of 41 compounds were detected in Hu-Gu capsule, and 25 compounds were characterized and identified by retention time, accurate mass within 5 ppm error and characteristic fragment ions. Among of them, four major flavonoids were further quantified by high performance liquid chromatography diode array detection in the four batches. The method was validated in terms of calibration curve regression coefficient (r 2 > 0.9994, repeatability (RSD < 3.5%, intra- and inter-day precision (RSD < 1.1%, recovery (93.0–106.4%, limit of detection (0.1 µg/ml, and limit of quantification (1 µg/ml. The research could provide the analysis of chemical composition and be helpful to control the quality of HGC.

  15. p38 Mitogen-activated protein kinase stabilizes SMN mRNA through RNA binding protein HuR.

    Science.gov (United States)

    Farooq, Faraz; Balabanian, Sylvia; Liu, Xuejun; Holcik, Martin; MacKenzie, Alex

    2009-11-01

    Spinal muscle atrophy (SMA) is an autosomal recessive neurodegenerative disease which is characterized by the loss of alpha motor neurons resulting in progressive muscle atrophy. Reduced amount of functional survival motor neuron (SMN) protein due to mutations or deletion in the SMN1 gene is the cause of SMA. A potential treatment strategy for SMA is to upregulate levels of SMN protein originating from the SMN2 gene compensating in part for the absence of functional SMN1 gene. Although there exists a sizeable literature on SMN2 inducing compounds, there is comparatively less known about the signaling pathways which modulate SMN levels. Here, we report a significant induction in SMN mRNA and protein following p38 activation by Anisomycin. We demonstrate that Anisomycin activation of p38 causes a rapid cytoplasmic accumulation of HuR, a RNA binding protein which binds to and stabilizes the AU-rich element within the SMN transcript. The stabilization of SMN mRNA, rather than transcriptional induction results in an increase in SMN protein. Our demonstration of SMN protein regulation through the p38 pathway and the role of HuR in this modulation may help in the identification and characterization of p38 pathway activators as potential therapeutic compounds for the treatment of SMA.

  16. Autotaxin Expression Is Regulated at the Post-transcriptional Level by the RNA-binding Proteins HuR and AUF1*

    Science.gov (United States)

    Sun, Shuhong; Zhang, Xiaotian; Lyu, Lin; Li, Xixi; Yao, Siliang; Zhang, Junjie

    2016-01-01

    Autotaxin (ATX) is a key enzyme that converts lysophosphatidylcholine (LPC) into lysophosphatidic acid (LPA), a lysophospholipid mediator that regulates cellular activities through its specific G protein-coupled receptors. The ATX-LPA axis plays an important role in various physiological and pathological processes, especially in inflammation and cancer development. Although the transcriptional regulation of ATX has been widely studied, the post-transcriptional regulation of ATX is largely unknown. In this study, we identified conserved adenylate-uridylate (AU)-rich elements in the ATX mRNA 3′-untranslated region (3′UTR). The RNA-binding proteins HuR and AUF1 directly bound to the ATX mRNA 3′UTR and had antagonistic functions in ATX expression. HuR enhanced ATX expression by increasing ATX mRNA stability, whereas AUF1 suppressed ATX expression by promoting ATX mRNA decay. HuR and AUF1 were involved in ATX regulation in Colo320 human colon cancer cells and the LPS-stimulated human monocytic THP-1 cells. HuR knockdown suppressed ATX expression in B16 mouse melanoma cells, leading to inhibition of cell migration. This effect was reversed by AUF1 knockdown to recover ATX expression or by the addition of LPA. These results suggest that the post-transcriptional regulation of ATX expression by HuR and AUF1 modulates cancer cell migration. In summary, we identified HuR and AUF1 as novel post-transcriptional regulators of ATX expression, thereby elucidating a novel mechanism regulating the ATX-LPA axis. PMID:27784781

  17. Human-derived IgG level as an indicator for EBV-associated lymphoma model in Hu-PBL/SCID chimeras.

    Science.gov (United States)

    Tang, Yunlian; He, Rongfang; Zhang, Yang; Liu, Fang; Cheng, Ailan; Wu, Yimou; Gan, Runliang

    2011-05-09

    Epstein-Barr virus (EBV) has a close association with various types of human lymphomas. Animal models are essential to elucidate the pathogenesis of human EBV-associated lymphomas. The aim of the present study is to evaluate the association between human IgG concentration and EBV-associated lymphoma development in huPBL/SCID mice. Human peripheral blood lymphocytes (hu-PBL) from EBV-seropositive donors were inoculated intraperitoneally into SCID mouse. Immunohistochemical staining was used to examine differentiated antigens of tumor cells. EBV infection of the induced tumors was detected by in situ hybridization. IgG concentrations in the serums of 12 SCID mice were measured by unidirectional immunodiffusion assay. 21 out of 29 mice developed tumors in their body. Immunohistochemical staining showed that all induced tumors were LCA (leukocyte common antigen) positive, B-cell markers (CD20, CD79a) positive, and T-cell markers (both CD3 and CD45RO) negative. The tumors can be diagnosed as human B-cell lymphomas by these morphological and immunohistochemical features. In situ hybridization exhibited resultant tumor cells had EBV encoded small RNA-1 (EBER-1). Human-derived IgG could be found in the serum from SCID mice on the 15th day following hu-PBL transplantation, and IgG levels increased with the tumor development in 6 hu-PBL/SCID chimeras. Intraperitoneal transfer of hu-PBLs from EBV+ donors to SCID mice leads to high human IgG levels in mouse serum and B cell lymphomas. Our findings suggest that increasing levels of human-derived IgG in peripheral blood from hu-PBL/SCID mice could be used to monitor EBV-related human B-cell lymphoma development in experimental animals.

  18. Development and Characterization of a Humanized Anti-HER2 Antibody HuA21 with Potent Anti-Tumor Properties in Breast Cancer Cells

    Directory of Open Access Journals (Sweden)

    Ruilin Li

    2016-04-01

    Full Text Available Human epidermal growth factor receptor 2 (HER2 is one of the most studied tumor-associated antigens for cancer immunotherapy. An engineered anti-HER-2 chimeric A21 antibody (chA21 is a chimeric antibody targeted to subdomain I of the HER2 extracellular domain. Here, we report the anti-tumor activity of the novel engineered monoclonal antibody humanized chA21 (HuA21 that targets HER2 on the basis of chA21, and we describe the underlying mechanisms. Our results reveal that HuA21 markedly inhibits the proliferation and migration of HER2-overexpressing breast cancer cells and causes enhanced antibody-dependent cell-mediated cytotoxicity potency against HER2-overexpressing tumor cells. In particular, HuA21, but not trastuzumab (Tra, markedly suppresses growth and enhances the internalization of the antibody in Tra-resistant BT-474 breast cancer cells. These characteristics are highly associated with the intrinsic ability of HuA21 to down-regulate HER2 activation and inhibit the extracellular signal-regulated kinase 1/2 (ERK1/2 and protein kinase B (Akt signaling pathways. Furthermore, the combination of HuA21 with Tra synergistically enhances the anti-tumor effects in vitro and in vivo and inhibits HER2 activation and the ERK1/2 and Akt signaling pathways. Altogether, our results suggest that HuA21 may represent a unique anti-HER2 antibody with potential as a therapeutic candidate alone or in combination with other anti-HER2 reagents in cancer therapy.

  19. Human-derived IgG level as an indicator for EBV-associated lymphoma model in Hu-PBL/SCID chimeras

    Directory of Open Access Journals (Sweden)

    Cheng Ailan

    2011-05-01

    Full Text Available Abstract Background Epstein-Barr virus (EBV has a close association with various types of human lymphomas. Animal models are essential to elucidate the pathogenesis of human EBV-associated lymphomas. The aim of the present study is to evaluate the association between human IgG concentration and EBV-associated lymphoma development in huPBL/SCID mice. Methods Human peripheral blood lymphocytes (hu-PBL from EBV-seropositive donors were inoculated intraperitoneally into SCID mouse. Immunohistochemical staining was used to examine differentiated antigens of tumor cells. EBV infection of the induced tumors was detected by in situ hybridization. IgG concentrations in the serums of 12 SCID mice were measured by unidirectional immunodiffusion assay. Results 21 out of 29 mice developed tumors in their body. Immunohistochemical staining showed that all induced tumors were LCA (leukocyte common antigen positive, B-cell markers (CD20, CD79a positive, and T-cell markers (both CD3 and CD45RO negative. The tumors can be diagnosed as human B-cell lymphomas by these morphological and immunohistochemical features. In situ hybridization exhibited resultant tumor cells had EBV encoded small RNA-1 (EBER-1. Human-derived IgG could be found in the serum from SCID mice on the 15th day following hu-PBL transplantation, and IgG levels increased with the tumor development in 6 hu-PBL/SCID chimeras. Conclusions Intraperitoneal transfer of hu-PBLs from EBV+ donors to SCID mice leads to high human IgG levels in mouse serum and B cell lymphomas. Our findings suggest that increasing levels of human-derived IgG in peripheral blood from hu-PBL/SCID mice could be used to monitor EBV-related human B-cell lymphoma development in experimental animals.

  20. The mRNA-binding protein HuR promotes hypoxia-induced chemoresistance through posttranscriptional regulation of the proto-oncogene PIM1 in pancreatic cancer cells.

    Science.gov (United States)

    Blanco, F F; Jimbo, M; Wulfkuhle, J; Gallagher, I; Deng, J; Enyenihi, L; Meisner-Kober, N; Londin, E; Rigoutsos, I; Sawicki, J A; Risbud, M V; Witkiewicz, A K; McCue, P A; Jiang, W; Rui, H; Yeo, C J; Petricoin, E; Winter, J M; Brody, J R

    2016-05-01

    Previously, it has been shown that pancreatic ductal adenocarcinoma (PDA) tumors exhibit high levels of hypoxia, characterized by low oxygen pressure (pO2) and decreased O2 intracellular perfusion. Chronic hypoxia is strongly associated with resistance to cytotoxic chemotherapy and chemoradiation in an understudied phenomenon known as hypoxia-induced chemoresistance. The hypoxia-inducible, pro-oncogenic, serine-threonine kinase PIM1 (Proviral Integration site for Moloney murine leukemia virus 1) has emerged as a key regulator of hypoxia-induced chemoresistance in PDA and other cancers. Although its role in therapeutic resistance has been described previously, the molecular mechanism behind PIM1 overexpression in PDA is unknown. Here, we demonstrate that cis-acting AU-rich elements (ARE) present within a 38-base pair region of the PIM1 mRNA 3'-untranslated region mediate a regulatory interaction with the mRNA stability factor HuR (Hu antigen R) in the context of tumor hypoxia. Predominantly expressed in the nucleus in PDA cells, HuR translocates to the cytoplasm in response to hypoxic stress and stabilizes the PIM1 mRNA transcript, resulting in PIM1 protein overexpression. A reverse-phase protein array revealed that HuR-mediated regulation of PIM1 protects cells from hypoxic stress through phosphorylation and inactivation of the apoptotic effector BAD and activation of MEK1/2. Importantly, pharmacological inhibition of HuR by MS-444 inhibits HuR homodimerization and its cytoplasmic translocation, abrogates hypoxia-induced PIM1 overexpression and markedly enhances PDA cell sensitivity to oxaliplatin and 5-fluorouracil under physiologic low oxygen conditions. Taken together, these results support the notion that HuR has prosurvival properties in PDA cells by enabling them with growth advantages in stressful tumor microenvironment niches. Accordingly, these studies provide evidence that therapeutic disruption of HuR's regulation of PIM1 may be a key strategy in

  1. Analysis of structure of the biathlon runs Analýza struktury biathlonového běhu

    Directory of Open Access Journals (Sweden)

    Adam Zając

    2005-02-01

    Full Text Available The biathlon is an Olympic sport discipline, which is a combination of two events, Nordic skiing and precision shooting. Combining events of such different psychophysical background creates great demands on the athlete and coach. The main objective of this paper was to determine which of these events has a greater impact on the final result considering the distance and sports level. The results of the World Cup and the Olympic Games in the 2001/02 season were analyzed statistically. The data indicates that the results of the run influence the final result to a higher degree than shooting does. This is especially true in the sprint and in relation to biathletes of higher sports level. At long distances, the level of shooting and the time of the run influence the final result to the same extent. The influence of the time of shooting on the final result is dependent on the distance of the run. Biathlon je olympijská disciplína spojující v sobě vlastně dvě sportovní disciplíny: lyžařský běh a střelbu ze sportovní pušky. Spojení těchto odlišných sportovních disciplín o různých psychofyzických požadavcích klade na závodníky i trenéry velmi vysoké požadavky. V práci se autoři snažili najít odpověď na otázku: která složka je důležitější pro dosažení konečného výsledku v závislosti na proběhnuté vzdálenosti, jakož i sportovní úrovni závodníků. Statistické analýze byly podrobeny výsledky vybraných závodů Světového poháru i olympijských her v sezóně 2001/02 v kategorii mužů. Analýze byl podroben čas běhu, přesnost střelby, čas střílení i sportovní výsledek. Na základě výsledků získaných z předmětné analýzy byl zjištěn větší význam běhové přípravy v sprintérském běhu u závodníků na vyšší sportovní úrovni vzhledem k vysoké vyrovnané úrovni střelby. V běhu na dlouhých tratích byl zjištěn přibližně stejný význam přesnosti st

  2. [Sudden death occurring after anti-Hu associated paraneoplastic cerebellar degeneration and dysautonomia revealing a small cell lung carcinoma].

    Science.gov (United States)

    Mirouse, A; Gobert, D; Chamouard, J-M; Iordache, L; Mekinian, A; Fain, O

    2014-11-01

    Paraneoplastic syndromes are a rare cancer complication with a frequent subacute evolution. A 62-year-old man was admitted presenting with a cerebellar syndrome and orthostatic hypotension with dysautonomia. Anti-Hu antibody research was positive. A subcarinal adenopathy biopsy found out a small cell lung carcinoma. Despite a treatment with immunoglobulin and chemotherapy, the patient died suddenly, after a raise of dysautonomia symptoms. Sudden death observations represent exceptional complications of paraneoplastic syndrome. They might be secondary to arrhythmias, ictal asystol or laryngospasm. Systematic research of paroxystic heart arrhythmias with holter-ECG in paraneoplastic syndrome may prevent sudden deaths. Copyright © 2014 Société nationale française de médecine interne (SNFMI). Published by Elsevier SAS. All rights reserved.

  3. The antiproliferative effect of kefir cell-free fraction on HuT-102 malignant T lymphocytes.

    Science.gov (United States)

    Rizk, Sandra; Maalouf, Katia; Baydoun, Elias

    2009-01-01

    Kefir is produced by adding kefir grains (a mass of proteins, polysaccharides, bacteria, and yeast) to pasteurized milk; it has been shown to control several cellular types of cancer, such as Sarcoma 180 in mice, Lewis lung carcinoma, and human mammary cancer. Human T-cell lymphotropic virus type 1 (HTLV-1) is the causative agent of adult T-cell leukemia, which is a fatal disease with no effective treatment. The current study aims at investigating the effect of a cell-free fraction of kefir on HuT-102 cells, which are HTLV-1-positive malignant T-lymphocytes. Cells were incubated with different kefir concentrations: the cytotoxicity of the compound was evaluated by determining the percentage viability of cells. The effect of all the noncytotoxic concentrations of kefir cell-free fraction on the proliferation of HuT-102 cells was then assessed. The levels of transforming growth factor (TGF)-alpha mRNA upon kefir treatment were then analyzed using reverse transcriptase polymerase chain reaction. Finally, the growth inhibitory effects of kefir on cell cycle progression and/or apoptosis were assessed by flow cytometry. The maximum cytotoxicity recorded at 80 microg/microL for 48 hours was only 43%. The percent reduction in proliferation was very significant, dose and time dependent, and reached 98% upon 60-microg/microL treatment for 24 hours. Kefir cell-free fraction caused the downregulation of TGF-alpha, which is a cytokine that induces the proliferation and replication of cells. Finally, a marked increase in cell cycle distribution was noted in the pre-G1 phase. In conclusion, kefir is effective in inhibiting proliferation and inducing apoptosis of HTLV-1-positive malignant T-lymphocytes. Therefore, further in vivo investigation is highly recommended.

  4. Dieta de roedores sigmodontinos (Cricetidae en los bosques montanos tropicales de Huánuco, Perú

    Directory of Open Access Journals (Sweden)

    Maggie C. Noblecilla

    2013-06-01

    Full Text Available Se analizó el contenido estomacal de cinco especies de roedores sigmodontinos: Akodon orophilus, Microry-zomys altissimus, M. minutus, Thomasomys notatus yT. kalinowskii, procedentes de los bosques montanos de Huánuco, Perú (2564 - 3850 m de altitud. Concluimos que A. orophiluses insectívora por haber presentado un alto volumen de artrópodos (adultos y larvas en el contenido estomacal (90,1%; mientras que T. notatusy T. kalinowskiison principalmente herbívoras por el alto volumen de materia vegetal, 89% y 67,75% respectiva-mente; y que M. altissimusy M. minutusson omnívoras por presentar volúmenes similares tanto para vegetales como para artrópodos. Thomasomys kalinowskiies considerada generalista por la mayor amplitud de nicho (4,61, mientras A. orophiluses considerada especialista por el menor valor (1,70. Akodon orophilusmostró una preferencia por el consumo de artrópodos adultos al tener un bajo coeficiente de variación (CV= 20% y también un significativo aumento en el consumo de larvas de artrópodos en la época húmeda, siendo la única especie con variación estacional en la dieta. Por otro lado, la sobreposición de nicho fue menor a 0,75 en el 80% de los pares de especies comparados, indicando una baja similitud en la dieta. La mayor similitud en la dieta se observó entre M. altissimus- T. notatus(0,822 y M. minutus - T. kalinowskii(0,816. Se concluye que estos roedores sigmodontinos, simpátricos en los bosques montanos de Huánuco, exhiben dietas disímiles, probablemente como una estrategia para evitar o aminorar la competencia interespecífica.

  5. Nivel de pobreza y estado nutricional asociados a parasitosis intestinal en estudiantes, Huánuco, Perú, 2010

    Directory of Open Access Journals (Sweden)

    César Gabriel Berto Moreano

    2013-10-01

    Full Text Available Introducción: Se ha encontrado una prevalencia alta de parasitosis en escolares de la amazonía; pese a ello, no hay estudios realizados que revisen su asociación con el nivel socioeconómico y estado nutricional. Objetivos: Determinar la relación entre nivel de pobreza y estado nutricional con la presencia de parásitos intestinales en estudiantes escolares del caserío Venenillo, Huánuco. Diseño: Estudio transversal-analítico. Lugar: Caserío de Venenillo, Huánuco. Participantes: Estudiantes escolares de la única institución educativa del centro poblado. Intervenciones: A 42 estudiantes se les realizó examen coproparasitológico mediante observación directa con lugol y técnica de sedimentación rápida de Lumbreras. El nivel de pobreza fue determinado mediante el índice de necesidades básicas insatisfechas (NBI; y el grado de desnutrición, por medio del índice de Waterlow. El análisis estadístico fue realizado mediante el coeficiente gamma de Goodman y Kruskal. Principales medidas de resultados: Relación de parasitosis intestinal con pobreza y estado nutricional. Resultados: Los parásitos intestinales estuvieron presentes en 97,6%. Se encontró asociación significativa entre el nivel de parasitismo y el nivel de pobreza (p=0,02; gamma=0,82. No se encontró asociación significativa entre nivel de desnutrición y parasitismo (p=0,77. Conclusiones: La parasitosis intestinal se asoció al nivel de pobreza, no así con el nivel de desnutrición en la población de estudio.

  6. Phase II trial of zanolimumab (HuMax-CD4) in relapsed or refractory non-cutaneous peripheral T cell lymphoma

    DEFF Research Database (Denmark)

    d'Amore, Francesco; Radford, John; Relander, Thomas

    2010-01-01

    The efficacy and safety of zanolimumab (HuMax-CD4) in patients with relapsed or refractory peripheral T Cell lymphoma (PTCL) was evaluated. Twenty-one adult patients with relapsed or refractory CD4(+) PTCL of non-cutaneous type (angioimmunoblastic T cell lymphoma (AITL) n = 9, PTCL-not otherwise...

  7. Intra- and inter-laboratory validation of an innovative huFcεRIα-RBL-2H3 degranulation assay for in vitro allergenicity assessment of whey hydrolysates

    NARCIS (Netherlands)

    Knipping, Karen; van Roest, Manon; Kruijssen, Laura; Smits, Mieke; Teunis, Marc; Cox, Linda; de Jong, Niels; Simons, Peter J.; Boon, Louis; Teshima, Reiko; Gros, Marjan; Kegler, Diane; Garssen, Johan; Knippels, Léon M J; Pieters, Raymond

    Cow's milk-derived whey hydrolysates are milk substitutes for cow's milk allergic infants. Safety assessment of these hydrolysates is crucial. Currently, huFcεRIα-RBL-2H3 cells, sensitized with serum IgE from cow's milk allergic patients, are used to assess in vitro residual allergenicity. However,

  8. Intra- and inter-laboratory validation of an innovative huFcεRIα-RBL-2H3 degranulation assay for in vitro allergenicity assessment of whey hydrolysates

    NARCIS (Netherlands)

    Laura Kruijssen; Johan Garssen; Niels de Jong; Louis Boon; Mieke Smits; Marjan Gros; Karen Knipping; Reiko Teshima; Linda Cox; Raymond Pieters; Léon M.J. Knippels; Marc Teunis; Peter J. Simons; Diana Kegler; Manon van Roest

    2016-01-01

    from the article: "Cow's milk-derived whey hydrolysates are milk substitutes for cow's milk allergic infants. Safety assessment of these hydrolysates is crucial. Currently, huFcεRIα-RBL-2H3 cells, sensitized with serum IgE from cow's milk allergic patients, are used to assess in vitro residual

  9. Short communication. Employment of molecular markers to develop tetraploid “supermale” asparagus from andromonoecious plants of the landrace ‘Morado de Huétor’

    Directory of Open Access Journals (Sweden)

    Jose J. Regalado

    2014-10-01

    Full Text Available The aim of this work was the development of new “supermale” genotypes retaining the highest genetic diversity possible of the tetraploid asparagus landrace ‘Morado de Huétor’. The elite andromonoecious male HT664 of the ‘Morado de Huétor’ asparagus landrace and the andromonoecious hybrid male HC027, obtained by crossing between this landrace and a commercial cultivar of Asparagus officinalis, were selected for self-pollination to produce possible “supermales” with genes of ‘Morado de Huétor’ (SMHT. To confirm the hybrid nature of HC027, we characterized this genotype with EST-SSR (Expressed Sequence Tag-derived Simple Sequence Repeats markers. We also adopted the sex-linked marker Asp1-T7 for sex determination in ‘Morado de Huétor’ and the resulting hybrids between this landrace and other commercial cultivars. Asp1-T7 marker was used for the selection and genotyping of SMHT. “All-male” cultivars with a different genetic background can be generated by crossing females with these new “supermale” genotypes, and the agronomical traits of these new cultivars would be very different from the “all-male” cultivars currently available in the market, making them extremely interesting for asparagus breeding programs.

  10. Proteomics reveal energy metabolism and mitogen-activated protein kinase signal transduction perturbation in human Borna disease virus Hu-H1-infected oligodendroglial cells.

    Science.gov (United States)

    Liu, X; Yang, Y; Zhao, M; Bode, L; Zhang, L; Pan, J; Lv, L; Zhan, Y; Liu, S; Zhang, L; Wang, X; Huang, R; Zhou, J; Xie, P

    2014-05-30

    Borna disease virus (BDV) is a neurotropic, non-cytolytic RNA virus which replicates in the cell nucleus targeting mainly hippocampal neurons, but also astroglial and oligodendroglial cells in the brain. BDV is associated with a large spectrum of neuropsychiatric pathologies in animals. Its relationship to human neuropsychiatric illness still remains controversial. We could recently demonstrate that human BDV strain Hu-H1 promoted apoptosis and inhibited cell proliferation in a human oligodendroglial cell line (OL cells) whereas laboratory BDV strain V acted contrariwise. Here, differential protein expression between BDV Hu-H1-infected OL cells and non-infected OL cells was assessed through a proteomics approach, using two-dimensional electrophoresis followed by matrix-assisted laser desorption ionization-time of flight tandem mass spectrometry. A total of 63 differential host proteins were identified in BDV Hu-H1-infected OL cells compared to non-infected OL cells. We found that most changes referred to alterations related to the pentose phosphate pathway, glyoxylate and dicarboxylate metabolism, the tricarboxylic acid (TCA) cycle, and glycolysis /gluconeogenesis. By manual querying, two differential proteins were found to be associated with mitogen-activated protein kinase (MAPK) signal transduction. Five key signaling proteins of this pathway (i.e., p-Raf, p-MEK, p-ERK1/2, p-RSK, and p-MSK) were selected for Western blotting validation. p-ERK1/2 and p-RSK were found to be significantly up-regulated, and p-MSK was found to be significantly down-regulated in BDV Hu-H1-infected OL cells compared to non-infected OL cell. Although BDV Hu-H1 constitutively activated the ERK-RSK pathway, host cell proliferation and nuclear translocation of activated pERK in BDV Hu-H1-infected OL cells were impaired. These findings indicate that BDV Hu-H1 infection of human oligodendroglial cells significantly perturbs host energy metabolism, activates the downstream ERK-RSK complex of

  11. Investigation of the HU-density conversion method and comparison of dose distribution for dose calculation on MV cone beam CT images

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Min Joo; Lee, Seu Ran; Suh, Tae Suk [Dept. of Biomedical Engineering, The Catholic University of Korea, Bucheon (Korea, Republic of)

    2011-11-15

    Modern radiation therapy techniques, such as Image-guided radiation therapy (IGRT), Adaptive radiation therapy (ART) has become a routine clinical practice on linear accelerators for the increase the tumor dose conformity and improvement of normal tissue sparing at the same time. For these highly developed techniques, megavoltage cone beam computed tomography (MVCBCT) system produce volumetric images at just one rotation of the x-ray beam source and detector on the bottom of conventional linear accelerator for real-time application of patient condition into treatment planning. MV CBCT image scan be directly registered to a reference CT data set which is usually kilo-voltage fan-beam computed tomography (kVFBCT) on treatment planning system and the registered image scan be used to adjust patient set-up error. However, to use MV CBCT images in radiotherapy, reliable electron density (ED) distribution are required. Patients scattering, beam hardening and softening effect caused by different energy application between kVCT, MV CBCT can cause cupping artifacts in MV CBCT images and distortion of Houns field Unit (HU) to ED conversion. The goal of this study, for reliable application of MV CBCT images into dose calculation, MV CBCT images was modified to correct distortion of HU to ED using the relationship of HU and ED from kV FBCT and MV CBCT images. The HU-density conversion was performed on MV CBCT image set using Dose difference map was showing in Figure 1. Finally, percentage differences above 3% were reduced depending on applying density calibration method. As a result, total error co uld be reduced to under 3%. The present study demonstrates that dose calculation accuracy using MV CBCT image set can be improved my applying HU-density conversion method. The dose calculation and comparison of dose distribution from MV CBCT image set with/without HU-density conversion method was performed. An advantage of this study compared to other approaches is that HU

  12. Infección por Gnathostoma (Spirurida: Gnathostomatidae en Hoplias microlepis: prevalencia, correlación con la talla del pez, huéspedes e implicaciones para salud pública en Ecuador

    Directory of Open Access Journals (Sweden)

    Juan José Alava

    2009-12-01

    Conclusiones. La gnathostomiasis sigue siendo prevalente en la zona costera de Ecuador y el agente patógeno es aún encontrado en el huésped intermediario. Diversos mamíferos neotropicales estarían actuando como huésped reservorio definitivo en el ciclo biológico de Gnathostoma en Ecuador.

  13. "Riia ring, "luurepost ja tööjaotus USA esindustest Baltikumis 1920. aastatel / Eero Medijainen""

    Index Scriptorium Estoniae

    Medijainen, Eero, 1959-

    2012-01-01

    Diplomaatilisest taustast. USA esinduste rajamisest Baltikumi. Olukorrast USA saatkonnas 1922. aastal. USA sõjalisest vaatlejast "Balti provintsides" 1919-1922. Luurekeskusest ja Sergius Riisist. "Vene sektsiooni" formaliseeerumisest.

  14. Conservation status of Lagothrix flavicauda and other primates in montane forest of San Martín and Huánuco, Peru

    Directory of Open Access Journals (Sweden)

    Rolando Aquino

    2017-04-01

    Full Text Available Lagothrix flavicauda is endemic and lives sympatrically with other primates in the montane forests of Amazonas, San Martín, La Libertad and Huánuco. Detailed information on its density and conservation status, as well as sites with healthy populations is lacking, except for Amazonas where most of the studies were carried out. In order to obtain information on the mentioned aspects, transect censuses were conducted between November and December of 2015, February to May of 2016, and between June and July of 2016 in six survey sites located in the regions of San Martín and Huánuco. As a result of the census, 49 groups belonging to 7 species were sighted, being L. flavicauda the most observed with 14 groups. The largest groups were observed in L. flavicauda (average 13.5±2.2 individuals and Cebus yuracus (average 12.5±3.6 individuals and the smallest in Alouatta seniculus (average 3.0± 2.4 individuals, both in Huánuco. The relative abundance was the highest for L. flavicauda in San Martín (2.4 individuals /10 km and the lowest for A. seniculus in Huánuco (0.2 individuals/ 10 km. Our observation of L. flavicauda on the eastern side of the Huallaga River extends its distribution in Huánuco to the Pozuzo River, but on the western side we can consider it locally extinct in much of its distributional range. At our survey sites, deforestation and hunting are the main threats to primates and other components of wildlife.

  15. Detrimental ELAVL-1/HuR-dependent GSK3β mRNA stabilization impairs resolution in acute respiratory distress syndrome.

    Directory of Open Access Journals (Sweden)

    Olivia Hoffman

    Full Text Available A hallmark of acute respiratory distress syndrome (ARDS is accumulation of protein-rich edema in the distal airspaces and its removal is critical for patient survival. Previous studies have shown a detrimental role of Glycogen Synthase Kinase (GSK 3β during ARDS via inhibition of alveolar epithelial protein transport. We hypothesized that post-transcriptional regulation of GSK3β could play a functional role in ARDS resolution. To address this hypothesis, we performed an in silico analysis to identify regulatory genes whose expression correlation to GSK3β messenger RNA utilizing two lung cancer cell line array datasets. Among potential regulatory partners of GSK3β, these studies identified the RNA-binding protein ELAVL-1/HuR (Embryonic Lethal, Abnormal Vision, Drosophila-Like as a central component in a likely GSK3β signaling network. ELAVL-1/HuR is a RNA-binding protein that selectively binds to AU-rich elements of mRNA and enhances its stability thereby increasing target gene expression. Subsequent studies with siRNA suppression of ELAVL-1/HuR demonstrated deceased GSK3β mRNA and protein expression and improved clearance of FITC-albumin in A549 cells. Conversely, stabilization of ELAVL-1/HuR with the proteasome inhibitor MG-132 resulted in induction of GSK3β at mRNA and protein level and attenuated FITC-albumin clearance. Utilizing ventilator-induced lung injury or intra-tracheal installation of hydrochloric acid to induce ARDS in mice, we observed increased mRNA and protein expression of ELAVL-1/HuR and GSK3β. Together, our findings indicate a previously unknown interaction between GSK3β and ELAV-1 during ARDS, and suggest the inhibition of the ELAV-1- GSK3β pathways as a novel ARDS treatment approach.

  16. Antitumor activity of hu14.18-IL2 in patients with relapsed/refractory neuroblastoma: a Children's Oncology Group (COG) phase II study.

    Science.gov (United States)

    Shusterman, Suzanne; London, Wendy B; Gillies, Stephen D; Hank, Jacquelyn A; Voss, Stephan D; Seeger, Robert C; Reynolds, C Patrick; Kimball, Jennifer; Albertini, Mark R; Wagner, Barrett; Gan, Jacek; Eickhoff, Jens; DeSantes, Kenneth B; Cohn, Susan L; Hecht, Toby; Gadbaw, Brian; Reisfeld, Ralph A; Maris, John M; Sondel, Paul M

    2010-11-20

    The hu14.18-IL2 fusion protein consists of interleukin-2 molecularly linked to a humanized monoclonal antibody that recognizes the GD2 disialoganglioside expressed on neuroblastoma cells. This phase II study assessed the antitumor activity of hu14.18-IL2 in two strata of patients with recurrent or refractory neuroblastoma. Hu14.18-IL2 was given intravenously (12 mg/m(2)/daily) for 3 days every 4 weeks for patients with disease measurable by standard radiographic criteria (stratum 1) and for patients with disease evaluable only by [(123)I]metaiodobenzylguanidine (MIBG) scintigraphy and/or bone marrow (BM) histology (stratum 2). Response was established by independent radiology review as well as BM histology and immunocytology, and durability was assessed by repeat evaluation after more than 3 weeks. Thirty-nine patients were enrolled (36 evaluable). No responses were seen in stratum 1 (n = 13). Of 23 evaluable patients in stratum 2, five patients (21.7%) responded; all had a complete response (CR) of 9, 13, 20, 30, and 35+ months duration. Grade 3 and 4 nonhematologic toxicities included capillary leak, hypoxia, pain, rash, allergic reaction, elevated transaminases, and hyperbilirubinemia. Two patients required dopamine for hypotension, and one patient required ventilatory support for hypoxia. Most toxicities were reversible within a few days of completing a treatment course and were expected based on phase I results. Patients with disease evaluable only by MIBG and/or BM histology had a 21.7% CR rate to hu14.8-IL2, whereas patients with bulky disease did not respond. Hu14.18-IL2 warrants further testing in children with nonbulky high-risk neuroblastoma.

  17. Modelo de gestión cultural: Una experiencia con el Qhapaq Ñan en Huánuco

    Directory of Open Access Journals (Sweden)

    Denesy Palacios Jiménez

    2014-06-01

    Full Text Available Objetivos: Plantear el aprovechamiento del patrimonio cultural arqueológico del Qhapaq Ñan en Huánuco en condición de parque cultural, mediante un modelo eficiente de gestión cultural basada en la investigación, protección, conservación y uso social, para convertir a este lugar en un destino turístico y así contribuir con un proyecto no solo para salvaguardarlo sino también para incrementar los ingresos económicos y reducir los niveles de pobreza en la zona. Métodos: Se trata de un estudio que describe y recoge experiencias de gestión cultural respecto a cómo se aprovecha en otros sitios el legado o patrimonio cultural arqueológico, tanto en el ámbito mundial como nacional. La investigación fue cuantitativa y cualitativa, con un alcance correlacional. Se usó el diseño descriptivo, comparativo, analítico, histórico, deductivo. Resultados: El estudio plantea la necesidad de optimizar los recursos para el aprovechamiento del Qhapaq Ñan como parque cultural a través de una adecuada gestión cultural, y que dicho parque comprenderá 68,34 km, desde el tambo de Tambococha o Tunsucancha hasta el tambo de Taparako, por ser uno de los tramos mejor conservados e involucra importantes zonas de patrimonio cultural material e inmaterial. Conclusiones: El Camino Inca en Huánuco es uno de los patrimonios más importantes del país, y es posible ser impulsado como un parque cultural mediante un modelo de gestión cultural, si tenemos en cuenta las diversas experiencias de gestión en el país y en mundo, cuyos aportes deben servir de apoyo para un modelo de gestión en este campo.

  18. Bioavailability of iron multi-amino acid chelate preparation in mice and human duodenal HuTu 80 cells.

    Science.gov (United States)

    Kajarabille, Naroa; Brown, Catriona; Cucliciu, Anamaria; Thapaliya, Gita; Latunde-Dada, Gladys O

    2017-03-01

    Strategies for preventing Fe deficiency include Fe supplementation and Fe fortification of foods. The absorption, metabolism and chemical characteristics of Fe multi-amino acid chelate (IMAAC) are not known. Absorption of IMAAC was compared with FeSO4 in Fe-depleted mice and in vitro chemical studies of the Fe supplement was performed in HuTu 80 cells. Hb repletion study was carried out in Fe-deficient CD1 mice that were fed for 10 d a diet supplemented with ferrous IMAAC or FeSO4. A control group of Fe-replete mice was fed a diet with adequate Fe concentrations throughout the study. Tissues were collected from the mice, and the expression of Fe-related genes was determined by quantitative PCR. Ferric reductase and Fe uptake were evaluated in HuTu 80 cells. Supplementation of the diet with FeSO4 or IMAAC significantly increased Hb levels (P<0·001) in Fe-deficient mice from initial 93·9 (SD 10·8) or 116·2 (SD 9·1) to 191 (SD 0·7) or 200 (SD 0·5) g/l, respectively. Initial and final Hb for the Fe-deficient control group were 87·4 (SD 6·7) and 111 (SD 11·7) g/l, respectively. Furthermore, the liver non-haem Fe of both supplement groups increased significantly (P<0·001). IMAAC was more effective at restoring Fe in the spleen compared with FeSO4 (P<0·005). Gene expression showed the IMAAC supplement absorption is regulated by the body's Fe status as it significantly up-regulated hepcidin (P<0·001) and down-regulated duodenal cytochrome b mRNA (P<0·005), similar to the effects seen with FeSO4. A significant proportion of Fe in IMAAC is reduced by ascorbic acid. Fe absorption in mice and cells was similar for both IMAAC and FeSO4 and both compounds induce and regulate Fe metabolism genes similarly in the maintenance of homeostasis in mice.

  19. Synergistic Anticancer Effects of Vorinostat and Epigallocatechin-3-Gallate against HuCC-T1 Human Cholangiocarcinoma Cells

    Directory of Open Access Journals (Sweden)

    Tae Won Kwak

    2013-01-01

    Full Text Available The aim of this study was to investigate the effect of the combination of vorinostat and epigallocatechin-3-gallate against HuCC-T1 human cholangiocarcinoma cells. A novel chemotherapy strategy is required as cholangiocarcinomas rarely respond to conventional chemotherapeutic agents. Both vorinostat and EGCG induce apoptosis and suppress invasion, migration, and angiogenesis of tumor cells. The combination of vorinostat and EGCG showed synergistic growth inhibitory effects and induced apoptosis in tumor cells. The Bax/Bcl-2 expression ratio and caspase-3 and -7 activity increased, but poly (ADP-ribose polymerase expression decreased when compared to treatment with each agent alone. Furthermore, invasion, matrix metalloproteinase (MMP expression, and migration of tumor cells decreased following treatment with the vorinostat and EGCG combination compared to those of vorinostat or EGCG alone. Tube length and junction number of human umbilical vein endothelial cells (HUVECs decreased as well as vascular endothelial growth factor expression following vorinostat and EGCG combined treatment. These results indicate that the combination of vorinostat and EGCG had a synergistic effect on inhibiting tumor cell angiogenesis potential. We suggest that the combination of vorinostat and EGCG is a novel option for cholangiocarcinoma chemotherapy.

  20. Characterization and hepatoprotective effect of polysaccharides from Ziziphus jujuba Mill. var. spinosa (Bunge) Hu ex H. F. Chou sarcocarp.

    Science.gov (United States)

    Yue, Yuan; Wu, Shuangchan; Zhang, Huifang; Zhang, Xuyan; Niu, Yunhui; Cao, Xiaoqin; Huang, Fuwei; Ding, Hong

    2014-12-01

    The polysaccharides from Ziziphus jujuba Mill. var. spinosa (Bunge) Hu ex H. F. Chou sarcocarp (PWJS) is evaluated for the chemical composition, antioxidant activity and hepatoprotective effect. The characteristics of PWJS were determined by FT-IR spectral and HPLC analysis. The antioxidant activity was investigated using in vitro systems. An in vivo study of PWJS against CCl4 induced liver injury was also conducted. HPLC analysis showed that PWJS is an acidic heteropolysaccharide, rich in glucose (38.59%), arabinose (23.16%), galacturonic acid (17.64%) and galactose (10.44%). PWJS displayed strong antioxidant activity in vitro. In the in vivo study, PWJS treatment lowered the serum levels of ALT and AST in CCl4-intoxicated mice. Additionally, levels of antioxidant enzymes (SOD and CAT) and GSH were elevated in liver damage mice by PWJS intervention, while content of MDA was lessened. Meanwhile, PWJS reverses the suppression of Nrf2 nuclear translocation, and increases the protein expression of HO-1, GSTα and NQO1 in liver damage mice. Hematoxylin-eosin staining showed that the condition of liver damage was mitigated. This study demonstrates that PWJS reverses hepatotoxicity in CCl4-intoxicated mice through the mechanisms of antioxidant activity, as well as an augmentation of the Nrf2 pathway in liver tissue. Copyright © 2014 Elsevier Ltd. All rights reserved.

  1. Karyotypes of Akodon orophilus Osgood 1913 and Thomasomys sp. (Rodentia: Sigmodontinae from Huánuco, Peru

    Directory of Open Access Journals (Sweden)

    Víctor Pacheco

    2012-10-01

    Full Text Available Conventional chromosomal preparations were made of three native mice from Huánuco, Peru: a male and a female of Thomasomys sp., and a male of Akodon orophilus. Thomasomys sp. had a karyotype of 2n = 42, XY (n = 21, meanwhile A. orophilus presented 2n = 22, XY (n = 11. Comparisons between chromosomal pairs from the existent literature indicate that both are new karyotypes. Thomasomys sp. has a distinct sexual Y chromosome, the only metacentric (m reported for the genus. The chromosomes X and Y of A. orophilus are acrocentrics (a; and the length of chromosome Y (2/3 of the length of X distinguishes A. orophilus from other congeneric. Because the structural differences between the sexual chromosomes usually generates mechanism of reproductive isolation at intraspecific level and are bigger still in interspecific crosses, we concluded that the karyotypes reported here support the validity of the species A. orophilus and suggest that Thomasomys sp. represents a new species to science.

  2. Trigeminal Neuralgia as the First Clinical Manifestation of Anti-Hu Paraneoplastic Syndrome Induced by a Borderline Ovarian Mucinous Tumor

    Directory of Open Access Journals (Sweden)

    Hossein Kalanie

    2014-01-01

    Full Text Available Paraneoplastic neurologic syndrome (PNS is an uncommon manifestation of cancer that is not caused by the tumor or metastasis. Trigeminal neuralgia (TN is an initial symptom of this disease, but it has rarely been reported in the literature. Here, we report the case of a 76-year-old woman who presented with classic TN, followed by limbic encephalitis due to an underlying ovarian intestinal-type mucinous borderline tumor, with the presence of anti-Hu antibodies. She recovered quickly after removal of the tumor and was essentially free of symptoms 2 weeks after surgery. Because PNS precedes the tumor in approximately 60% of cases, its rapid detection and treatment are crucial. Therefore, we propose that PNS be considered during the management of TN when brain imaging is normal, as it is followed by other central and/or peripheral neurological manifestations as well as the presence of systemic symptoms such as anemia, fatigability, loss of appetite, or weight loss.

  3. A Network Pharmacology Approach to Uncover the Pharmacological Mechanism of XuanHuSuo Powder on Osteoarthritis

    Directory of Open Access Journals (Sweden)

    Huaqi Tang

    2016-01-01

    Full Text Available As the most familiar type of arthritis and a chronic illness of the joints, Osteoarthritis (OA affects a great number of people on the global scale. XuanHuSuo powder (XHSP, a conventional herbal formula from China, has been extensively applied in OA treatment. Nonetheless, its pharmacological mechanism has not been completely expounded. In this research, a network pharmacology approach has been chosen to study the pharmacological mechanism of XHSP on OA, and the pharmacology networks were established based on the relationship between four herbs found in XHSP, compound targets, and OA targets. The pathway enrichment analysis revealed that the significant bioprocess networks of XHSP on OA were regulation of inflammation, interleukin-1β (IL-1β production and nitric oxide (NO biosynthetic process, response to cytokine or estrogen stimuli, and antiapoptosis. These effects have not been reported previously. The comprehensive network pharmacology approach developed by our research has revealed, for the first time, a connection between four herbs found in XHSP, corresponding compound targets, and OA pathway systems that are conducive to expanding the clinical application of XHSP. The proposed network pharmacology approach could be a promising complementary method by which researchers might better evaluate multitarget or multicomponent drugs on a systematic level.

  4. A Network Pharmacology Approach to Uncover the Pharmacological Mechanism of XuanHuSuo Powder on Osteoarthritis.

    Science.gov (United States)

    Tang, Huaqi; He, Shuaibing; Zhang, Xinyue; Luo, Shilin; Zhang, Baixia; Duan, Xiaojie; Zhang, Zhiqian; Wang, Wenqi; Wang, Yun; Sun, Yikun

    2016-01-01

    As the most familiar type of arthritis and a chronic illness of the joints, Osteoarthritis (OA) affects a great number of people on the global scale. XuanHuSuo powder (XHSP), a conventional herbal formula from China, has been extensively applied in OA treatment. Nonetheless, its pharmacological mechanism has not been completely expounded. In this research, a network pharmacology approach has been chosen to study the pharmacological mechanism of XHSP on OA, and the pharmacology networks were established based on the relationship between four herbs found in XHSP, compound targets, and OA targets. The pathway enrichment analysis revealed that the significant bioprocess networks of XHSP on OA were regulation of inflammation, interleukin-1β (IL-1β) production and nitric oxide (NO) biosynthetic process, response to cytokine or estrogen stimuli, and antiapoptosis. These effects have not been reported previously. The comprehensive network pharmacology approach developed by our research has revealed, for the first time, a connection between four herbs found in XHSP, corresponding compound targets, and OA pathway systems that are conducive to expanding the clinical application of XHSP. The proposed network pharmacology approach could be a promising complementary method by which researchers might better evaluate multitarget or multicomponent drugs on a systematic level.

  5. Pelger-Huët anomaly and Greenberg skeletal dysplasia: LBR-associated diseases of cholesterol metabolism.

    Science.gov (United States)

    Turner, Elizabeth M; Schlieker, Christian

    2016-01-01

    Lamin B Receptor (LBR) is an inner nuclear membrane protein associated with the rare human diseases Pelger-Huët anomaly and Greenberg skeletal dysplasia. A new study has used CRISPR/Cas9-mediated genetic manipulations in a human cell system to determine that the molecular etiology of these previously poorly understood disorders is a defect in cholesterol synthesis due to loss of LBR-associated sterol C14 reductase activity. The study furthermore determined that disease-associated LBR point mutations reduce sterol C14 reductase activity by decreasing the affinity of LBR for the reducing agent NADPH. Moreover, two disease-associated LBR truncation mutants were found to be highly unstable at the protein level and are rapidly turned over by a novel nuclear membrane-based protein quality control pathway. Thus, truncated LBR variants can now be used as model substrates for further investigations of nuclear protein quality control to uncover possible implications for other disease-associated nuclear envelopathies.

  6. Hepatitis B Virus X Upregulates HuR Protein Level to Stabilize HER2 Expression in Hepatocellular Carcinoma Cells

    Directory of Open Access Journals (Sweden)

    Chao-Ming Hung

    2014-01-01

    Full Text Available Hepatitis B virus- (HBV- associated hepatocellular carcinoma (HCC is the most common type of liver cancer. However, the underlying mechanism of HCC tumorigenesis is very complicated and HBV-encoded X protein (HBx has been reported to play the most important role in this process. Activation of downstream signal pathways of epidermal growth factor receptor (EGFR family is known to mediate HBx-dependent HCC tumor progression. Interestingly, HER2 (also known as ErbB2/Neu/EGFR2 is frequently overexpressed in HBx-expressing HCC patients and is associated with their poor prognosis. However, it remains unclear whether and how HBx regulates HER2 expression. In this study, our data showed that HBx expression increased HER2 protein level via enhancing its mRNA stability. The induction of RNA-binding protein HuR expression by HBx mediated the HER2 mRNA stabilization. Finally, the upregulated HER2 expression promoted the migration ability of HBx-expressing HCC cells. These findings deciphered the molecular mechanism of HBx-mediated HER2 upregulation in HBV-associated HCC.

  7. Avaliação dos óbitos ocorridos no Hospital Universitário da Universidade Federal de Santa Catarina (HU/UFSC Evaluation of deaths occurred at the University Hospital (HU/UFSC

    Directory of Open Access Journals (Sweden)

    Rachel Duarte Moritz

    2008-10-01

    Full Text Available OBJETIVO: Avaliar os óbitos ocorridos no HU/UFSC. Comparar o perfil dos pacientes que morreram nas enfermarias com o daqueles que morreram na UTI. Verificar se os óbitos foram considerados esperados (E e não evitáveis (NE. Constatar se houve recusa/suspensão de terapêutica (RST precedendo a morte. MÉTODOS: Obtivemos dados por meio de ficha elaborada pela Comissão de Óbito Hospitalar (COH, na qual constavam os aspectos demográficos, clínicos e terapêuticos dos pacientes e a avaliação da COH sobre a expectativa/evitabilidade dos óbitos. RESULTADOS: Analisamos os dados dos 326 pacientes com mais de 14 anos, que morreram entre julho/2004 e dezembro/2005. Desses, 128 morreram na UTI (G1 e 198 nas enfermarias (G2. A RST precedeu 38,2% dos óbitos no G1 e 2% no G2 (pOBJECTIVE: To evaluate the deaths which occurred at the HU/UFSC. To compare the profile of patients who died in the wards with that of patients who died in the ICU. To classify deaths which were expected or not, and avoidable or not. To verify how often withholding or withdrawing (WW therapy preceded death. METHODS: Archives of the Hospital Death Commission (HDC were analyzed. The clinical and demographic records were retrieved from the HDC data bank. Deaths were classified by the HDC as expected or not and avoidable or not. RESULTS: Data from 326 dead persons over 14 years of age were analyzed. One hundred and twenty eight deaths occurred in the ICU (G1 and 198 in the wards (G2. WW therapy preceded 38.2% of deaths in G1 and 2% in G2 (p<0.001. The main WW therapies were vasoactive drugs and antibiotics. Almost 20% of deaths were unexpected/avoidable in G1. In G2 6.5% were considered unexpected and 5% avoidable (p<0.005. Patients in G1 were younger and mostly male (p<0.005. Do-not-resuscitate orders were registered in 48.4% of patients' medical charts in G2 and 6.3% in G1 (p<0.001. Cardiopulmonary resuscitation was performed in 23.4% of patients in G1 and in 5.5% in G2 (p<0

  8. Niños y Niñas, expósitos y huérfanos en Montevideo del siglo XIX

    Directory of Open Access Journals (Sweden)

    María Laura Osta Vázquez

    2016-12-01

    Full Text Available Desde la perspectiva de la historia de la infancia, de la historia de los conceptos, entre otras perspectivas metodológicas, nos proponemos visibilizar a niños y niñas huérfanos Montevideanos del siglo XIX. En 1818 fue fundado el primer hogar de niños huérfanos llamado La Inclusa, donde las prácticas giraban a partir de un Torno 1, donde los bebés eran dejados en su mayoría anónimamente por sus padres, familiares, vecinos o parteras. Nos proponemos deconstruir conceptos hoy día utilizados y contextualizarlos históricamente a estas prácticas. A través de algunos cuadros realizados a partir de actas de registros y adopciones, buscamos visibilizar en cifras estos niños, niñas, padres, madres y nodrizas

  9. Application of virtual screening and molecular dynamics for the analysis of selectivity of inhibitors of HU proteins targeted to the DNA-recognition site

    Science.gov (United States)

    Talyzina, A. A.; Agapova, Yu. K.; Podshivalov, D. D.; Timofeev, V. I.; Sidorov-Biryukov, D. D.; Rakitina, T. V.

    2017-11-01

    DNA-Binding HU proteins are essential for the maintenance of genomic DNA supercoiling and compaction in prokaryotic cells and are promising pharmacological targets for the design of new antibacterial agents. The virtual screening for low-molecular-weight compounds capable of specifically interacting with the DNA-recognition loop of the HU protein from the mycoplasma Spiroplasma melliferum was performed. The ability of the initially selected ligands to form stable complexes with the protein target was assessed by molecular dynamics simulation. One compound, which forms an unstable complex, was eliminated by means of a combination of computational methods, resulting in a decrease in the number of compounds that will pass to the experimental test phase. This approach can be used to solve a wide range of problems related to the search for and validation of low-molecular-weight inhibitors specific for a particular protein target.

  10. AdHu5Ag85A Respiratory Mucosal Boost Immunization Enhances Protection against Pulmonary Tuberculosis in BCG-Primed Non-Human Primates.

    Science.gov (United States)

    Jeyanathan, Mangalakumari; Shao, Zhongqi; Yu, Xuefeng; Harkness, Robin; Jiang, Rong; Li, Junqiang; Xing, Zhou; Zhu, Tao

    2015-01-01

    Persisting high global tuberculosis (TB) morbidity and mortality and poor efficacy of BCG vaccine emphasizes an urgent need for developing effective novel boost vaccination strategies following parenteral BCG priming in humans. Most of the current lead TB vaccine candidates in the global pipeline were developed for parenteral route of immunization. Compelling evidence indicates respiratory mucosal delivery of vaccine to be the most effective way to induce robust local mucosal protective immunity against pulmonary TB. However, despite ample supporting evidence from various animal models, there has been a lack of evidence supporting the safety and protective efficacy of respiratory mucosal TB vaccination in non-human primates (NHP) and humans. By using a rhesus macaque TB model we have evaluated the safety and protective efficacy of a recombinant human serotype 5 adenovirus-based TB vaccine (AdHu5Ag85A) delivered via the respiratory mucosal route. We show that mucosal AdHu5Ag85A boost immunization was safe and well tolerated in parenteral BCG-primed rhesus macaques. A single AdHu5Ag85A mucosal boost immunization in BCG-primed rhesus macaques enhanced the antigen-specific T cell responses. Boost immunization significantly improved the survival and bacterial control following M.tb challenge. Furthermore, TB-related lung pathology and clinical outcomes were lessened in BCG-primed, mucosally boosted animals compared to control animals. Thus, for the first time we show that a single respiratory mucosal boost immunization with a novel TB vaccine enhances protection against pulmonary TB in parenteral BCG-primed NHP. Our study provides the evidence for the protective potential of AdHu5Ag85A as a respiratory mucosal boost TB vaccine for human application.

  11. Intratumoral hu14.18-IL-2 (IC) induces local and systemic antitumor effects that involve both activated T and NK cells as well as enhanced IC retention.

    Science.gov (United States)

    Yang, Richard K; Kalogriopoulos, Nicholas A; Rakhmilevich, Alexander L; Ranheim, Erik A; Seo, Songwon; Kim, Kyungmann; Alderson, Kory L; Gan, Jacek; Reisfeld, Ralph A; Gillies, Stephen D; Hank, Jacquelyn A; Sondel, Paul M

    2012-09-01

    hu14.18-IL-2 (IC) is an immunocytokine consisting of human IL-2 linked to hu14.18 mAb, which recognizes the GD2 disialoganglioside. Phase 2 clinical trials of i.v. hu14.18-IL-2 (i.v.-IC) in neuroblastoma and melanoma are underway and have already demonstrated activity in neuroblastoma. We showed previously that intratumoral hu14.18-IL-2 (IT-IC) results in enhanced antitumor activity in mouse models compared with i.v.-IC. The studies presented in this article were designed to determine the mechanisms involved in this enhanced activity and to support the future clinical testing of intratumoral administration of immunocytokines. Improved survival and inhibition of growth of both local and distant tumors were observed in A/J mice bearing s.c. NXS2 neuroblastomas treated with IT-IC compared with those treated with i.v.-IC or control mice. The local and systemic antitumor effects of IT-IC were inhibited by depletion of NK cells or T cells. IT-IC resulted in increased NKG2D receptors on intratumoral NKG2A/C/E⁺ NKp46⁺ NK cells and NKG2A/C/E⁺ CD8⁺ T cells compared with control mice or mice treated with i.v.-IC. NKG2D levels were augmented more in tumor-infiltrating lymphocytes compared with splenocytes, supporting the localized nature of the intratumoral changes induced by IT-IC treatment. Prolonged retention of IC at the tumor site was seen with IT-IC compared with i.v.-IC. Overall, IT-IC resulted in increased numbers of activated T and NK cells within tumors, better IC retention in the tumor, enhanced inhibition of tumor growth, and improved survival compared with i.v.-IC.

  12. An in vitro model for Pelger-Huët anomaly: Stable knockdown of lamin B receptor in HL-60 cells

    OpenAIRE

    Olins, Ada L; Ernst, Aurélie; Zwerger, Monika; Herrmann, Harald; Olins, Donald E.

    2010-01-01

    The principal human blood granulocyte (neutrophil) possesses a lobulated and deformable nucleus, important to facilitate rapid egress from blood vessels as these cells migrate to sites of bacterial or fungal infection. This unusual nuclear shape is a product of elevated levels of an integral membrane protein of the nuclear envelope lamin B receptor (LBR) and of decreased amounts of lamin A/C. In humans, a genetic deficiency of LBR produces Pelger-Huët anomaly, resulting in blood neutrophils t...

  13. A comparative study of oral health attitudes and behavior using the Hiroshima University-Dental Behavioral Inventory (HU-DBI) between dental and civil engineering students in Colombia.

    Science.gov (United States)

    Jaramillo, Jorge A; Jaramillo, Fredy; Kador, Itzjak; Masuoka, David; Tong, Liyue; Ahn, Chul; Komabayashi, Takashi

    2013-03-01

    The aim of this study was to use the Hiroshima University - Dental Behavioral Inventory (HU-DBI) to compare oral health attitudes and behavior of dental and civil engineering students in Colombia. The HU-DBI's survey consisting of twenty dichotomous responses (agree-disagree) regarding tooth brushing, was completed at University Antonio Narino for the dental students and the University of Cauca for the civil engineering students. The Spanish version of the HU-DBI questionnaire was taken by 182 of 247 dental students and 411 of 762 engineering students. The data was-statistically analyzed by the chi-square test and backward logistic regression. Compared to the engineering students, the dental students were more likely to agree with questions such as "I am bothered by the color of my gums"(OR = 2.2, 95% CI: 1.3-3.7),"I think I can clean my teeth well without using toothpaste" (OR = 3.0, 95% CI: 1.5-5.9), "I have used a dye to see how clean my teeth are" (OR = 2.9, 95% CI: 1.9-4.3), and "I have had my dentist tell me that I brush very well" (OR = 2.0, 95% CI: 1.3-3.1). The dental education curriculum in a dental school compared to a civil engineering school in Colombia indicated that a three-phase curriculum in didactics and clinics increased oral health attitudes and behavior from entry to graduation.

  14. Adrenaline promotes epithelial-to-mesenchymal transition via HuR-TGFβ regulatory axis in pancreatic cancer cells and the implication in cancer prognosis.

    Science.gov (United States)

    Pu, Jun; Zhang, Xiaorui; Luo, Huiwen; Xu, Lijuan; Lu, Xiaozhao; Lu, Jianguo

    2017-11-25

    Psychological stress has recently been described as a risk factor in the development of pancreatic cancer. Here, we reported that increased neurotransmitter adrenaline was associated with the poor survival in pancreatic cancer patients. Moreover, in the cell model study, we found adrenaline promoted pancreatic cell PANC-1 migration in a dose dependent manner. Block of the β2-adrenoreceptor with ICI118,551, significantly reduced cell migration. Further study found that adrenaline induced a cytoplasmic translocation of RNA binding protein HuR, which in turn activated TGFβ, as shown by the SBE luciferase assay and phosphorylation of Smad2/3. Either HuR knockdown or TGFβ inhibition reduced cell migration induced by adrenaline. Taken together, our study here revealed that adrenaline-HuR-TGFβ regulatory axis at least partially contributes to the psychological stress induced metastasis in PANC-1 cells, shedding light on therapeutic targeting psychological stress in improving the prognosis of pancreatic cancer. Copyright © 2017 Elsevier Inc. All rights reserved.

  15. La presencia de Ixodes luciae en el noroeste argentino y nuevos huéspedes para Ixodes pararicinus y algunas especies de Amblyomma (Acari: Ixodidae

    Directory of Open Access Journals (Sweden)

    Analía G. AUTINO

    2006-01-01

    Full Text Available El análisis de una colección de garrapatas de mamíferos del noroeste argentino, depositados en la Colección de Anexos de la Colección Mamíferos Lillo (CML de la Universidad Nacional de Tucumán, permitió ampliar el área de distribución de Ixodes luciae Sénevet, a las provincias de Salta y Tucumán e incrementar su rango de huéspedes al roedor sigmodontino Calomys callosus (Rengger y a los marsupiales de la familia Didelphidae Micoureus constantiae (Thomas, Thylamys cinderella Thomas y Thylamys venustus (Thomas. Se registró a C. callosus y Oligoryzomys destructor (Tschudi como nuevos huéspedes de Ixodes pararicinus Keirans & Clifford, y a los Carnivora Lycalopex gymnocercus (Fischer y Oncifelis geoffroyi (d ́Orbigny & Gervais como nuevos huéspedes de Amblyomma neumanni Ribaga y Amblyomma parvum Aragão, respectivamente. Adicionalmente, se observó la infestación de Lutreolina crassicaudata (Desmarest (Didelphidae por I. luciae y la presencia de Amblyomma tigrinum Koch, sobre L. gymnocercus. Ninfas de Amblyomma sp. se obtuvieron de Akodon Meyen (Sigmodontinae.

  16. Genetic polymorphisms of CASR and cancer risk: evidence from meta-analysis and HuGE review

    Directory of Open Access Journals (Sweden)

    Jeong S

    2016-02-01

    Full Text Available Sohyun Jeong, Jae Hyun Kim, Myeong Gyu Kim, Nayoung Han, In-Wha Kim, Therasa Kim, Jung Mi Oh College of Pharmacy and Research Institute of Pharmaceutical Sciences, Seoul National University, Seoul, South Korea Background: CASR gene appears to be involved in cancer biology and physiology. However, a number of studies investigating CASR polymorphisms and cancer risks have presented inconclusive results. Thus, a systematic review and a meta-analysis of the effect of CASR polymorphisms on several cancer risks were performed to suggest a statistical evidence for the association of CASR polymorphisms with cancer risks.Methods: MEDLINE, EMBASE, Web of Science, Scopus, and the HuGE databases were searched. Nineteen articles of case–control and cohort studies were included for the final analysis.Results: The colorectal cancer risk was reduced in proximal (odds ratio [OR] =0.679, P=0.001 and distal (OR =0.753, P=0.026 colon sites with GG genotype of CASR rs1042636 and increased in distal colon site (OR =1.418, P=0.039 with GG genotype of rs1801726 by additive genetic model. The rs17251221 demonstrated noticeable associations that carrying a homozygote variant increases breast and prostate cancer risk considerably.Conclusion: The significant association of CASR polymorphisms with several cancer risks was observed in this review. In particular, the act of CASR polymorphisms as a tumor suppressor or an oncogene differs by cancer site and can be the research target for tumorigenesis. Keywords: rs1042636, rs1801725, rs1801726, systematic review, colorectal cancer

  17. Combined influence of CT random noise and HU-RSP calibration curve nonlinearities on proton range systematic errors

    Science.gov (United States)

    Brousmiche, S.; Souris, K.; Orban de Xivry, J.; Lee, J. A.; Macq, B.; Seco, J.

    2017-11-01

    Proton range random and systematic uncertainties are the major factors undermining the advantages of proton therapy, namely, a sharp dose falloff and a better dose conformality for lower doses in normal tissues. The influence of CT artifacts such as beam hardening or scatter can easily be understood and estimated due to their large-scale effects on the CT image, like cupping and streaks. In comparison, the effects of weakly-correlated stochastic noise are more insidious and less attention is drawn on them partly due to the common belief that they only contribute to proton range uncertainties and not to systematic errors thanks to some averaging effects. A new source of systematic errors on the range and relative stopping powers (RSP) has been highlighted and proved not to be negligible compared to the 3.5% uncertainty reference value used for safety margin design. Hence, we demonstrate that the angular points in the HU-to-RSP calibration curve are an intrinsic source of proton range systematic error for typical levels of zero-mean stochastic CT noise. Systematic errors on RSP of up to 1% have been computed for these levels. We also show that the range uncertainty does not generally vary linearly with the noise standard deviation. We define a noise-dependent effective calibration curve that better describes, for a given material, the RSP value that is actually used. The statistics of the RSP and the range continuous slowing down approximation (CSDA) have been analytically derived for the general case of a calibration curve obtained by the stoichiometric calibration procedure. These models have been validated against actual CSDA simulations for homogeneous and heterogeneous synthetical objects as well as on actual patient CTs for prostate and head-and-neck treatment planning situations.

  18. ESR1 Gene Polymorphisms and Prostate Cancer Risk: A HuGE Review and Meta-Analysis.

    Directory of Open Access Journals (Sweden)

    Yu-Mei Wang

    Full Text Available Many published data on the association between single nucleotide polymorphisms (SNPs in the ESR1 gene and prostate cancer susceptibility are inconclusive. The aim of this Human Genome Epidemiology (HuGE review and meta-analysis is to derive a more precise estimation of this relationship.A literature search of PubMed, Embase, Web of Science and Chinese Biomedical (CBM databases was conducted from their inception through July 1st, 2012. Crude odds ratios (ORs with 95% confidence intervals (CIs were calculated to assess the strength of association.Twelve case-control studies were included with a total 2,165 prostate cancer cases and 3,361 healthy controls. When all the eligible studies were pooled into the meta-analysis, ESR1 PvuII (C>T and XbaI (A>G polymorphisms showed no association with the risk of prostate cancer. However, in the stratified analyses based on ethnicity and country, the results indicated that ESR1 PvuII (C>T polymorphism was significantly associated with increased risk of prostate cancer among Asian populations, especially among Indian population; while ESR1 XbaI (A>G polymorphism may significantly increase the risk of prostate cancer among American population. Furthermore, we also performed a pooled analysis for all eligible case-control studies to explore the role of codon 10 (T>C, codon 325 (C>G, codon 594 (G>A and +261G>C polymorphisms in prostate cancer risk. Nevertheless, no significant associations between these polymorphisms and the risk of prostate cancer were observed.Results from the current meta-analysis indicate that ESR1 PvuII (C>T polymorphism may be a risk factor for prostate cancer among Asian populations, especially among Indian population; while ESR1 XbaI (A>G polymorphism may increase the risk of prostate cancer among American population.

  19. A.~()HU

    African Journals Online (AJOL)

    Sandhurst's founder established a brave tradition. For he was no armchair strategist: in 1812 he died in a gallant charge .... of the many accounts of the Academy. It is now rather out-of-date. 2. H Thomas: op. cil., p 167. ..... The possibility of Scotland, with its vital. NATP bases, securing independence is becoming a nightmare ...

  20. Genetic inactivation of the Fanconi anemia gene FANCC identified in the hepatocellular carcinoma cell line HuH-7 confers sensitivity towards DNA-interstrand crosslinking agents

    Directory of Open Access Journals (Sweden)

    Bassermann Florian

    2010-05-01

    Full Text Available Abstract Background Inactivation of the Fanconi anemia (FA pathway through defects in one of 13 FA genes occurs at low frequency in various solid cancer entities among the general population. As FA pathway inactivation confers a distinct hypersensitivity towards DNA interstrand-crosslinking (ICL-agents, FA defects represent rational targets for individualized therapeutic strategies. Except for pancreatic cancer, however, the prevalence of FA defects in gastrointestinal (GI tumors has not yet been systematically explored. Results A panel of GI cancer cell lines was screened for FA pathway inactivation applying FANCD2 monoubiquitination and FANCD2/RAD51 nuclear focus formation and a newly identified FA pathway-deficient cell line was functionally characterized. The hepatocellular carcinoma (HCC line HuH-7 was defective in FANCD2 monoubiquitination and FANCD2 nuclear focus formation but proficient in RAD51 focus formation. Gene complementation studies revealed that this proximal FA pathway inactivation was attributable to defective FANCC function in HuH-7 cells. Accordingly, a homozygous inactivating FANCC nonsense mutation (c.553C > T, p.R185X was identified in HuH-7, resulting in partial transcriptional skipping of exon 6 and leading to the classic cellular FA hypersensitivity phenotype; HuH-7 cells exhibited a strongly reduced proliferation rate and a pronounced G2 cell cycle arrest at distinctly lower concentrations of ICL-agents than a panel of non-isogenic, FA pathway-proficient HCC cell lines. Upon retroviral transduction of HuH-7 cells with FANCC cDNA, FA pathway functions were restored and ICL-hypersensitivity abrogated. Analyses of 18 surgical HCC specimens yielded no further examples for genetic or epigenetic inactivation of FANCC, FANCF, or FANCG in HCC, suggesting a low prevalence of proximal FA pathway inactivation in this tumor type. Conclusions As the majority of HCC are chemoresistant, assessment of FA pathway function in HCC could

  1. Effectiveness of the HuCare Quality Improvement Strategy on health-related quality of life in patients with cancer: study protocol of a stepped-wedge cluster randomised controlled trial (HuCare2 study).

    Science.gov (United States)

    Caminiti, Caterina; Iezzi, Elisa; Passalacqua, Rodolfo

    2017-10-06

    Our group previously demonstrated the feasibility of the HuCare Quality Improvement Strategy (HQIS), aimed at integrating into practice six psychosocial interventions recommended by international guidelines. This trial will assess whether the introduction of the strategy in oncology wards improves patient's health-related quality of life (HRQoL). Multicentre, incomplete stepped-wedge cluster randomised controlled trial, conducted in three clusters of five centres each, in three equally spaced time epochs. The study also includes an initial epoch when none of the centres are exposed to the intervention, and a final epoch when all centres will have implemented the strategy. The intervention is applied at a cluster level, and assessed at an individual level with cross-sectional model. A total of 720 patients who received a cancer diagnosis in the previous 2 months and about to start medical treatment will be enrolled. The primary aim is to evaluate the effectiveness of the HQIS versus standard care in terms of improvement of at least one of two domains (emotional and social functions) of HRQoL using the EORTC QLQ-C30 (European Organisation for Research and Treatment of Cancer Quality of Life Questionnaire-Core 30 items) questionnaire, at baseline and at 3 months. This outcome was chosen because patients with cancer generally exhibit low HRQoL, particularly at certain stages of care, and because it allows to assess the strategy's impact as perceived by patients themselves. The HQIS comprises three phases: (1) clinician training-to improve communication-relational skills and instruct on the project; (2) centre support-four on-site visits by experts of the project team, aimed to boost motivation, help with context analysis and identification of solutions; (3) implementation of Evidence-Based Medicine (EBM) recommendations at the centre. Ethics committee review approval has been obtained from the Ethics Committee of Parma. Results will be disseminated at conferences, and

  2. Phase I trial of anti-GD2 monoclonal antibody hu3F8 plus GM-CSF: Impact of body weight, immunogenicity and anti-GD2 response on pharmacokinetics and survival.

    Science.gov (United States)

    Cheung, Irene Y; Kushner, Brian H; Modak, Shakeel; Basu, Ellen M; Roberts, Stephen S; Cheung, Nai-Kong V

    2017-01-01

    Fifty-seven stage 4 patients with refractory/relapsed neuroblastoma were enrolled in a phase I trial (Clinicaltrials.gov NCT01757626) using humanized anti-GD2 monoclonal antibody hu3F8 in combination with granulocyte-macrophage colony-stimulating factor. The influence of body weight and human anti-human antibody (HAHA) on the pharmacokinetics (PK) of hu3F8, and the effect of de novo anti-GD2 response on patient outcome were explored. Serum samples before hu3F8 infusion, and serially up to day 12 during treatment cycle #1, and at 5 min after each hu3F8 infusion for all subsequent cycles were collected. PK was analyzed using non-compartmental modeling. Immunogenicity was assayed by HAHA response, and vaccination effect by induced host anti-GD2 response measured periodically until disease progression or last followup. Progression-free and overall survival was estimated by the Kaplan-Meier method. Despite dosing being based on body weight, smaller patients had consistently lower area-under-the-curve and faster clearance over the 15 dose levels (0.9 to 9.6 mg/kg per treatment cycle) in this trial. Positive HAHA, defined by the upper limit of normal, when measured within 10 days from the last hu3F8 dose received, was associated with significantly lower serum hu3F8. Despite prior sensitization to other anti-GD2 antibody, e.g. mouse 3F8 or ch14.18, 75% of the patients never developed HAHA response even after getting more treatment cycles. Hu3F8 induced a de novo anti-GD2 response in patients, which was prognostic of progression-free survival. We conclude that hu3F8 had low immunogenicity. During treatment, positive HAHA and low body weight affected PK adversely, whereas induced anti-GD2 response was an outcome predictor.

  3. Rationale and design of mDOT-HuA study: a randomized trial to assess the effect of mobile-directly observed therapy on adherence to hydroxyurea in adults with sickle cell anemia in Tanzania

    Directory of Open Access Journals (Sweden)

    Abel Makubi

    2016-10-01

    Full Text Available Abstract Background Hydroxyurea (HU has been demonstrated to be efficacious in reducing complications in individuals with sickle cell anemia (SCA but poor adherence is a barrier. Directly Observed Therapy (DOT has been shown to improve adherence in various chronic diseases but there is limited data in adults with SCA. Methods and design To examine the effect of mobile-directly observed therapy (mDOT on adherence to HU (mDOT-HuA in adults with SCA at Muhimbili National Hospital in Tanzania. The mDOT-HuA study is a single centre, prospective, randomized, open label clinical trial. One-hundred individuals with SCA with haemoglobin SS genotype, aged ≥18 years, living in Dar es Salaam, able and willing to record and submit videos electronically will be included. Participants will be divided into two treatment arms; 50 in the standard monitoring (SM arm will receive mobile phones and fixed dose HU therapy with standard monitoring; 50 in the mDOT arm will receive mobile phones, fixed dose HU therapy with standard monitoring and a mobile directly observed web based medication adherence monitoring system. The primary outcome is the proportion of participants achieving ≥80 % HU adherence compared between the two arms as assessed through medication possession ratio at the end of 3 months of treatment. REDCap, an open source software application will be used to collect data using clinical research forms. The proportions of adherence in the two arms will be compared by Fisher’s exact test. Analysis of outcomes will have performed by both the intention-to treat and per-protocol methods. Discussion Should this study become sucessful, it will have the potential for the development of novel strategies for improving HU adherence in SCA. Trial registration ClinicalTrials.gov Identifier: NCT02844673 , registered on 25tht July 2016 (retrospectively registered.

  4. A biblioterapia na humanização da assistência hospitalar do Hospital Universitário da Universidade Federal de Santa Catarina – HU/UFSC/Bibliotherapy for the hospital care humanization in the university hospital of Santa Catarina Federal University – HU/UFSC

    Directory of Open Access Journals (Sweden)

    Eva Seitz

    2008-01-01

    Full Text Available Este artigo tem por finalidade apresentar resultados do estudo realizado com pacientes, acompanhantes e funcionários das Unidades de Internação Cirúrgica do Hospital Universitário da Universidade Federal de Santa Catarina (UIC/HU/UFSC. O foco central foi o de verificar até que ponto a prática biblioterapêutica e as atividades de lazer contribuem no processo de Humanização da Assistência Hospitalar dos pacientes internados nas (UIC/HU/UFSC, na percepção dos pacientes, acompanhantes, funcionários da enfermagem e assistentes sociais da referida unidade de internação. Foram entrevistados 16 pacientes, 11 acompanhantes e 13 funcionários da enfermagem e assistentes sociais. As atividades de lazer analisadas neste estudo foram a prática biblioterapêutica, as atividades do grupo Reaja e a dança. Trata-se de uma pesquisa quantitativa e qualitativa. Quanto ao procedimento técnico, a presente pesquisa é classificada como estudo de caso, no qual, utilizou-se, para a coleta dos dados a entrevista estruturada e, cujos resultados demonstram que as atividades contribuem muito na Humanização da Assistência Hospitalar dos pacientes internados na UIC/HU/UFSC. This article has for purpose to present resulted of the study carried through with patients, companions and employees of the Units of Surgical Internment of the University Hospital of the Federal University of Santa Catarina (UIC/HU/UFSC. The central focus was to verify until point the practical library-therapy and the activities of leisure contribute in the process of Humanization of the Hospital Assistance of the patients interned in (UIC/HU/UFSC, in the perception of the patients, companions, employees of the nursing and social assistants of the related unit of internment. 16 patients, 11 companions and 13 social employees of the nursing and assistants had been interviewed. The analyzed activities of leisure in this study had been the practical library-therapy, the activities of

  5. Attenuation of Proinflammatory Responses by S-[6]-Gingerol via Inhibition of ROS/NF-Kappa B/COX2 Activation in HuH7 Cells

    Directory of Open Access Journals (Sweden)

    Xiao-Hong Li

    2013-01-01

    Full Text Available Introduction. Hepatic inflammation underlies the pathogenesis of chronic diseases such as insulin resistance and type 2 diabetes mellitus. S-[6]-Gingerol has been shown to have anti-inflammatory properties. Important inflammatory mediators of interleukins include nuclear factor κB (NFκB and cyclooxygenase 2 (COX2. We now explore the mechanism of anti-inflammatory effects of S-[6]-gingerol in liver cells. Methods. HuH7 cells were stimulated with IL1β to establish an in vitro hepatic inflammatory model. Results. S-[6]-Gingerol attenuated IL1β-induced inflammation and oxidative stress in HuH7 cells, as evidenced by decreasing mRNA levels of inflammatory factor IL6, IL8, and SAA1, suppression of ROS generation, and increasing mRNA levels of DHCR24. In addition, S-[6]-gingerol reduced IL1β-induced COX2 upregulation as well as NFκB activity. Similar to the protective effects of S-[6]-gingerol, both NS-398 (a selective COX2 inhibitor and PDTC (a selective NFκB inhibitor suppressed mRNA levels of IL6, IL8, and SAA1. Importantly, PDTC attenuated IL1β-induced overexpression of COX2. Of particular note, the protective effect of S-[6]-gingerol against the IL1β-induced inflammatory response was similar to that of BHT, an ROS scavenger. Conclusions. The findings of this study demonstrate that S-[6]-gingerol protects HuH7 cells against IL1β-induced inflammatory insults through inhibition of the ROS/NFκB/COX2 pathway.

  6. Efecto de una intervención educativa sobre los conocimientos de teniasis/cisticercosis en una comunidad rural de Huánuco, Perú 2005

    OpenAIRE

    Elsa Palacios-Flores; Eler Borneo-Cantalicio

    2008-01-01

    Objetivo. Evaluar el efecto de una intervención educativa sobre los conocimientos de teniasis/cisticercosis en los pobladores de la localidad de Queropalca, Huánuco. Materiales y métodos. Se realizó un ensayo comunitario, en el cual se aplicó una estrategia educativo comunicacional sobre los factores de riesgo de teniasis/cisticercosis, consistente en metodologías participativas de visitas casa en casa y campañas de promoción en toda la jurisdicción durante seis meses (junio a diciembre del 2...

  7. Priming with r-metHuSCF and filgrastim or chemotherapy and filgrastim in patients with malignant lymphomas: a randomized phase II pilot study of mobilization and engraftment

    DEFF Research Database (Denmark)

    Johnsen, H E; Geisler, C; Juvonen, E

    2011-01-01

    SCF has been shown to synergize with G-CSF to mobilize CD34(+) PBPCs. In this study we report results from this combination after a phase II trial of 32 patients with malignant lymphoma randomized to receive recombinant methionyl human SCF (ancestim, r-metHuSCF) in combination with recombinant...... and thrombocytopenia was documented in arm B. Third, 9/14 (64%) patients in arm A reached the target of 5 million CD34(+) cells/kg body weight (bw) compared with 13/15 (87%) in arm B. The results represent the first randomized trial of growth factor plus chemotherapy priming and indicate that a formal phase III trial...

  8. Modelo de gestión para la atención integral de pacientes con enfermedades huérfanas o raras en Colombia

    OpenAIRE

    Córdoba Buriticá, Juan Pablo; Salinas Nova, María Angélica

    2016-01-01

    Las enfermedades raras o huérfanas corresponden a aquellas con baja prevalencia en la población, y en varios países tienen una definición distinta de acuerdo con el número de pacientes que afectan en la población. La Organización Mundial de la Salud (OMS), las define como un trastorno que afecta de 650 a 1.000 personas por millón de habitantes, de las que se han identificado alrededor de 7.000. En Colombia su prevalencia es menor de 1 por cada 5.000 personas y comprenden: las enfermedades rar...

  9. A novel cantharidin analog N-Benzylcantharidinamide reduces the expression of MMP-9 and invasive potentials of Hep3B via inhibiting cytosolic translocation of HuR

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Ji-Yeon; Chung, Tae-Wook; Choi, Hee-Jung [Division of Applied Medicine, School of Korean Medicine, Pusan National University, Yangsan, Gyeongnam (Korea, Republic of); Lee, Chang Hyun [Department of Anatomy, College of Korean Medicine, Woosuk University, Wanju-gun, Jeonbuk (Korea, Republic of); Eun, Jae Soon; Han, Young Taek [College of Pharmacy, Woosuk University, Wanju-gun, Jeonbuk (Korea, Republic of); Choi, Jun-Yong [Department of Internal Medicine, Korean Medicine Hospital, School of Korean Medicine, Pusan National University, Yangsan 626-870 (Korea, Republic of); Department of Korean Medical Science, School of Korean Medicine, Pusan National University, Yangsan, Gyeongnam (Korea, Republic of); Kim, So-Yeon; Han, Chang-Woo [Department of Internal Medicine, Korean Medicine Hospital, School of Korean Medicine, Pusan National University, Yangsan 626-870 (Korea, Republic of); Jeong, Han-Sol, E-mail: jhsol33@pusan.ac.kr [Division of Applied Medicine, School of Korean Medicine, Pusan National University, Yangsan, Gyeongnam (Korea, Republic of); Ha, Ki-Tae, E-mail: hagis@pusan.ac.kr [Division of Applied Medicine, School of Korean Medicine, Pusan National University, Yangsan, Gyeongnam (Korea, Republic of); Department of Korean Medical Science, School of Korean Medicine, Pusan National University, Yangsan, Gyeongnam (Korea, Republic of)

    2014-05-02

    Highlights: • We examined the inhibition of N-Benzylcantharidinamide on MMP-9-mediated invasion. • Unlike cantharidin, N-Benzylcantharidinamide has very low toxicity on Hep3B cells. • The reduced MMP-9 expression was due to HuR-mediated decrease of mRNA stability. • We suggest N-Benzylcantharidinamide as a novel inhibitor of MMP-9-related invasion. - Abstract: Invasion and metastasis are major causes of malignant tumor-associated mortality. The present study aimed to investigate the molecular events underlying inhibitory effect of N-Benzylcantharidinamide, a novel synthetic analog of cantharidin, on matrix metalloproteinase-9 (MMP-9)-mediated invasion in highly metastatic hepatocellular carcinoma Hep3B cells. In this investigation, among six analogs of cantharidin, only N-Benzylcantharidinamide has the inhibitory action on MMP-9 expression at non-toxic dose. The MMP-9 expression and invasion of Hep3B cells were significantly suppressed by treatment of N-Benzylcantharidinamide in a dose-dependent manner. On the other hand, the transcriptional activity of MMP-9 promoter and nuclear levels of NF-κB and AP-1 as the main transcriptional factors inducing MMP-9 expression were not affected by it although the level of MMP-9 mRNA was reduced by treatment of N-Benzylcantharidinamide. Interestingly, the stability of MMP-9 mRNA was significantly reduced by N-Benzylcantharidinamide-treatment. In addition, the cytosolic translocation of human antigen R (HuR), which results in the increase of MMP-9 mRNA stability through interaction of HuR with 3′-untranslated region of MMP-9 mRNA, was suppressed by treatment of N-Benzylcantharidinamide, in a dose-dependent manner. Taken together, it was demonstrated, for the first time, that N-Benzylcantharidinamide suppresses MMP-9 expression by reducing HuR-mediated MMP-9 mRNA stability for the inhibition of invasive potential in highly metastatic Hep3B cells.

  10. NESTEENSEURANTA OSANA SYDÄMEN VAJAATOIMINTAPOTILAAN HOITOA : Nestelistan käyttökoulutus Huén yliopistollisen sairaalan sisätautiosastolla

    OpenAIRE

    Semi, Johannes; Lankinen, Markus

    2017-01-01

    Lankinen, Markus & Semi, Johannes. Nestelista osana sydämen vajaatoimintapotilaan hoitoa – Huén yliopistollisen sairaalan sisätautiosasto. Kevät 2017, 48 s., 8 liitettä. Diakonia-ammattikorkeakoulu. Hoitotyön koulutusohjelma, Sairaanhoitaja (AMK). Opinnäytetyössä perehdytään sydämen vajaatoimintaan, nesteenseurantaan sekä raportoidaan kehittämisproduktio. Sen tavoitteena oli kouluttaa henkilökuntaa nesteenseurannan tarkkailussa. Tätä varten kehitettiin nestelista, jonka käyttö opetettiin ...

  11. Inhibition of miR-9 de-represses HuR and DICER1 and impairs Hodgkin lymphoma tumour outgrowth in vivo

    DEFF Research Database (Denmark)

    Leucci, E; Zriwil, A; Gregersen, L H

    2012-01-01

    MicroRNAs are important regulators of gene expression in normal development and disease. miR-9 is overexpressed in several cancer forms, including brain tumours, hepatocellular carcinomas, breast cancer and Hodgkin lymphoma (HL). Here we demonstrated a relevance for miR-9 in HL pathogenesis...... of miR-9 by a systemically delivered antimiR-9 in a xenograft model of HL increases the protein levels of HuR and DICER1 and results in decreased tumour outgrowth, confirming that miR-9 actively participates in HL pathogenesis and points to miR-9 as a potential therapeutic target.Oncogene advance online...

  12. [Acquired Pelger-Huët anomaly/abnormal chromatin clumping of granulocytes after allogeneic hematopoietic stem cell transplantation for acute myeloid leukaemia: medication or relapse? ].

    Science.gov (United States)

    Daufresne, Pierre; Cottin, Laurane; Girard, Jean-Maxime; Henriot, Iris; Zharkova, Anna; Sutra Del Galy, Aurélien; Schmidt, Aline; Ribourtout, Bénédicte; Zandecki, Marc

    2016-01-01

    An acute myeloid leukemia was diagnosed in a 53-year-old female patient. She received an allogeneic stem cell transplant. After this transplant, some neutrophils with hyposegmented nucleus and abnormal chromatin clumping appeared in the peripheral blood, and their number gradually increased. The hypothesis of early relapse after transplant was ruled out and drug-related anomaly was suspected. The authors discuss about morphological features of constitutional and acquired Pelger-Huët anomaly. In the patient reported here, ciclosporine seemed to be involved in the phenomenon, as the morphological anomaly of the neutrophils gradually decreased after the drug was discontinued.

  13. Tafonomia del yacimiento de vertebrados pleistoceno de Huéscar-1 (Granada, españa

    Directory of Open Access Journals (Sweden)

    Alberdi, M. T.

    2003-08-01

    Full Text Available This work analyses the sedimentary and taphonomic processes that induced the selective preservation and spatial distribution of Húescar-1 bone assemblage (early Galerian. The bone fossil remains are associated with an alluvial fan system that flowed into a lacustrine area with calcareous sedimentation. The fossils show numerous scratch and abrasion marks produced during their transportation as channel lag. The remains appear in three sedimentological settings: in paleochannel filling-up sequences, in pockets built at the outlet of the channels in the lacustrine area, and scattered within calcareous silts. Nevertheless, most of them are found in the second instante. The cumulative process was attritional as pointed out by the mortality profiles of Equus altidens and could be explained by selective predation and/or seasonal bone accumulation. The notably small number of artiodactyl species, particularly in the typical foms of bush or forest habitats and the presence of amphibious forms (Hippopotamus are indicative of an open grassland habitat. The aquatic birds represent the autochthonous component of the association. For each bone recovered severa1 variables were measured, the data obtained underwent graphic and statistical treatment that provided useful information for the site taphonomic interpretation.Se estudia el conjunto de procesos sedimentarios y rasgos tafonómicos que condicionaron la preservación selectiva y disposición espacial de los restos de vertebrados que forman el yacimiento de edad Galeriense inferior de Huéscar-l. Los restos óseos están asociados a un sistema de abanicos aluviales que desembocaba en una zona lacustre carbonatada amplia. Es un conjunto transportado donde los restos muestran numerosas señales de abrasión y arrastre. Los restos óseos aparecen en tres situaciones sedimentológicas: carga de fondo en el relleno de los paleocanales, bolsadas formadas en el punto de la desembocadura y dispersos espor

  14. A phase 1b study of humanized KS-interleukin-2 (huKS-IL2) immunocytokine with cyclophosphamide in patients with EpCAM-positive advanced solid tumors.

    Science.gov (United States)

    Connor, Joseph P; Cristea, Mihaela C; Lewis, Nancy L; Lewis, Lionel D; Komarnitsky, Philip B; Mattiacci, Maria R; Felder, Mildred; Stewart, Sarah; Harter, Josephine; Henslee-Downey, Jean; Kramer, Daniel; Neugebauer, Roland; Stupp, Roger

    2013-01-15

    Humanized KS-interleukin-2 (huKS-IL2), an immunocytokine with specificity for epithelial cell adhesion molecule (EpCAM), has demonstrated favorable tolerability and immunologic activity as a single agent. Phase 1b study in patients with EpCAM-positive advanced solid tumors to determine the maximum tolerated dose (MTD) and safety profile of huKS-IL2 in combination with low-dose cyclophosphamide. Treatment consisted of cyclophosphamide (300 mg/m2 on day 1), and escalating doses of huKS-IL2 (0.5-4.0 mg/m2 IV continuous infusion over 4 hours) on days 2, 3, and 4 of each 21-day cycle. Safety, pharmacokinetic profile, immunogenicity, anti-tumor and biologic activity were evaluated. Twenty-seven patients were treated for up to 6 cycles; 26 were evaluable for response. The MTD of huKS-IL2 in combination with 300 mg/m2 cyclophosphamide was 3.0 mg/m2. At higher doses, myelosuppression was dose-limiting. Transient lymphopenia was the most common grade 3/4 adverse event (AE). Other significant AEs included hypotension, hypophosphatemia, and increase in serum creatinine. All patients recovered from these AEs. The huKS-IL2 exposure was dose-dependent, but not dose-proportional, accumulation was negligible, and elimination half-life and systemic clearance were independent of dose and time. Most patients had a transient immune response to huKS-IL2. Immunologic activity was observed at all doses. Ten patients (38%) had stable disease as best response, lasting for ≥ 4 cycles in 3 patients. The combination of huKS-IL2 with low-dose cyclophosphamide was well tolerated. Although no objective responses were observed, the combination showed evidence of immunologic activity and 3 patients showed stable disease for ≥ 4 cycles.

  15. Chemogenomic Study of Carboplatin in Saccharomyces cerevisiae: Inhibition of the NEDDylation Process Overcomes Cellular Resistance Mediated by HuR and Cullin Proteins

    Science.gov (United States)

    Custodio, Débora Fernandes; Freitas, Vanessa Morais; Monteiro, Gisele

    2015-01-01

    The use of carboplatin in cancer chemotherapy is limited by the emergence of drug resistance. To understand the molecular basis for this resistance, a chemogenomic screen was performed in 53 yeast mutants that had previously presented strong sensitivity to this widely used anticancer agent. Thirty-four mutants were responsive to carboplatin, and from these, 21 genes were selected for further studies because they have human homologues. Sixty percent of these yeast genes possessed human homologues which encoded proteins that interact with cullin scaffolds of ubiquitin ligases, or whose mRNA are under the regulation of Human antigen R (HuR) protein. Both HuR and cullin proteins are regulated through NEDDylation post-translational modification, and so our results indicate that inhibition of this process should sensitise resistant tumour cells to carboplatin. We showed that treatment of a tumour cell line with MLN4924, a NEDDylation inhibitor, overcame the resistance to carboplatin. Our data suggest that inhibition of NEDDylation may be a useful strategy to resensitise tumour cells in patients that have acquired carboplatin resistance. PMID:26692264

  16. Mesenchymal Stromal Cells Prevent Renal Fibrosis in a Rat Model of Unilateral Ureteral Obstruction by Suppressing the Renin-Angiotensin System via HuR.

    Directory of Open Access Journals (Sweden)

    Marilena Gregorini

    Full Text Available We studied Mesenchymal Stromal Cells (MSC effects in experimental Unilateral Ureteral Obstruction (UUO, a fibrogenic renal disease. Rats were divided in 5 groups: sham, UUO, MSC treated-UUO, ACEi treated-UUO, MSC+ACEi treated- UUO. Data were collected at 1, 7, 21 days. UUO induced monocyte renal infiltration, tubular cell apoptosis, tubular atrophy, interstitial fibrosis and overexpression of TGFβ, Renin mRNA (RENmRNA, increase of Renin, Angiotensin II (AII and aldosterone serum levels. Both lisinopril (ACEi and MSC treatment prevented monocyte infiltration, reduced tubular cell apoptosis, renal fibrosis and TGFβ expression. Combined therapy provided a further suppression of monocyte infiltration and tubular injury. Lisinopril alone caused a rebound activation of Renin-Angiotensin System (RAS, while MSC suppressed RENmRNA and Renin synthesis and induced a decrease of AII and aldosterone serum levels. Furthermore, in in-vitro and in-vivo experiments, MSC inhibit Human antigen R (HuR trascription, an enhancer of RENmRNA stability by IL10 release. In conclusion, we demonstrate that in UUO MSC prevent fibrosis, by decreasing HuR-dependent RENmRNA stability. Our findings give a clue to understand the molecular mechanism through which MSC may prevent fibrosis in a wide and heterogeneous number of diseases that share RAS activation as common upstream pathogenic mechanism.

  17. El zorro Andino, P seudalopes P seudalopes P culpaeus , un nuevo huésped para Corynosoma obtuscens (Acanthocephala en el Perú*

    Directory of Open Access Journals (Sweden)

    Manuel Tantaleán

    2013-04-01

    Full Text Available Se describe la presencia de Corynosoma obtuscens Lincicome, 1943 (Acanthocephala, Polymor- Corynosoma obtuscens L i n c i c o m e , 1 9 4 3 ( A c a n t h o c e p h a l a , P o l y m o r - Corynosoma obtuscens phidae en el intestino delgado del zorro andino Pseudalopex culpaeus (Molina, 1782 procedente Pseudalopex culpaeus ( M o l i n a , 1 7 8 2 p r o c e d e n t e Pseudalopex culpaeus de San Juan de Marcona, Departamento de Ica, Perú. Esta es la segunda vez que se registra la infección natural de un mamífero terrestre por C. obtuscens en el Perú, por lo que se considera C. obtuscens en el Perú, por lo que se considera C. obtuscens a P. culpaeus como huésped defi nitivo accidental P. culpaeus como huésped defi nitivo accidental P. culpaeus ; además se comenta la posibilidad de que éste acantocefalo infecte al hombre.

  18. Studie průběhu zakázky firmou se zaměřením na expedici

    OpenAIRE

    Indráková, Adriana

    2013-01-01

    Diplomová práce monitoruje průběh zakázky firmou Böhler Uddeholm CZ s.r.o. v prodejním oddělení a v oddělení nákupu a logistiky. Cílem práce je analýza současného stavu a návrh na zlepšení průběhu zakázky a expedice. V teoretické části se práce zaměřuje na informační technologie, cyklus objednávky a její zpracování. V praktické části je představena analyzovaná společnost, popsán průběh zakázky firmou a poté jsou formulovány návrhy, které by měly přispět k efektivnějšímu průběhu zakázky. Th...

  19. Hyper conserved elements in vertebrate mRNA 3'-UTRs reveal a translational network of RNA-binding proteins controlled by HuR.

    Science.gov (United States)

    Dassi, Erik; Zuccotti, Paola; Leo, Sara; Provenzani, Alessandro; Assfalg, Michael; D'Onofrio, Mariapina; Riva, Paola; Quattrone, Alessandro

    2013-03-01

    Little is known regarding the post-transcriptional networks that control gene expression in eukaryotes. Additionally, we still need to understand how these networks evolve, and the relative role played in them by their sequence-dependent regulatory factors, non-coding RNAs (ncRNAs) and RNA-binding proteins (RBPs). Here, we used an approach that relied on both phylogenetic sequence sharing and conservation in the whole mapped 3'-untranslated regions (3'-UTRs) of vertebrate species to gain knowledge on core post-transcriptional networks. The identified human hyper conserved elements (HCEs) were predicted to be preferred binding sites for RBPs and not for ncRNAs, namely microRNAs and long ncRNAs. We found that the HCE map identified a well-known network that post-transcriptionally regulates histone mRNAs. We were then able to discover and experimentally confirm a translational network composed of RNA Recognition Motif (RRM)-type RBP mRNAs that are positively controlled by HuR, another RRM-type RBP. HuR shows a preference for these RBP mRNAs bound in stem-loop motifs, confirming its role as a 'regulator of regulators'. Analysis of the transcriptome-wide HCE distribution revealed a profile of prevalently small clusters separated by unconserved intercluster RNA stretches, which predicts the formation of discrete small ribonucleoprotein complexes in the 3'-UTRs.

  20. A topical microbicide gel formulation of CCR5 antagonist maraviroc prevents HIV-1 vaginal transmission in humanized RAG-hu mice.

    Directory of Open Access Journals (Sweden)

    C Preston Neff

    Full Text Available For prevention of HIV infection many currently licensed anti-HIV drugs and new ones in the pipeline show potential as topically applied microbicides. While macaque models have been the gold standard for in vivo microbicide testing, they are expensive and sufficient numbers are not available. Therefore, a small animal model that facilitates rapid evaluation of potential candidates for their preliminary efficacy is urgently needed in the microbicide field. We previously demonstrated that RAG-hu humanized mouse model permits HIV-1 mucosal transmission via both vaginal and rectal routes and that oral pre-exposure chemo-prophylactic strategies could be tested in this system. Here in these proof-of-concept studies, we extended this system for topical microbicide testing using HIV-1 as the challenge virus. Maraviroc, a clinically approved CCR5 inhibitor drug for HIV treatment, was formulated as a microbicide gel at 5 mM concentration in 2.2% hydroxyl ethyl cellulose. Female RAG-hu mice were challenged vaginally with HIV-1 an hour after intravaginal application of the maraviroc gel. Our results showed that maraviroc gel treated mice were fully protected against vaginal HIV-1 challenge in contrast to placebo gel treated mice which all became infected. These findings highlight the utility of the humanized mouse models for microbicide testing and, together with the recent data from macaque studies, suggest that maraviroc is a promising candidate for future microbicide clinical trials in the field.

  1. From the Ethnic History of Asia – the Dōnghú, Wūhuán and Xiānbēi Proto-Mongolian Tribes

    Directory of Open Access Journals (Sweden)

    Nenad Vidaković

    2012-04-01

    Full Text Available The aim of this paper is to present the history of the Dōnghú, Wūhuán and Xiānbēi Proto-Mongolian tribes in the period from the 4th century B.C. to the end of the 3rd century A.D. The history of the ancient nomadic peoples who lived north of China is written in Chinese dynasty chronicles. Proto-Mongolian tribes from the 1st century B.C. are called Dōnghú in Chinese sources. The earliest news on them originates from the Warring States Period (4th – 3rd century B.C., and tells of a conflict with the northern Chinese states. Other types of sources on the history of the Proto-Mongolian tribes are archaeological findings, which associate Mongolian ethnogenesis with slab grave cultures and the Lower Xiàjiādiàn. Linguists find the materials for the research on Mongolian ethnogenesis in the Altaic linguistic family, which the Mongolian language belongs to as well. Based on the mentioned sources, the change in the political situation in the steppes at the end of the 3rd century B.C., when the people of Xiōngnú created a powerful state and conquered the Dōnghúes, is described in the paper. The remains of the shattered Dōnghúes, who had mostly migrated to the north, have been recorded in Chinese chronicles under new topoethnonyms: Xiānbēi and Wūhuán. The weakening and fall of the Xiōngnúes’ state enabled the Proto-Mongolian tribes to re-enter the historical scene. At the end of the 1st century B.C. the Chinese Hàn Empire firstly established relations with the Wūhuán tribes and in the middle of the 1st century A.D. with the Xiānbēi tribes, too. In the beginning both tribal alliances acknowledged the supreme authority of China and carried out frontier service. Under the guidance of tribal chiefs the tribes started to run an independent policy and attack China’s border areas during the 2nd century A.D. In the conclusion, the author describes the period when the Wūhuán and Xiānbēi tribes were at the peak of their power

  2. DOSoReMI.hu: collection of countrywide DSM products partly according to GSM.net specifications, partly driven by specific user demands

    Science.gov (United States)

    Pásztor, László; Laborczi, Annamária; Takács, Katalin; Szatmári, Gábor; Illés, Gábor; Bakacsi, Zsófia; Szabó, József

    2017-04-01

    Due to former soil surveys and mapping activities significant amount of soil information has accumulated in Hungary. In traditional soil mapping the creation of a new map was troublesome and laborious. As a consequence, robust maps were elaborated and rather the demands were fitted to the available map products. Until recently spatial soil information demands have been serviced with the available datasets either in their actual form or after certain specific and often enforced, thematic and spatial inference. Considerable imperfection may occur in the accuracy and reliability of the map products, since there might be significant discrepancies between the available data and the expected information. The DOSoReMI.hu (Digital, Optimized, Soil Related Maps and Information in Hungary) project was started intentionally for the renewal of the national soil spatial infrastructure in Hungary. During our activities we have significantly extended the potential, how soil information requirements could be satisfied. Soil property, soil type as well as functional soil maps were targeted. The set of the applied digital soil mapping techniques has been gradually broadened incorporating and eventually integrating geostatistical, data mining and GIS tools. Soil property maps have been compiled partly according to GSM.net specifications, partly by slightly or more strictly changing some of their predefined parameters (depth intervals, pixel size, property etc.) according to the specific demands on the final products. The elaborated primary maps were further processed, since even DOSoReMI.hu intended to take steps for the regionalization of higher level soil information (processes, functions, and services) involving crop models in the spatial modelling. The framework of DOSoReMI.hu also provides opportunity for the elaboration of goal specific soil maps, with the prescription of the parameters (thematic, resolution, accuracy, reliability etc.) characterizing the map product. As a

  3. An Integrated Analysis of MicroRNA and mRNA Expression Profiles to Identify RNA Expression Signatures in Lambskin Hair Follicles in Hu Sheep.

    Directory of Open Access Journals (Sweden)

    Xiaoyang Lv

    Full Text Available Wave patterns in lambskin hair follicles are an important factor determining the quality of sheep's wool. Hair follicles in lambskin from Hu sheep, a breed unique to China, have 3 types of waves, designated as large, medium, and small. The quality of wool from small wave follicles is excellent, while the quality of large waves is considered poor. Because no molecular and biological studies on hair follicles of these sheep have been conducted to date, the molecular mechanisms underlying the formation of different wave patterns is currently unknown. The aim of this article was to screen the candidate microRNAs (miRNA and genes for the development of hair follicles in Hu sheep. Two-day-old Hu lambs were selected from full-sib individuals that showed large, medium, and small waves. Integrated analysis of microRNA and mRNA expression profiles employed high-throughout sequencing technology. Approximately 13, 24, and 18 differentially expressed miRNAs were found between small and large waves, small and medium waves, and medium and large waves, respectively. A total of 54, 190, and 81 differentially expressed genes were found between small and large waves, small and medium waves, and medium and large waves, respectively, by RNA sequencing (RNA-seq analysis. Differentially expressed genes were classified using gene ontology and pathway analyses. They were found to be mainly involved in cell differentiation, proliferation, apoptosis, growth, immune response, and ion transport, and were associated with MAPK and the Notch signaling pathway. Reverse transcription-polymerase chain reaction (RT-PCR analyses of differentially-expressed miRNA and genes were consistent with sequencing results. Integrated analysis of miRNA and mRNA expression indicated that, compared to small waves, large waves included 4 downregulated miRNAs that had regulatory effects on 8 upregulated genes and 3 upregulated miRNAs, which in turn influenced 13 downregulated genes. Compared to

  4. Phase I/II clinical and pharmacokinetic study evaluating a fully human monoclonal antibody against EGFr (HuMax-EGFr) in patients with advanced squamous cell carcinoma of the head and neck

    DEFF Research Database (Denmark)

    Bastholt, Lars; Specht, Lena; Jensen, Kenneth

    2007-01-01

    PURPOSE: To assess safety, tolerability, pharmacokinetics and clinical activity of HuMax-EGFr in patients with SCCHN. PATIENTS AND METHODS: Twenty-eight patients with SCCHN were enrolled. The study comprised a single-dose escalation part for assessment of safety issues followed by a repeat dose...... reactions varied from few days to 2 months. No DLTs were observed and MTD was not reached. In the two highest dose groups, 7 of 11 patients obtained a PR or SD and 9 patients obtained metabolic PR or SD. CONCLUSIONS: HuMax-EGFr can be safely administered in doses up to 8 mg/kg, and preliminary data...

  5. A phase I clinical trial of the hu14.18-IL2 (EMD 273063) as a treatment for children with refractory or recurrent neuroblastoma and melanoma: a study of the Children's Oncology Group.

    Science.gov (United States)

    Osenga, Kaci L; Hank, Jacquelyn A; Albertini, Mark R; Gan, Jacek; Sternberg, Adam G; Eickhoff, Jens; Seeger, Robert C; Matthay, Katherine K; Reynolds, C Patrick; Twist, Clare; Krailo, Mark; Adamson, Peter C; Reisfeld, Ralph A; Gillies, Stephen D; Sondel, Paul M

    2006-03-15

    Evaluate the clinical safety, toxicity, immune activation/modulation, and maximal tolerated dose of hu14.18-IL2 (EMD 273063) in pediatric patients with recurrent/refractory neuroblastoma and other GD2-positive solid tumors. Twenty-seven pediatric patients with recurrent/refractory neuroblastoma and one with melanoma were treated with a humanized anti-GD2 monoclonal antibody linked to human interleukin 2 (IL-2). Cohorts of patients received hu14.18-IL2, administered i.v. over 4 hours for three consecutive days, at varying doses. Patients with stable disease, partial, or complete responses were eligible to receive up to three additional courses of therapy. Most of the clinical toxicities were anticipated and similar to those reported with IL-2 and anti-GD2 monoclonal antibody therapy and to those noted in the initial phase I study of hu14.18-IL2 in adults with metastatic melanoma. The maximal tolerated dose was determined to be 12 mg/m2/d, with agent-related dose-limiting toxicities of hypotension, allergic reaction, blurred vision, neutropenia, thrombocytopenia, and leukopenia. Three patients developed dose-limiting toxicity during course 1; seven patients in courses 2 to 4. Two patients required dopamine for hypotension. There were no treatment-related deaths, and all toxicity was reversible. Treatment with hu14.18-IL2 led to immune activation/modulation as evidenced by elevated serum levels of soluble IL-2 receptor alpha (sIL2Ralpha) and lymphocytosis. The median half-life of hu14.18-IL2 was 3.1 hours. There were no measurable complete or partial responses to hu14.18-IL2 in this study; however, three patients did show evidence of antitumor activity. Hu14.18-IL2 (EMD 273063) can be administered safely with reversible toxicities in pediatric patients at doses that induce immune activation. A phase II clinical trial of hu14.18-IL2, administered at a dose of 12 mg/m2/d x 3 days repeated every 28 days, will be done in pediatric patients with recurrent

  6. A Phase I Clinical Trial of the hu14.18-IL2 (EMD 273063) as a Treatment for Children with Refractory or Recurrent Neuroblastoma and Melanoma: a Study of the Children’s Oncology Group

    Science.gov (United States)

    Osenga, Kaci L.; Hank, Jacquelyn A.; Albertini, Mark R.; Gan, Jacek; Sternberg, Adam G.; Eickhoff, Jens; Seeger, Robert C.; Matthay, Katherine K.; Reynolds, C. Patrick; Twist, Clare; Krailo, Mark; Adamson, Peter C.; Reisfeld, Ralph A.; Gillies, Stephen D.; Sondel, Paul M.

    2008-01-01

    Purpose Evaluate the clinical safety, toxicity, immune activation/modulation, and maximal tolerated dose of hu14.18-IL2 (EMD 273063) in pediatric patients with recurrent/refractory neuroblastoma and other GD2-positive solid tumors. Experimental Design Twenty-seven pediatric patients with recurrent/refractory neuroblastoma and one with melanoma were treated with a humanized anti-GD2 monoclonal antibody linked to human interleukin 2 (IL-2). Cohorts of patients received hu14.18-IL2, administered i.v. over 4 hours for three consecutive days, at varying doses. Patients with stable disease, partial, or complete responses were eligible to receive up to three additional courses of therapy. Results Most of the clinical toxicities were anticipated and similar to those reported with IL-2 and anti-GD2 monoclonal antibody therapy and to those noted in the initial phase I study of hu14.18-IL2 in adults with metastatic melanoma. The maximal tolerated dose was determined to be 12 mg/m2/d, with agent-related dose-limiting toxicities of hypotension, allergic reaction, blurred vision, neutropenia, thrombocytopenia, and leukopenia. Three patients developed dose-limiting toxicity during course 1; seven patients in courses 2 to 4. Two patients required dopamine for hypotension. There were no treatment-related deaths, and all toxicity was reversible. Treatment with hu14.18-IL2 led to immune activation/modulation as evidenced by elevated serum levels of soluble IL-2 receptor α (sIL2Rα) and lymphocytosis. The median half-life of hu14.18-IL2 was 3.1 hours. There were no measurable complete or partial responses to hu14.18-IL2 in this study; however, three patients did show evidence of antitumor activity. Conclusion Hu14.18-IL2 (EMD 273063) can be administered safely with reversible toxicities in pediatric patients at doses that induce immune activation. A phase II clinical trial of hu14.18-IL2, administered at a dose of 12 mg/m2/d × 3 days repeated every 28 days, will be done in pediatric

  7. A dual model HU conversion from MRI intensity values within and outside of bone segment for MRI-based radiotherapy treatment planning of prostate cancer

    Energy Technology Data Exchange (ETDEWEB)

    Korhonen, Juha, E-mail: juha.p.korhonen@hus.fi [Clinical Research Institute Helsinki University Central Hospital Ltd., POB-700, 00029 HUS, Finland and Department of Oncology, Helsinki University Central Hospital, POB-180, 00029 HUS (Finland); Kapanen, Mika [Clinical Research Institute Helsinki University Central Hospital Ltd., POB-700, 00029 HUS (Finland); Department of Oncology, Helsinki University Central Hospital, POB-180, 00029 HUS (Finland); Department of Medical Physics, Tampere University Hospital, POB-2000, 33521 Tampere (Finland); Keyriläinen, Jani; Seppälä, Tiina; Tenhunen, Mikko [Department of Oncology, Helsinki University Central Hospital, POB-180, 00029 HUS (Finland)

    2014-01-15

    Purpose: The lack of electron density information in magnetic resonance images (MRI) poses a major challenge for MRI-based radiotherapy treatment planning (RTP). In this study the authors convert MRI intensity values into Hounsfield units (HUs) in the male pelvis and thus enable accurate MRI-based RTP for prostate cancer patients with varying tissue anatomy and body fat contents. Methods: T{sub 1}/T{sub 2}*-weighted MRI intensity values and standard computed tomography (CT) image HUs in the male pelvis were analyzed using image data of 10 prostate cancer patients. The collected data were utilized to generate a dual model HU conversion technique from MRI intensity values of the single image set separately within and outside of contoured pelvic bones. Within the bone segment local MRI intensity values were converted to HUs by applying a second-order polynomial model. This model was tuned for each patient by two patient-specific adjustments: MR signal normalization to correct shifts in absolute intensity level and application of a cutoff value to accurately represent low density bony tissue HUs. For soft tissues, such as fat and muscle, located outside of the bone contours, a threshold-based segmentation method without requirements for any patient-specific adjustments was introduced to convert MRI intensity values into HUs. The dual model HU conversion technique was implemented by constructing pseudo-CT images for 10 other prostate cancer patients. The feasibility of these images for RTP was evaluated by comparing HUs in the generated pseudo-CT images with those in standard CT images, and by determining deviations in MRI-based dose distributions compared to those in CT images with 7-field intensity modulated radiation therapy (IMRT) with the anisotropic analytical algorithm and 360° volumetric-modulated arc therapy (VMAT) with the Voxel Monte Carlo algorithm. Results: The average HU differences between the constructed pseudo-CT images and standard CT images of each

  8. Effect of Age on Energy Requirement for Maintenance and Growth of Dorper and Hu Crossbred F1 Ewes Weighing 20 to 50 kg

    Directory of Open Access Journals (Sweden)

    H. T. Nie

    2015-08-01

    Full Text Available This research aimed to define the energy requirement of Dorper and Hu Hybrid F1 ewes 20 to 50 kg of body weight, furthermore to study energy requirement changes with age and evaluate the effect of age on energy requirement parameters. In comparative slaughter trial, thirty animals were divided into three dry matter intake treatments (ad libitum, n = 18; low restricted, n = 6; high restricted, n = 6, and were all slaughtered as baseline, intermediate, and final slaughter groups, to calculate body chemical components and energy retained. In digestibility trial, twelve ewes were housed in individual metabolic cages and randomly assigned to three feeding treatments in accordance with the design of a comparative slaughter trial, to evaluate dietary energetic values at different feed intake levels. The combined data indicated that, with increasing age, the net energy requirement for maintenance (NEm decreased from 260.62±13.21 to 250.61±11.79 kJ/kg0.75 of shrunk body weight (SBW/d, and metabolizable energy requirement for maintenance (MEm decreased from 401.99±20.31 to 371.23±17.47 kJ/kg0.75 of SBW/d. Partial efficiency of ME utilization for maintenance (km, 0.65 vs 0.68 and growth (kg, 0.42 vs 0.41 did not differ (p>0.05 due to age; At the similar condition of average daily gain, net energy requirements for growth (NEg and metabolizable energy requirements for growth (MEg for ewes during late fattening period were 23% and 25% greater than corresponding values of ewes during early fattening period. In conclusion, the effect of age upon energy requirement parameters in the present study were similar in tendency with previous recommendations, values of energy requirement for growth (NEg and MEg for Dorper and Hu crossbred female lambs ranged between the NRC (2007 recommendation for early and later maturating growing sheep.

  9. Isolation and characterization of an AP2/ERF-RAV transcription factor BnaRAV-1-HY15 in Brassica napus L. HuYou15.

    Science.gov (United States)

    Zhuang, Jing; Sun, Chao-Cai; Zhou, Xi-Rong; Xiong, Ai-Sheng; Zhang, Jian

    2011-08-01

    Transcriptional regulation is thought to be important for stress tolerance and response of transcription factors. RAV subfamily transcription factor contains an AP2- and B3-DNA binding domain, which belongs to the AP2/ERF family. It encodes transcriptional regulators with a variety of functions involved in the developmental and physiological processes in plants. Here, a RAV-like gene, BnaRAV-1-HY15, was isolated from Brassica napus L. cv HuYou15. Sequence homology analysis revealed that the BnaRAV-1-HY15 factor belongs to the RAV subfamily of the AP2/ERF family, and it shares high identity with the AtRAV2 of Arabidopsis. Sequence and three-dimensional structural analyses revealed that BnaRAV-1-HY15 contains two distinct DNA-binding domains, one AP2 domain together with one B3 domain. The AP2 domain composed of 54 amino acids and present in N-terminal region. In addition to AP2 domain, 117 amino acids show significant sequence similarity to the B3 domain present in C-terminal region. Semi-quantitative RT-PCR analysis indicated that the BnaRAV-1-HY15 gene is induced by cold, NaCl and PEG treatments. Under ABA stress, the expression of BnaRAV-1-HY15 gene was not detected. The gene expression was also not traceable from the tissues of pod, bud, petal, leaf, stem and root of normally grown B. napus L. HuYou15 plant at the period of flowering and seed development.

  10. Analysis of the kinetic of expression of tristetraprolin and HuR by rheumatoid arthritis patients pheripheral blood mononuclear cells stimulated with lipopolysaccharide

    Directory of Open Access Journals (Sweden)

    G. Ferraccioli

    2011-09-01

    Full Text Available Objective. Given the role of TNF-α in Rheumatoid Arthritis (RA we decided to define the characteristics of the TNF- α synthesis by peripheral blood mononuclear cells (PBMNCs obtained from active-aggressive RA patients giving a particular attention to the modulation of the expression of two fundamental proteins in TNF-α mRNA stability regulation, Tristetraprolin (TTP and HuR. Methods. 11 RA patients with active disease were enrolled in the study before their entry in 2 double blind protocols: Infliximab versus MTX and Etanercept versus MTX. 9 healthy blood donors were taken as controls. PBMNCs obtained by Ficoll centrifugation and plastic adherence were stimulated with lipopolysaccharide (LPS and TNF-α was measured in the supernatant during 8 hours by ELISA. At each time point the cells were harvested and analysed for TNF- α, TTP and HuR mRNA expression by semi-quantitative PCR. Results. MNCs TNF-α secretion after LPS stimulation did not differ significantly between RA and control subjects, even if a tendency towards a more prompt response was observed in the patients. More importantly only the DMARDs responsive patients (DAS <3.7 at the 6th month, with a minimal reduction of 1.2 points disclosed precociously (at the first month a significant change in the profile of TNF-α secretion and maintained it until the 6th month. The “normalization” of the synthetic behaviour was accompanied by the resetting in the regulation of the expression of the TTP, that appeared significantly different in the patients before and after therapy. Conclusions. Independently from the type of therapy, responsive patients demonstrate a rapid change in the cellular biology at the systemic level that might drive the resolution of the phlogistic process at the synovial level.

  11. SU-F-J-193: Efficient Dose Extinction Method for Water Equivalent Path Length (WEPL) of Real Tissue Samples for Validation of CT HU to Stopping Power Conversion

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, R; Baer, E; Jee, K; Sharp, G; Flanz, J; Lu, H [Massachusetts General Hospital and Harvard Medical School, Boston, MA (United States)

    2016-06-15

    Purpose: For proton therapy, an accurate model of CT HU to relative stopping power (RSP) conversion is essential. In current practice, validation of these models relies solely on measurements of tissue substitutes with standard compositions. Validation based on real tissue samples would be much more direct and can address variations between patients. This study intends to develop an efficient and accurate system based on the concept of dose extinction to measure WEPL and retrieve RSP in biological tissue in large number of types. Methods: A broad AP proton beam delivering a spread out Bragg peak (SOBP) is used to irradiate the samples with a Matrixx detector positioned immediately below. A water tank was placed on top of the samples, with the water level controllable in sub-millimeter by a remotely controlled dosing pump. While gradually lowering the water level with beam on, the transmission dose was recorded at 1 frame/sec. The WEPL were determined as the difference between the known beam range of the delivered SOBP (80%) and the water level corresponding to 80% of measured dose profiles in time. A Gammex 467 phantom was used to test the system and various types of biological tissue was measured. Results: RSP for all Gammex inserts, expect the one made with lung-450 material (<2% error), were determined within ±0.5% error. Depends on the WEPL of investigated phantom, a measurement takes around 10 min, which can be accelerated by a faster pump. Conclusion: Based on the concept of dose extinction, a system was explored to measure WEPL efficiently and accurately for a large number of samples. This allows the validation of CT HU to stopping power conversions based on large number of samples and real tissues. It also allows the assessment of beam uncertainties due to variations over patients, which issue has never been sufficiently studied before.

  12. Difference Existed Is Difficult to Obtain Agreement: Hu Feng's View on May 4th Different from the Mainstream and Its Influence on Hu Feng's Doom%“存异”难以“求同”——胡风“五四”观异于主流的歧见及其对胡风命运的影响

    Institute of Scientific and Technical Information of China (English)

    谢刚

    2012-01-01

    如何看待“五四”,是审视胡风思想内质及其与左翼主流分歧的一个关键角度。两者在“五四”总主题的认识上并无差异,而在“五四”领导者的认定及历史意义的阐发上却有不同。胡风认为:经过真切实践的鲁迅在“五四”时期已经成为共产主义知识分子.理当居于“五四”领导者之列,这与权威的“鲁迅转变论”产生龃龉;“五四”的历史意义主要在于文学/文化层面,而非政治范畴。“五四”的反封建传统较之其反帝传统更为根本和重要。这些独异之见动摇了主流意识形态合法性论证的逻辑,是导致胡风悲剧命运的重要祸根。%How to look on May 4th is key point that surveys Hu Feng's thought and its divergence with Left Wing's main thought. Both had no difference on cognition of main thesis of May 4th but difference on leader and historical significance of May 4th, Hu Feng argued that Lu Xun had become communist through personal experience in May 4th period and should become a leader of May 4th. The view had discord with authoritative conclusion about Lu Xun change. Hu Feng thought that historical significance of May 4th focused on literature or culture not on political category and anti-feudalism was more fundamental and important than anti-imperialism tradition. These unique views shook demonstrative logic of legitimacy of the mainstream ideology, which led to Hu Feng's tragic doom.

  13. The Management of Foreigners in China: Changes to the Migration Law and Regulations during the Late HuWen and Early XiLi Eras and Their Potential Effects

    National Research Council Canada - National Science Library

    Tabea Bork-Hüffer; Yuan Yuan-Ihle

    2014-01-01

    ...) have been introduced during the late Hu-Wen and early Xi-Li eras. The major objective of this article is to discuss whether the new provisions will generally change non-Chinese foreigners' livelihoods and opportunities for working and residing in the country...

  14. The human combinatorial antibody library HuCAL GOLD combines diversification of all six CDRs according to the natural immune system with a novel display method for efficient selection of high-affinity antibodies.

    Science.gov (United States)

    Rothe, Christine; Urlinger, Stefanie; Löhning, Corinna; Prassler, Josef; Stark, Yvonne; Jäger, Ute; Hubner, Bernd; Bardroff, Michael; Pradel, Ingrid; Boss, Melanie; Bittlingmaier, Renate; Bataa, Tschimegma; Frisch, Christian; Brocks, Bodo; Honegger, Annemarie; Urban, Margit

    2008-02-29

    This article describes the generation of the Human Combinatorial Antibody Library HuCAL GOLD. HuCAL GOLD is a synthetic human Fab library based on the HuCAL concept with all six complementarity-determining regions (CDRs) diversified according to the sequence and length variability of naturally rearranged human antibodies. The human antibody repertoire was analyzed in-depth, and individual CDR libraries were designed and generated for each CDR and each antibody family. Trinucleotide mixtures were used to synthesize the CDR libraries in order to ensure a high quality within HuCAL GOLD, and a beta-lactamase selection system was employed to eliminate frame-shifted clones after successive cloning of the CDR libraries. With these methods, a large, high-quality library with more than 10 billion functional Fab fragments was achieved. By using CysDisplay, the antibody fragments are displayed on the tip of the phage via a disulfide bridge between the phage coat protein pIII and the heavy chain of the antibody fragment. Efficient elution of specific phages is possible by adding reducing agents. HuCAL GOLD was challenged with a variety of different antigens and proved to be a reliable source of high-affinity human antibodies with best affinities in the picomolar range, thus functioning as an excellent source of antibodies for research, diagnostic, and therapeutic applications. Furthermore, the data presented in this article demonstrate that CysDisplay is a robust and broadly applicable display technology even for high-throughput applications.

  15. Los orígenes del Colegio Menor de la Concepción de Huérfanos de Salamanca

    Directory of Open Access Journals (Sweden)

    Miguel A. MARTÍN SÁNCHEZ

    2009-12-01

    Full Text Available RESUMEN: El Colegio Menor de la Concepción de Huérfanos de la Universidad de Salamanca es uno más de la gran cantidad de colegios que se fundaron al amparo del estudio salmantino en el siglo XVI. Fundado por Francisco de Solís, obispo de Bagnorea y secretario de Paulo III, durante tres siglos facilitó y proporcionó amparo y educación a multitud de estudiantes pobres que no tenían recursos para ello. Fundado en la primera mitad del siglo XVI, durante esta centuria se asentó y comenzó su andadura, que terminaría en el siglo XIX. Este trabajo realiza un análisis sobre los primeros años de vida del Colegio, analizando cuestiones tan importantes como su fundación, las bulas fundacionales, el fundador, las primeras constituciones o la matrícula durante el siglo XVI, entre otras. Fue el siglo XVI el siglo de su nacimiento y consolidación, realizando durante esta centuria un gran esfuerzo institucional, como demuestra el hecho de la elaboración de las primeras constituciones, la construcción del edificio, o la incorporación a la Universidad de Salamanca, por ejemplo. A lo largo de estas páginas realizaremos un recorrido por los orígenes del primer colegio universitario que se crea para el amparo de niños pobres y huérfanos, permitiéndoles estudiar desde la gramática hasta graduarse en la ciencia que mejor les pareciere. La obra social y educativa del Colegio permitió la progresión y ascenso social de multitud de estudiantes pobres y huérfanos con talento, que de otra forma nunca hubieran podido realizar estudios en la Universidad, puesto que carecían de recursos para ello.ABSTRACT: The Conception of Orphans Minor College of the University of Salamanca is one more of the great quantity of colleges that were founded under protection of Salamancan Study in the 16th century. It was founded by Francisco de Solís, bishop of Bagnorea and secretary of Paulo III, provided protection and education to many poor students without

  16. La masacre de Ambo: Histoire d'une revolte paysanne, département de Huánuco, Pérou, 1962-1963

    Directory of Open Access Journals (Sweden)

    2004-01-01

    Full Text Available À travers l’histoire de la révolte de la communauté de Huaylla y Aclacancha (vallée d’Ambo, département de Huánuco il est possible de comprendre comment s’organisent les paysans comuneros pour défendre leurs terres communautaires. L’analyse des requêtes paysannes envoyées aux autorités gouvernementales dévoile l’importance pour la communauté de faire valoir la légitimité de ses droits de propriété, en s’appuyant à la fois sur des actions légales et sur des occupations de terre. Cependant l’utilisation simultanée de ces moyens de revendication n’explique pas en soi le dérapage vers la violence, connu dans la presse comme la masacre de Ambo (la tuerie d’Ambo. Seule une étude des contextes dans lesquels interagissent tous les acteurs concernés (comuneros, syndicalistes, autorités politiques, policiers et hacendados peut permettre de saisir pourquoi les réclamations de cette communauté ont débouché sur la mort de comuneros. A través la historia de la lucha de la comunidad de Huaylla y Aclacancha (provincia de Ambo, departamento de Huánuco se puede comprender cómo se organizan los comuneros para defender sus tierras comunales. El análisis de las solicitudes enviadas por los comuneros a las autoridades gubernamentales nos muestra la importancia, para la comunidad, de hacer valer tanto la legitimidad de sus derechos de propiedad como, al mismo tiempo, apoyarse sobre acciones legales y ocupaciones de tierras. La utilización simultánea de esos medios de reivindicación no explica en sí el deslizamiento violento, conocido en la prensa como la masacre de Ambo. Pero sí, el análisis de los contextos en los cuales interactuan todos los actores de ese drama (comuneros, sindicalistas, autoridades políticas, gardias civiles y hacendados nos permite comprender por qué las reclamaciones de esta comunidad desembocan en la muerte de comuneros. Through a history of the community’s rebellion (Huaylla y Aclacancha, in

  17. Glycosylphosphatidylinositol-Anchored Anti-HIV scFv Efficiently Protects CD4 T Cells from HIV-1 Infection and Deletion in hu-PBL Mice.

    Science.gov (United States)

    Ye, Chaobaihui; Wang, Weiming; Cheng, Liang; Li, Guangming; Wen, Michael; Wang, Qi; Zhang, Qing; Li, Dan; Zhou, Paul; Su, Lishan

    2017-02-01

    Despite success in viral inhibition and CD4 T cell recovery by highly active antiretroviral treatment (HAART), HIV-1 is still not curable due to the persistence of the HIV-1 reservoir during treatment. One patient with acute myeloid leukemia who received allogeneic hematopoietic stem cell transplantation from a homozygous CCR5 Δ32 donor has had no detectable viremia for 9 years after HAART cessation. This case has inspired a field of HIV-1 cure research focusing on engineering HIV-1 resistance in permissive cells. Here, we employed a glycosylphosphatidylinositol (GPI)-scFv X5 approach to confer resistance of human primary CD4 T cells to HIV-1. We showed that primary CD4 T cells expressing GPI-scFv X5 were resistant to CCR5 (R5)-, CXCR4 (X4)-, and dual-tropic HIV-1 and had a survival advantage compared to control cells ex vivo In a hu-PBL mouse study, GPI-scFv X5-transduced CD4 T cells were selected in peripheral blood and lymphoid tissues upon HIV-1 infection. Finally, GPI-scFv X5-transduced CD4 T cells, after being cotransfused with HIV-infected cells, showed significantly reduced viral loads and viral RNA copy numbers relative to CD4 cells in hu-PBL mice compared to mice with GPI-scFv AB65-transduced CD4 T cells. We conclude that GPI-scFv X5-modified CD4 T cells could potentially be used as a genetic intervention against both R5- and X4-tropic HIV-1 infections. Blocking of HIV-1 entry is one of most promising approaches for therapy. Genetic disruption of the HIV-1 coreceptor CCR5 by nucleases in T cells is under 2 clinical trials and leads to reduced viremia in patients. However, the emergence of viruses using the CXCR4 coreceptor is a concern for therapies applying single-coreceptor disruption. Here, we report that HIV-1-permissive CD4 T cells engineered with GPI-scFv X5 are resistant to R5-, X4-, or dual-tropic virus infection ex vivo In a preclinical study using hu-PBL mice, we show that CD4 T cells were protected and that GPI-scFv X5-transduced cells were

  18. La estrategia diplomática-militar de España reflejada en la correspondencia extraoficial del Duque de Huéscar entre 1747 y 1748

    Directory of Open Access Journals (Sweden)

    Naiara Pavía Dopazo

    2014-02-01

    Full Text Available En este artículo se pretende contribuir al conocimiento de los sucesos bélicos acaecidos en Génovadurante la primavera de 1747, a través del intercambio de correspondencia inédita entre algunos delos principales aliados españoles de esta república, capitaneados por Carvajal y Ensenada que encontraronen don Fernando de Silva, duque de Huéscar (luego de Alba, el mejor enlace para la conformaciónde una red social que permitiera un conocimiento extraoficial que mejorara la capacidad deactuación a favor de los intereses de España en dicha república. Un análisis interpersonal de un hechohistórico que pone de manifiesto la «tensa relación» diplomática entre Francia y España, unidas porel Pacto de Familia de 1743 y que determinó las estrategias diplomáticas llevadas por ambos durantelas negociaciones de la paz de Aquisgrán, que puso fin a la Guerra de Sucesión Austriaca.With this article we’re trying to contribute to the knowledge of the warlike events occurred in Genoaduring the spring of 1747, through the exchange of unknown correspondence among some of theprincipal Spanish allies of this republic, led by Carvajal and Ensenada who found in don Fernando ofSilva, Duke of Huéscar (later Duke of Alba, the best link for the conformation of a social network thatallowed an unofficial knowledge in order to improve the capacity of action in favour of the interestsof Spain in the above mentioned republic. An interpersonal analysis of a historical fact that revealsthe diplomatic «tense relationship” between France and Spain, joined by the Family agreement of 1743and that was decisive for the diplomatic strategies accomplished by both of them during thenegotiations of the Peace of Aachen (Aix-la-Chapelle, which came to an end with the War of theAustrian Succession.

  19. NOTES AND CORRESPONDENCE Evaluation of Tidal Removal Method Using Phase Average Technique from ADCP Surveys along the Peng-Hu Channel in the Taiwan Strait

    Directory of Open Access Journals (Sweden)

    Yu-Chia Chang

    2008-01-01

    Full Text Available Three cruises with shipboard Acoustic Doppler Current Profiler (ADCP were performed along a transect across the Peng-hu Channel (PHC in the Taiwan Strait during 2003 - 2004 in order to investigate the feasibility and accuracy of the phase-averaging method to eliminate tidal components from shipboard ADCP measurement of currents. In each cruise measurement was repeated a number of times along the transect with a specified time lag of either 5, 6.21, or 8 hr, and the repeated data at the same location were averaged to eliminate the tidal currents; this is the so-called ¡§phase-averaging method¡¨. We employed 5-phase-averaging, 4-phase-averaging, 3-phase-averaging, and 2-phase-averaging methods in this study. The residual currents and volume transport of the PHC derived from various phase-averaging methods were intercompared and were also compared with results of the least-square harmonic reduction method proposed by Simpson et al. (1990 and the least-square interpolation method using Gaussian function (Wang et al. 2004. The estimated uncertainty of the residual flow through the PHC derived from the 5-phase-averaging, 4-phase-averaging, 3-phase-averaging, and 2-phase-averaging methods is 0.3, 0.3, 1.3, and 4.6 cm s-1, respectively. Procedures for choosing a best phase average method to remove tidal currents in any particular region are also suggested.

  20. Simultaneous determination and pharmacokinetic study of three flavonoid glycosides in rat plasma by LC-MS/MS after oral administration of Rubus chingii Hu extract.

    Science.gov (United States)

    Zan, Tao; Piao, Li; Wei, Yuntao; Gu, Yue; Liu, Baohua; Jiang, Daqing

    2018-03-01

    A simple and sensitive liquid chromatography tandem mass spectrometry (LC-MS/MS) method was developed for the simultaneous determination of isoquercitrin, kaempferol-3-O-rutinoside and tiliroside in rat plasma. Plasma samples were deproteinized with methanol and separated on a Hypersil Gold C 18 column (2.1 × 50 mm, i.d., 3.0 μm) using gradient elution with the mobile phase of water and methanol at a flow rate of 0.4 mL/min. Mass spectrometric detection was performed with negative ion electrospray ionization in selected reaction monitoring mode. All analytes showed good linearity over their investigated concentration ranges (r 2  > 0.99). The lower limit of quantification was 1.0 ng/mL for isoquercitrin and 2.0 ng/mL for kaempferol-3-O-rutinoside and tiliroside, respectively. Intra- and inter-day precisions were 80.4%. The assay was successfully applied to investigate the pharmacokinetic study of the three ingredients after oral administration of Rubus chingii Hu to rats. Copyright © 2017 John Wiley & Sons, Ltd.

  1. Hu-Lu-Ba-Wan Attenuates Diabetic Nephropathy in Type 2 Diabetic Rats through PKC-α/NADPH Oxidase Signaling Pathway

    Directory of Open Access Journals (Sweden)

    Lishan Zhou

    2013-01-01

    Full Text Available Hu-Lu-Ba-Wan (HLBW is a Chinese herbal prescription used to treat kidney deficiency. The aim of this study was to explore the effect and mechanism of HLBW on diabetic nephropathy (DN in type 2 diabetic rats. The rat model of DN was established by being fed a high-fat diet and intravenous injection of streptozotocin. Then, HLBW decoction was administered for 16 weeks. Blood glucose level, lipid profile, renal function, 24-hour total urinary protein, and albumin content were examined. Renal morphology and superoxide anion levels were evaluated. The activity of nicotinamide-adenine dinucleotide phosphate (NADPH and protein kinase C-alpha (PKC-α related genes expression in renal tissue were also determined. Our data demonstrated that HLBW significantly improved hyperglycemia, hyperlipidemia, and proteinuria in diabetic rats compared with those of control group. HLBW also alleviated glomerular expansion and fibrosis, extracellular matrix accumulation and effacement of the foot processes. Additionally, HLBW reduced superoxide anion level, NADPH oxidase activity, the protein and mRNA expressions of p47phox, and the protein expression of phosphorylated PKC-α in renal tissue. These results suggest that HLBW is effective in the treatment of DN in rats. The underlying mechanism may be related to the attenuation of renal oxidative stress via PKC-α/NADPH oxidase signaling pathway.

  2. Factores asociados a la infección por Ehrlichia canis en perros infestados con garrapatas en la ciudad de Huánuco, Perú

    Directory of Open Access Journals (Sweden)

    Edward Huerto-Medina

    Full Text Available El objetivo del estudio fue determinar la frecuencia y factores asociados a la infección por Ehrlichia canis en perros. Se recolectaron muestras de sangre de 150 perros infestados con garrapatas en 10 consultorios veterinarios de la ciudad de Huánuco en Perú, los perros fueron seleccionados al azar sin distinción de raza, edad ni sexo. Se detectó anticuerpos contra Ehrlichia canis mediante inmunoensayo cromatográfico. El 51,3% de perros estuvieron infectados por Ehrlichia canis. En el análisis multivariado se encontraron asociados a la presencia Ehrlichia canis, el mal estado de salud del perro (p=0,049, un promedio mayor de infestación por garrapatas (p=0,018, perros de edad adulta (p=0,038. La frecuencia de Ehrlichia canis en perros de esta ciudad es alta. Se recomienda el control de la garrapata marrón del perro (Rhipicephalus sanguineus vector de la Ehrlichia canis

  3. Direct versus indirect climate controls on Holocene diatom assemblages in a sub-tropical deep, alpine lake (Lugu Hu, Yunnan, SW China)

    Science.gov (United States)

    Wang, Qian; Yang, Xiangdong; Anderson, Nicholas John; Dong, Xuhui

    2016-07-01

    The reconstruction of Holocene environmental changes in lakes on the plateau region of southwest China provides an understanding of how these ecosystems may respond to climate change. Fossil diatom assemblages were investigated from an 11,000-year lake sediment core from a deep, alpine lake (Lugu Hu) in southwest China, an area strongly influenced by the southwest (or the Indian) summer monsoon. Changes in diatom assemblage composition, notably the abundance of the two dominant planktonic species, Cyclotella rhomboideo-elliptica and Cyclostephanos dubius, reflect the effects of climate variability on nutrient dynamics, mediated via thermal stratification (internal nutrient cycling) and catchment-vegetation processes. Statistical analyses of the climate-diatom interactions highlight the strong effect of changing orbitally-induced solar radiation during the Holocene, presumably via its effect on the lake's thermal budget. In a partial redundancy analysis, climate (solar insolation) and proxies reflecting catchment process (pollen percentages, C/N ratio) were the most important drivers of diatom ecological change, showing the strong effects of climate-catchment-vegetation interactions on lake functioning. This diatom record reflects long-term ontogeny of the lake-catchment ecosystem and suggests that climatic changes (both temperature and precipitation) impact lake ecology indirectly through shifts in thermal stratification and catchment nutrient exports.

  4. Aqueous Extract of Chrysanthemum morifolium ( Jú Huā) Enhances the Antimelanogenic and Antioxidative Activities of the Mixture of Soy Peptide and Collagen Peptide.

    Science.gov (United States)

    Gui, Min; Du, Jun; Guo, Jianmin; Xiao, Baiquan; Yang, Wei; Li, Minjie

    2014-07-01

    The possible synergistic effect between the aqueous extract of Chrysanthemum morifolium ( Jú Huā) (AECM) and the peptide mixture (PM) containing soy peptide and collagen peptide was investigated in an ultraviolet (UV) irradiation-induced skin damage mouse model. The irradiated mice were treated with the PM or PM + AECM (containing PM and AECM), respectively. Both PM and PM + AECM groups displayed an apparent photoprotective effect on the UV-irradiated skin damage of mice. Histological evaluation demonstrated that the epidermal hyperplasia and melanocytes in the basal epidermal layer of the UV-irradiated skin in mice decreased when treated with either PM or PM + AECM. Further study showed that soy peptide, collagen peptide, and AECM also inhibited the activities of mushroom tyrosinase with IC50 values of 82.3, 28.2, and 1.6 μg/ml, respectively. Additionally, PM + AECM reduced melanogenesis by 46.2% at the concentration of 10 mg/ml in B16 mouse melanoma cells. Meanwhile, the UV-induced increase of antioxidative indicators, including glutathione peroxidase (GSH-Px), superoxide dismutase (SOD), and malondialdehyde (MDA), was reduced significantly after treatment with 1.83 g/kg/dbw of PM + AECM. This evidence supported the synergistic antioxidative effect of AECM with PM. These results demonstrated that oral intake of PM and AECM had synergistic antimelanogenic and antioxidative effects in UV-irradiated mice.

  5. Differential internalization of hu14.18-IL2 immunocytokine by NK and tumor cell: impact on conjugation, cytotoxicity, and targeting

    Science.gov (United States)

    Buhtoiarov, Ilia N.; Neal, Zane C.; Gan, Jacek; Buhtoiarova, Tatiana N.; Patankar, Manish S.; Gubbels, Jennifer A. A.; Hank, Jacquelyn A.; Yamane, Brett; Rakhmilevich, Alexander L.; Reisfeld, Ralph A.; Gillies, Stephen D.; Sondel, Paul M.

    2011-01-01

    The hu14.18-IL2 (EMD 273063) IC, consisting of a GD2-specific mAb genetically engineered to two molecules of IL-2, is in clinical trials for treatment of GD2-expressing tumors. Anti-tumor activity of IC in vivo and in vitro involves NK cells. We studied the kinetics of retention of IC on the surface of human CD25+CD16– NK cell lines (NKL and RL12) and GD2+ M21 melanoma after IC binding to the cells via IL-2R and GD2, respectively. For NK cells, ∼50% of IC was internalized by 3 h and ∼90% by 24 h of cell culture. The decrease of surface IC levels on NK cells correlated with the loss of their ability to bind to tumor cells and mediate antibody-dependent cellular cytotoxicity in vitro. Unlike NK cells, M21 cells retained ∼70% of IC on the surface following 24 h of culture and maintained the ability to become conjugated and lysed by NK cells. When NKL cells were injected into M21-bearing SCID mice, IT delivery of IC augmented NK cell migration into the tumor. These studies demonstrate that once IC binds to the tumor, it is present on the tumor surface for a prolonged time, inducing the recruitment of NK cells to the tumor site, followed by tumor cell killing. PMID:21248148

  6. Mutations in the gene encoding the lamin B receptor produce an altered nuclear morphology in granulocytes (Pelger-Huët anomaly).

    Science.gov (United States)

    Hoffmann, Katrin; Dreger, Christine K; Olins, Ada L; Olins, Donald E; Shultz, Leonard D; Lucke, Barbara; Karl, Hartmut; Kaps, Reinhard; Müller, Dietmar; Vayá, Amparo; Aznar, Justo; Ware, Russell E; Sotelo Cruz, Norberto; Lindner, Tom H; Herrmann, Harald; Reis, André; Sperling, Karl

    2002-08-01

    Pelger-Huët anomaly (PHA; OMIM *169400) is an autosomal dominant disorder characterized by abnormal nuclear shape and chromatin organization in blood granulocytes. Affected individuals show hypolobulated neutrophil nuclei with coarse chromatin. Presumed homozygous individuals have ovoid neutrophil nuclei, as well as varying degrees of developmental delay, epilepsy and skeletal abnormalities. Homozygous offspring in an extinct rabbit lineage showed severe chondrodystrophy, developmental anomalies and increased pre- and postnatal mortality. Here we show, by carrying out a genome-wide linkage scan, that PHA is linked to chromosome 1q41-43. We identified four splice-site, two frameshift and two nonsense mutations in LBR, encoding the lamin B receptor. The lamin B receptor (LBR), a member of the sterol reductase family, is evolutionarily conserved and integral to the inner nuclear membrane; it targets heterochromatin and lamins to the nuclear membrane. Lymphoblastoid cells from heterozygous individuals affected with PHA show reduced expression of the lamin B receptor, and cells homozygous with respect to PHA contain only trace amounts of it. We found that expression of the lamin B receptor affects neutrophil nuclear shape and chromatin distribution in a dose-dependent manner. Our findings have implications for understanding nuclear envelope-heterochromatin interactions, the pathogenesis of Pelger-like conditions in leukemia, infection and toxic drug reactions, and the evolution of neutrophil nuclear shape.

  7. An in vitro model for Pelger-Huët anomaly: stable knockdown of lamin B receptor in HL-60 cells.

    Science.gov (United States)

    Olins, Ada L; Ernst, Aurélie; Zwerger, Monika; Herrmann, Harald; Olins, Donald E

    2010-01-01

    The principal human blood granulocyte (neutrophil) possesses a lobulated and deformable nucleus, important to facilitate rapid egress from blood vessels as these cells migrate to sites of bacterial or fungal infection. This unusual nuclear shape is a product of elevated levels of an integral membrane protein of the nuclear envelope lamin B receptor (LBR) and of decreased amounts of lamin A/C. In humans, a genetic deficiency of LBR produces Pelger-Huët anomaly, resulting in blood neutrophils that exhibit hypolobulated nuclei with redistributed heterochromatin. Structural changes in nuclear architecture occur during granulopoiesis within bone marrow. The exact mechanisms of this nuclear shape change and of heterochromatin redistribution remain largely unknown. As a tool to facilitate analysis of these mechanisms, a stable LBR knockdown subline of HL-60 cells was established. During in vitro granulopoiesis induced with retinoic acid, the LBR knockdown cells retain an ovoid shaped nucleus with reduced levels of lamin A/C; while, the parent cells develop highly lobulated nuclei. In contrast, macrophage forms induced in LBR knockdown cells by in vitro treatment with phorbol ester were indistinguishable from the parent cells, judged by both nuclear shape and attached cell morphology. The capability of differentiation of LBR knockdown HL-60 cells should facilitate a detailed analysis of the molecular relationship between LBR levels, granulocyte nuclear shape and heterochromatin distribution.

  8. Adenosine-to-inosine RNA editing controls cathepsin S expression in atherosclerosis by enabling HuR-mediated post-transcriptional regulation.

    Science.gov (United States)

    Stellos, Konstantinos; Gatsiou, Aikaterini; Stamatelopoulos, Kimon; Perisic Matic, Ljubica; John, David; Lunella, Federica Francesca; Jaé, Nicolas; Rossbach, Oliver; Amrhein, Carolin; Sigala, Frangiska; Boon, Reinier A; Fürtig, Boris; Manavski, Yosif; You, Xintian; Uchida, Shizuka; Keller, Till; Boeckel, Jes-Niels; Franco-Cereceda, Anders; Maegdefessel, Lars; Chen, Wei; Schwalbe, Harald; Bindereif, Albrecht; Eriksson, Per; Hedin, Ulf; Zeiher, Andreas M; Dimmeler, Stefanie

    2016-10-01

    Adenosine-to-inosine (A-to-I) RNA editing, which is catalyzed by a family of adenosine deaminase acting on RNA (ADAR) enzymes, is important in the epitranscriptomic regulation of RNA metabolism. However, the role of A-to-I RNA editing in vascular disease is unknown. Here we show that cathepsin S mRNA (CTSS), which encodes a cysteine protease associated with angiogenesis and atherosclerosis, is highly edited in human endothelial cells. The 3' untranslated region (3' UTR) of the CTSS transcript contains two inverted repeats, the AluJo and AluSx+ regions, which form a long stem-loop structure that is recognized by ADAR1 as a substrate for editing. RNA editing enables the recruitment of the stabilizing RNA-binding protein human antigen R (HuR; encoded by ELAVL1) to the 3' UTR of the CTSS transcript, thereby controlling CTSS mRNA stability and expression. In endothelial cells, ADAR1 overexpression or treatment of cells with hypoxia or with the inflammatory cytokines interferon-γ and tumor-necrosis-factor-α induces CTSS RNA editing and consequently increases cathepsin S expression. ADAR1 levels and the extent of CTSS RNA editing are associated with changes in cathepsin S levels in patients with atherosclerotic vascular diseases, including subclinical atherosclerosis, coronary artery disease, aortic aneurysms and advanced carotid atherosclerotic disease. These results reveal a previously unrecognized role of RNA editing in gene expression in human atherosclerotic vascular diseases.

  9. Contents of the heavy metals nickel and lead in leaves of Paulownia elongata S.Y. Hu and Paulownia fortunei Hems. in Serbia

    Directory of Open Access Journals (Sweden)

    Stanković Dragica

    2009-01-01

    Full Text Available A comparative study was carried out on the capabilities of the two species Paulownia elongata S. Y. Hu and Paulownia fortunei Hems. as biomonitors of atmospheric (and soil heavy-metal pollution. Research on content of the heavy metals nickel (Ni and lead (Pb in leaves of the species Paulownia elongata growing under urban and suburban conditions with the comparison to the concentration of these elements in leaves of the species Paulownia elongata and Paulownia fortunei on an experimental plot in Bela Crkva showed average nickel concentrations of 2.7 μg/g on the experimental plot in Bela Crkva, Serbia, twice as low as the concentrations measured under extreme urban conditions (6.62 μg/g, or 4.54 μg/g in the immediate vicinity of suburban traffic lines. Inasmuch as Paulownia elongata endures urban conditions well, it can be recommended for cultivation in parks, tree alleys, and wind-protection zones along urban and regional traffic lines.

  10. SupT1 Cell Infusion as a Possible Cell-Based Therapy for HIV: Results from a Pilot Study in Hu-PBMC BRGS Mice

    Directory of Open Access Journals (Sweden)

    Jonathan Fior

    2016-04-01

    Full Text Available In a previous in vitro study, the SupT1 cell line was explored as a decoy target for HIV-1, proposing SupT1 cell infusion as a possible cell-based therapy for HIV. In the present work, the previous in vitro model was translated into an in vivo setting. Specifically, Hu-PBMC BRGS mice were infected with a high input of HIV-1 LAI (100,000 TCID50, and 40 million 30 Gy-irradiated SupT1 cells were infused weekly for 4 weeks as a therapy. Blood samples were taken to monitor CD4+ T cell count and viral load, and mice were monitored daily for signs of illness. At the earliest time point analyzed (Week 1, there was a significantly lower plasma viral load (~10-fold in all animals treated with SupT1 cell infusion, associated with a higher CD4+ T cell count. At later time points, infection proceeded with robust viral replication and evident CD4+ T cell depletion, except in one mouse that showed complete suppression of viral replication and preservation of CD4+ T cell count. No morbidity or mortality was associated with SupT1 cell infusion. The interesting tendencies observed in the generated data suggest that this approach should be further investigated as a possible cell-based HIV therapy.

  11. Geología y paleontología de los yacimientos plio-pleistocenos de Huéscar (Depresión de Guadix-Baza. Granada

    Directory of Open Access Journals (Sweden)

    Mazo, A. V.

    1985-12-01

    Full Text Available In this work, two new vertebrare fossil faunas from the Guadix-Baza Depression (Granada, Spain are studied. Huéscar 3 is characterized by Castillomys crusafonti, Mimomys stehlini, Blancomys neglectus, Thischizolagus aff. maritsae and Anancus arvernensis; This site, which belong to the upper Ruscinian (MN 15 of Mein can be correlated with the localities of Arquillo 3, Villalba Alta, Sête and Seines. Huéscar 1, with Mimomys savini, Microtus brecciensis, cf. Microtus (Pitymys gregaloides, Hippopotamus antiquus and Mammuthus meridionalis, can be placed in the lower part of the middle Pleistocene and can be correlated with the Le Vallonet fossil site.

    En el presente trabajo se estudian dos nuevos yacimientos de vertebrados fósiles de la Depresión do Guadix-Baza (Granada. Huéscar 3, caracterizado por Castillomys crusafonti, Mimomys stehlini, Blancomys neglectus, Trischizolagus aff. maritsae y Anancus arvernensis, se sitúa en el Rusciniense superior (MN 15 de Mein, siendo correlacionable con las locali dades de Arquillo 3, Villalba Alta, Sête y Seines. Huéscar 1, con Mimomys savini, Microtus brecciensis, cf. Microtus (Pitymys gregaloides, Hippopotamus antiquus y Mammuthus meridionalis, se atribuye a la parte inferior del Pleistoceno medio, correlacionable con el yacimiento de Le Vallonet

  12. Mitilanotherium inexpectatum (Giraffidae, Mammalia from Huélago (Lower Pleistocene; Guadix-Baza basin, Granada, Spain - observations on a peculiar biogegraphic pattern

    Directory of Open Access Journals (Sweden)

    Morales, J.

    2011-12-01

    Full Text Available Giraffid fossils from the lowermost Pleistocene (MN17 locality Huélago (Guadix-Baza Basin, Granada, Spain are described and assigned to Mitilanotherium inexpectatum Samson & Radulesco (1966. The remains are compared to giraffid material from the Pliocene and younger. The known geographic distribution of this giraffid is disjunct; it is found in Spain and in an area stretching from Rumania and Greece to Tadzhikistan, but not in central Europe. The oldest record is from the Upper Pliocene (MN16 of Turkey and the youngest is from the Lower Pleistocene of Greece (with an estimated age of about 1.2 Ma. Shortly after 2.6 Ma it may have dispersed to Spain, where it may have lived as much as half a million years. The dispersal did not leave a fossil record in the area between SE Europe and Spain. The same occured with dispersals of other mammals in the Early, Middle and Late Miocene, Pliocene and Pleistocene. These species that show this pattern are interpreted to be adapted to open or arid environments. Their dispersals across Europe to Spain may have occurred during short periods of atypical environmental conditions and thus did not leave an easily detectable fossil record.Los fósiles de jirafas del Pleistoceno basal (MN 17 de la localidad de Huélago (Cuenca de Guadix- Baza, Granada, Spain son descritos y asignados a Mitilanotherium inexpectatum Samson & Radulesco (1966. Los restos fósiles son comparados con jiráfidos del Plioceno, y formas más recientes. La distribución geográfica conocida muestra que es disyunta; encontrándose en España y en un área que se extiende de Rumania y Grecia a Tadzhikistan, pero no en Europa central. El registro más antiguo procede del Plioceno Superior (MN 16 de Turquía y el más reciente del Pleistoceno inferior de Grecia (con una edad estimada de ca. 1, 2 Ma. Poco después de los 2,6 Ma la especie pudo haberse dispersado a España, donde como mucho pudo haber durado medio millón de años. Esta dispersion

  13. Efecto de una intervención educativa sobre los conocimientos de teniasis/cisticercosis en una comunidad rural de Huánuco, Perú 2005

    Directory of Open Access Journals (Sweden)

    Elsa Palacios-Flores

    2008-07-01

    Full Text Available Objetivo. Evaluar el efecto de una intervención educativa sobre los conocimientos de teniasis/cisticercosis en los pobladores de la localidad de Queropalca, Huánuco. Materiales y métodos. Se realizó un ensayo comunitario, en el cual se aplicó una estrategia educativo comunicacional sobre los factores de riesgo de teniasis/cisticercosis, consistente en metodologías participativas de visitas casa en casa y campañas de promoción en toda la jurisdicción durante seis meses (junio a diciembre del 2005. Se midió el nivel de conocimientos sobre teniasis/cisticercosis en los pobladores de 10 años a más de edad. Resultados. Se evaluaron 142 pobladores, la intervención educativa mejoró el nivel de conocimiento global sobre la teniasis/cisticercosis (p < 0,001 y sobre los factores de riesgo como la eliminación de basura al campo libre (p = 0,027, consumo de alimentos sin lavarse las manos (p = 0,043, crianza de cerdos sin corral (p < 0,001, no uso de letrinas o baños (p < 0,001, consumo de carne de cerdo sin inspección sanitaria (p < 0,001, no se modificó el nivel de conocimiento relacionado al consumo de agua no tratada (p = 0,148. Conclusiones. La aplicación de la metodología educativo comunicacional incrementó los conocimientos relacionados con las medidas higiénicas sanitarias para la prevención y control de la teniasis/cisticercosis en una población altoandina.

  14. Humanización de la Sanidad y Salud Laboral: Implicaciones, estado de la cuestión y propuesta del Proyecto HU-CI

    Directory of Open Access Journals (Sweden)

    Macarena Gálvez Herrer

    Full Text Available Resumen La evolución científica y técnica de la atención sanitaria mantienen un desarrollo exponencial que permite cada vez una mejor asistencia a los pacientes, nuevas formas de tratamiento y crecientes índices de supervivencia. Sin embargo, estos importantes avances que enriquecen la atención a la salud, en muchas ocasiones, han ido invadiendo espacio al propio acto humano de la atención a la persona. Potenciar organizaciones más humanizadas implicará establecer acciones dirigidas al ambiente y lugar de trabajo, así como a todos los agentes implicados (pacientes, familiares y profesionales. Con dicha finalidad, las políticas de Humanización y su aplicación al contexto sanitario son una realidad en nuestros días y están concretándose en algunas propuestas específicas en determinadas organizaciones, con el apoyo de algunos organismos oficiales. En el presente trabajo, señalamos la interacción entre los objetivos de dichas políticas de humanización y las metas de la salud laboral en contextos asistenciales. Se exploran áreas comunes de trabajo dirigidas al bienestar del profesional sanitario, posibilidades de gestión integral de ambos conceptos, y se expone un ejemplo concreto como es el Proyecto de Humanización de las Unidades de Cuidados Intensivos (HU-CI.

  15. Estudio clínico epidemiológico de bartonelosis humana en el valle del Monzón, Huamalíes, Huánuco

    Directory of Open Access Journals (Sweden)

    Abelardo Tejada

    2003-12-01

    Full Text Available OBJETIVO: Estudiar los casos de bartonelosis humana en valle del Monzón y determinar las especies de Lutzomyia que podrían jugar papel en la transmisión de la enfermedad en la zona. MATERIAL Y MÉTODOS: Se estudió casos de la enfermedad de Carrión en la selva alta del valle del Monzón, provincia de Huamalíes, Huánuco, donde entre 1997 y 1998 se presentó un brote epidémico. Para el diagnóstico de los casos se realizó frotis y gota gruesa, hemocultivo y serología. Para la captura de flebotominos, se utilizó trampas de luz CDC y trampa Shannon, en ambientes intra y peridomiciliarios. RESULTADOS: A lo largo de 21 localidades, la enfermedad afectó 140 personas, 25 de ellos entre 1 y 4 años de edad, 81 mujeres y 59 hombres; 121 presentaron la fase aguda de la enfermedad, 16 la fase intercalar y 3 la fase eruptiva. La población de la zona se dedica principalmente al cultivo de la coca, café y cacao. CONCLUSIÓN: Se estableció que el valle del Monzón es nueva zona endémica de bartonelosis humana, donde la transmisión ocurre principalmente en ambientes intra y peridomiciliarios, siendo Lutzomyia serrana el vector más probable.

  16. Mutations at the mouse ichthyosis locus are within the lamin B receptor gene: a single gene model for human Pelger-Huët anomaly.

    Science.gov (United States)

    Shultz, Leonard D; Lyons, Bonnie L; Burzenski, Lisa M; Gott, Bruce; Samuels, Rebecca; Schweitzer, Peter A; Dreger, Christine; Herrmann, Harald; Kalscheuer, Vera; Olins, Ada L; Olins, Donald E; Sperling, Karl; Hoffmann, Katrin

    2003-01-01

    The nature of the wild-type gene product at the mouse ichthyosis (ic) locus has been of great interest because mutations at this locus cause marked abnormalities in nuclear heterochromatin, similar to those observed in Pelger-Huët anomaly (PHA). We recently found that human PHA is caused by mutations in the gene (LBR) encoding lamin B receptor, an evolutionarily conserved inner nuclear membrane protein involved in nuclear assembly and chromatin binding. Mice homozygous for deleterious alleles at the ichthyosis (ic) locus present with a blood phenotype similar to PHA, and develop other phenotypic abnormalities, including alopecia, variable expression of syndactyly and hydrocephalus. The ic locus on mouse chromosome 1 shares conserved synteny with the chromosomal location of the human LBR locus on human chromosome 1. In this study, we identified one nonsense (815ins) and two frameshift mutations (1088insCC and 1884insGGAA) within the Lbr gene of mice homozygous for either of three independent mutations (ic, ic(J) and ic(4J), respectively) at the ichthyosis locus. These allelic mutations are predicted to result in truncated or severely impaired LBR protein. Our studies of mice homozygous for the ic(J) mutation revealed a complete loss of LBR protein as shown by immunofluorescence microscopy and immunoblotting. The findings provide the molecular basis for the heterochromatin clumping and other distinct phenotypes caused by ic mutations. These spontaneous Lbr mutations confirm the molecular basis of human PHA and provide a small animal model for determination of the precise function of LBR in normal and pathological states.

  17. HuMax-CD4

    DEFF Research Database (Denmark)

    Skov, Lone; Kragballe, Knud; Zachariae, Claus

    2003-01-01

    BACKGROUND: Psoriasis is characterized by infiltration with mononuclear cells. Especially activated memory CD4+ T cells are critical in the pathogenesis. Interaction between the CD4 receptor and the major histocompatibility complex class II molecule is important for T-cell activation. OBJECTIVE...

  18. Factores diagnósticos endoscópicos y pronósticos relacionados con el Helicobacter Pylori en la enfermedad injerto contra huésped tras el trasplante alogénico de células hematopoyéticas

    OpenAIRE

    Velasco Guardado, Antonio

    2016-01-01

    [ES] INTRODUCCIÓN: El trabajo consta de tres artículos originales relacionados por un lado con el diagnóstico endoscópico e histológico en la Enfermedad de Injerto contra Huésped (EICH) tras el trasplante alogénico de células hematopoyéticas (TACH) y por otro sobre el papel que juega la infección por Helicobacter pylori (HP) en dicha enfermedad. El tracto gastrointestinal es la principal diana de la Enfermedad de Injerto contra Huésped. Su diagnóstico se basa en los hallazgos endoscópicos e ...

  19. Concentrations en métaux toxiques chez Crassostrea gasar (Huître de mangrove) en zone urbaine lagunaire d'Abidjan (Côte d'Ivoire)

    OpenAIRE

    Métongo, Bernard Soro

    1991-01-01

    Cet article présente les résultats relatifs à une étude des concentrations en métaux toxiques (Cd, Cu, Hg et Zn) chez Crassostrea gasar (huître de mangrove). Une étude comparative est faite entre les échantillons collectés en zone urbaine (Abidjan) et ceux des régions rurales (Assini-mafia et Assouindé). Les échantillons collectés en zone urbaine d'Abidjan ont des teneurs en métal plus élevées que ceux de la zone rurale, en raison de la pollution chimique due aux rejets urbains et industriels...

  20. Socavación producida por el río Huallaga al puente Colpa Alta en la provincia de Huánuco, utilizando los Métodos de Artamanov, Straub y Maza, en el HEC-RAS

    OpenAIRE

    Felipe Matías, Elbio Fernando

    2016-01-01

    La investigación tiene como objetivo conocer los resultados obtenidos en el cálculo de socavación transversal, socavación general y socavación de estribos del río Huallaga en el puente Colpa Alta en la provincia de Huánuco en el año 2015 aplicando los métodos de Artamonov, Straub y Maza utilizando los parámetros hidráulicos del programa HEC-RAS. Para ello, se recogió información de los antecedentes en el mundo y en el Perú acerca de los estudios realizados sobre socavación de puentes, en los ...

  1. Etude des processus de dérive et de sélection liés aux pratiques d'élevage en écloserie d'huître creuse

    OpenAIRE

    Boudry, Pierre

    2006-01-01

    Afin d'étudier les conséquences génétiques des pratiques de production de larves en écloserie d'huître creuse, deux facteurs ont été examinés : l'effet de l'élimination des plus petites larves et l'effet de la température. Une approche de familles élevées en mélange a été utilisée afin d'avoir accès à l'information génétique au stade larvaire. Les résultats obtenus montrent que l'assignation de parenté basée sur des marqueurs microsatellites hautement discriminants est un outil performant pou...

  2. Ausências previstas e não previstas da equipe de enfermagem das unidades de internação do HU-USP Ausencias previstas y no previstas del equipo de enfermería en las unidades de internamiento del HU-USP-Brasil Expected and unexpected absences of the nursing team at the inpatient units of a university hospital at the University of Sao Paulo-Brazil

    Directory of Open Access Journals (Sweden)

    Fernanda Maria Togeiro Fugulin

    2003-12-01

    Full Text Available O estudo, exploratório-descritivo, teve por objetivo identificar o percentual de ausências previstas e não previstas da equipe de enfermagem das Unidades de Internação do HU-USP. Os dados referentes às ausências não previstas foram levantados das escalas mensais, do ano 2000, dos funcionários da equipe de enfermagem dessas Unidades. Os percentuais de ausências previstas referentes às folgas semanais remuneradas, feriados e férias corresponderam, respectivamente, à 19%, 3,9% e 8,9%. O levantamento do percentual de ausências não previstas mostrou uma variação entre os índices encontrados em cada Unidade, indicando a possibilidade de estar ocorrendo sobrecarga de trabalho em algumas Unidades de Internação.El objetivo de este estudio exploratorio-decriptivo fue identificar el porcentaje de ausencias previstas y no previstas del equipo de enfermería de las Unidades de Internamiento del HU-USP. Los datos referentes a las ausencias no previstas fueron recolectados de las rotaciones mensuales, del año 2000, de los funcionarios del equipo de enfermería de estas Unidades. Los porcentajes de ausencias previstas referentes a huelgas semanales remuneradas, feriados y vacaciones correspondieron, respectivamente, al 19%, 3,9% y 8,9%. El porcentaje de ausencias no previstas mostró una variación entre los índices encontrados en cada Unidad, indicando la posibilidad de la ocurrencia de una sobrecarga de trabajo en algunas Unidades de Internamiento.The objective of this exploratory-descriptive study was to identify expected and unexpected absences of the nursing team at the inpatient units of the University Hospital at the University of Sao Paulo. Data regarding unexpected absences of the nursing staff employees of these inpatient units were assessed on a monthly basis for the year 2000. The percentage of the expected absences regarding remunerated weekly time off, holidays and vacations corresponded to 19%, 3.9% and 8.9%, respectively

  3. HuEP5C7 as a humanized monoclonal anti-E/P-selectin neurovascular protective strategy in a blinded placebo-controlled trial of nonhuman primate stroke.

    Science.gov (United States)

    Mocco, J; Choudhri, Tanvir; Huang, Judy; Harfeldt, Elisabeth; Efros, Lyubov; Klingbeil, Corine; Vexler, Vladimir; Hall, William; Zhang, Yuan; Mack, William; Popilskis, Sulli; Pinsky, David J; Connolly, E Sander

    2002-11-15

    Although inhibiting interaction of beta(2) integrins with cognate immunoglobulin class adhesion receptor ligands is an effective neuroprotective strategy in small mammal models of stroke, the strategy has failed in human trials. A completely different antiadhesion receptor strategy was therefore rigorously tested in a model that may more closely approximate human reperfused stroke. Early leukoadhesive events in postischemic cerebral microvessels are mediated by upregulated selectin-class adhesion receptors on endothelial cells. Therefore, a blocking antibody prepared against common P- and E-selectin epitopes was humanized to suppress complement activation and tested in a reperfused hemispheric stroke model in Papio anubis (baboon). Histological examination of postischemic cerebral microvessels revealed a strong upregulation of E-and P-selectin expression. Placebo-blinded administration of the humanized anti-human E- and P-selectin monoclonal antibody (HuEP5C7, 20 mg/kg IV, n=9; placebo, n=9) immediately after the onset of 1 hour of temporary ischemia resulted in trends showing reduced polymorphonuclear leukocyte (PMN) infiltration into ischemic cortex, reduced infarct volumes (by 41%), improved neurological score (by 35%), and improved ability to self-care (by 39%). Importantly, there was no evidence of systemic complement activation, immune suppression, or pathological coagulopathy associated with this therapy. These data suggest that a humanized anti-E/P-selectin antibody approach is safe and may be effective as a clinical treatment for human stroke.

  4. Qualitative and quantitative characterization of secondary metabolites and carbohydrates in Bai-Hu-Tang using ultraperformance liquid chromatography coupled with quadrupole time-of-flight mass spectrometry and ultraperformance liquid chromatography coupled with photodiode array detector

    Directory of Open Access Journals (Sweden)

    Wei-Fang Zhong

    2017-10-01

    Full Text Available Bai-Hu-Tang (BHT, a classic traditional Chinese medicine (TCM formula used for clearing heat and promoting body fluid, consists of four traditional Chinese medicines, i.e., Gypsum Fibrosum (Shigao, Anemarrhenae Rhizoma (Zhimu, Glycyrrhizae Radix et Rhizoma Praeparata cum Melle (Zhigancao, and nonglutinous rice (Jingmi. The chemical composition of BHT still remains largely elusive thus far. To qualitatively and quantitatively characterize secondary metabolites and carbohydrates in BHT, here a combination of analytical approaches using ultraperformance liquid chromatography coupled with quadrupole time-of-flight mass spectrometry and ultraperformance liquid chromatography coupled with photodiode array detector was developed and validated. A total of 42 secondary metabolites in BHT were tentatively or definitely identified, of which 10 major chemicals were quantified by the extracting ion mode of quadrupole time-of-flight mass spectrometry. Meanwhile, polysaccharides, oligosaccharides, and monosaccharides in BHT were also characterized via sample pretreatment followed by sugar composition analysis. The quantitative results indicated that the determined chemicals accounted for 35.76% of the total extract of BHT, which demonstrated that the study could be instrumental in chemical dissection and quality control of BHT. The research deliverables not only laid the root for further chemical and biological evaluation of BHT, but also provided a comprehensive analytical strategy for chemical characterization of secondary metabolites and carbohydrates in traditional Chinese medicine formulas.

  5. Qualitative and quantitative characterization of secondary metabolites and carbohydrates in Bai-Hu-Tang using ultraperformance liquid chromatography coupled with quadrupole time-of-flight mass spectrometry and ultraperformance liquid chromatography coupled with photodiode array detector.

    Science.gov (United States)

    Zhong, Wei-Fang; Tong, Wing-Sum; Zhou, Shan-Shan; Yip, Ka-Man; Li, Song-Lin; Zhao, Zhong-Zhen; Xu, Jun; Chen, Hu-Biao

    2017-10-01

    Bai-Hu-Tang (BHT), a classic traditional Chinese medicine (TCM) formula used for clearing heat and promoting body fluid, consists of four traditional Chinese medicines, i.e., Gypsum Fibrosum (Shigao), Anemarrhenae Rhizoma (Zhimu), Glycyrrhizae Radix et Rhizoma Praeparata cum Melle (Zhigancao), and nonglutinous rice (Jingmi). The chemical composition of BHT still remains largely elusive thus far. To qualitatively and quantitatively characterize secondary metabolites and carbohydrates in BHT, here a combination of analytical approaches using ultraperformance liquid chromatography coupled with quadrupole time-of-flight mass spectrometry and ultraperformance liquid chromatography coupled with photodiode array detector was developed and validated. A total of 42 secondary metabolites in BHT were tentatively or definitely identified, of which 10 major chemicals were quantified by the extracting ion mode of quadrupole time-of-flight mass spectrometry. Meanwhile, polysaccharides, oligosaccharides, and monosaccharides in BHT were also characterized via sample pretreatment followed by sugar composition analysis. The quantitative results indicated that the determined chemicals accounted for 35.76% of the total extract of BHT, which demonstrated that the study could be instrumental in chemical dissection and quality control of BHT. The research deliverables not only laid the root for further chemical and biological evaluation of BHT, but also provided a comprehensive analytical strategy for chemical characterization of secondary metabolites and carbohydrates in traditional Chinese medicine formulas. Copyright © 2017. Published by Elsevier B.V.

  6. Biscuits with No Added Sugar Containing Stevia, Coffee Fibre and Fructooligosaccharides Modifies α-Glucosidase Activity and the Release of GLP-1 from HuTu-80 Cells and Serotonin from Caco-2 Cells after In Vitro Digestion

    Science.gov (United States)

    Martinez-Saez, Nuria; Hochkogler, Christina Maria; Somoza, Veronika; del Castillo, Maria Dolores

    2017-01-01

    This study assessed the in vitro effects of the bioaccessible food components released during the simulated human digestion of a coffee fibre-containing biscuit (CFB) on α-glucosidase activity, antioxidant capacity and satiety hormones. Digest of CFB presented a significantly (p < 0.05) lower amount of sugar (68.6 mg/g) and a higher antioxidant capacity (15.1 mg chlorogenic acid eq./g) than that of a sucrose-containing biscuit (SCB). The CFB significantly reduced (p < 0.05) α-glucosidase activity (IC50 = 3.3 mg/mL) compared to the SCB (IC50 = 6.2 mg/mL). Serotonin and glucagon-like peptide-1 (GLP-1) release by differentiated Caco-2 and HuTu-80 cells, respectively, was stimulated by the CFB (355% at a concentration of 0.5 mg/mL and 278% at a concentration of 0.05 mg/mL) to the same order of magnitude as those of the SCB. To summarize, the CFB was demonstrated to reduce monosaccharide bioaccessibility, to inhibit a diabetes-related digestive enzyme, and to improve the release of satiety hormones. PMID:28677657

  7. Analyse de la capacité trophique de l'écosystème "claires ostréicoles" dans le cadre de l'affinage de l'huître creuse Crassostrea gigas (Bassin de Marennes-Oléron)

    OpenAIRE

    Soletchnik, Patrick; Razet, Daniel; Goulletquer, Philippe; Geairon, Philippe; Le Moine, Olivier; Faury, Nicole

    1995-01-01

    Bien que défini par la Norme AFNOR (NF V45-056), l'affinage des huîtres C. gigas en claires ostréicoles traditionnelles reste une pratique zootechnique non contrôlée. L'expérimentation 1994 a permis de tester 1) l'effet de la densité d'élevage (2 à 10 huîtres/m2) sur la croissance et la production de C. gigas, 2) la variabilité au sein de la claire de la croissance, et 3) d'évaluer les différentes sources de variabilité des paramètres physico-chimiques et trophiques de la colonne d'eau et de ...

  8. Introduction of digital soil mapping techniques for the nationwide regionalization of soil condition in Hungary; the first results of the DOSoReMI.hu (Digital, Optimized, Soil Related Maps and Information in Hungary) project

    Science.gov (United States)

    Pásztor, László; Laborczi, Annamária; Szatmári, Gábor; Takács, Katalin; Bakacsi, Zsófia; Szabó, József; Dobos, Endre

    2014-05-01

    Due to the former soil surveys and mapping activities significant amount of soil information has accumulated in Hungary. Present soil data requirements are mainly fulfilled with these available datasets either by their direct usage or after certain specific and generally fortuitous, thematic and/or spatial inference. Due to the more and more frequently emerging discrepancies between the available and the expected data, there might be notable imperfection as for the accuracy and reliability of the delivered products. With a recently started project (DOSoReMI.hu; Digital, Optimized, Soil Related Maps and Information in Hungary) we would like to significantly extend the potential, how countrywide soil information requirements could be satisfied in Hungary. We started to compile digital soil related maps which fulfil optimally the national and international demands from points of view of thematic, spatial and temporal accuracy. The spatial resolution of the targeted countrywide, digital, thematic maps is at least 1:50.000 (approx. 50-100 meter raster resolution). DOSoReMI.hu results are also planned to contribute to the European part of GSM.net products. In addition to the auxiliary, spatial data themes related to soil forming factors and/or to indicative environmental elements we heavily lean on the various national soil databases. The set of the applied digital soil mapping techniques is gradually broadened incorporating and eventually integrating geostatistical, data mining and GIS tools. In our paper we will present the first results. - Regression kriging (RK) has been used for the spatial inference of certain quantitative data, like particle size distribution components, rootable depth and organic matter content. In the course of RK-based mapping spatially segmented categorical information provided by the SMUs of Digital Kreybig Soil Information System (DKSIS) has been also used in the form of indicator variables. - Classification and regression trees (CART) were

  9. Inventario y evaluación de primates y amenazas para sus poblaciones en bosque montano de la Región Huánuco, Perú

    Directory of Open Access Journals (Sweden)

    Rolando Aquino

    2015-06-01

    Full Text Available El estudio estuvo orientado al inventario y evaluación de primates e identificar las amenazas para sus poblaciones en bosque montano de la Región Huánuco,  un área poco explorado con respecto a la  fauna silvestre. De Junio a Julio y de Setiembre a Octubre del 2014, fueron conducidos censos por transecto en puntos de muestreo correspondientes a las microcuencas de los ríos Chontayacu y Chinchao y cuenca alta del río Huallaga. En 618 km de longitud recorrida fueron registrados 47 grupos pertenecientes a cinco especies, siendo las más comunes Alouatta seniculus (15 grupos y Lagothrix flavicauda  (13 grupos. L. flavicauda fue observada únicamente en la Microcuenca del río Chontayacu,  y Ateles chamek  en la Cuenca alta del río Huallaga. En el área de estudio, los primates viven en parches de bosques primario y residual, excepto en el Chontayacu, donde el bosque primario es todavía denso y extenso. La densidad poblacional fue más alta para L. flavicauda (20,8 indiv./km2 y más baja para Sapajus macrocephalus (2,7 indiv./km2. Entre las actividades observadas, la deforestación para la agricultura y ganadería constituye la principal  amenaza para la supervivencia de primates, en particular en la Microcuenca del río Chinchao y Cuenca alta del río Huallaga.

  10. Eficiencia de polinización de colonias huérfanas del abejorro nativo Bombus atratus (Hymenoptera: Apidae en dos cultivares de fresa (Fragaria x ananassa sembrados bajo cubierta en la sabana de Bogotá

    Directory of Open Access Journals (Sweden)

    Carlos Alberto Poveda Coronel

    2018-01-01

    Full Text Available En Colombia la fresa se ha convertido en un cultivo de interés económico debido a la creciente demanda en el mercado extranjero en la última década. La mayoría de plantaciones son a campo abierto y no usan esquemas de polinización para mejorar la calidad de producción. La polinización con abejorros mejora la calidad de los frutos, aunque estos se producen mediante polinización espontánea. La especie nativa Bombus atratus ha sido reconocida como un polinizador eficiente de cultivos hortofrutícolas colombianos bajo invernadero. El presente estudio evaluó la eficiencia de polinización de dos colonias huérfanas en la calidad de los frutos de las variedades camino real y ventana sembrados bajo invernadero en Cajicá-Colombia. Se embolsaron los botones para obtener los frutos producidos espontáneamente y ser comparados con los frutos provenientes de la visita de obreras de B. atratus. Se encontró que la visita de las obreras mejoró la calidad de los frutos en las variables, calibre (35 % y 31 %, longitud (28 % y 19 %, peso fresco (103 % y 90 %, peso seco (126 % y 145 % y número de semillas (55 % y 81 % para las variedades Camino Real y Ventana respectivamente. A partir de las observaciones realizadas, se determinó que el recurso floral utilizado por las obreras de B. atratus fue el néctar y se hacen recomendaciones sobre su uso en este cultivo.

  11. Phase I/II open-label study of the biologic effects of the interleukin-2 immunocytokine EMD 273063 (hu14.18-IL2 in patients with metastatic malignant melanoma

    Directory of Open Access Journals (Sweden)

    Gillies Stephen D

    2009-07-01

    Full Text Available Abstract Background To explore the biological activity of EMD 273063 (hu14.18-IL2, a humanized anti-GD2 monoclonal antibody fused to interleukin-2 (IL2, in patients with unresectable, stage IV cutaneous melanoma as measured by induction of immune activation at the tumor site and in peripheral blood. Methods Nine patients were treated with 4 mg/m2 per day of EMD 273063 given as a 4-h intravenous infusion on days 1, 2, and 3 every four weeks (one cycle. Peripheral blood was analyzed for T cell and natural killer cell phenotype and frequency, as well as levels of soluble IL2 receptor (sIL2R, IL10, IL6, tumor necrosis factor alpha and neopterin. Biopsies of tumor metastasis were performed prior to therapy and at day 10 of the first 2 cycles to study lymphocyte accumulation by immunohistochemistry. Results Treatment was generally well tolerated and there were no study drug-related grade 4 adverse events. Grade 3 events were mainly those associated with IL2, most commonly rigors (3 patients and pyrexia (2 patients. Best response on therapy was stable disease in 2 patients. There were no objective tumor regressions by standard response criteria. Systemic immune activation was demonstrated by increases in serum levels of sIL2R, IL10, and neopterin. There was evidence of increased tumor infiltration by T cells, but not NK cells, in most post-dosing biopsies, suggesting recruitment of immune cells to the tumor site. Conclusion EMD 273063 demonstrated biologic activity with increased immune-related cytokines and intratumoral changes in some patients consistent with the suspected mechanism of action of this immunocytokine.

  12. EnviroAtlas - HU12_polygon

    Data.gov (United States)

    U.S. Environmental Protection Agency — This data set is a complete digital hydrologic unit boundary layer to the Subwatershed (12-digit) 6th level for the entire United States. This data set consists of...

  13. Main: 1HU9 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available Lox3; Glycine Max Molecule: Lipoxygenase-3; Chain: A; Synonym: L-3; Other_details: Complex With 4-Hydroperox...RSKLDSQVYGDHTSQITKEHLEPNLEGLTVDEAIQNKRLFLLGHHDPIMPYLRRINATSTKAYATRTILFLKNDGTLRPLAIELSLPHPQGDQSGAFSQVFLPADEGV...TFLWGRYSVEMSAVVYKDWVFTDQALPADLIKRGMAIEDPSCPHGIRLVIEDYPYAVDGLEIWDAIKTWVHEYVFLYYKSDDTLREDPELQACWKELVEVGHGDKKNEPWWPKMQTREELVEACAI

  14. "... Y nos quedamos huérfanos..."

    Directory of Open Access Journals (Sweden)

    María Clemencia Castro.

    1998-09-01

    Full Text Available El vínculo a la guerrilla implica al sujeto inscribirse en la ilegalidad, la vía armada y la clandestinidad. Se abandona todo, aún el propio nombre, haciendo ingreso al anonimato. La entrega a esta causa es una ruptura con la cadena de filiación primera y el inicio de una nueva cadena de identificaciones. Hacerse clandestino es hacer del clan su destino. En estos devenires del sujeto es posible recorrer las versiones del padre en la vida guerrillera. En un momento particular para cada uno, tiene lugar una nueva destitución del padre que impide seguirse sosteniendo en la elección por la guerrilla. Frente al desinvestimiento del Otro se hace imposible el lazo social, con el consecuente desplome de los colectivos. En este nuevo tiempo lógico en la subjetividad irrumpe la pregunta del sujeto por la paternidad, dando paso al enigma de la función.

  15. Heterogeneous catalytic degradation of polyacrylamide solution | Hu ...

    African Journals Online (AJOL)

    Modified with trace metal elements, the catalytic activity of Fe2O3/Al2O3 could be changed greatly. Among various trace metal elements, Fe2O3/Al2O3 catalysts modified with Co and Cu showed great increase on catalytic activity. International Journal of Engineering, Science and Technology, Vol. 2, No. 7, 2010, pp. 110- ...

  16. Sistema de classificação de pacientes: identificação do perfil assistencial dos pacientes das unidades de internação do HU-USP Sistema de clasificación de pacientes: identificación del perfil asistencial de los pacientes de las unidades de internación del HU-USP Patient classification system: identification of the patient care profile at hospitalization units of the UH-USP

    Directory of Open Access Journals (Sweden)

    Fernanda Maria Togeiro Fugulin

    2005-02-01

    Full Text Available Este estudo, exploratório-descritivo, teve por objetivo identificar o perfil assistencial dos pacientes das Unidades de Internação do Hospital Universitário da USP, como subsídio para alocação de recursos humanos, avaliação do quadro de pessoal de enfermagem e como fundamentação para os processos de tomada de decisão relacionados à organização e ao planejamento da assistência de enfermagem. Para conhecer o perfil dos pacientes em relação à complexidade assistencial foi utilizado o instrumento de classificação de pacientes, desenvolvido e implantado na Unidade de Clínica Médica do HU-USP, desde 1990. Os resultados deste estudo permitiram avaliar a adequação do instrumento de classificação de pacientes utilizado, bem como forneceu informações acerca do perfil assistencial dos pacientes e da carga de trabalho existente em cada Unidade de Internação, subsidiando, assim, as decisões gerenciais referentes à alocação de recursos humanos, ao planejamento da assistência e à organização dos serviços frente à demanda da clientela assistida.Este estudio exploratorio-descriptivo tuvo por objetivo identificar el perfil asistencial de los pacientes de las Unidades de Internación del Hospital Universitario de la USP, como subsidio para la distribución de recursos humanos, la evaluación del equipo de personal de enfermería y como fundamento para los procesos de toma de decisiones relacionadas a la organización y al planeo de la atención en enfermería. Para conocer el perfil de los pacientes respecto a la complejidad asistencial, fue utilizado el instrumento de clasificación de pacientes, desarrollado e implantado en la Unidad de Clínica Médica del HU-USP desde 1990. Los resultados de este estudio permitieron evaluar la adecuación del instrumento de clasificación de pacientes utilizado, y también forneció informaciones acerca del perfil asistencial de los pacientes y de la carga de trabajo existente en cada

  17. In vitro and in vivo bactericidal activity of Tinospora sagittata (Oliv.) Gagnep. var. craveniana (S.Y.Hu) Lo and its main effective component, palmatine, against porcine Helicobacter pylori.

    Science.gov (United States)

    Rong, Qian; Xu, Min; Dong, Qi; Zhang, Yuli; Li, Yinglun; Ye, Gang; Zhao, Ling

    2016-08-30

    Tinospora sagittata (Oliv.) Gagnep. var. craveniana (S.Y.Hu) Lo (TSG) is a traditional Chinese herb that has been used for the treatment of upper respiratory tract infection and has anti-bacterial and anti-ulcer activity. Our study investigated the bactericidal effects of TSG and its major component, palmatine, against a Helicobacter pylori (H. pylori) strain isolated from pig and the standard strain H. pylori SS1 in vitro and in vivo. H. pylori was isolated from pig and named H. pylori SCYA201401. For in vitro experiments, the inhibitory activity of TSG and palmatine against H. pylori SCYA201401 and H. pylori SS1 were tested by use of the agar cup diffusion technique. The minimal inhibitory concentration (MIC) and minimal bactericidal concentration (MBC) were determined from the absence of H. pylori colonies on agar plates. Time-kill curves were used to evaluate bactericidal activity; the average number of colonies was calculated at 0 to 48 h after liquid incubation, with concentrations of drugs at 0.5, 1, and 2 × MIC. For in vivo experiments, H. pylori SCYA201401-infected mice were randomly divided into TSG, palmatine, triple therapy (omeprazole, clarithromycin, and amoxicillin), blank control, and model groups. The eradication ratios were determined by use of rapid urease tests and bacterial culture. In vitro, the MIC and MBC of TSG against H. pylori SCYA201401 and SS1 were both 6250 μg/mL, whereas palmatine against H. pylori SCYA201401 was 6.25 μg/mL and against H. pylori SS1 was 3.12 μg/mL. The time-kill curves showed a dose-dependent, progressive decline in the numbers of viable bacteria up to 40 h. In vivo, the eradication ratios in the TSG and palmatine groups of mice were 80 and 50 % compared with 70 % in the triple-therapy group. TSG and its major component, palmatine, have bactericidal activity against H. pylori in vitro and in vivo. The possibility that TSG or palmatine can be effective in the treatment of human and animals H. pylori

  18. Percepciones del personal de salud y la comunidad sobre la adecuación cultural de los servicios materno perinatales en zonas rurales andinas y amazónicas de la región Huánuco

    Directory of Open Access Journals (Sweden)

    Julio Mayca

    2009-04-01

    Full Text Available La mortalidad materna, problema prioritario mundial, es mayor en países subdesarrollados con analfabetismo, zonas rurales poco accesibles e insuficiente personal de salud calificado. Objetivos. Este estudio explora las percepciones del personal de salud y la comunidad en relación con la adecuación cultural de servicios maternos perinatales en la región Huánuco, observando aspectos críticos de la oferta propuesta y las necesidades de la población. Materiales y métodos. Estudio exploratorio, transversal, cualitativo. Incluyó personal de salud a quienes se realizó entrevistas a profundidad (EP, y población en general para grupos focales (GF. Los instrumentos incluyeron aspectos como: adecuación y aceptación del servicio ofrecido, entendimiento y capacitación del personal en estos temas, y entendimiento de la población de las acciones y oferta en salud. Resultados. Se realizó 15 EP y 15 GF; en el primer caso el personal de salud refirió la poca adecuación de la infraestructura actual, mejora en la aceptación del servicio por la comunidad y la necesidad de tener ellos un mayor entendimiento del tema. La población manifestó su opinión acerca de lo poco adecuado del servicio ofertado a su cultura, poco entendimiento a las indicaciones médicas y deseos que se incorpore más a su cultura en dichos procesos. Conclusiones. Nuestros servicios maternos no tienen acondicionamiento adecuado con relación a la cultura de la comunidad, pues es insuficiente lo que una gestante podría encontrar en un consultorio relacionado con sus costumbres. Necesitamos considerar propuestas elaboradas desde la comunidad, para disponer de una oferta identificada con aspectos sociales, culturales, y étnicos, que sea identificada por la población como suya.

  19. Bilan de l'année 1996 : Cultures d'huîtres en eaux profondes ; Suivi de l'activité physiologique de C. gigas sur le banc de Ronce (mortalités anormales sur le banc de Ronce) ; Valorisation des claires ostréicoles

    OpenAIRE

    Goulletquer, Philippe; Le Moine, Olivier; Soletchnik, Patrick; Razet, Daniel; Turpin, Vincent; Robert, Jean-Michel; Gras, Paul; Faury, Nicole; Geairon, Philippe; Taillade, Sylvie; Lodato, Marie; Lagarde, Franck

    1997-01-01

    La contractualisation SRC/IFREMER-URAPC concernait en 1996 trois actions spécifiques : • Expertise pour les cultures d'huîtres en eaux profondes, • Suivi de l'activité physiologique sur le banc de Ronce, • Valorisation des claires ostréicoles - optimisation du processus d'affinage. Le premier thème n'a pu être abordé que via les différentes réunions préparatoires SRC Ré Centre Ouest, Marennes-Oléron et les commissions des cultures marines. Depuis l'accord de la CCM de La Rochelle en date du 1...

  20. Papel del receptor huérfano GPR55 en la fisiopatología del cáncer : implicación en la proliferación e invasión de células tumorales

    OpenAIRE

    Andradas Arias, Clara

    2013-01-01

    GPR55 es un receptor huérfano acoplado a proteinas G que, según publicaciones recientes, podría ser activado por lisofosfatidilinositol y determinados cannabinoides. Aunque se conoce poco todavía sobre su función fisiológica, existen evidencias que indican que podría desempeñar un papel importante en la regulación del metabolismo óseo o el control del dolor inflamatorio, por ejemplo. En esta Tesis hemos estudiado el papel de GPR55 en la fisiopatología del cáncer. Nuestros resultados muestr...

  1. Anne Le Huérou, Aude Merlin, Amandine Regamey and Silvia Serrano, Tchétchénie: une affaire intérieure? Russes et Tchétchènes dans l’étau de la guerre, Paris: Editions Autrement, 2005

    Directory of Open Access Journals (Sweden)

    Bruno Coppieters

    2005-10-01

    Full Text Available This book on Chechnya has been co-authored by Anne Le Huérou, Aude Merlin, Amandine Regamey and Silvia Serrano. These scholars are associated with either the Ecole des hautes études en sciences sociales - CNRS or with the Institut d'études politiques de Paris. Their book offers an excellent introduction to the two most recent wars with Russia. Its aim is to explain to a wider public their historical and social background, the claims put forward by the various actors, the different currents in...

  2. Efectos musculares y hematológicos del uso de rHuEpo en combinación con el entrenamiento físico : implicaciones de la demospresina y la hipoxia en el dopaje sanguíneo : estudios in vivo e in vitro

    OpenAIRE

    Martínez Bello, Vladimir Essau

    2011-01-01

    En la presente Tesis Doctoral hemos querido estudiar, en primer lugar, el efecto que tendría el incremento artificial de la capacidad de transporte de oxígeno, a través del tratamiento con rHuEpo, sobre distintos parámetros musculares así como su implicación en la mejora del rendimiento físico. Son muchos los autores que, tanto en el ámbito clínico (Winearls, Oliver y cols. 1986; Bommer, Muller-Buhl y cols. 1987) como en el ámbito deportivo (Berglund y Ekblom 1991; Lundby, Robach y cols. 2008...

  3. La presencia de Ixodes luciae en el noroeste argentino y nuevos huéspedes para Ixodes pararicinus y algunas especies de Amblyomma (Acari: Ixodidae Presence of Ixodes luciae in Argentina northwest and new hosts for Ixodes pararicinus and some species of Amblyomma (Acari: Ixodidae

    Directory of Open Access Journals (Sweden)

    Analía G. Autino

    2006-07-01

    Full Text Available El análisis de una colección de garrapatas de mamíferos del noroeste argentino, depositados en la Colección de Anexos de la Colección Mamíferos Lillo (CML de la Universidad Nacional de Tucumán, permitió ampliar el área de distribución de Ixodes luciae Sénevet, a las provincias de Salta y Tucumán e incrementar su rango de huéspedes al roedor sigmodontino Calomys callosus (Rengger y a los marsupiales de la familia Didelphidae Micoureus constantiae (Thomas, Thylamys cinderella Thomas y Thylamys venustus (Thomas. Se registró a C . callosus y Oligoryzomys destructor (Tschudi como nuevos huéspedes de Ixodes pararicinus Keirans & Clifford, y a los Carnivora Lycalopex gymnocercus (Fischer y Oncifelis geoffroyi (d´Orbigny & Gervais como nuevos huéspedes de Amblyomma neumanni Ribaga y Amblyomma parvum Aragão, respectivamente. Adicionalmente, se observó la infestación de Lutreolina crassicaudata (Desmarest (Didelphidae por I. luciae y la presencia de Amblyomma tigrinum Koch, sobre L. gymnocercus . Ninfas de Amblyomma sp . se obtuvieron de Akodon Meyen (Sigmodontinae.The analysis of a tick collection of mammals from northwestern Argentina deposited in the Annexes (ACML of Colección Mamíferos Lillo (CML National University of Tucumán, amplified the distribution of Ixodes luciae Sénevet, to Salta and Tucumán provinces and increased the host range to the sigmodontinae rodent Calomys callosus (Rengger and the Didelphidae Micoureus constantiae (Thomas, Thylamys cinderella Thomas and Thylamys venustus (Thomas. Calomys callosus and Oligoryzomys destructor (Tschudi were registered as new hosts of Ixodes pararicinus Keirans & Clifford, and the Carnivora Lycalopex gymnocercus (Fischer and Oncifelis geoffroyi (d´Orbigny & Gervais as new hosts of Amblyomma neumanni Ribaga, and Amblyomma parvum Aragão, respectively . Lutreolina crassicaudata (Desmarest (Didelphidae was also found infested with I. luciae while Amblyomma tigrinum Koch was

  4. The genus Ixodes (Acari: Ixodidae in Mexico: adult identification keys, diagnoses, hosts, and distribution El género Ixodes (Acari: Ixodidae en México: claves de identificación para adultos, diagnosis, huéspedes y distribución

    Directory of Open Access Journals (Sweden)

    Carmen Guzmán-Cornejo

    2010-08-01

    Full Text Available Identification keys, diagnoses, hosts, and distribution data are provided for adults of the 26 species of Ixodes known from Mexico. Data are from specimens deposited in the Colección Nacional de Ácaros (CNAC, Instituto de Biología, Universidad Nacional Autónoma de México, and from the literature.Se presentan claves de identificación, diagnosis, huéspedes y datos sobre la distribución de 26 especies de Ixodes conocidas para México. La información proviene de especímenes depositados en la Colección Nacional de Ácaros (CNAC, Instituto de Biología, Universidad Nacional Autónoma de México y de la literatura.

  5. The Anticancer Properties and Apoptosis-inducing Mechanisms of Cinnamaldehyde and the Herbal Prescription Huang-Lian-Jie-Du-Tang (黃連解毒湯 Huáng Lián Jiě Dú Tang in Human Hepatoma Cells

    Directory of Open Access Journals (Sweden)

    Liang-Tzung Lin

    2013-10-01

    Full Text Available Hepatocellular carcinoma (HCC has long been one of the most important causes of cancer mortality in the world. Many natural products and traditional herbal medicines have been used to treat HCC in Asian countries such as Japan, Korea, Taiwan, and China. The present review aims to describe the anticancer properties and apoptotic mechanisms of cinnamaldehyde, the bioactive ingredient isolated from cinnamon trees, and the herbal prescription Huang-Lian-Jie-Du-Tang (黃連解毒湯 Huáng Lián Jiě Dú Tang; HLJDT against human hepatoma cells in vitro and in vivo. Implication of their treatment for the development of targeted therapy against HCC is discussed.

  6. β-l-1-[5-(E-2-bromovinyl)-2-(hydroxymethyl)-1,3-(dioxolan-4-yl)] uracil (l-BHDU) prevents varicella-zoster virus replication in a SCID-Hu mouse model and does not interfere with 5-fluorouracil catabolism.

    Science.gov (United States)

    De, Chandrav; Liu, Dongmei; Zheng, Bo; Singh, Uma S; Chavre, Satish; White, Catherine; Arnold, Robert D; Hagen, Fred K; Chu, Chung K; Moffat, Jennifer F

    2014-10-01

    The alphaherpesvirus varicella-zoster virus (VZV) causes chickenpox and shingles. Current treatments are acyclovir (ACV) and its derivatives, foscarnet and brivudine (BVdU). Additional antiviral compounds with increased potency and specificity are needed to treat VZV, especially to treat post-herpetic neuralgia. We evaluated β-l-1-[5-(E-2-bromovinyl)-2-(hydroxymethyl)-1,3-(dioxolan-4-yl)] uracil (l-BHDU, 1) and 5'-O-valyl-l-BHDU (2) in three models of VZV replication: primary human foreskin fibroblasts (HFFs), skin organ culture (SOC) and in SCID-Hu mice with skin xenografts. The efficacy of l-BHDU in vivo and its drug-drug interactions were previously not known. In HFFs, 200μM l-BHDU was noncytotoxic over 3days, and l-BHDU treatment reduced VZV genome copy number and cell to cell spread. The EC50 in HFFs for l-BHDU and valyl-l-BHDU were 0.22 and 0.03μM, respectively. However, l-BHDU antagonized the activity of ACV, BVdU and foscarnet in cultured cells. Given its similar structure to BVdU, we asked if l-BHDU, like BVdU, inhibits 5-fluorouracil catabolism. BALB/c mice were treated with 5-FU alone or in combination with l-BHDU or BVdU. l-BHDU did not interfere with 5-FU catabolism. In SCID-Hu mice implanted with human skin xenografts, l-BHDU and valyl-l-BHDU were superior to ACV and valacyclovir. The maximum concentration (Cmax) levels of l-BHDU were determined in mouse and human tissues at 2h after dosing, and comparison of concentration ratios of tissue to plasma indicated saturation of uptake at the highest dose. For the first time, an l-nucleoside analog, l-BHDU, was found to be effective and well tolerated in mice. Copyright © 2014 Elsevier B.V. All rights reserved.

  7. Primer registro del Calancate Común Aratinga a. acuticaudata (Aves: Psittacidae como huésped nativo primario de Ornithocoris toledoi Pinto (Hemiptera: Heteroptera: Cimicidae First record of Blue-Crowned Parrot Aratinga a. acuticaudata (Aves: Psittacidae as primary native host of Ornithocoris toledoi Pinto (Cimicidae: Hemiptera: Heteroptera

    Directory of Open Access Journals (Sweden)

    Diego L Carpintero

    2011-12-01

    Full Text Available Se presenta como huésped primario nativo de la chinche Ornithocoris toledoi Pinto (Hemiptera: Heteroptera: Cimicidae al Calancate Común Aratinga a. acuticaudata (Aves: Psittacidae. Su presencia en la provincia del Chaco constituye además un nuevo registro distribucional de esta chinche en la República Argentina. Se agrega una breve discusión acerca de la taxonomía de la misma y se comparan algunos parámetros poblacionales con los de otras especies de cimícidos. Finalmente, se discuten las vías de infestación posibles en el estado actual de conocimiento, incluyendo otras aves (Furnariidae y murciélagos (Chiroptera.The primary natural host of cimicid bug Ornithocoris toledoi Pinto (Hemiptera: Heteroptera: Cimicidae is presented as Blue-Crowned Parrot Aratinga a. acuticaudata (Aves: Psittacidae. Its presence in the Chaco province is also a new distributional record of this bug in Argentina. A brief discussion about the taxonomy is also given and some population parameters are compared with those of other bug species. Finally, we discuss possible infestation ways in the current state of knowledge, including other birds (Furnariidae and bats (Chiroptera.

  8. Reacción de ingerto versus huésped: de la comprensión a la utilización de un fenómeno biológico Graft versus host reation: from comprehension to utilization of a biological phenomenon

    Directory of Open Access Journals (Sweden)

    Jorge Eliécer Ossa Londoño

    1999-01-01

    Full Text Available La enfermedad de injerto versus huésped es una de las complicaciones con mayor mortalidad que se presentan después de un trasplante, usualmente de médula ósea, o después de una transfusión sanguínea.- Los principales órganos blanco son la piel. el hígado, el tracto gastrointestinal y el sistema inmune. Sin embargo. la apreciación de esta enfermedad ha venido cambiando a medida que avanza la comprensión de la inmunología de trasplantes. pues se ha visto que puede tener resultados benéficos como son un efecto antireucémico y un aumento de la tolerancia a los trasplantes. Graft versus host disease is one of the complications with greater lethality after transplantation, usually of bone marrow, or after blood transfusion. Organs involved include skin, liver, gastrointestinal tract and the immune system. However, the conception of graft versus host disease has been changing as comprehension of transplant immunology has advanced, since it has been demonstrated that it can have beneficial results as an antileucemic response and because of an increased tolerance to grafts.

  9. Viral and host factors related with histopathologyc activity in patients with chronic hepatitis B and moderate or intermittently elevated alanine aminotransferase levels Influencia de factores virales y del huésped en la actividad histológica en pacientes con hepatitis crónica por virus de la hepatitis B y elevación moderada o intermitente de alanina aminotransferasa

    Directory of Open Access Journals (Sweden)

    E. Molina Pérez

    2010-09-01

    Full Text Available Objective: viral and host factors are related with progression of pathological lesion in chronic hepatitis B. We analyzed these factors in patients with moderate or intermittently elevated ALT levels, and its threshold that determinate significant histological activity. Patients and methods: retrospective analyses of viral and host parameters in 89 consecutive chronic hepatitis B patients biopsied because of moderate or intermittently elevated ALT levels [1-2 x ULN (ULN = 39 IU/mL] and/or DNA-HBV > 2 x 10³ IU/mL in AntiHBe+ patients. It was analyzed age, gender, ALT levels, HBeAg, viral load and genotype. It was considered advanced histological lesion a Knodell Score (KS > 7 and histological lesion indicating treatment, lobular inflammation ≥ 2 or fibrosis ≥ 2 according to Scheuer Classification. Results: KS > 7 and histological lesion indicating treatment was found in 47.8 and 60.7% respectively. It was observed relationship between age, male gender, ALT levels and viral load with histological damage (p ULN (69.1 vs. 47.1%, p = 0.04. There were not significant upper frequencies of advanced lesion when a cut-off of 40 years or DNA-HBV > 2 x 10³ IU/mL viral load or serological status HBeAg was considerate. Histological activity was lesser in genotype D patients than those infected with others genotypes (p Objetivo: analizar factores virales y del huésped relacionados con actividad histológica en un subgrupo de pacientes con hepatitis crónica B y elevación intermitente o moderada de alanina aminotransferasa (ALT, y el umbral que determine daño histológico indicativo de tratamiento. Pacientes y métodos: análisis retrospectivo de parámetros virales y del huésped en 89 pacientes con hepatitis crónica B biopsiados consecutivamente por elevación intermitente o moderada de ALT [1-2 x USN (USN = 39 UI/mL]. Fueron analizados edad, sexo, ALT, HBeAg, carga viral y genotipo. Se consideró como lesion histologica avanzada un Índice de

  10. Mineralogía y cambios composicionales en fragmentos óseos atribuidos a un dinosaurio ornitópodo del yacimiento barremiense de Buenache de la Sierra (Formación Calizas de La Huérguina, Cuenca, España

    Directory of Open Access Journals (Sweden)

    Merino, L.

    2013-12-01

    Full Text Available X-ray diffraction, optical polarizing microscopy, scanning electron microscopy and electron microprobeto, have been used to analyse the diagenetic processes of isolated dinosaur bones and ribs attributed to an ornithopod dinosaur from Buenache de la Sierra (Upper Barremian, La Huérguina Formation. We also examine the geochemical and mineralogical bone mineralization of extant archosaurs (caiman and bird for comparison. Diagenetic processes have modified the original chemical composition of the studied fragments of bones, as well as its crystallinity, which increases in the fossil samples. In recent bones, hydroxyapatite results the main mineral constituent, while in fossils is fluorapatite. We found two types of mineralogical arrangements: one group exhibiting the spongy structure completely collapsed forming breccias of bone fragments, and a second group with well preserved spongy structure but substituted by calcium carbonate. Calcite is the most abundant authigenic mineral infilling pores and fissures of the fossilized remains. The presence of pyrite in bone cavities suggests an early burial stage under euxinic conditions of a reductor environment. The biostratinomic and fossildiagenetic alterations allow us to conclude that the remains have two distinct taphonomic histories, and that the association undergone taphonomical resedimentation.Las diferentes técnicas utilizadas (difracción de rayos X, microscopio petrográfico, microscopio electrónico de barrido y microsonda electrónica en el estudio de los restos óseos atribuidos a un ornitópodo del yacimiento Buenache de la Sierra (Baremiense superior, Formación La Huérguina han permitido caracterizar los procesos diagenéticos. Se han analizado huesos de arcosaurios vivos (caimán y ave, para comparar la mineralogía y la geoquímica del material óseo. Los procesos diagenéticos han modificado la composición química original de los fragmentos de huesos estudiados, así como su

  11. Antihepatoma and Liver Protective Potentials of Ganoderma Lucidum (靈芝 Ling Zhi Fermented in a Medium Containing Black Soybean (黑豆 Hēi Dòu and Astragalus Membranaceus (生黃耆 Shēng Huáng Qí

    Directory of Open Access Journals (Sweden)

    Zheng-Yuan Su

    2013-04-01

    Full Text Available The antihepatoma activity and liver protective function of the fermentation products (5 L fermenator of Ganoderma lucidum (GL; 靈芝 Ling Zhi cultivated in a medium containing black soybean (BS; 黑豆 Hēi Dòu and Astragalus membranaceus (AM; 生黃耆 Shēng Huáng Qí at different fermentation temperatures were investigated in this study. Hep 3B cells pretreated with lovastatin were used to study the antihepatoma activity, and possible active components were analyzed by reverse-phase high-performance liquid chromatography. Carbon tetrachloride (CCl4-induced primary rat hepatocyte injury was further used to evaluate the liver protective activity of the fermentation products. While all the GL broth filtrates do not inhibit the growth of Hep 3B cells, the ethanolic extract from GL-2 mycelia (GL-2-mE, cultivated in the medium containing BS (50 g/L and AM (20 g/L at 24 °C for 11 days showed the best antihepatoma activity (IC50 26.6 μg/mL than the other ethanolic extracts from GL mycelia, GL fruiting body, BS, and AM did. The antihepatoma activities were correlated with some unknown active components in these samples. Furthermore, GL-2-mE (100 μg/mL without harmful effect on the growth of normal primary rat hepatocytes significantly maintained cell viability, reduced lactate dehydrogenase leakage, lowered lipid peroxidation, and increased glutathione peroxidase and glutathione S-transferase activities in the CCl4-induced damaged primary rat hepatocytes.

  12. Changes in speed and strength in female volleyball players during and after a plyometric training program Změny rychlostně-silových předpokladů volejbalistek v průběhu a po absolvování plyometrického tréninkového programu

    Directory of Open Access Journals (Sweden)

    Milan Elfmark

    2009-03-01

    Full Text Available The goal of this article was the validation of a plyometric training program and the evaluation of the changes in monitored speed and explosive power predispositions during and after the end of the training program. The program was applied to a group of female youth volleyball players (n = 11 twice a week during an eight week period. Their actual level of explosive power and locomotor speed was evaluated before, during and after the intervention was completed. The levels were determined with the following tests: the standing vertical jump, the vertical jump with an approach and the shuttle run for 6 x 6 m. There were positive changes in the average values of test scores during the period of testing, but the dynamics of the changes in the explosive power and the speed were different. Other increases in all the characteristics were noticeable when the final measurements were made six weeks after the completion of the training program. Examination of the differences in the test scores by the follow up group, before the beginning and six weeks after finishing the intervention, was centred on objectively and statistically important changes in the volleyball players' motor predispositions (p < .05. The results of the program support the opinion that plyometric exercises are effective tools in the development of explosive power and speed in young athletes. Cílem studie bylo ověřit v tréninkové praxi program sestávající z vybraných plyometrických cvičení a zhodnotit změny sledovaných rychlostně-silových předpokladů v průběhu a po jeho absolvování. Program byl aplikován u volejbalistek kadetské kategorie (n = 11 2x týdně po dobu 8 týdnů. Aktuální úroveň výbušné síly a lokomoční rychlosti byla hodnocena před, v průběhu a po skončení intervence testy dosah jednoruč po výskoku z místa, dosah jednoruč výskokem po smečařském rozběhu a rychlostní člunkový běh na 6 x 6 m. V období realizace programu doch

  13. Comparative Analysis of Pso-Pid and Hu-Pid

    Directory of Open Access Journals (Sweden)

    Chanda Thakur

    2017-02-01

    Full Text Available PID control is an important ingredient of a distributed control system. The controllers are also embedded in many special purpose control systems. PID control is often combined with logic, sequential functions, selectors, and simple function blocks to build the complicated automation systems used for energy production, transportation, and manufacturing. Many sophisticated control strategies, such as model predictive control, are also organized hierarchically. PID control is used at the lowest level; the multivariable controller gives the set points to the controllers at the lower level. The PID controller can thus be said to be the “bread and butter‟ of power system engineering. It is an important component in every control engineer‟s tool box. PID controllers have survived many changes in technology, from mechanics and pneumatics to microprocessors via electronic tubes, transistors, integrated circuits. The microprocessor has had a dramatic influence on the PID controller

  14. ÕhuLoss - ehtides maailma / Pekka Erelt

    Index Scriptorium Estoniae

    Erelt, Pekka, 1965-

    2011-01-01

    Ehtekunstnike rühmitusest õhuLoss (Kadri Mälk, Piret Hirv, Eve Margus-Villems, Tanel Veenre, Kristiina Laurits, Villu Plink, Katrin Sipelgas). Esimest korda astus rühmitus üles 10 aastat tagasi Hollandis Marzee galeriis toimunud näitusel. 2011. aasta augustis-septembris toimus näitus Tallinna Põhjatuletornis

  15. HU_DB at TREC 2014 Microblog Track

    Science.gov (United States)

    2014-11-01

    tweet generated by another user), as well as non- English tweets. We also removed duplicates tweets. Note that we removed illegal tweets from R2 (and not...without incurring too much query drift. Grammar -based term modification during query expan- sion. The corpus of tweets against which we applied queries was

  16. Fluoriidid Eesti elanike joogivees / Astrid Saava, Ene Indermitte

    Index Scriptorium Estoniae

    Saava, Astrid, 1938-

    2007-01-01

    Eesti elanike joogivee-uuringust, mis tehti 2004. aastal Eesti Stomatoloogia Seltsi tellimisel. Lisad: Eesti elanike joogivee fluoriidisisalduse kaart. Elanike jaotus tarbitava joogivee fluoriidisisalduse alusel maakonniti

  17. Eesti maakondade klasteranalüüs ja regionaalsed valikud / Annemari Päll

    Index Scriptorium Estoniae

    Päll, Annemari

    2003-01-01

    Artikkel analüüsib tuginedes peamistele sotsiaalmajanduslikele näitajatele piirkondliku jaotuse kujunemist aastatel 1996-2000 ja annab hinnangu senise regionaalpoliitika tulemuslikkusele. Tabelid. Graafik

  18. Determination of diferences in runs between boys and girls aged 5.5 Určení rozdílu v běhu mezi chlapci a dívkami ve věku 5,5 roku

    Directory of Open Access Journals (Sweden)

    Damir Karpljuk

    2005-02-01

    Full Text Available The aim of this research is to determine whether there are distinctions in runs among five and a half year old boys and girls. The research is based on studying 80 girls and 64 boys from seven kindergartens in Slovenia. The following five measurement methods have been used in our research: a 10-meter run, a 150-meter run, a 10-meter run with a flying start, 4-times 5-meter run, and a 300-meter run. The results of the t-test indicate a statistically characteristic difference among boys and girls in 300 m run test results only, that is, a method used for measuring aerobic endurance. Other motor skills results have shown that there are no statistically characteristic differences among boys and girls. It is important that sport activities for boys and girls are organized for both groups of children equally. Especially girls must take part in a variety of running exercises in order to increase their aerobic endurance. They should be encouraged to take part in a variety of games which require activating the energy component of movement. Based on the results of this research we can say that physical education (PE of preschool children should be planned regardless of sex and the PE program should be the same for both boys and girls. Cílem tohoto výzkumu je určit, zda existují odlišnosti v běhu chlapců a dívek ve věku 5,5 roku. Výzkum je založen na studii 80 dívek a 64 chlapců v sedmi mateřských školách ve Slovinsku. Bylo použito těchto pěti měřicích metod: běh na 10 metrů, běh na 150 metrů, běh na 10 metrů s letmým startem, běh 4 × 5 metrů, běh na 300 metrů. Výsledky t-testu vykázaly statisticky významný rozdíl mezi chlapci a dívkami jen v běhu na 300 metrů, což je metoda používaná pro měření aerobní vytrvalosti. Výsledky ostatních pohybových aktivit vykazují, že mezi chlapci a dívkami není žádný statisticky významný rozdíl. Je důležité, aby sportovní aktivity byly organizovány rovnom

  19. Autonomic nervous system activity assessment in recreational half marathon runners [Hodnocení aktivity autonomního nervového systému u rekreačních účastníků půlmaratonského běhu

    Directory of Open Access Journals (Sweden)

    David Smékal

    2011-03-01

    competition. It is evident that the causes of soreness or fatigue do not markedly affect ANS activity during a later phase of recovery.[VÝCHODISKA: Spektrální analýza (SA variability srdeční frekvence (VSF je považována za neinvazivní metodu kvantifikace autonomní kardiální regulace sinoatriálního uzlu. Je známo, že autonomní regulace je ovlivňována různými stresory jako například nervozitou nebo tělesnou prací. CÍLE: Cílem předložené studie bylo zhodnotit vliv předstartovního stavu na aktivitu autonomního nervového systému (ANS a dále pak monitorovat časový průběh zotavení ANS paralelně se subjektivně vnímanou únavou v průběhu 24 hodin od ukončení půlmaratonu u amatérských běžců. METODIKA: Autonomní kardiální regulace byla posuzována pomocí metody SA VSF. Aktivita ANS byla hodnocena jeden týden před závodem a v den závodu. Po ukončení závodu proběhla měření aktivity ANS v 1., 12. a 24. hodině. Aktivita ANS byla reprezentována standardními spektrálními parametry a také komplexními indexy SA HRV. K hodnocení velikosti předstartovní nervozity byla využita modifikovaná Likertova 10bodová škála. Subjektivně vnímaná únava byla hodnocena na 6bodové škále. VÝSLEDKY: Vnímání nervozity bylo signifikantně vyšší v den závodu než týden před závody. Signifikantní pokles komplexního indexu sympatovagové balance v den závodu nepřímo svědčil o vzestupu aktivity sympatiku. Ve 12. ani 24. hodině zotavení se již žádný ze sledovaných parametrů VSF signifikantně nelišil od obou vstupních vyšetření. Subjektivně vnímaná únava zůstala zvýšená ještě 24 hodin od ukončení závodu. ZÁVĚRY: Naše práce ukázala, že zvýšená předzávodní nervozita vede k převaze sympatiku v autonomní regulaci zejména během orthostatické stimulace. Dále bylo zjištěno, že aktivita ANS se navrátila na předzátěžovou úroveň během 12. hodiny od ukončení z

  20. "Solntseedõ" godõ bez "makovoi rosinki" vo rtu / Aleksandr Komarov ; interv. Jelena Nikoforova

    Index Scriptorium Estoniae

    Komarov, Aleksandr

    2001-01-01

    "Päikesesööjad" - need on inimesed, kes on loobunud toidu omastamisest mao kaudu, nad toituvad päikeseenergiast, mida omastavad naha ja kopsude kaudu. Intervjuu vene uurijaga, kes töötas välja oma metoodika

  1. Diversidad, fluctuación poblacional y plantas huésped de escolitinos (Coleoptera: Curculionidae asociados con el agroecosistema cacao en Tabasco, México Diversity, dynamic population and host plants of bark and ambrosia beetles (Coleoptera: Curculionidae associated to the cocoa agroecosystem in Tabasco, Mexico

    Directory of Open Access Journals (Sweden)

    Manuel Pérez-De La Cruz

    2009-12-01

    Full Text Available Se estudió la diversidad de escolitinos asociados con el agroecosistema cacao en Tabasco, México durante el año 2007. Los insectos adultos fueron recolectados en 4 localidades con trampas de alcohol etílico, trampas de atracción luminosa y captura directa sobre sus plantas huésped. Se recolectaron 19 263 ejemplares, pertenecientes a 51 especies y 26 géneros. Araptus hymenaeae y Cnesinus squamosus son nuevos registros para México. La máxima diversidad de insectos capturados con los 3 métodos de recolecta se obtuvo en El Bajío (H'=2.45 y Dmg=4.83, la mínima en Río Seco (H'=2.29 y Km. 21 (Dmg=3.85, y el máximo valor de equidad (J lo obtuvo El Bajío (0.67. El índice de similitud de Sorensen (Is mostró que los sitios de estudio tienden a presentar la misma composición de especies. Los índices de diversidad, equidad y similitud, aplicados a la fauna de escolitinos capturados con cada uno de los métodos empleados, mostraron diferencias, excepto en las trampas de alcohol. La fluctuación presenta picos poblacionales marcados al inicio y al final del año de estudio. Las plantas en las que se recolectó el mayor número de especies fueron Theobroma cacao (16 y Swietenia macrophylla (13.The bark and ambrosia beetle diversity in cocoa agroecosystems was studied during 2007 in Tabasco, Mexico. Adult insects were gathered in 4 localities with ethanol and light traps and by direct collecting in their host plants. 19 263 specimens were gathered, belonging to 51 species and 26 genera. Araptus hymenaeae and Cnesinus squamosus are new records for Mexico. The maximum diversity of insects captured with the 3 collecting methods was obtained in El Bajío (H'=2.45 and Dmg=4.83, the minimum in Río Seco (H'=2.29 and Km. 21 (Dmg=3.85, and the maximum value of justness (J was obtained in El Bajío (0.67. The Sorensen similarity index (Is showed that the study places present the same species composition. The diversity, justness and similarity indices

  2. First records of three species of Oxycraspedus Kuschel (Coleóptera: Belidae in Argentina and use of a predictive model to compare their potential distribution with the range of their host-plant, Araucaria araucana Primera cita de las tres especies de Oxycraspedus Kuschel (Coleóptera: Belidae en Argentina y uso de un modelo predictivo para comparar su distribución potencial con el rango de su planta huésped, la Araucaria araucana

    Directory of Open Access Journals (Sweden)

    M.S. FERRER

    2007-09-01

    Full Text Available The first records of the three known species of Oxycraspedus Kuschel (Belidae: Oxycoryninae in Argentina are reported, and added to their known distribution in Chile. These weevils are of interest because of their association with the pehuén or monkey puzzle tree, Araucaria araucana, a species of conservation concern. Their distribution data are of value for the protection of biodiversity in natural areas of Patagonia. The potential distribution of Oxycraspedus, as predicted by a model using bioclimatic variables, is coincident as expected, with the geographic range of the araucaria host-plantSe reportan por primera vez en Argentina las tres especies de Oxycraspedus Kuschel (Belidae: Oxycoryninae y se añaden a su distribución en Chile. Estos gorgojos son de interés debido a su asociación con el pehuén Araucaria araucana, una especie de gran interés en temas de conservación. Los datos sobre su distribución son valiosos para proteger la biodiversidad en áreas de la Patagonia. La distribución potencial de Oxycraspedus predicha por un modelo a partir de variables bioclimáticas, es coincidente, como se esperaba, con el rango geográfico de su planta huésped, la araucaria

  3. Riigi kultuuristipendiumid jagatud / Reet Weidebaum

    Index Scriptorium Estoniae

    Weidebaum, Reet

    2000-01-01

    Kultuuriminister Signe Kivi määras 2000. a. riigi kultuuristipendiumide II jaotuse kümme 24000 kroonist stipendiumi (kunstiinimestest Andro Kööp, Ave Räkk, Mariann Raisma, Epi Tohvri). III jaotuse avaldusi võetakse vastu 20. aug.-ni.

  4. Estudo da anomalia de Pelger-Huët em núcleo familiar Pelger-Huët anomaly study in a family

    National Research Council Canada - National Science Library

    Patrícia H. O. Calderan; Dimas J. Campiolo; Omar S.G. Saavedra; Cláudia R. Bonini-Domingos

    2008-01-01

    .... We evaluate eleven members of a familiar nucleus and, after the blood cells analysis, six of then had presented neutrophils and eosinophils with nuclei characteristic of the heterozygotes form of the Pelger...

  5. Névtani kérdések a nyest.hu-n. [Onomastic questions on nyest.hu website

    Directory of Open Access Journals (Sweden)

    Haindrich, Helga Anna

    2013-12-01

    Full Text Available Since the 1st of June 2009, members of the general public have been able to visit a Hungarian website focusing on national and international news and events concerning Linguistic Studies. The portal classifies the current news according to their topics; thus, writings on onomastic questions can be found under the heading Proper Names. Most relevant articles deal with place names; other writings – in order of decreasing frequency – discuss personal names, names for institutions, names for animals, names for artefacts, and trade names. The portal not only shares news and knowledge, but also offers services such as a help desk for problems in translation, text ergonomics and Linguistics. The opportunity to comment on articles and launch forums or blogs to initiate a discourse on topical issues is also provided by the webmaster. The website, by presenting interesting news and topics in connection with proper names, plays a vital role in disseminating factual knowledge relating to Onomastics.

  6. Economical and Political Transformations - Latvia's Case / Lembit Ebre

    Index Scriptorium Estoniae

    Ebre, Lembit

    1999-01-01

    Juris Dreifeldsi raamatust "Latvia in transition" ja Marja Nissineni raamatust "Latvia's transition to a market economy". Läti poliitiline ja majanduslik areng. Tabel: Ettevõtete omanike jaotus rahvuste järgi

  7. Vene riiklik pank noolib tublit tükki Saksa Opelis / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2009-01-01

    Kanada autoosade tootja Magna, Belgia päritolu investor RHI International ja Beijing Automotive Industries tahavad General Motorsilt osta enamusosalust Saksa autotootjas Opel. Magna, kelle pakkumises osaleb Venemaa riiklik Sberbank, soovib endale intellektuaalset omandit ja jaotusõigusi Venemaal

  8. Estonija : objomõ rastut - profil menjajetsja / Dmitri Kulikov

    Index Scriptorium Estoniae

    Kulikov, Dmitri

    2007-01-01

    Eesti transport otsib uusi kasvuvõimalusi - Vene transiidi olulisus, lennujaama ja sadamate areng, konteiner- ja autoveod. Diagrammid: Kaubavedu raudtee kaudu 2002-2006, sadamate kaudu 1999-2006, rahvusvaheliste kaubavedude jaotus

  9. Kuidas hinnata äririske? / Mart Mere

    Index Scriptorium Estoniae

    Mere, Mart

    2006-01-01

    Marsh Kindlustusmaakler AS-i juhatuse esimees äritegevuses riskide teadvustamisest ja riskijuhtimisest. Skeem: Riskide jaotus ärikeskkonnas. Diagramm: Aktsiahinna languse peamised põhjused, 2001. a. Tabel: Ettevõtte riskitaluvus

  10. Eesti ettevõtete kaubavahetus tehnoloogilisuse vaatepunktist = Trade of Estonia's enterprises from point of view of technology / Riina Kerner

    Index Scriptorium Estoniae

    Kerner, Riina

    2011-01-01

    Tööstusharude jaotus tehnoloogilise intensiivsuse järgi. Töötleva tööstuse kaubavahetuse areng ja statistika, teadlaste ja inseneride arv. Eesti võrdlus teiste Euroopa Liidu riikidega. Tabelid

  11. Tšernobõli katastroof oma silmaga / Uno Schultz

    Index Scriptorium Estoniae

    Schultz, Uno, 1956-

    2000-01-01

    Rootsi ajakirjaniku kohtumisest rakverelasega, kes 1986. aastal Tšernobõli aatomielektrijaama neljanda ploki plahvatuse tagajärgi likvideerima saadeti : Lisa: Tšernobõli saadetud meeste jaotus maakonniti ; Eestit ümbritsevad tuumaelektrijaamad

  12. Personaalne Varahaldus pakub usaldussuhet / Tiit Efert

    Index Scriptorium Estoniae

    Efert, Tiit, 1976-

    2004-01-01

    Ilmunud ka: Spekter (vene k.), 2004, nr. 1, lk. 8-9. Autor tutvustab Hansapanga poolt eraisikutele pakutavat Personaalse Varahalduse teenust. Kommenteerivad: Heino Harak ja Oleg Ossinovski. Diagramm: Personaalse Varahalduse investeeringute jaotus. Vt. samas: Kellele Personaalpangandus, kellele Võtmekliendipakkumine

  13. Linna asus parkimise korraldaja otsingule / Martin Šmutov

    Index Scriptorium Estoniae

    Šmutov, Martin

    2005-01-01

    Ilmunud ka: Tartu Postimees 12. september lk. 1. Tartu raad kuulutas välja riigihanke uue parkimiskorraldaja leidmiseks. Diagramm: Parkimise teenustasude ja viivistasude jaotus Tartus viimasel viiel aastal

  14. Kutseharidus Eestis - muutused ja arengutendentsid = Vocational education in Estonia - changes and trends / Meelis Aunap

    Index Scriptorium Estoniae

    Aunap, Meelis

    2007-01-01

    Eesti kutseharidussüsteemi kujundamise põhimõtted. Kutsehariduse seadusandlus, põhjalikumad ümberkorraldused, finantseerimine. Diagrammid: Kutsehariduse osatähtsus hariduskuludes, 1995-2004; Avaliku sektori hariduskulude jaotus, 1995-2004

  15. Hu et al., Afr J Tradit Complement Altern Med. (2016) 13(3):60-65 ...

    African Journals Online (AJOL)

    Pharmacy, Gansu University of traditional Chinese medicine, 35 Dingxi east Road, Lanzhou 730000, China ... supporting or inhibiting B cells to produce antibodies, promoting mitogen responses and producing cytokines and so on. It is the body to ... However, large dose, long processing time, inconvenience for carrying ...

  16. [Sex pheromone secondary components of Indian meal moth Plodia interpunctella in China. HU wenlil 2, DU].

    Science.gov (United States)

    Hu, Wenli; Du, Jiawei

    2005-09-01

    Indian meal moth Plodia interpunctella Hübner (Lepidoptera: Pyralidae) is considered as an important insect pest infesting stored grains and other products in China. The major sex pheromone component of P. interpunctella, Z9, E12-14: OAc (TDA), has already been identified. Though the efficiency of male capture by using the bait with this component alone is quite good, the pheromone system is far from fully understood. The identification with capillary chromatographic analysis and GC-MS methods showed that there were four main components, i. e., Z9, E12-14: OAc(A), Z9, E12-14: OH (B), Z9, E12-14: Ald(C), and Z9-14: OAc(D), in the sex pheromone gland of female P. interpunctella, and the ratio of these four components was A: B: C:D= 100:22: 12:9. Wind tunnel experimental results suggested that the response of male P. interpunctella to a blend (A: B: C: D = 8:2:1:0.8) was not significantly different from that to female sex pheromone gland extracts.

  17. 1994 NASA-HU American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program

    Science.gov (United States)

    Spencer, John H. (Compiler); Young, Deborah B. (Compiler)

    1994-01-01

    Since 1964, the National Aeronautics and Space Administration (NASA) has supported a program of summer faculty fellowships for engineering and science educators. In a series of collaborations between NASA research and development centers and nearby universities, engineering faculty members spend 10 weeks working with professional peers on research. The Summer Faculty Program Committee of the American Society for Engineering Education supervises the programs. Objectives: (1) To further the professional knowledge of qualified engineering and science faculty members; (2) To stimulate and exchange ideas between participants and NASA; (3) To enrich and refresh the research and teaching activities of participants' institutions; (4) To contribute to the research objectives of the NASA center.

  18. 1998 NASA-HU American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program

    Science.gov (United States)

    Marable, William P. (Compiler); Murray, Deborah B. (Compiler)

    1998-01-01

    Since 1964, the National Aeronautics and Space Administration (NASA) has supported a program of summer faculty fellowships for engineering and science educators. In a series of collaborations between NASA research and development centers and nearby universities, engineering faculty members spend 10 weeks working with professional peers on research. The Summer Faculty Program Committee of the American Society for Engineering Education supervises the programs. The program objectives include: (1) To further the professional knowledge of qualified engineering and science faculty members; (2) To stimulate and exchange ideas between participants and NASA; (3) To enrich and refresh the research and teaching activities of participants' institutions; (4) To contribute to the research objectives of the NASA center. College or university faculty members will be appointed as Research Fellows to spend 10 weeks in cooperative research and study at the NASA Langley Research Center. The Fellow will devote approximately 90 percent of the time to a research problem and the remaining time to a study program. The study program will consist of lectures and seminars on topics of interest or that are directly relevant to the Fellows' research topics. The lecture and seminar leaders will be distinguished scientists and engineers from NASA, education, and industry.

  19. 2000 NASA-HU American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program

    Science.gov (United States)

    Marable, William P. (Compiler); Murray, Deborah B. (Compiler); Hathaway, Roger A. (Technical Monitor)

    2000-01-01

    Since 1964, the National Aeronautics and Space Administration (NASA) has supported a program of summer faculty fellowships for engineering and science educators. In a series of collaborations between NASA research and development centers and nearby universities, engineering faculty members spend ten weeks working with professional peers on research. The Summer Faculty Program Committee of the American Society for Engineering Education supervises the programs. The objectives are: (1) to further the professional knowledge of qualified engineering and science faculty members; (2) to stimulate and exchange ideas between participants and NASA; (3) to enrich and refresh the research and teaching activities of participants' institutions; and (4) to contribute to the research objectives of the NASA center. College or university faculty members will be appointed as Research Fellows to spend ten weeks in cooperative research and study at the NASA Langley Research Center. The Fellow will devote approximately 90 percent of the time to a research problem and the remaining time to a study program. The study program will consist of lectures and seminars on topics of interest or that are directly relevant to the Fellows' research topics. The lecture and seminar leaders will be distinguished scientists and engineers from NASA, education, and industry. A list of the abstracts of the presentations is provided.

  20. Huéspedes definitivos de Spirometra mansonoides (Cestoda, Diphyllobothriidae en el Perú

    Directory of Open Access Journals (Sweden)

    Manuel Tantaleán

    2013-05-01

    Full Text Available Se realizó un estudio parasitológico en el zoológico Parque de Las Leyendas, Lima, Perú en el año de 1993. Se recolectaron 49 muestras de heces de carnívoros pertenecientes a cinco familias: Canidae, Ursidae, Procyonidae, Mustelidae y Felidae, éstas fueron procesadas usando métodos rutinarios para la búsqueda de huevos de helmintos. En las heces de tres especies de la familia Felidae, Puma concolor (puma andino y puma de la selva, Panthera onca (otorongo y Leopardus pardalis (tigrillo se identificaron huevos de Spirometra mansonoides.

  1. Assessing the People’s Liberation Army in the Hu Jintao Era

    Science.gov (United States)

    2014-04-01

    destabilizing element’…farmers, workers, even the homeless , get looked after. But we don’t have anyone to stand up for us. In the month prior to the 80th...General Guo Boxiong: — May 2009: Turkey, Germany, Finland — November 2009: Russia — May 2010: Australia , New Zealand, and Indonesia...General Staff General Chen Bingde — October 2009: Australia (12th Defense and Strategic Consultations) and Papua New Guinea — May 2010: Namibia

  2. HuMiChip: Development of a Functional Gene Array for the Study of Human Microbiomes

    Energy Technology Data Exchange (ETDEWEB)

    Tu, Q.; Deng, Ye; Lin, Lu; Hemme, Chris L.; He, Zhili; Zhou, Jizhong

    2010-05-17

    Microbiomes play very important roles in terms of nutrition, health and disease by interacting with their hosts. Based on sequence data currently available in public domains, we have developed a functional gene array to monitor both organismal and functional gene profiles of normal microbiota in human and mouse hosts, and such an array is called human and mouse microbiota array, HMM-Chip. First, seed sequences were identified from KEGG databases, and used to construct a seed database (seedDB) containing 136 gene families in 19 metabolic pathways closely related to human and mouse microbiomes. Second, a mother database (motherDB) was constructed with 81 genomes of bacterial strains with 54 from gut and 27 from oral environments, and 16 metagenomes, and used for selection of genes and probe design. Gene prediction was performed by Glimmer3 for bacterial genomes, and by the Metagene program for metagenomes. In total, 228,240 and 801,599 genes were identified for bacterial genomes and metagenomes, respectively. Then the motherDB was searched against the seedDB using the HMMer program, and gene sequences in the motherDB that were highly homologous with seed sequences in the seedDB were used for probe design by the CommOligo software. Different degrees of specific probes, including gene-specific, inclusive and exclusive group-specific probes were selected. All candidate probes were checked against the motherDB and NCBI databases for specificity. Finally, 7,763 probes covering 91.2percent (12,601 out of 13,814) HMMer confirmed sequences from 75 bacterial genomes and 16 metagenomes were selected. This developed HMM-Chip is able to detect the diversity and abundance of functional genes, the gene expression of microbial communities, and potentially, the interactions of microorganisms and their hosts.

  3. Page 1 142 Tian-Hu Yu, Sanjit K Mitra and Hrvoje Babic Table 1 ...

    Indian Academy of Sciences (India)

    To run the optimization procedures for the notch filter design, it is very useful to estimate a priori, the filter length N and number (Q–1) of transition samples, from the designed filter specifications, such as the bandwidth A0) and the attenuation A. To estimate Q from the desired attenuation, table 1 can be used. This table is ...

  4. Further considerations on the phonetics and morphologizations of Hi and Hu̯ in Indoeuropean

    Directory of Open Access Journals (Sweden)

    Francisco R. Adrados

    1981-12-01

    Full Text Available The author puts up to date his ideas on Indo-European Laryngeals, which have been published from 1956 onwards. He takes into account new materials as well as new proposals about the most difficult points. He starts exposing some General Phonetics facts which favor his theory and then he offers some new evidence from Anatolian languages which enlarge our knowledge of Indo-European Laryngeals. Then he explains minutely the different treatments of Laryngeals in Post-Anatolian Indo-European, arriving frequently to more economical and simple solutions. The paper ends with a synopsis of the treatments of the six Laryngeals (three with a palatal appendix and three with a labial one in Indo-European.

  5. Power Consumption Considerations of GSM-connected Sensors in the AgroDat.hu Sensor Network

    Directory of Open Access Journals (Sweden)

    Gábor Paller

    2015-06-01

    Full Text Available The number of large sensor systems is rapidly growing nowadays in many fields. Well-designed Big Data solutions are able to manage the enormous data flow and create real business benefits. One dynamically growing application area is precision farming. It requires robust and energy- efficient sensors, because the devices are placed outdoors, often in harsh conditions, and there is no power outlet “in the middle of a corn field”. Power efficiency is in general one of the major themes of the Internet of Things (IoT. According to the IoT vision, embedded sensors send their data to processing units (either located near to the sensor or on some intermediate ”gateway” device or in the cloud using heterogeneous transport networks. Some sensors employ short-range network like Bluetooth and some ”gateway” device like a tablet. Other sensors directly connect to wide-area networks like cellular networks. This paper will analyze different communication patterns accomplished over GSM network from the viewpoint of the energy consumption of the sensor device with the assumption that the sensor is stationary. The measurements were done using two different GSM modems designed for embedded systems to ensure that the results represent a wider picture and not some implementation property of a particular GSM modem. Recommendations are given about the strategies applications should follow in order to minimize the energy consumption of their GSM subsystems.

  6. Reporting of Human Genome Epidemiology (HuGE association studies: An empirical assessment

    Directory of Open Access Journals (Sweden)

    Gwinn Marta

    2008-05-01

    Full Text Available Abstract Background Several thousand human genome epidemiology association studies are published every year investigating the relationship between common genetic variants and diverse phenotypes. Transparent reporting of study methods and results allows readers to better assess the validity of study findings. Here, we document reporting practices of human genome epidemiology studies. Methods Articles were randomly selected from a continuously updated database of human genome epidemiology association studies to be representative of genetic epidemiology literature. The main analysis evaluated 315 articles published in 2001–2003. For a comparative update, we evaluated 28 more recent articles published in 2006, focusing on issues that were poorly reported in 2001–2003. Results During both time periods, most studies comprised relatively small study populations and examined one or more genetic variants within a single gene. Articles were inconsistent in reporting the data needed to assess selection bias and the methods used to minimize misclassification (of the genotype, outcome, and environmental exposure or to identify population stratification. Statistical power, the use of unrelated study participants, and the use of replicate samples were reported more often in articles published during 2006 when compared with the earlier sample. Conclusion We conclude that many items needed to assess error and bias in human genome epidemiology association studies are not consistently reported. Although some improvements were seen over time, reporting guidelines and online supplemental material may help enhance the transparency of this literature.

  7. Impact Analysis of Peng-Hu Power System Connected with a Photovoltaic System

    DEFF Research Database (Denmark)

    Wang, Li; Nguyen, Ha Thi; Yan, Chih-Hao

    2014-01-01

    With the rapid increase of photovoltaic (PV) systems installed in power systems in the recent years, the negative impacts on power quality of distribution networks due to highpenetration PV systems can be increased. This paper presents the system-impact analyzed results of a 0.6-MW PV system conn...... the simulation software of EMTP-RV. The simulated results indicate that the voltage deviations at the point of common coupling (PCC) can be well maintained to meet the grid code of Taiwan Power System under various operating conditions....

  8. vénérolo ogie du CH HU Ibn

    African Journals Online (AJOL)

    raoul

    bn Sina a po e la santé a ermatoses en pective mené nts hospitali ant la périod on Rabat – les maladies ermatoses du i peut être ju ongue prise ons cutanées n charge .... De nombreux facteurs génétiques, endocriniens, ... paranéoplasique sont les hémopathies malignes, le cancer du sein chez la femme et les cancers.

  9. Estudo da anomalia de Pelger-Huët em núcleo familiar

    National Research Council Canada - National Science Library

    Patrícia H. O. Calderan; Dimas J. Campiolo; Omar S.G. Saavedra; Cláudia R. Bonini-Domingos

    2008-01-01

    .... We evaluate eleven members of a familiar nucleus and, after the blood cells analysis, six of then had presented neutrophils and eosinophils with nuclei characteristic of the heterozygotes form of the Pelger...

  10. Impacts of elevated ozone on growth and photosynthesis of Metasequoia glyptostroboides Hu et Cheng.

    Science.gov (United States)

    Zhang, Weiwei; Feng, Zhaozhong; Wang, Xiaoke; Niu, Junfeng

    2014-09-01

    One-year-old Metasequoia glyptostroboides seedlings were exposed to non-filtered ambient air (NF) and elevated ozone (E-O3, NF+60 ppb) in open-top chambers for two years. E-O3 accelerated leaf senescence, as indicated by significant decreases in photosynthetic pigment contents with the elongation of O3 exposure. E-O3 significantly affected gas exchange and carboxylation, inducing reductions in light-saturated photosynthesis (Asat), the maximum activity of Rubisco (Vc,max) and the maximum electron transport rate (Jmax). Chl a/b, Vc,max/Jmax and stomatal limitation (l) were not affected. Stomatal conductance (gs) was significantly decreased by E-O3 in the first year, but remained unchanged in the second year. It can be inferred that the decrease in Asat by E-O3 was mainly attributed to the changes in non-stomatal factors. After two years' exposure, E-O3 caused significant decreases in canopy photosynthesis and leaf mass per area, and a significant increase in the number of branches, but induced slight, not significant decreases in growth and biomass. Therefore, it can be concluded that the carbon accumulation of the species M. glyptostroboides could be negatively affected after long-term exposure to high O3 concentration. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

  11. World Energy Data System (WENDS). Volume VIII. Nuclear facility profiles, CO--HU. [Brief tabulated information

    Energy Technology Data Exchange (ETDEWEB)

    1979-06-01

    In this compendium each profile of a nuclear facility is a capsule summary of pertinent facts regarding that particular installation. The facilities described include the entire fuel cycle in the broadest sense, encompassing resource recovery through waste management. Power plants and all US facilities have been excluded. To facilitate comparison the profiles have been recorded in a standard format. Because of the breadth of the undertaking some data fields do not apply to the establishment under discussion and accordingly are blank. The set of nuclear facility profiles occupies four volumes; the profiles are ordered by country name, and then by facility code. Each nuclear facility profile volume contains two complete indexes to the information. The first index aggregates the facilities alphabetically by country. It is further organized by category of facility, and then by the four-character facility code. It provides a quick summary of the nuclear energy capability or interest in each country and also an identifier, the facility code, which can be used to access the information contained in the profile.

  12. Frecuencia de enfermedades huérfanas en Cartagena de Indias, Colombia

    National Research Council Canada - National Science Library

    Dacia Isabel Malambo-Garcia, Rossana Lopez-Saleme, Gustavo Jose Mora-Garcia, Enrique Ramos-Clason, Enrique Mazenett-Granados, Diego Ernesto Herrera-Malambo, Doris Gomez-Camargo

    2016-01-01

    ... en los Códigos Internacionales de Enfermedad (CIE10). Resultados En total se registraron 522 181 personas que consultaron al sistema de salud. El 0,8 % (n=16 527) tuvieron algún diagnóstico Q...

  13. Human remains from Valdegoba Cave (Huérmeces, Burgos, Spain)

    OpenAIRE

    Quam, R.; Arsuaga, Juan Luis; Bermúdez de Castro, José María; Díez Fernández-Lomana, Juan Carlos; Lorenzo Merino, Carlos; Carretero, José Miguel; García García, Nuria; Ortega Martínez, Ana Isabel

    2001-01-01

    Systematic excavations, begun in 1987, at the Valdegoba cave site in northern Spain have yielded the remains of five individuals associated with a Middle Paleolithic stone tool technology and Pleistocene fauna. A fragmentary mandible of an adolescent (VB1), preserving nearly a full set of teeth, exhibits a symphyseal tubercle and slight incurvatio mandibulae anterior on the external symphysis. Both the superior and inferior transverse tori are present on the internal aspect....

  14. Microvariability Detection of Mrk 421 Xu Chen, Shao Ming Hu & Di ...

    Indian Academy of Sciences (India)

    School of Space Science and Physics, Shandong University, 180 Cultural West Road,. Weihai, Shandong 264209, China. ∗ e-mail: husm@sdu.edu.cn. Abstract. BL Lac ... but no significant microvariability was detected during our observations. Key words. AGN—HBL—Mrk 421—microvariability. 1. Introduction. The BL Lac ...

  15. Leptospirosis en Colecciones Zoológicas y sus Potenciales Huéspedes

    OpenAIRE

    Diana Mora-Bustamante; Diego Soler-Tovar; P Hernández-Rodríguez

    2014-01-01

    Leptospirosis es un problema de salud pública que afecta especialmente a los países en desarrollo debido a factores climáticos y a problemas con el saneamiento básico. La falta de información por parte del público en general y de los profesionales de la salud con respecto a la leptospirosis es un problema, debido a que no se toman medidas adecuadas para su prevención y  control. Los animales silvestres y las colecciones zoológicas juegan un papel importante en la posible transmisión y disemin...

  16. ?Hu Hong? (bad thing): parental perceptions of teenagers? sexuality in urban Vietnam

    OpenAIRE

    Lan Anh Thi Do; Pimpawun Boonmongkon; Seung Chun Paek; Guadamuz, Thomas E.

    2017-01-01

    Abstract Background Teenagers under 18 years old in Vietnam are considered as minors who usually lack the autonomy to make decisions. They are also sometimes viewed as contributors to social evils including crime, violence and substance use. Moreover, most Vietnamese teenagers have unsafe sex before marriage. The objective of this study is to explore the parental perceptions relating to their teenagers’ sexuality, particularly the social and cultural forces, that may hinder access to sexualit...

  17. Page 1 Hu TropJ ObstetGynaecol, 18 (2), October 2001. A Review of ...

    African Journals Online (AJOL)

    Results: Seventy-seven Rh-negative pregnancies were managed, accounting for 2.6% of the total obstetric population. Those who received immuno-prophylaxis following previous abortions ... Data entry was done with dBase IV software. Data analysis was done with SAS software. Comparisons of means were done with ...

  18. Xiao-Chai-Hu Tang in treating model mice with D-Galactosamine ...

    African Journals Online (AJOL)

    Both of XCHT and biphenyl dicarboxylate significantly decreased the serum IL-6 and TNF-á levels and FasmRNA, FasLmRNA, Bax protein expression and increased the Bcl-2 mRNA expression of the liver tissues of model mice (P<0.05). It may be through decreasing the serum IL-6 and TNF-á levels and FasmRNA, ...

  19. Sledování průběhu malolaktické fermentace

    OpenAIRE

    Štětkářová, Lucie

    2014-01-01

    Malolactic fermentation (MLF), or malolactic fermentation is a process which converts Malic acid to lactic acid. Made with lactic fermentation bacteria. There are different kinds of lactic acid bacteria -- positive (Oenococcus oeni) and negative (Lactobacillus, Pediococcus). Malolactic fermentation on wine by reducing acidity, improves the stability of microbial and sensory properties of wine. Malolactic fermentation we can perform before the alcoholic fermentation, during alcoholic fermentat...

  20. Hüseyin Nail Kubali and Durkheim’s Professional ethics and civic morals

    Directory of Open Access Journals (Sweden)

    Ivan Strenski

    2006-01-01

    Full Text Available A swirl of puzzles surrounds a work of Émile Durkheim’s that Jonathan Z. Smith claims is the ‘single most provocative treatment of’ the idea of the sacred in the Durkheimian corpus – Professional Ethics and Civic Morals. Why, one asks, was Durkheim’s work first published in Turkey, especially when the lectures that gave rise to this volume had been delivered in France in the early years of the twentieth century? Of what particular importance was Durkheim for modern Turkish thinkers, and what kinds of thinkers might they be? And, what of this particular work of Durkheim’s? What special purpose, moreover, might have been served by publishing it in Turkey when it was – in 1950? Why was the volume edited by (and who was? Hüseyin Nail Kubali? What were his motives – both of a scientific kind or of a wider social or political sort? These are the questions that are addressed in this article. As readers will discover, in answering them, a nest of hidden themes is uncovered – a nest that few readers – even those who know the Durkheim corpus – will have anticipated. Not only are Durkheimian interpretations of religion at issue, but also the particular bearing of Durkheimianism on modern Turkey. This link with modern Turkey, in turn, brings to the surface many of the controversial questions now vexing the European Union as it ponders the possibility of Turkish membership of the EU – questions of human rights, civil society, the rule of law, the relation of religion and state, to name just the most relevant to the content of this article.

  1. Možnosti fyzioterapie v průběhu gravidity

    OpenAIRE

    Palacká, Klára

    2016-01-01

    Title: Possibilities of physiotherapy in pregnancy Objectives: The aim of this study is to create a comprehensive overview of current knowledge concerning the issue of pregnancy from the point of view of a physiotherapist. Literature resources will be collected in order to provide information about the frequent difficulties of pregnant women in the context of the musculoskeletal system and their possible treatment by physiotherapy and also about physical activity during pregnancy. Methods: Th...

  2. Oxidation of M252 but not M428 in hu-IgG1 is responsible for decreased binding to and activation of hu-FcγRIIa (His131).

    Science.gov (United States)

    Cymer, Florian; Thomann, Marco; Wegele, Harald; Avenal, Cecile; Schlothauer, Tilman; Gygax, Daniel; Beck, Hermann

    2017-11-01

    Oxidation of monoclonal therapeutic antibodies (mAbs) can affect binding to Fc-receptors and potentially influence pharmacokinetics or effector functions like e.g. antibody dependent cellular phagocytosis (ADCP). Recently, it has been demonstrated that binding to FcγRIIa (H131) is affected by methionine oxidation of the Fc-portion but it is currently unknown which methionine is responsible for decreased binding. We separated an oxidized IgG1 monoclonal antibody based on the oxidation state of methionine 252 and analyzed fractionated material in receptor binding experiments as well as in functional (cell-based) assays. Although the unfractionated mixture demonstrated weaker interaction/activation of the receptor, differently oxidized isolated subspecies can lead both to stronger as well as weaker binding and activation of the histidine variant of FcγRIIa. Copyright © 2017 The Authors. Published by Elsevier Ltd.. All rights reserved.

  3. Quality control for the equipment of Nuclear medicine: experience of the H.U. de la Princesa; Control de calidad del equipamiento en Medicina Nuclear. Experiencia enel H.U. de la Princesa

    Energy Technology Data Exchange (ETDEWEB)

    Espana, M.L.; Gracia, A.; Prieto, C.; Lopez F, P. [Servicio de ProteccionRadiologica. Hospital Universitario de la Princesa C/ Diego de Leon 62, 28006Madrid (Spain)

    1998-12-31

    The quality control of the equipment used in a nuclear medicine service is a fundamental aspect in the Quality Assurance Program that in the present time is starting in our hospital. the objective of this work is to present the internal protocol used, its problematic associated with its starting, and the results obtained in the quality control as of the gamma camera as of the activimeter. In addition to the equipment own to the nuclear medicine service it has been used a Cs-137 source and puppets for several purposes. The results obtained demonstrated the stability of the controlled parameters which has led us to a restating of the established periodicities in our internal protocol, over all for some constancy tests. (Author)

  4. Proteasome inhibition reduces superantigen-mediated T cell activation and the severity of psoriasis in a SCID-hu model

    OpenAIRE

    Zollner, Thomas M.; Podda, Maurizio; Pien, Christine; Elliott, Peter J.; Kaufmann, Roland; Boehncke, Wolf-Henning

    2002-01-01

    There is increasing evidence that bacterial superantigens contribute to inflammation and T cell responses in psoriasis. Psoriatic inflammation entails a complex series of inductive and effector processes that require the regulated expression of various proinflammatory genes, many of which require NF-κB for maximal trans-activation. PS-519 is a potent and selective proteasome inhibitor based upon the naturally occurring compound lactacystin, which inhibits NF-κB activation by blocking the degr...

  5. Strengthening institutions or institutionalising weaknesses? : interactions between aid and institutions in Huíla Province, Angola

    NARCIS (Netherlands)

    Serrano, M.M.

    2012-01-01

    This research analyses the interaction between aid interventions and local institutions through which people address needs during crisis. These include state and non- state institutions involved in social assistance and in the delivery of basic services such as healthcare. The study focuses on the

  6. Introduction to Computational Chemistry: Teaching Hu¨ckel Molecular Orbital Theory Using an Excel Workbook for Matrix Diagonalization

    Science.gov (United States)

    Litofsky, Joshua; Viswanathan, Rama

    2015-01-01

    Matrix diagonalization, the key technique at the heart of modern computational chemistry for the numerical solution of the Schrödinger equation, can be easily introduced in the physical chemistry curriculum in a pedagogical context using simple Hückel molecular orbital theory for p bonding in molecules. We present details and results of…

  7. Entomofauna asociada con la Cocona (Solanum sessiliflorum dunal) en Tingo María, Huánuco

    OpenAIRE

    Anteparra M., E.; Ruiz S., M.; Granados L., B.; Díaz W., C.

    2016-01-01

    El trabajo forma parte de las memorias del I Encuentro de Investigadores Ambientales: Avances de la Investigación Ambiental en la Región Amazonas, desarrollado del 12 al 13 de diciembre del 2012 en la ciudad de Iquitos. Tiene por finalidad dar a conocer los diferentes artrópodos que están asociados con la parte aérea de este cultivo, a fin de poder establecer estrategias de manejo dentro del cultivo de la cocona. Se han colectado cincuenta especies de insectos asociadas con la cocona. Se han ...

  8. La escritura huérfana: Miguel Romero Esteo o la sublimidad del grotesco en la última vanguardia

    Directory of Open Access Journals (Sweden)

    Cornago Bernal, Óscar

    2002-06-01

    Full Text Available This paper analyzes Romero Esteo's work from a cultural and aesthetic background rarely founded in the peninsular hispanic studies, in spite of being the appropiate one regarding his times. This complex theoretical frame, which has been related afterwards to diverse currents as Posestructuralism, the «New Left» and «Postmodernity», began to be developed in Europe during the sixties. Among the main names of these tendencies, who are the basis for my present approach, Michel Foucault, Roland Barthes, Jacques Derrida, Jean-François Lyotard, Gille Deleuze y Felix Guattari, Jean Baudrillard, Umberto Eco o Eugenio Trías are included. Starting from this wide corpus of aesthetic philosophy, which is going to be given an unitary interpretation through a consideration of the barroque condition of contemporary culture —reconsidering the theory of alegory by Benjamin—, this study intends to understand the specifity of an aesthetic project of great originality as well as the cultural background where it has risen.Este estudio analiza la obra de Miguel Romero Esteo desde un contexto cultural y estético escasamente transitado en el hispanismo peninsular, pero que es, sin embargo, el que le corresponde por generación histórica. Este complejo marco teórico, que ha sido relacionado posteriormente con corrientes diversas como el Posestructuralismo, la «nueva izquierda » o la Posmodernidad, comenzó a desarrollarse en Europa a medida que avanzaban los años sesenta. Entre los nombres que lo han protagonizado, y que son la base de este trabajo, se incluyen Michel Foucault, Roland Barthes, Jacques Derrida, Jean-François Lyotard, Gille Deleuze y Felix Guattari, Jean Baudrillard, Umberto Eco o Eugenio Trías. A partir de este amplio corpus de filosofia estética, al que se le dará una lectura unitaria mediante la condición barroca de la cultura actual —recuperando la teoría de la alegoría de Benjamin—, se trata de entender la especificidad que caracteriza tanto un proyecto estético de gran originalidad como del medio cultural que lo vio nacer.

  9. Effects of Explant Source and Dark-preconditioning on Adventitious Bud Formation in Neofinetia falcata H. H. Hu in vitro

    National Research Council Canada - National Science Library

    箕作, 和彦; 森, 源治郎; 淨閑, 正史; 三柴, 啓一郎; 森川, 利信; 小田, 雅行

    2009-01-01

    フウラン(Neofinetia falcata H. H. Hu)の中でも観賞価値の高い品種は,形質が分離する種子繁殖ではなく,栄養繁殖が行われている.しかし,その増殖率は低い.そこで,幼植物の組織培養による増殖効率の向上について検討した.まず,無菌播種して形成したプロトコームを上下に 2...

  10. Trinidad y Pascua en la teología de H-U. von Balthasar y J. Moltmann

    Directory of Open Access Journals (Sweden)

    Eloy Bueno de la Fuente

    2015-06-01

    Full Text Available The rediscovery of the Trinity and the Easter constitutes one of the most important phenomena of the last century theology, especially when it emphasises the intimate connection between both of them. Magnificent examples of this are von Balthasar and Moltmann’s theological projects. However, in these writers, the primacy that is attributed to the cross does not permit to perceive clearly the role and the sense of the resurrection of Jesus.

  11. The efficacy of darbepoetin alpha in hemodialysis patients resistant to human recombinant erythropoietin (rHuEpo

    Directory of Open Access Journals (Sweden)

    Hejaili Fayez

    2009-01-01

    Full Text Available Darbepoetin due to longer half life is convenient and effective for long term. This study was done to assess the efficacy of darbepoetin in the treatment of patients on high doses of erythropoietin (EPO and to compare its efficacy in patients resistant and responsive to EPO. This is a prospective, controlled open label study assessing the efficacy of darbepoetin in 55 hemodialysis patients on high dose EPO and comparing its efficacy in the patients who were "EPO -resistant" (group 1, n= 28 and in those who were "EPO-responsive" (group 2, n= 27. The initial conversion ratio was 380 mcg darbepoetin: 1 U EPO/ week and the dose of darbepoetin was adjusted thereafter at fortnightly intervals with the aim of achieving and maintaining the hemoglobin level between 11-12 g/dL. The patients were followed up for 12 weeks following the introduction of darbepoetin. The impact of gender, baseline PTH, age, Kt/V, duration on dialysis, initial EPO dose on the response to darbepoetin was investigated. Continuous variables were compared using two tailed t-test and non-parametric by Fisher exact test. Overall darbepoetin was effective with 85.5 % of the patients responding and 21.8 % of the patients′ able to maintain their hemoglobin with once fortnightly dose by the end of the study. Mean darbepoetin dose and the mean EPO to darbepoetin conversion ratio on completion of the study were 58.2 (42.4 mcg/week (0.983 (0.87 mcg/kg/week and 384:1 respectively. Hemoglobin levels in groups 1 improved from 9.8 ± 0.9 g/dL to 12.0 ± 1.4 g/dL (0.0001 and 2 were and maintained it in group 2 at 11.9 ± 1.3 g/dL (P= 0.79. The doses of darbepoetin required in groups 1 and 2 were similar (54.3 ± 33 and 53.9 ± 47 mcg/week (P= 0.97 respectively and 0.89 ± 0.6 and 0.98 ± 1.0 mcg/kg/week (P= 0.8. 22 (78.6 % of the EPO resistant patients responded to darbepoetin. In conclusion conversion from high dose EPO to darbepoetin proved successful even in patients who were resistant to EPO. The darbepoetin dose required in the EPO resistant and EPO responsive groups did not differ significantly and age, duration on dialysis and baseline PTH level had no impact on responsiveness to EPO or darbepoetin.

  12. Řízení průběhu zakázky organizací

    OpenAIRE

    Sedláčková, Martina

    2008-01-01

    Diplomová práce analyzuje logistický proces ve společnosti SVOBODA-výroba domácích knedlíků s.r.o. Obsahuje studie logistických koncepcí, které pomohou v budování zákaznicky orientované firmy a k proniknutí na zahraniční trh. This diploma work analyses logistic process in the company SVOBODA-výroba domácích knedlíků s.r.o. It includes studies of logistic conceptions, that help at building of customer-orientated company and pervasion to the foreign marketplace. B

  13. Boaventura de Sousa Santos, El milenio huérfano. Ensayos para una nueva cultura política

    Directory of Open Access Journals (Sweden)

    Juan José Tamayo

    2012-10-01

    Full Text Available El científico social como excavador ¿Por qué resulta tan difícil hoy construir teorías y ciencias sociales críticas, cuando hay tanto que criticar, cuando cada vez son más las situaciones que suscitan incomodidad, más aún, indignación, y deberían llevar al inconformismo, cuando las grandes promesas de la libertad, la igualdad y la paz perpetua de la modernidad quedaron sin cumplir y, cuando la realización de algunas promesas como la de dominar la naturaleza, ha tenido consecuencias tan perver...

  14. Expression of LMP and EBNA genes in Epstein-Barr virus-associated lymphomas in Hu-PBL/SCID mice.

    Science.gov (United States)

    Tang, Yunlian; Lu, Suli; Gan, Xiaoning; Liu, Fang; Zhang, Yang; Luo, Chunyan; Pan, Yuxia; Hong, Li; Gan, Ruliang

    2016-02-01

    Transplantation of peripheral blood lymphocytes (PBLs) from healthy humans with latent Epstein-Barr virus (EBV) infection into severe combined immunodeficiency (SCID) mice results in development of EBV-associated human B-cell lymphoma. However, the expression of EBV genes in relation to lymphoma development has not been reported. We investigated latent membrane protein (LMP) and EBV nuclear antigen (EBNA) gene expression in PBLs from EBV-positive blood donors and induced-lymphoma cells from SCID mice to elucidate the functions and effects of the EBV genome in the occurrence and development of lymphoma. PBLs were isolated from 9 healthy blood donors and transplanted into SCID mice. Gene expression levels of LMP-1, LMP-2A, and LMP-2B and EBNA-1, EBNA-2, EBNA-3A, EBNA-3B, EBNA-3C and EBNA-LP were monitored by real-time quantitative-polymerase chain reaction (qRT-PCR) in cells from nine EBV-induced lymphomas and in matched lymphocytes from healthy subjects. LMP-1, EBNA-1 and EBNA-2 protein levels were detected by western blotting. As a result, LMP-1, LMP-2A and LMP-2B mRNA levels were upregulated 256-, 38- and 331-fold, respectively, in the EBV-induced lymphoma cells compared with the controls, while EBNA-1 and EBNA-3A mRNA levels were upregulated 1157- and 1154-fold, respectively. EBNA-2, EBNA-3B, EBNA-3C and EBNA-LP mRNAs were detected in lymphoma cells, but not in lymphocytes from EBV-positive blood donors. LMP-1 and EBNA-2 proteins were not expressed in lymphocytes from EBV-positive blood donors, according to western blotting. Weak EBNA-1 expression was observed in lymphocytes from blood donors with latent EBV infection, while LMP-1, EBNA-1 and EBNA-2 protein levels were significantly upregulated in EBV-induced lymphoma cells, consistent with mRNA expression levels detected by qRT-PCR. In conclusion, LMP-1, LMP-2A, LMP-2B, EBNA-1 and EBNA-3A were upregulated in EBV-induced lymphoma cells, while EBNA-2, EBNA-3B, EBNA-3C and EBNA-LP were absent in lymphocytes from humans with latent EBV infection, but were positively expressed in EBV-induced lymphoma cells.

  15. Meta- and pooled analysis of GSTP1 polymorphism and lung cancer: a HuGE-GSEC review.

    Science.gov (United States)

    Cote, Michele L; Chen, Wei; Smith, Daryn W; Benhamou, Simone; Bouchardy, Christine; Butkiewicz, Dorota; Fong, Kwun M; Gené, Manuel; Hirvonen, Ari; Kiyohara, Chikako; Larsen, Jill E; Lin, Pinpin; Raaschou-Nielsen, Ole; Povey, Andrew C; Reszka, Edyta; Risch, Angela; Schneider, Joachim; Schwartz, Ann G; Sorensen, Mette; To-Figueras, Jordi; Tokudome, Shinkan; Pu, Yuepu; Yang, Ping; Wenzlaff, Angela S; Wikman, Harriet; Taioli, Emanuela

    2009-04-01

    Lung cancer is the most common cancer worldwide. Polymorphisms in genes associated with carcinogen metabolism may modulate risk of disease. Glutathione S-transferase pi (GSTP1) detoxifies polycyclic aromatic hydrocarbons found in cigarette smoke and is the most highly expressed glutathione S-transferase in lung tissue. A polymorphism in the GSTP1 gene, an A-to-G transition in exon 5 (Ile105Val, 313A --> 313G), results in lower activity among individuals who carry the valine allele. The authors present a meta- and a pooled analysis of case-control studies that examined the association between this polymorphism in GSTP1 and lung cancer risk (27 studies, 8,322 cases and 8,844 controls and 15 studies, 4,282 cases and 5,032 controls, respectively). Overall, the meta-analysis found no significant association between lung cancer risk and the GSTP1 exon 5 polymorphism. In the pooled analysis, there was an overall association (odds ratio = 1.11, 95% confidence interval: 1.03, 1.21) between lung cancer and carriage of the GSTP1 Val/Val or Ile/Val genotype compared with those carrying the Ile/Ile genotype. Increased risk varied by histologic type in Asians. There appears to be evidence for interaction between amount of smoking, the GSTP1 exon 5 polymorphism, and risk of lung cancer in whites.

  16. Profile of Patients of the Auditory Health of the State of Santa Catarina Served at HU-UFSC

    Directory of Open Access Journals (Sweden)

    Dimatos, Oscar Cardoso

    2011-01-01

    Full Text Available Introduction: Hearing is one of the essential functions for the development of language and its deficiency may lead to several consequences. Objective: To describe the profile of patients of the Hearing Health Program of the State of Santa Catarina attended at the College Hospital of the Federal University of Santa Catarina. Method:We performed a retrospective study with the patients with hearing aid indication attended in the years 2007 and 2008. They were divided into 2 groups: children ( 18 years. We assessed the following: age, sex, loss type and degree, duration, co-morbidity and probable etiology. Results: 304 reports were reviewed, 10.2% of the children group and 80.8% of the adult group. In the children group, the mean age was of 7.7±5,4 years, with 58.06% boys and 41.94% girls, and in the adult group the mean age was of 61±16 years, with 52.38% women and 47.62% men. The neurosensorial hearing loss was found more frequently in both groups. In the children group, the severe degree loss was more frequent, and in the adult group, the moderate and moderate to severe degrees were more frequent. The main etiologies were genetic/unknown causes in the children group and presbycusis in the adults group. Conclusion:In the children group, most was formed by boys with neurosensorial loss of light and severe degrees, duration > 1 year and without co-morbidities. In the adult group, most was formed by women with neurosensorial loss of moderate and moderate-severe degrees, duration > 5 year and with co-morbidities.

  17. Una experiencia de terapia grupal con niños abandonados y huérfanos en una aldea infantil

    Directory of Open Access Journals (Sweden)

    Rosa María Normand

    1987-06-01

    Full Text Available El presente artículo tiene como objetivo relatar los primeros ocho meses de una experiencia de terapia grupal que tendrá una duración total de 15 meses, en una aldea infantil que pertenece a la Fundación por los Niños del Perú. La técnica terapéutica aplicada se emplea en el Bearverbrook Guidance Center de la ciudad de Boston en EE.UU. de Norteamérica. El marco de referencia de esta posición es integracionista, incluyéndose autores como Anna Freud, Joseph Sandler, D.W. Winnicott, John Bowlby y Virginia Axline. Se trata de una primera experiencia, aún no concluída, pero que pensamos puede ser relatada por los importantes cambios observados en los niños tratados. Presentaremos un segundo artículo al finalizar los 15 meses del tratamiento.

  18. A HuGE Review and Meta-Analyses of Genetic Associations in New Onset Diabetes after Kidney Transplantation.

    Directory of Open Access Journals (Sweden)

    Katherine Angela Benson

    Full Text Available New onset diabetes after transplantation (NODAT is a serious complication following solid organ transplantation. There is a genetic contribution to NODAT and we have conducted comprehensive meta-analysis of available genetic data in kidney transplant populations.Relevant articles investigating the association between genetic markers and NODAT were identified by searching PubMed, Web of Science and Google Scholar. SNPs described in a minimum of three studies were included for analysis using a random effects model. The association between identified variants and NODAT was calculated at the per-study level to generate overall significance values and effect sizes.Searching the literature returned 4,147 citations. Within the 36 eligible articles identified, 18 genetic variants from 12 genes were considered for analysis. Of these, three were significantly associated with NODAT by meta-analysis at the 5% level of significance; CDKAL1 rs10946398 p = 0.006 OR = 1.43, 95% CI = 1.11-1.85 (n = 696 individuals, KCNQ1 rs2237892 p = 0.007 OR = 1.43, 95% CI = 1.10-1.86 (n = 1,270 individuals, and TCF7L2 rs7903146 p = 0.01 OR = 1.41, 95% CI = 1.07-1.85 (n = 2,967 individuals.Evaluating cumulative evidence for SNPs associated with NODAT in kidney transplant recipients has revealed three SNPs associated with NODAT. An adequately powered, dense genome-wide association study will provide more information using a carefully defined NODAT phenotype.

  19. Kodutus Eestis - kas indiviidi või ühiskonna probleem? / Jüri Kõre, Riina Kiik, Eva Kõiv

    Index Scriptorium Estoniae

    Kõre, Jüri, 1953-

    2005-01-01

    Kodutuse ajaloolisest taustast ja põhjustest. Tartu linna kodutute hulgas 2003.-2004. a. tehtud uurimusest ning Eva Kõivu magistritööst "Kodutus Tartu linnas: Põhjused ja võimalikud lahendused". Diagrammid: Tartu koduta inimeste jaotus kodutuse kestuse järgi; Intervjueeritute sissetulekuallikad

  20. Res Publica nõuab veel üht abilinnapea kohta / Urmas Seaver

    Index Scriptorium Estoniae

    Seaver, Urmas, 1973-

    2005-01-01

    Tallinna linnapea Tõnis Palts on seisukohal, et Reformierakond surus koalitsiooni moodustamisel Res Publicale peale ebaõiglase vastutusvaldkondade jaotuse. Res Publica peasekretär Ott Lumi ei välista võimuliidu loomist Keskerakonnaga, kui Reformierakond järeleandmisi ei tee. ERL tegi ettepaneku kokku kutsuda erakondade ümarlaud. Vt. samas intervjuud Ott Lumiga

  1. Income redistribution in Estonia / Lisa Wilder, Viies Mare

    Index Scriptorium Estoniae

    Wilder, Lisa

    2003-01-01

    Tulude jaotuse ebaühtluse ja ümberjaotuse ulatusest Eestis. Aluseks võttes 1999. aastaks kujunenud tulusituatsiooni, võib väita, et riigi majanduslik areng ja otsused ning kokkulepped sotsiaalpoliitika vallas peegelduvad otseselt elanike sissetulekute suuruse ja struktuuri muutustes. Tabelid. Lisad lk. 120-122

  2. Noor meedik läheks mujale tööle / Anneli Sihvart

    Index Scriptorium Estoniae

    Sihvart, Anneli, 1964-

    2004-01-01

    Poliitikauuringute keskuse PRAXIS uuringust Eesti tervishoiutöötajate migratsiooni kohta. Kommenteerib sotsiaalministeeriumi pressiesindaja Katrin Pärgmäe. Diagramm: Põhjuste jaotus välismaal töötamiseks olenemata nende nimetamise tähtsuse järjekorrast (%)

  3. Eesti naised võimu juures 1992-2003 / Tiina Raitviir

    Index Scriptorium Estoniae

    Raitviir, Tiina

    2003-01-01

    Eesti naiste osatähtsus seadusandliku ja täidesaatva võimu juures on väike. Tabelid: Naiste kandideerimine ja valituks osutumine valimistel 1989-2003; Naiste ja meeste kandideerimise efektiivsus valimistel 1992-2003; Mandaatide jaotus ja omandamise viis parlamendivalimistel 1992-2003; Naised valitsuse liikmena 1990-2003

  4. Riigikogu töö kajastus Eesti meedias / Ivo Rull

    Index Scriptorium Estoniae

    Rull, Ivo, 1965-

    2002-01-01

    Riigikogu Kantselei tellimusel analüüsis suhtekorraldusfirma Rull & Rumm Eesti online- ja trükimeedia kajastuste põhjal Riigikogu avalikku reputatsiooni 2001. aastal. Autor vahendab analüüsi tulemusi. Tabelid: meediamonitooringu tulemused; meediakajastuste jaotus valdkonniti

  5. Poleemikast kestvuse vormidega ajaloolises kultuuris : ajalooline identiteet ja linnaruum / Mart Kivimäe

    Index Scriptorium Estoniae

    Kivimäe, Mart, 1951-

    2005-01-01

    Ettekanne Eesti Kunstiakadeemia restauraatorite konverentsil 4. V. Jaotused: Hävitus ja säilitus - positsioone ajalookultuuri ajaloost. Postmodernne historism ja Nietzsche küsimused. Ajutist ja püsivat elamisruumis. Elukeskkond ja ajaloolise relativismi jaatamine. Historism kui nüüdiskultuuri saatusekujund

  6. Tööpartei edu sundis Leedu sotsiaaldemokraadid liitu parempoolsetega / Tõnu Prei

    Index Scriptorium Estoniae

    Prei, Tõnu, 1950-

    2004-01-01

    Leedu parlamendivalimiste teises voorus saatis edu paremparteisid. Tööerakond saavutas küll 141-kohalise Seimi uues koosseisus 39 kohta, kuid liitlaste puudumise tõttu nad tõenäoliselt võimule ei pääse. Lisa: Kohtade esialgne jaotus Leedu Seimis

  7. Riigi eelarve vorm ja sisu / Johannes Mäll

    Index Scriptorium Estoniae

    Mäll, Johannes, 1911-1981

    1996-01-01

    Riigieelarve ühtsuse ja täielikkuse nõue, tulude ja kulude jaotus riigieelarves ning riigieelarve sisunõuded vastavalt 1938. a. põhiseadusele. Artikkel avaldati esmakordselt: Õigus, 1940, nr. 1, lk. 29-44

  8. Ühest sotsiaalutoopilisest eksperimendist Vene impeeriumi linnades 19. sajandi esimesel poolel = About a Social-Utopian Experiment in the Cities of the Russian Empire in the First Half of the 19th Century / Epi Tohvri ; tõlk. Kersti Meinart

    Index Scriptorium Estoniae

    Tohvri, Epi

    2003-01-01

    1809. a. Vene impeeriumi linnades kehtestatud tüüpfassaadide kohustusest eraehitusele, millist sõnumit kandsid 1809.-1812. a. tüüpfassaadid tolleaegses elukeskkonnas. Jaotused: Valgustusideed ja arhitektuur. C.-N. Ledoux laadis sotsiaalutoopia teostumine Vene impeeriumis. Klassitsistliku ehituskunsti suundumused Eesti linnades Tartu ehitiste näidete varal. Sisaldab bibliogr. 17 ill

  9. Uue majanduse lätteil / Jaak Valge

    Index Scriptorium Estoniae

    Valge, Jaak

    2003-01-01

    Sisemajanduse kogutoodangu mõistest ja arvutusmetoodikast, rahvamajanduse arvepidamise kujunemisest erinevates riikides, elatusmaksumusindeksist (tarbimishinnaindeks) ja rahvastiku elatusaladest. Lisatud tabelid: rahvamajanduslik sissetulek Eestis aastatel 1928-1930 ; tootmisalade puhastoodang aastatel 1929-1938 ; rahvamajanduse kogutoodangu maht turuhindades (miljonites 1960. a. USA dollarites); rahvamajanduse kogutoodangu maht ühe isiku kohta jooksvates hindades ning tabelid Eesti elatusmaksumusindeksi ja rahvastiku jaotuse kohta elatusalade järgi

  10. Palk ja ostujõud / Mare Viies

    Index Scriptorium Estoniae

    Viies, Mare

    2004-01-01

    Ilmunud ka: Social trends. - Tallinn, 2004, nr. 3, lk. 67-79. Keskmise nominaalse bruto-, neto- ja alampalga tasemes ning ostujõus toimunud muutustest aastatel 1993-2002, palgaerinevustest tegevus- ja ametialati, muudatustest palkade jaotuses ning konvergentsitendentsi olemasolust palgatasemes. Tabelid. Diagrammid. Graafikud

  11. Mis on looming.org? : elektrooniline heli / Andres Lõo

    Index Scriptorium Estoniae

    Lõo, Andres

    2004-01-01

    Võrguajakirjast www.looming.org, kuhu kogutakse infot põhiliselt kahe jaotuse põhjal: muusika ja helieksperimentalism ning kaasaegne kunst, kunsti ja meediaga seonduv. Idee autorid: Hanno Soans ja Andres Lõo. Ilmunud on looming.orgi esimene muusikakogumik "Lilled algebrale"

  12. Tööturuasutuste võrgustik EURES = The European employment services network in Estonia / Heleri Hermanson

    Index Scriptorium Estoniae

    Hermanson, Heleri

    2006-01-01

    EURES (EURopean Employment Services) on Euroopa Komisjoni riiklike tööturuasutuste koostöövõrgustik. Eestlaste võimalustest leida tööd Euroopa Liidu liikmesmaades. Lisad: Töötu sotsiaalse kaitse kulutuste jaotus, 2005; Töötu sotsiaalse kaitse kulutused, 1994-2005; Kõnekaid fakte

  13. Ühiskond on saladus / Toivo Palm

    Index Scriptorium Estoniae

    Palm, Toivo

    2003-01-01

    Ilmunud ka: Koit 8. mai lk. 6, Teataja : Eestimaa Rahvaliidu ajaleht ; Vestnik : Gazeta Narodnogo Sojuza Estonii 4. juuni nr. 4 lk. 4. Riigikogu Rahvaliidu fraktsiooni nõunik kirjutab inimarengu indeksist ja selle ühest komponendist - sisemajanduse kogutoodangust. Eesti elatustasemest Euroopa Liiduga liitumisel ja rikkuse jaotuse hindamiseks kasutatavast Gini indeksist

  14. 21. sajandi katk kukutab majandust / Gaili Eding

    Index Scriptorium Estoniae

    Eding, Gaili

    2008-01-01

    Riikide majanduskasv langeb aidsi tõttu kuni kahe protsendi võrra. Kommenteerib sotsiaalminister Maret Maripuu. Lisaks diagrammid: Tervishoiu kogukulude jaotus 1999-2006 ; Aidsi globaalne ajaliin 1959-2008 ; Uued HIVi nakatunute juhud ; Tervishoiu kogukulud inimese kohta (kroonides), kulud kokku ja % SKPst 1999-2006

  15. Tähed ja märgid : Pilguheit Muti, Tarandi ja Karulini Sirpi / Rebekka Lotman

    Index Scriptorium Estoniae

    Lotman, Rebekka, 1978-

    2015-01-01

    Peatoimetajate Mihkel Muti, Kaarel Tarandi ja Ott Karulini juhitud Sirpide võrdlev analüüs. Kaunite kunstide - kirjanduse, kunsti, muusika, teatri ja filmi kajastuste statistiline analüüs : autorite variatiivsus, sagedasemad kirjutajad, artiklite žanriline jaotus valdkonniti, temaatika

  16. Menores y huérfanos en la comunidad castellana de Brujas : una primera aproximación a su estudio

    Directory of Open Access Journals (Sweden)

    Betsabé Caunedo del Potro

    1998-01-01

    Full Text Available Los mercaderes castellanos que negociaban en Europa buscaron formas de asociación que, además de favorecer sus intereses profesionales, cumpliesen una tarea asistencial, proporcionando a sus miembros ayuda y apoyo. Es en una de esas funciones en la que vamos a fijar nuestra atención en el presente trabajo, en la protección que la Nación española de Brujas ofrecía a sus miembros más desvalidos: viudas y fiuérfanos de mercaderes allí residentes. Contemplamos los períodos de minoría de edad como especialmente delicados en la historia de las familias de mercaderes, pues podemos decir que suponían el principio del fin, al menos en lo que se refiere a su vinculación con el mundo de los negocios. La obsesión por conservar sus bienes suponía no incrementarlos. La ya disgregada hacienda paterna, que había sufrido diversas particiones, no podía soportar ni resistir la inactividd de la inversión durante una larga espera.The Castilian merchante who traded in Europe looked for forms of association which, apart from fulfilling a helping task, also favoured their professional interests, providing their members with help and support. It is in one of these functions that we are going to look at in this work, focusing our attention on the protection which the Spanish Nación in Bruges offered its more helpless members: widows and orphans of the merchants who were resident there. We will look at the periods of age of minority especially sensitive in the history of the merchants families, we could say which were the beginning of the end, and least in what was referred to as their links with the trading world. The obsession for conserving their goods meant non increasing them. The already disintegrated paternal propery that had suffered various divisions could not wittistand or endure the inactivity in investment during a long period of time.

  17. E-Health, another mechanism to recruit and retain healthcare professionals in remote areas: lessons learned from EQUI-ResHuS project in Mali.

    Science.gov (United States)

    Bagayoko, Cheick-Oumar; Gagnon, Marie-Pierre; Traoré, Diakaridia; Anne, Abdrahamane; Traoré, Abdel Kader; Geissbuhler, Antoine

    2014-12-24

    The aim of this study was to evaluate the perceived influence of telehealth on recruitment and retention of healthcare professionals in remote areas in Mali. After 15 months of diagnosis imaging training and telehealth activities at four project sites in remote Mali, between May 2011 and August 2012, a 75-item questionnaire was administered to healthcare professionals to assess the various factors related to Information and Communication Technologies (ICT), especially telehealth, and their influence on health personnel recruitment and retention. Questions assessing perceived impact of telehealth on recruitment and retention of healthcare professionals were rated on a five-point Likert scale. Dependent variables were perceived influence of ICT on recruitment and retention and independent variables were access to ICT, ICT training, ICT use, perceived benefits and drawbacks of telehealth, and perceived barriers to recruitment and retention. A multiple linear regression was performed to identify variables explaining the respondents' perceptions regarding telehealth influence on recruitment and retention. Data analysis showed that professionals in remote areas have very positive perceptions of telehealth in general. Many benefits of telehealth for recruitment and retention were highlighted, with perceived benefits of ICT (p = 0.0478), perceived effects of telehealth on recruitment (p = 0.0018), telehealth training (0.0338) and information on telehealth (0.0073) being the strongest motivators for recruitment, while the perceived effects of telehealth on retention (p = 0.0018) was the only factor significantly associated with retention. Based on our study results, telehealth could represent a mechanism for recruiting and retaining health professionals in remote areas and could reduce the isolation of these professionals through networking opportunities.

  18. Pooled analysis and meta-analysis of glutathione S-transferase M1 and bladder cancer: A HuGE review

    DEFF Research Database (Denmark)

    Engel, Lawrence S.; Taioli, Emanuela; Pfeiffer, Ruth

    2002-01-01

    Smoking is a known risk factor for bladder cancer. The product of the GSTM1 gene, glutathione S-transferase M1 (GSTM1), is involved in the detoxification of polycyclic aromatic hydrocarbons found in tobacco smoke; a homozygous deletion of this gene in approximately 50% of Caucasians and Asians...

  19. Autotaxin Expression Is Regulated at the Post-transcriptional Level by the RNA-binding Proteins HuR and AUF1*

    OpenAIRE

    Sun, Shuhong; Zhang, Xiaotian; Lyu, Lin; Li, Xixi; Yao, Siliang; Zhang, Junjie

    2016-01-01

    Autotaxin (ATX) is a key enzyme that converts lysophosphatidylcholine (LPC) into lysophosphatidic acid (LPA), a lysophospholipid mediator that regulates cellular activities through its specific G protein-coupled receptors. The ATX-LPA axis plays an important role in various physiological and pathological processes, especially in inflammation and cancer development. Although the transcriptional regulation of ATX has been widely studied, the post-transcriptional regulation of ATX is largely unk...

  20. Association between heme oxygenase-1 gene promoter polymorphisms and type 2 diabetes mellitus: a HuGE review and meta-analysis.

    Science.gov (United States)

    Bao, Wei; Song, Fangfang; Li, Xiangyang; Rong, Shuang; Yang, Wei; Wang, Di; Xu, Jiqu; Fu, Juan; Zhao, Yanting; Liu, Liegang

    2010-09-15

    Several studies have recently focused on the association between heme oxygenase-1 (HMOX1) gene promoter polymorphisms and susceptibility to type 2 diabetes mellitus; however, results have been conflicting. This systematic Human Genome Epidemiology review and meta-analysis was undertaken to integrate previous findings and summarize the effect size of the association of HMOX1 gene promoter polymorphisms with susceptibility to type 2 diabetes. The authors retrieved all studies matched to search terms from the PubMed/MEDLINE, EMBASE, and ISI Web of Science databases that had been published through December 31, 2009. The articles were then checked independently by 2 investigators according to the eligibility and exclusion criteria. For all alleles and genotypes, odds ratios were pooled using either fixed-effects or random-effects models. An increased odds ratio for type 2 diabetes was observed in persons with the (GT)(n) L (long) allele as compared with those with the (GT)(n) S (short) allele (odds ratio = 1.12, 95% confidence interval: 1.02, 1.24; P = 0.02). Furthermore, the diabetes odds ratio for persons with the LL genotype, versus those with the SS genotype, was significantly increased (odds ratio = 1.25, 95% confidence interval: 1.04, 1.50; P = 0.02). Persons carrying longer (GT)(n) repeats in the HMOX1 gene promoter may have a higher risk of type 2 diabetes.

  1. Purchase of Microwave Reactors for Implementation of Small-scale Microwave-accelerated Organic Chemistry Laboratory Program in Undergraduate Curriculum and Synthetic Chemistry Research at HU

    Science.gov (United States)

    2015-05-16

    Jennifer L. Zile, and Kathryn H. Barker Journal of Chemical Education 2006 83 (11), 1658 7. A Greener Approach to Aspirin Synthesis Using Microwave...and other methods. Currently, we are developing a two-step scheme for the synthesis of esters that will require distillation and/or column...recognize the link between them. We are developing for the above purpose, the microwave-assisted, two-step synthesis of high boiling point esters. The

  2. Validación de un cuestionario para determinar el valor de marca en los hoteles: análisis desde la perspectiva del huésped

    OpenAIRE

    Elizabeth López Carré

    2015-01-01

    El objetivo de este artículo es validar un cuestionario para determinar la lealtad, la calidad percibida y la imagen de la marca, como determinantes del valor de marca desde la perspectiva del consumidor. Se toman como sujetos de estudio a los clientes de hoteles del segmento de negocios de la plaza Toluca-Metepec-Lerma, Estado de México. El aporte académico del trabajo está en función del entendimiento del constructo valor de marca y sus componentes. La contribución práctica radica en que lo...

  3. Transduction efficiency of neurons and glial cells by AAV-1, -5, -9, -rh10 and -hu11 serotypes in rat spinal cord following contusion injury.

    Science.gov (United States)

    Petrosyan, H A; Alessi, V; Singh, V; Hunanyan, A S; Levine, J M; Arvanian, V L

    2014-12-01

    Adeno-associated viruses (AAVs) are a promising system for therapeutic gene delivery to neurons in a number of neurodegenerative conditions including spinal cord injuries (SCIs). Considering the role of macrophages and glia in the progression of 'secondary damage', we searched for the optimal vectors for gene transfer to both neurons and glia following contusion SCI in adult rats. Contusion models share many similarities to most human spinal cord traumas. Several AAV serotypes known for their neuronal tropism expressing enhanced green-fluorescent protein (GFP) were injected intraspinally following thoracic T10 contusion. We systematically compared the transduction efficacy and cellular tropism of these vectors for neurons, macrophages/microglia, oligodendrocytes, astrocytes and NG2-positive glial cells following contusion SCI. No additional changes in inflammatory responses or behavioral performance were observed for any of the vectors. We identified that AAV-rh10 induced robust transduction of both neuronal and glial cells. Even though efficacy to transduce neurons was comparable to already established AAV-1, AAV-5 and AAV-9, AAV-rh10 transduced significantly higher number of macrophages/microglia and oligodendrocytes in damaged spinal cord compared with other serotypes tested. Thus, AAV-rh10 carries promising potential as a gene therapy vector, particularly if both the neuronal and glial cell populations in damaged spinal cord are targeted.

  4. O endomarketing como técnica interveniente no processo de acreditação do HU-UFSC e seus reflexos à cultura organizacional

    OpenAIRE

    Alcântara, Jaqueline Siqueira

    2012-01-01

    Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro Sócio-Econômico. Programa de Pós-Graduação em Administração Universitária A gestão da qualidade nas últimas décadas ultrapassou as fronteiras da indústria, chegando às organizações comerciais e às prestadoras de serviços, dentre elas as organizações prestadoras de serviços de saúde. Dentro deste contexto, o modelo de Acreditação hospitalar emergiu como a ferramenta de gestão da qualidade, preconizando a padronização da...

  5. Komfort rodičky v průběhu spontánního a indukovaného porodu

    OpenAIRE

    BERANOVÁ, Jana

    2013-01-01

    Bachelor thesis deals with comfort of a mother-to-be during spontaneous and induced labour. Spontaneous labour has assumed on the basis of natural mechanisms of a woman´s organism and was going on without obstetrician´s interventions. In the opposite we understand with the induced labour an artificial evocation of the womb activity in order to end pregnancy with a vaginal delivery. Comfort is closely connected with the delivery; it is defined as situation of physical, psychic and social well-...

  6. Komparace strategie íránské podpory terorismu na příkladu Hamásu a Hizballáhu

    Directory of Open Access Journals (Sweden)

    Josef KRAUS

    2010-12-01

    Full Text Available This paper is focused on the comparison of strategy of state-sponsoring of terrorist groups Hamas and Hezbollah by the Islamic Republic of Iran. The strategy is described using five types of support – propaganda and political support, directing the terror, the use of financial leverage, instruction and training, the transfer of weaponry. The primary aim of this text is to clear up the Iranian role in supporting of two chosen Islamic terrorist organization and to explain its differences caused by historical, ideological, political and technical matters to the reader of this article. The text also contains the explanation of the origin, ideological background, political demands and the main terroristic activity of Palestinian Hamas and Lebanese Hezbollah.

  7. Alpe d'HuZes Cancer Rehabilitation (A-CaRe) Research: Four Randomized Controlled Exercise Trials and Economic Evaluations in Cancer Patients and Survivors.

    NARCIS (Netherlands)

    Chinapaw, M.J.M.; Buffart, L.M.; van Mechelen, W.; Schep, G.; Aaronson, N.K.; van Harten, Willem H.

    2012-01-01

    Background: Previous studies showed that exercise in cancer patients is feasible and may reduce fatigue and improve physical fitness and quality of life. However, many previous studies had methodological weaknesses related to trial design, sample size, comparison group, outcome measures, short

  8. Alpe d'HuZes Cancer Rehabilitation (A-CaRe) Research: Four Randomized Controlled Exercise Trials and Economic Evaluations in Cancer Patients and Survivors

    NARCIS (Netherlands)

    Chin A Paw, M.J.M.; Buffart, L.M.; van Mechelen, W.; Schep, G.; Aaronson, N.K.; van Harten, W.H.; Stuiver, M.M.; Kersten, M.J.; Nollet, F.; Kaspers, G.J.L.; van Dulmen-den Broeder, E.; Huisman, J.; Takken, T.; van Tulder, M.W.; Brug, J.

    2012-01-01

    Background Previous studies showed that exercise in cancer patients is feasible and may reduce fatigue and improve physical fitness and quality of life. However, many previous studies had methodological weaknesses related to trial design, sample size, comparison group, outcome measures, short

  9. Abusos y condiciones de servidumbre relacionados con la implementación de los programas de trabajadores huéspedes (el caso tamaulipeco

    Directory of Open Access Journals (Sweden)

    Simón Pedro Izcara Palacios

    2010-01-01

    Full Text Available Las visas H-2A para trabajadores agrarios temporales son muy controvertidas. Así, los grupos defensores de los jornaleros han argumentado que éstas no protegen a la mano de obra estadounidense y propician el abuso y la explotación de los trabajadores foráneos. Tamaulipas presenta una larga tradición de emigración de su población rural a Estados Unidos en busca de empleos agrarios. La preferencia de los empleadores estadounidenses por los jornaleros tamaulipecos se debe a la cercanía de Tamaulipas con la frontera estadounidense, que abarata los costos de transporte, y a la experiencia de los jornaleros tamaulipecos en la realización de actividades muy demandantes físicamente, como la pizca de la naranja. Este artículo analiza el nivel de cumplimiento de los contratos laborales de los trabajadores tamaulipecos que emigran a Estados Unidos con visas temporales H-2A para trabajar en la agricultura.

  10. Meta- and Pooled Analyses of the Methylenetetrahydrofolate Reductase (MTHFR) C677T Polymorphism and Colorectal Cancer: A HuGE-GSEC Review

    Science.gov (United States)

    Taioli, E.; Garza, M. A.; Ahn, Y. O.; Bishop, D. T.; Bost, J.; Budai, B.; Chen, K.; Gemignani, F.; Keku, T.; Lima, C. S. P.; Le Marchand, L.; Matsuo, K.; Moreno, V.; Plaschke, J.; Pufulete, M.; Thomas, S. B.; Toffoli, G.; Wolf, C. R.; Moore, C. G.; Little, J.

    2009-01-01

    Worldwide, over 1 million cases of colorectal cancer (CRC) were reported in 2002, with a 50% mortality rate, making CRC the second most common cancer in adults. Certain racial/ethnic populations continue to experience a disproportionate burden of CRC. A common polymorphism in the 5,10-methylenetetrahydrofolate reductase (MTHFR) gene has been associated with a lower risk of CRC. The authors performed both a meta-analysis (29 studies; 11,936 cases, 18,714 controls) and a pooled analysis (14 studies; 5,068 cases, 7,876 controls) of the C677T MTHFR polymorphism and CRC, with stratification by racial/ethnic population and behavioral risk factors. There were few studies on different racial/ethnic populations. The overall meta-analysis odds ratio for CRC for persons with the TT genotype was 0.83 (95% confidence interval (CI): 0.77, 0.90). An inverse association was observed in whites (odds ratio = 0.83, 95% CI: 0.74, 0.94) and Asians (odds ratio = 0.80, 95% CI: 0.67, 0.96) but not in Latinos or blacks. Similar results were observed for Asians, Latinos, and blacks in the pooled analysis. The inverse association between the MTHFR 677TT polymorphism and CRC was not significantly modified by smoking status or body mass index; however, it was present in regular alcohol users only. The MTHFR 677TT polymorphism seems to be associated with a reduced risk of CRC, but this may not hold true for all populations. PMID:19846566

  11. Estrategias bioinformáticas y moleculares para aislar genes con potencial biotecnológico a partir de especies huérfanas de la ciencia

    Directory of Open Access Journals (Sweden)

    Juan Castro Gómez

    2013-12-01

    Full Text Available La amazonía peruana es megabiodiversa y posee millones de genes con potencial biotecnológico que debemos descubrir. Para identificarlos, aislarlos y poder aprovecharlos tenemos que secuenciar los genomas y transcriptomas de las especies más importantes. Sin embargo, hasta concretar este tipo de proyectos, combinando estrategias bioinformáticas y moleculares podemos aislar genes con potencial biotecnológico. El objetivo fue aislar genes involucrados en la biosíntesis de vitamina C en Myrciaria dubia. De acuerdo a las relaciones filogenéticas de M. dubia con otras especies, se buscaron secuencias homólogas en el banco de genes del gen que codifica L-galactono-1,4-lactona deshidrogenasa (L-GalLDH. En base al alineamiento múltiple obtenido, se construyó un filograma consenso y de los clados formados se diseñaron cebadores degenerados. Los frutos fueron obtenidos de una colección de germoplasma y el ARN total se purificó, el ADNc se sintetizó y amplificó con cebadores degenerados. El amplicón sintetizado se clonó y secuenció con técnicas estándares. Con las aproximaciones empleadas se logró aislar, clonar y secuenciar un segmento de 921 pb del gen L-GalLDH de M. dubia. En conclusión, con las estrategias bioinformáticas y moleculares descritas se aisló el segmento de un gen que codifica la enzima L-galactono-1,4-lactona deshidrogenasa de la vía biosintética de vitamina C en M. dubia, especie de la que no se disponía de secuencias génicas. Con estas mismas aproximaciones será posible aislar genes de interés biotecnológico de esta y otras especies amazónicas que aún no cuentan con bases de datos de secuencias nucleotídicas.

  12. Interaction studies of human prion protein (HuPrP109-111: methionine-lysine-histidine) tripeptide model with transition metal cations.

    Science.gov (United States)

    Pitchumani Violet Mary, C; Shankar, R; Vijayakumar, S; Kolandaivel, P

    2016-09-01

    In the present study, the coordination bonds between the Methionine-Lysine-Histidine (Ac-MKH-NHMe) tripeptide model associated with the fifth metal binding site, which triggers the β-sheet formation of human prion protein and the divalent metal cations such as Mn(2+), Cu(2+) and Zn(2+) were studied using B3LYP and M052X levels of theory with LANL2DZ basis set. For each transition divalent metal cation, three different coordination modes (4N, 3NO, and 2NSO) were analyzed. The present result reveals that overall structural parameters of MKH model tripeptide are altered due to the interaction of divalent metal cations. Among these three coordination modes, the 4N-M(2)(+) and 4N2O-Mn(2+) complexes are found to have the larger interaction energy, MIA and deformation energies. The triply deprotonated coordination mode of the Ac-MKH-NHMe tripeptide transfers more amount of charge to the divalent metal cations than the dually and singly deprotonated complexes. Furthermore, the atoms in molecules (AIM) topological analysis confirm that, the interaction between the metal cations Mn(2+), Cu(2+) and Zn(2+) and Ac-MKH-NHMe tripeptide are electrostatic dominant and the coordination modes with triply deprotonation states possess larger electron density at their BCP corresponding to their coordination bonds. The electrostatic potential difference maps of the most stable 4N-M(2+) (M(2+)=Cu(2+) and Zn(2+)) and 4N2O-Mn(2+) reveals that, as the ionic radii of the metal ion increases, the delocalization charges localized on the metal cations are found to be decreased. The Infra-red stretching frequencies of NH, CH, and CH2 groups of each coordination complexes are observed with shift in their stretching frequencies. From these observations we conclude that, the transition divalent metal cations binding in 4N coordination mode will induce more conformational changes of the Prion protein. Copyright © 2016 Elsevier Inc. All rights reserved.

  13. Browse Author Index

    African Journals Online (AJOL)

    , B · Hu, Bingxue · Hu, Dongsheng · Hu, HG · Hu, Shu-Bin · Hu, XL · Hu, Yaodong · Hua, H · Hualin, Yang · Huang, Bing-Tong · Huang, GY · Huang, Han · Huang, JianHua · Huang, Ying-Chie · Huang, YJ · Huanying, Z

  14. Eesti kultuuritarbija tüübid : kultuuriaktiivsus ja majanduslik heaolu / Malle Järve

    Index Scriptorium Estoniae

    Järve, Malle

    2004-01-01

    Tallinna Pedagoogikaülikooli Rahvusvaheliste Sotsiaaluuringute Instituudi poolt 1998. a. läbi viidud 18-70-aastase elanikkonna küsitlusest "Eesti 98" kultuuritarbimise kohta. Tabelid: Tüpoloogia aluseks olevad näitajad kultuuritarbija tüüpide lõikes; Kultuuritarbija tüübistik erinevates elanikkonna rühmades (%); Kultuuriaktiivsuse indeks erinevates rahvarühmades; Kultuuritarbimusliku ilmajäetuse jaotus erinevates kultuuriaktiivsuse ja sissetuleku tüüpides 1998 (%)

  15. Browse Author Index

    African Journals Online (AJOL)

    Hsieh, KC · Hsieh, M · Hsona, MS · Hsouna, Anis Ben · Hsu, CB · Hsu, Y · Htut, T · Htwe, NN · Hu, C · Hu, CQ · Hu, D · Hu, G · Hu, GS 12251 - 12300 of 33376 Items >>. ISSN: 1684-5315. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians ...

  16. Spotřební chování studentů VŠE při výběru a v průběhu dovolené

    OpenAIRE

    Kirchnerová, Kateřina

    2013-01-01

    The Bachelor's thesis "Consumer Behaviour of Students of the University of Economics when Selecting a Holiday Destination and During Their Holiday" considers consumer behaviour of young people towards tourism. The thesis defines the issue of consumer behaviour and characterizes the tourims market and trends. Apart from the general characteristics it deals with factors determining the consumer behaviour. It presents results of research "Preferences of Europeans towards Tourism" which was condu...

  17. Papeleros urbanos vs aseo del centro de Santiago de Chile.Impacto de las variables formales de los papeleros urbanos existentes en los paseos peatonales Ahumada y Huérfanos. /Waste containers vs. cleaning in downtown Santiago, Chile.

    Directory of Open Access Journals (Sweden)

    Muñoz Peralta, Osvaldo

    2009-12-01

    Full Text Available El diseño que presentan los papeleros urbanos de los paseos peatonales del centro de Santiago no facilita su uso adecuado, lo que contribuye a la suciedad de sus calles peatonales. Como elementos de mobiliario urbano en el espacio público, deberían tener un mejor diseño en orden a mejorar su función y facilitar su uso. /The urban trash cans design, on pedestrian walks in Santiago downtown, doesn't facilitate its appropriate use, what contributes to the dirt of its pedestrian streets. As part of urban furniture in public space, they should have a better design in order to improve their function and to facilitate their use.

  18. Lymnaea cousini, huésped de Fasciola hepatica en el trópico alto andino de Colombia, y sus nuevos haplotipos, confirmados con el marcador mitocondrial del gen de la citocromo oxidasa I

    Directory of Open Access Journals (Sweden)

    Nelson Uribe

    2014-12-01

    Conclusión. Mediante el marcador mitocondrial del COI, se confirmó que los especímenes pertenecían a la especie L. cousini. Con el hallazgo se duplicó el número de haplotipos conocidos de la especie en Colombia y se amplió su distribución geográfica al suroeste y nordeste de la región altoandina colombiana.

  19. The interleukin 10 -819C/T polymorphism and cancer risk: a HuGE review and meta-analysis of 73 studies including 15,942 cases and 22,336 controls.

    Science.gov (United States)

    Yu, Zhibin; Liu, Qing; Huang, Chen; Wu, Minghua; Li, Guiyuan

    2013-04-01

    The aim of the present work was to perform a meta-analysis to evaluate the association between the interleukin 10 (IL-10) -819C/T (rs1800871) polymorphism and cancer risk. A total of 73 studies, including 15,942 cancer cases and 22,336 controls, were identified in this meta-analysis. The odds ratios (ORs) with 95% confidence intervals (CIs) were calculated using the random-effects model. Overall, no significant association was identified between the IL-10 -819C/T polymorphism and cancer risk. In the subgroup analyses, the T allele and TT genotype were associated with a moderately reduced cancer risk in the Asian population (T allele vs. C allele: OR=0.93, 95%CI: 0.87, 0.99; TT vs. CC: OR=0.86, 95%CI: 0.76, 0.98; TT vs. CT/CC: OR=0.90, 95%CI: 0.82, 0.98). Individuals who were homozygous for the T allele (TT) were found to be associated with significantly reduced gastric cancer risk in the Asian population. The heterozygous variant (CT) and the dominant model (TT/CT vs. CC) were associated with an increased risk for cervical and ovarian cancer. However, the IL-10 -819C/T polymorphism was not significantly associated with breast cancer, colorectal cancer, lung cancer, hepatocellular carcinoma, prostate cancer, lymphoma, or melanoma. The depressed cancer risk of the TT genotype occurred in the studies of hospital-based case-control studies and the studies recruited less than 500 subjects, but no statistically significant results were found in the stratified analyses using genotyping method. The results suggest that the IL-10 -819TT genotype may be a protective factor for cancer in Asians, especially gastric cancer. In contrast, the CT genotype and the dominant model could be risk factors for cervical and ovarian cancer. The importance of stratifying by ethnicity, cancer type, study design, and sample size needs to be standardized in future studies, together with considering the association between the IL-10 -819C/T polymorphism and cancer risk. Furthermore, the linkage of -819C/T with other polymorphisms of the IL-10 gene may help explain the variability in findings.

  20. Biscuits with No Added Sugar Containing Stevia, Coffee Fibre and Fructooligosaccharides Modifies α-Glucosidase Activity and the Release of GLP-1 from HuTu-80 Cells and Serotonin from Caco-2 Cells after In Vitro Digestion.

    Science.gov (United States)

    Martinez-Saez, Nuria; Hochkogler, Christina Maria; Somoza, Veronika; Del Castillo, Maria Dolores

    2017-07-04

    This study assessed the in vitro effects of the bioaccessible food components released during the simulated human digestion of a coffee fibre-containing biscuit (CFB) on α-glucosidase activity, antioxidant capacity and satiety hormones. Digest of CFB presented a significantly (p diabetes-related digestive enzyme, and to improve the release of satiety hormones.

  1. Quality of Beauveria bassiana conidia after successive passages through Alphitobius diaperinus (Coleoptera: Tenebrionidae)/ Calidad de conidios de Beauveria bassiana después de sucesivos pasajes por el huésped Alphitobius diaperinus (Coleoptera: Tenebrionidae)

    National Research Council Canada - National Science Library

    Patricia H Santoro; Janaina Zorzetti; Kelly Constanski; Pedro M O J Neves

    2015-01-01

      The vegetative growth, conidial production, conidial yield on rice, virulence, and heat and UV radiation tolerances of Beauveria bassiana after successive passages through Alphitobius diaperinus were investigated. Three strains of B...

  2. A novel and simple method for generation of human dendritic cells from unfractionated peripheral blood mononuclear cells within 2 days: its application for induction of HIV-1-reactive CD4(+) T cells in the hu-PBL SCID mice.

    Science.gov (United States)

    Kodama, Akira; Tanaka, Reiko; Saito, Mineki; Ansari, Aftab A; Tanaka, Yuetsu

    2013-01-01

    Because dendritic cells (DCs) play a critical role in the regulation of adaptive immune responses, they have been ideal candidates for cell-based immunotherapy of cancers and infections in humans. Generally, monocyte-derived DCs (MDDCs) were generated from purified monocytes by multiple steps of time-consuming physical manipulations for an extended period cultivation. In this study, we developed a novel, simple and rapid method for the generation of type-1 helper T cell (Th1)-stimulating human DCs directly from bulk peripheral blood mononuclear cells (PBMCs). PBMCs were cultivated in the presence of 20 ng/ml of granulocyte-macrophage colony-stimulating factor, 20 ng/ml of interleukin-4 (IL-4) and 1,000 U/ml of interferon-β for 24 h followed by 24 h maturation with a cytokine cocktail containing 10 ng/ml of tumor necrosis factor-α (TNF-α), 10 ng/ml of IL-1β and 1 μg/ml of prostaglandin E2. The phenotype and biological activity of these new DCs for induction of allogeneic T cell proliferation and cytokine production were comparable to those of the MDDCs. Importantly, these new DCs pulsed with inactivated HIV-1 could generated HIV-1-reactive CD4(+) T cell responses in humanized mice reconstituted with autologous PBMCs from HIV-1-negative donors. This simple and quick method for generation of functional DCs will be useful for future studies on DC-mediated immunotherapies.

  3. Nejlepší zájem dítěte v průběhu rozvodu rodičů a v porozvodové péči

    OpenAIRE

    Benešová, Zdeňka

    2015-01-01

    This diploma thesis deals with contemporary family, in particular by ensuring the best interests of the child during the parents' divorce and post-divorce in care. The theoretical part introduces the characteristics of the contemporary family, as a result of socio-cultural development of society, and then attempts to put forward the concept of the current healthy family, as the possibility of a positive direction. It deals with the causes and manifestations of families at risk to stability, t...

  4. Vývoj a politický dopad hnutí Tea Party a Occupy Wall Street v průběhu prezidentství Baracka Obamy

    OpenAIRE

    Hushegyi, Ádám

    2017-01-01

    Barack Obama's administration inherited one of the most severe economic crises in the history of the United States, which severely undermined the American public's confidence in the country's political and economic future. Declining trust in the federal government and its handling of the economic recession gave rise to two influential movements, the Tea Party and Occupy Wall Street, which were thoroughly critical of the country's leadership. Both movements made use of a strong populist rhetor...

  5. Cambios hidromorfológicos en el Guadalquivir y sus afluentes Guadalbarcar, Rivera de Huéznar y Rivera de Huelva (sector, Palma del Río-Sevilla)

    OpenAIRE

    García Martínez, María Belén

    2016-01-01

    Falta palabras clave Partiendo de los planteamientos generales de la investigación, los objetivos generales de esta Tesis han tratado de abordar un conjunto de problemas científicos referidos a los ríos aluviales a través de sus cambios hidromorfológicos. Para ello se ha utilizado al río Guadalquivir y a algunos de sus afluentes como exponentes del entorno mediterráneo de Andalucía occidental, a la hora de poner de manifiesto los diferentes ritmos hidrológicos y sus consecuencias ...

  6. Srovnání maximální tepové frekvence při běhu, na bicyklovém ergometru a při plavání

    OpenAIRE

    Májková, Tereza

    2015-01-01

    Theoretical part of this thesis is focused on a heart rate, especially its parameters, measurement methods and regulation. Moreover describes maximal heart rate issue. Practical part was performed as an experimental measurement of maximal heart rate level of 40 healthy adult probands (20 men and 20 women) between the ages of twenty and forty. Maximal heart rate was measured by telemetry meter FT4 Polar ® in 3 types of exercise tests - running, ergometer cycling and swimming. Results were stat...

  7. Současné možnosti řešení správy a oběhu dokumentů ve firmě

    OpenAIRE

    Kučerová Zrálíková, Václava

    2011-01-01

    The thesis analyzes the area of enterprise content management (ECM), identifies its relation to other business applications and defines various stages of the life cycle of documents. It also describes individual components of ECM, including the technologies covering these components. A tool for managing and storing documents (DMS) in ABC company is presented in more detail in the practical part. The Exact Synergy Enterprise software demonstrates its advantages and disadvantages affecting docu...

  8. Míra negativního zobrazení Miloše Zemana a Karla Schwarzenberga v médiích v průběhu prezidentské volby v roce 2013

    OpenAIRE

    Tvarohová, Jana

    2014-01-01

    Diploma thesis The Rate of Negativity in Miloš Zeman's and Karel Schwarzenberg' Reflection in Media during Presidential Election in 2013 analyses the rate of negativity in the news production of three national newspapers - Mladá fronta Dnes, Lidové noviny and Právo - about these presidential candidates. Time range setting is one month before first round of presidential election and one month after first round of presidential election. The presidential election in January of 2013 was completel...

  9. Le matériel archéologique de Piruru II: la collection Louis Girault - Université Hermilio Valdizán, Huánuco-Perú

    Directory of Open Access Journals (Sweden)

    1982-01-01

    Full Text Available On présente tout d'abord l'état de la collection, ainsi que la méthode de travail suivie. On définit ensuite quatre types céramiques on s'interroge sur leur répartition dans la fouille, sur la façon dont ils s'associent entre eux, ainsi que sur leur position chronologique. Le matériel lithique, malheureusement en grande partie disparu, est rapidement analysé. On tente alors de replacer ce matériel dans le contexte de l'archéologie andine. Quelques hypothèses sont enfin soulevées sur la date d'apparition de la céramique à Piruru II. Primero presentamos el estado de la colección y el método de trabajo seguido. Luego definimos cuatro tipos cerámicos y nos cuestionamos sobre su repartición en la excavación, la manera como se asocian entre ellos así como su situación cronológica. El material lítico, desgraciadamente perdido en gran parte, lo analizamos rápidamente. Intentamos seguidamente reubicar este material en el contexto de la arqueología andina. En fin levantamos algunas hipótesis sobre la fecha de aparición de la cerámica en Piruru II. First of all the collection and the method of analysis are presented. Four ceramic types are then defined their possible distribution in the excavation, the way in which they are interrelated, and their chronological position are discussed. The lithic material, unfortunately largely disappeared, is briefly analyzed. This material is then placed in the context of Andean archaeology. Some hypotheses concerning the date of the emergence of ceramic material at Piruru II are raised.

  10. Fyzioterapeutické ovlivnění pohybového aparátu v průběhu těhotenství a příprava k porodu

    OpenAIRE

    KOTRŠALOVÁ, Jana

    2009-01-01

    This bachelor work was aimed at the effect of individual physiotherapy on apparatus of movement during pregnancy and preparation to the labour. The first objective of my research was to find out whether the women who underwent individual physiotherapy in their pregnancy, in addition to the above stated courses, suffered minor problems connected with the locomotive apparatus before and during the parturition than the women who did not undergo individual therapy. I also addressed parturition, p...

  11. Etude de génétique des populations sur l'huître creuse de mangrove, Crassostrea gasar (Adanson, 1757), par l'apport du marqueur ITS2

    OpenAIRE

    Moreau, Dimitri

    2001-01-01

    Le genre Crassostrea regroupe de nombreuses espèces dont la répartition mondiale s'étend sur une grande partie des régions côtières des basses et moyennes latitudes. La classification des différentes espèces décrites à partir des critères morphologiques et de répartition géographique est aujourd'hui remise en cause dans de nombreux cas par les nouvelles études utilisent les techniques récentes de biologie moléculaire. C'est en particulier grâce à l'apport des séquences génomiques variables, q...

  12. Experimental evidence for negative turgor pressure in small leaf cells of Robinia pseudoacacia L versus large cells of Metasequoia glyptostroboides Hu et W.C.Cheng. 1. Evidence from pressure-volume curve analysis of dead tissue.

    Science.gov (United States)

    Yang, Dongmei; Pan, Shaoan; Ding, Yiting; Tyree, Melvin T

    2017-03-01

    This paper provides a mini-review of evidence for negative turgor pressure in leaf cells starting with experimental evidence in the late 1950s and ending with biomechanical models published in 2014. In the present study, biomechanical models were used to predict how negative turgor pressure might be manifested in dead tissue, and experiments were conducted to test the predictions. The main findings were as follows: (i) Tissues killed by heating to 60 or 80 °C or by freezing in liquid nitrogen all became equally leaky to cell sap solutes and all seemed to pass freely through the cell walls. (ii) Once cell sap solutes could freely pass the cell walls, the shape of pressure-volume curves was dramatically altered between living and dead cells. (iii) Pressure-volume curves of dead tissue seem to measure negative turgor defined as negative when inside minus outside pressure is negative. (iv) Robinia pseudoacacia leaves with small palisade cells had more negative turgor than Metasequoia glyptostroboides with large cells. (v) The absolute difference in negative turgor between R. pseudoacacia and M. glyptostroboides approached as much as 1.0 MPa in some cases. The differences in the manifestation of negative turgor in living versus dead tissue are discussed. © 2016 John Wiley & Sons Ltd.

  13. Oyster investigations in the Northumberland Strait Region of New Brunswick. Vol.1 The nature of the growing area and the distribution of oysters: Études relatives aux huîtres dans la region du détroit de Northumberland. : Vol.1 Étude de la distribution des huîtres et de certains paramétres dans les zones de culture

    National Research Council Canada - National Science Library

    Bacon, G.B

    1977-01-01

    .... In essence RPC was commissionned to investigate, on a comparative basis, hydrographic conditions, water chemistry, substrate characteristics, plankton assemblages and oyster populations in Bay du Vin...

  14. Eesti kultuuritarbija tüübid : kultuuriaktiivsus ja majanduslik heaolu / Malle Järve

    Index Scriptorium Estoniae

    Järve, Malle

    2004-01-01

    Tallinna Pedagoogikaülikooli Rahvusvaheliste Sotsiaaluuringute Instituudi poolt 1998. a. läbi viidud 18-70-aastase elanikkonna esinduslikust küsitlusest "Eesti 98" kultuuritarbimise kohta. Tabelid: Tüpoloogia aluseks olevad näitajad kultuuritarbija tüüpide lõikes; Kultuuritarbija tüübistik erinevates elanikkonna rühmades (%); Kultuuriaktiivsuse indeks erinevates rahvarühmades; Kultuuritarbimusliku ilmajäetuse jaotus erinevates kultuuriaktiivsuse ja sissetuleku tüüpides 1998 (%)

  15. Alajaamad ehitatakse grafitikindlaks / Raivo Murde

    Index Scriptorium Estoniae

    Murde, Raivo

    2010-01-01

    Eesti Energia tellimusel anti Eesti Kunstiakadeemia tootedisaini tudengitele lähteülesanne pakkuda eri tüüpi alajaamadele ning jaotus- ja liitumiskilpidele keskkonda sobituvaid grafitikindlaid disainlahendusi. Žürii tunnistas kõige läbimõeldumaks magistrant Lauri Hirvesaare töö, bakalaureusetöödest parimaks Maarja Mõtuse ja Vilja Juursalu töö ning valis välja ka Tšehhi vahetustudengi Alžbeta Zimmerova maapiirkonna alajaamade lahenduse

  16. A Novel system for evaluating the interaction between human norovirus and receptors

    Science.gov (United States)

    Human noroviruses (HuNoVs) are major pathogens for acute nonbacterial gastroenteritis outbreaks. Many aspects of HuNoVs are poorly understood due to both the current inability to culture HuNoVs, and the lack of efficient small animal models. Recombinant HuNoV viral capsid proteins and/or P particles...

  17. AcEST: DK952737 [AcEST

    Lifescience Database Archive (English)

    Full Text Available trella paten... 269 1e-70 tr|Q38HU4|Q38HU4_SOLTU Thaliana 60S ribosomal protein L7 (At2g44... 268 2e-70 tr|A...5 YVTYGYPNLKTVRELIYKRGYGKLNKSRTALTDNSIIEEALGKYGIICIEDLIHEIYTVG 194 >tr|Q38HU4|Q38HU4_SOLTU Thaliana 60S ribo

  18. AcEST: DK953338 [AcEST

    Lifescience Database Archive (English)

    Full Text Available in At2g01250.2 OS=Ar... 226 4e-58 tr|Q38HU4|Q38HU4_SOLTU Thaliana 60S ribosomal protein L7 (At2g44... 226 6e...FPNLKSVKELIYKRGYGKLNHQRIALTDNSI 168 >tr|Q38HU4|Q38HU4_SOLTU Thaliana 60S ribosoma

  19. AcEST: DK945947 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ative uncharacterized protein OS=Popul... 239 6e-62 tr|Q38HU4|Q38HU4_SOLTU Thaliana 60S ribosomal protein L7...RGFGKLNQQRIPLTDNSIVEQGLGKHG 179 >tr|Q38HU4|Q38HU4_SOLTU Thaliana 60S ribosomal pr

  20. AcEST: DK949874 [AcEST

    Lifescience Database Archive (English)

    Full Text Available |A9TJB0_PHYPA Predicted protein OS=Physcomitrella paten... 335 1e-90 tr|Q38HU4|Q38HU4_SOLTU Thaliana 60S rib...NH++E GDA Sbjct: 195 PHFKEANNFLWPFKLSAPLGGLTKKRNHYVEHGDA 229 >tr|Q38HU4|Q38HU4_SOLTU Thaliana 60S ribosomal

  1. AcEST: DK954107 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Uncharacterized protein At2g01250.2 OS=Ar... 202 7e-51 tr|Q38HU4|Q38HU4_SOLTU Thaliana 60S ribosomal protein...NLKSVKELIYK Sbjct: 132 PYVTYGFPNLKSVKELIYK 150 >tr|Q38HU4|Q38HU4_SOLTU Thaliana 60S ribosomal protein L7 (At

  2. AcEST: DK961393 [AcEST

    Lifescience Database Archive (English)

    Full Text Available -61 tr|A9P9W9|A9P9W9_POPTR Putative uncharacterized protein OS=Popul... 236 6e-61 tr|Q38HU4|Q38HU4_SOLTU Thalia...GKLNQQRIPLTDNSIVEQGLGK 177 >tr|Q38HU4|Q38HU4_SOLTU Thaliana 60S ribosomal protein

  3. AcEST: DK949832 [AcEST

    Lifescience Database Archive (English)

    Full Text Available itrella paten... 330 7e-89 tr|Q38HU4|Q38HU4_SOLTU Thaliana 60S ribosomal protein ...ANNFLWPFKLSAPLGGLTKKRNHYVE 225 >tr|Q38HU4|Q38HU4_SOLTU Thaliana 60S ribosomal protein L7 (At2g44120) OS=Sola

  4. AcEST: DK949514 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ein At2g44120.2 OS=Ar... 236 5e-61 tr|Q38HU4|Q38HU4_SOLTU Thaliana 60S ribosomal protein L7 (At2g44... 235 9...+++N L+RRMN Sbjct: 237 NFINELVRRMN 247 >tr|Q38HU4|Q38HU4_SOLTU Thaliana 60S ribos

  5. Hindlimb unloading induces a collagen isoform shift in the soleus muscle of the rat

    Science.gov (United States)

    Miller, T. A.; Lesniewski, L. A.; Muller-Delp, J. M.; Majors, A. K.; Scalise, D.; Delp, M. D.

    2001-01-01

    To determine whether hindlimb unloading (HU) alters the extracellular matrix of skeletal muscle, male Sprague-Dawley rats were subjected to 0 (n = 11), 1 (n = 11), 14 (n = 13), or 28 (n = 11) days of unloading. Remodeling of the soleus and plantaris muscles was examined biochemically for collagen abundance via measurement of hydroxyproline, and the percentage of cross-sectional area of collagen was determined histologically with picrosirius red staining. Total hydroxyproline content in the soleus and plantaris muscles was unaltered by HU at any time point. However, the relative proportions of type I collagen in the soleus muscle decreased relative to control (Con) with 14 and 28 days HU (Con 68 +/- 5%; 14 days HU 53 +/- 4%; 28 days HU 53 +/- 7%). Correspondingly, type III collagen increased in soleus muscle with 14 and 28 days HU (Con 32 +/- 5%; 14 days HU 47 +/- 4%; 28 days HU 48 +/- 7%). The proportion of type I muscle fibers in soleus muscle was diminished with HU (Con 96 +/- 2%; 14 days HU 86 +/- 1%; 28 days HU 83 +/- 1%), and the proportion of hybrid type I/IIB fibers increased (Con 0%; 14 days HU 8 +/- 2%; 28 days HU 14 +/- 2%). HU had no effect on the proportion of type I and III collagen or muscle fiber composition in plantaris muscle. The data demonstrate that HU induces a shift in the relative proportion of collagen isoform (type I to III) in the antigravity soleus muscle, which occurs concomitantly with a slow-to-fast myofiber transformation.

  6. Sensitivity of visual and quantitative detection of middle cerebral artery occlusion on non-contrast-enhanced computed tomography

    Energy Technology Data Exchange (ETDEWEB)

    Ernst, M.; Buhk, J.H.; Kemmling, A.; Fiehler, J.; Groth, M. [University Medical Center Hamburg-Eppendorf, Center for Radiology and Endoscopy Department of Diagnostic and Interventional Neuroradiology, Hamburg (Germany); Romero, J.M. [Massachusetts General Hospital Harvard Medical School, Department of Radiology Division of Neuroradiology, Boston, MA (United States)

    2014-12-15

    This study aims to investigate diagnostic sensitivity and reliability for the detection of middle cerebral artery occlusion (MCAO) on non-contrast-enhanced computed tomography (NECT) by visual assessment (VA), Hounsfield unit (HU) measurement, calculation of the Hounsfield unit/hematocrit (HU/Hct) ratio, and combination of visual assessment and attenuation measurement (VA + HU). NECT of 18 patients with angiographically proven MCAO and 18 patients without MCAO were reviewed by two blinded observers. Visual assessment of presence or absence of a hyperdense sign was followed by HU measurement of both middle cerebral arteries (MCA). Sensitivity, specificity, positive predictive value, and negative predictive value were calculated for VA, HU measurement, HU/Hct ratio, and VA + HU measurement. Receiver operating characteristic curve analysis (ROC) was performed to determine the optimal cut-off values for MCAO using attenuation measurements or HU/Hct ratio. Diagnostic sensitivity/specificity was 63 %/91 % for VA, 56 %/88 % for attenuation measurement, 68 %/81 % for HU/Hct ratio, and 75 %/78 % for VA + HU. ROC curve analysis revealed cut-off values of >42.5 HU for attenuation measurements and >1.12 HU/Hct for HU/Hct ratio. Combination of visual assessment with additional attenuation measurement with a cut-off value of 42.5 HU is recommended for most sensitive and reliable detection of MCAO on NECT. (orig.)

  7. Can Hounsfield Unit Value Predict Type of Urinary Stones?

    Directory of Open Access Journals (Sweden)

    Alper Gok

    2014-03-01

    Full Text Available Aim: Aim of this study is to determine the role of Hounsfield unit (HU in predicting results of stone analysis. Material and Method: This study included 199 patients to whom percutaneous nephrolithotomy (PNL procedures were applied between January 2008 and May 2011 in our clinic. Before the procedure HU values of kidney stones were measured using non-contrast computed tomography. After the operation, obtained stone samples were analysed using X-ray diffraction technique. HU values were compared with stone analysis results. Results: Stone analysis revealed eight different stone types. Distribution of stone types and HU value ranges were as follows: 85% calcium oxalate monohydrate, 730-1130 HU; 38% calcium oxalate dihydrate, 510-810 HU; 21% uric acid, 320-550 HU; 23% struvite, 614-870 HU; 7% calcium hydrogene phosphate, 1100-1365 HU; 3% cystine, 630-674 HU; 15% mixed uric acid plus calcium oxalate, 499-840 HU; and 7% mixed cystine plus calcium phosphate, 430-520 HU. HU values of all stone types ranged between 320 and 1365. There was a statistically significant relation between HU values of uric acid and non uric acid stones (p

  8. SwissProt search result: AK069912 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK069912 J023037G11 (Q14576) ELAV-like protein 3 (Hu-antigen C) (HuC) (Paraneoplastic... cerebellar degeneration-associated antigen) (Paraneoplastic limbic encephalitis antigen 21) ELAV3_HUMAN 6e-16 ...

  9. SwissProt search result: AK120962 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK120962 J023039O15 (Q14576) ELAV-like protein 3 (Hu-antigen C) (HuC) (Paraneoplastic... cerebellar degeneration-associated antigen) (Paraneoplastic limbic encephalitis antigen 21) ELAV3_HUMAN 4e-12 ...

  10. SwissProt search result: AK100904 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK100904 J023132A08 (Q14576) ELAV-like protein 3 (Hu-antigen C) (HuC) (Paraneoplastic... cerebellar degeneration-associated antigen) (Paraneoplastic limbic encephalitis antigen 21) ELAV3_HUMAN 3e-16 ...

  11. SwissProt search result: AK067816 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK067816 J013116F07 (Q14576) ELAV-like protein 3 (Hu-antigen C) (HuC) (Paraneoplastic... cerebellar degeneration-associated antigen) (Paraneoplastic limbic encephalitis antigen 21) ELAV3_HUMAN 1e-21 ...

  12. SwissProt search result: AK120313 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK120313 J013055L11 (Q14576) ELAV-like protein 3 (Hu-antigen C) (HuC) (Paraneoplastic... cerebellar degeneration-associated antigen) (Paraneoplastic limbic encephalitis antigen 21) ELAV3_HUMAN 5e-16 ...

  13. SwissProt search result: AK071053 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK071053 J023078J08 (Q14576) ELAV-like protein 3 (Hu-antigen C) (HuC) (Paraneoplastic... cerebellar degeneration-associated antigen) (Paraneoplastic limbic encephalitis antigen 21) ELAV3_HUMAN 7e-15 ...

  14. SwissProt search result: AK070743 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK070743 J023062K14 (Q14576) ELAV-like protein 3 (Hu-antigen C) (HuC) (Paraneoplastic... cerebellar degeneration-associated antigen) (Paraneoplastic limbic encephalitis antigen 21) ELAV3_HUMAN 7e-18 ...

  15. SwissProt search result: AK069121 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK069121 J023007A14 (Q14576) ELAV-like protein 3 (Hu-antigen C) (HuC) (Paraneoplastic... cerebellar degeneration-associated antigen) (Paraneoplastic limbic encephalitis antigen 21) ELAV3_HUMAN 8e-17 ...

  16. SwissProt search result: AK101593 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK101593 J033051E20 (Q14576) ELAV-like protein 3 (Hu-antigen C) (HuC) (Paraneoplastic... cerebellar degeneration-associated antigen) (Paraneoplastic limbic encephalitis antigen 21) ELAV3_HUMAN 3e-14 ...

  17. SwissProt search result: AK121107 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK121107 J023072J20 (Q14576) ELAV-like protein 3 (Hu-antigen C) (HuC) (Paraneoplastic... cerebellar degeneration-associated antigen) (Paraneoplastic limbic encephalitis antigen 21) ELAV3_HUMAN 1e-11 ...

  18. SwissProt search result: AK101214 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK101214 J033031B04 (Q14576) ELAV-like protein 3 (Hu-antigen C) (HuC) (Paraneoplastic... cerebellar degeneration-associated antigen) (Paraneoplastic limbic encephalitis antigen 21) ELAV3_HUMAN 5e-18 ...

  19. SwissProt search result: AK067252 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK067252 J013098L06 (Q14576) ELAV-like protein 3 (Hu-antigen C) (HuC) (Paraneoplastic... cerebellar degeneration-associated antigen) (Paraneoplastic limbic encephalitis antigen 21) ELAV3_HUMAN 3e-14 ...

  20. SwissProt search result: AK072804 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK072804 J023135B10 (Q14576) ELAV-like protein 3 (Hu-antigen C) (HuC) (Paraneoplastic... cerebellar degeneration-associated antigen) (Paraneoplastic limbic encephalitis antigen 21) ELAV3_HUMAN 3e-12 ...

  1. SwissProt search result: AK241310 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241310 J065141C01 (Q14576) ELAV-like protein 3 (Hu-antigen C) (HuC) (Paraneoplastic... cerebellar degeneration-associated antigen) (Paraneoplastic limbic encephalitis antigen 21) ELAV3_HUMAN 6e-14 ...

  2. SwissProt search result: AK073225 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK073225 J033023C04 (Q14576) ELAV-like protein 3 (Hu-antigen C) (HuC) (Paraneoplastic... cerebellar degeneration-associated antigen) (Paraneoplastic limbic encephalitis antigen 21) ELAV3_HUMAN 2e-15 ...

  3. SwissProt search result: AK099501 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK099501 J013028I07 (Q14576) ELAV-like protein 3 (Hu-antigen C) (HuC) (Paraneoplastic... cerebellar degeneration-associated antigen) (Paraneoplastic limbic encephalitis antigen 21) ELAV3_HUMAN 2e-15 ...

  4. SwissProt search result: AK069926 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK069926 J023036B01 (Q14576) ELAV-like protein 3 (Hu-antigen C) (HuC) (Paraneoplastic... cerebellar degeneration-associated antigen) (Paraneoplastic limbic encephalitis antigen 21) ELAV3_HUMAN 7e-16 ...

  5. SwissProt search result: AK070850 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK070850 J023066B20 (Q14576) ELAV-like protein 3 (Hu-antigen C) (HuC) (Paraneoplastic... cerebellar degeneration-associated antigen) (Paraneoplastic limbic encephalitis antigen 21) ELAV3_HUMAN 1e-17 ...

  6. SwissProt search result: AK103536 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK103536 J033132B05 (Q14576) ELAV-like protein 3 (Hu-antigen C) (HuC) (Paraneoplastic... cerebellar degeneration-associated antigen) (Paraneoplastic limbic encephalitis antigen 21) ELAV3_HUMAN 6e-18 ...

  7. SwissProt search result: AK101706 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK101706 J033060I24 (Q14576) ELAV-like protein 3 (Hu-antigen C) (HuC) (Paraneoplastic... cerebellar degeneration-associated antigen) (Paraneoplastic limbic encephalitis antigen 21) ELAV3_HUMAN 1e-21 ...

  8. SwissProt search result: AK121802 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK121802 J033097J11 (Q14576) ELAV-like protein 3 (Hu-antigen C) (HuC) (Paraneoplastic... cerebellar degeneration-associated antigen) (Paraneoplastic limbic encephalitis antigen 21) ELAV3_HUMAN 2e-12 ...

  9. SwissProt search result: AK073796 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK073796 J033067B10 (Q14576) ELAV-like protein 3 (Hu-antigen C) (HuC) (Paraneoplastic... cerebellar degeneration-associated antigen) (Paraneoplastic limbic encephalitis antigen 21) ELAV3_HUMAN 5e-17 ...

  10. SwissProt search result: AK100101 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK100101 J023004I20 (Q14576) ELAV-like protein 3 (Hu-antigen C) (HuC) (Paraneoplastic... cerebellar degeneration-associated antigen) (Paraneoplastic limbic encephalitis antigen 21) ELAV3_HUMAN 9e-15 ...

  11. SwissProt search result: AK120834 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK120834 J023019P13 (Q14576) ELAV-like protein 3 (Hu-antigen C) (HuC) (Paraneoplastic... cerebellar degeneration-associated antigen) (Paraneoplastic limbic encephalitis antigen 21) ELAV3_HUMAN 4e-11 ...

  12. SwissProt search result: AK072470 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK072470 J023121E15 (Q14576) ELAV-like protein 3 (Hu-antigen C) (HuC) (Paraneoplastic... cerebellar degeneration-associated antigen) (Paraneoplastic limbic encephalitis antigen 21) ELAV3_HUMAN 2e-26 ...

  13. SwissProt search result: AK098867 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK098867 J013001A12 (Q14576) ELAV-like protein 3 (Hu-antigen C) (HuC) (Paraneoplastic... cerebellar degeneration-associated antigen) (Paraneoplastic limbic encephalitis antigen 21) ELAV3_HUMAN 2e-17 ...

  14. Objective quantification of emphysema: Determining best threshold on MDCT 3D volumetry; based on lung function evaluation

    Directory of Open Access Journals (Sweden)

    Nasef Abdelsalam Rezk

    2014-04-01

    Conclusion: MDCT can easily assess the volume of emphysematous lung with positive correlation to lung function testing. Threshold value of −900 HU is more sensitive in the assessment than at −950 HU.

  15. SwissProt search result: AK067492 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK067492 J013110L09 (Q14576) ELAV-like protein 3 (Hu-antigen C) (HuC) (Paraneoplastic... cerebellar degeneration-associated antigen) (Paraneoplastic limbic encephalitis antigen 21) ELAV3_HUMAN 1e-14 ...

  16. SwissProt search result: AK120437 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK120437 J013098D14 (Q14576) ELAV-like protein 3 (Hu-antigen C) (HuC) (Paraneoplastic... cerebellar degeneration-associated antigen) (Paraneoplastic limbic encephalitis antigen 21) ELAV3_HUMAN 2e-13 ...

  17. SwissProt search result: AK067260 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK067260 J013096N13 (Q14576) ELAV-like protein 3 (Hu-antigen C) (HuC) (Paraneoplastic... cerebellar degeneration-associated antigen) (Paraneoplastic limbic encephalitis antigen 21) ELAV3_HUMAN 3e-15 ...

  18. SwissProt search result: AK067210 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK067210 J013096J03 (Q14576) ELAV-like protein 3 (Hu-antigen C) (HuC) (Paraneoplastic... cerebellar degeneration-associated antigen) (Paraneoplastic limbic encephalitis antigen 21) ELAV3_HUMAN 6e-21 ...

  19. SwissProt search result: AK068720 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK068720 J013169L09 (Q14576) ELAV-like protein 3 (Hu-antigen C) (HuC) (Paraneoplastic... cerebellar degeneration-associated antigen) (Paraneoplastic limbic encephalitis antigen 21) ELAV3_HUMAN 7e-14 ...

  20. SwissProt search result: AK065167 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK065167 J013002C13 (Q14576) ELAV-like protein 3 (Hu-antigen C) (HuC) (Paraneoplastic... cerebellar degeneration-associated antigen) (Paraneoplastic limbic encephalitis antigen 21) ELAV3_HUMAN 2e-17 ...

  1. SwissProt search result: AK103490 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK103490 J033130N07 (Q14576) ELAV-like protein 3 (Hu-antigen C) (HuC) (Paraneoplastic... cerebellar degeneration-associated antigen) (Paraneoplastic limbic encephalitis antigen 21) ELAV3_HUMAN 4e-19 ...

  2. Meeting the Sustainability Challenge in Research and Education

    NARCIS (Netherlands)

    Erlijn Eweg; Ivo Opstelten; Nadia Verdeyen

    2013-01-01

    HU University of Applied Sciences Utrecht (HU) initiated a sustainability program in 2010. A compelling vision, collaboration with external partners, interdisciplinary research and interweavement of research and education are important elements in this program. The scope of this paper is

  3. AcEST: DK950981 [AcEST

    Lifescience Database Archive (English)

    Full Text Available tr|A9P9W9|A9P9W9_POPTR Putative uncharacterized protein OS=Popul... 248 2e-69 tr|Q38HU4|Q38HU4_SOLTU Thalia...HYVE 225 >tr|Q38HU4|Q38HU4_SOLTU Thaliana 60S ribosomal protein L7 (At2g44120) OS=Solanum tuberosum PE=2 SV=

  4. Bacterial surface-displayed GII.4 human norovirus capsid proteins bound to surface of Romaine lettuce through HBGA-like molecules

    Science.gov (United States)

    Human Noroviruses (HuNoVs) are the main cause of nonbacterial gastroenteritis. Contaminated produce is a main vehicle for dissemination of HuNoVs. In this study, we used an ice nucleation protein (INP) mediated surface display system to present the protruding domain of GII.4 HuNoV capsid protein (G...

  5. Does recombinant human Epo increase exercise capacity by means other than augmenting oxygen transport?

    DEFF Research Database (Denmark)

    Lundby, C; Robach, P; Boushel, R

    2008-01-01

    before rHuEpo treatment). Blood buffer capacity remained unaffected by rHuEpo treatment and hemodilution. The augmented hematocrit did not compromise peak cardiac output. In summary, in healthy humans, rHuEpo increases maximal oxygen consumption due to augmented systemic and muscular peak oxygen delivery....

  6. BENTUK, FUNGSI, DAN MAKNA FENG SHUI BAGI KEHIDUPAN MASYARAKAT TIONGHOA KOTA MEDAN ??????????????????? (Y?nn? Mi?n L?n Hu?y? Du? F?ngshu? De L?ji? H? Y?y? F?nx? Y?nji?)

    OpenAIRE

    Depari, Yoan Gaby Angela Sembiring

    2012-01-01

    080710023 The title of the paper is ?Bentuk, Fungsi Dan Makna Feng Shui Bagi Masyarakat Tionghoa di Kota Medan?. In this paper, the writer hope to reveal the form, function, and meaning of Feng Shui such as interior, exterior, and the rule for using Feng Shui thing. The methodology of this paper is Qualitative Descripitive, where it focusing to the function and meaning of Feng Shui for poeple who use it. The function is when Feng Shui give a positive situation and a better life for peopl...

  7. Porovnání průběhu a výsledků poválečné obnovy Bosny a Hercegoviny s obnovou po 2. sv. válce v zemích západní Evropy

    OpenAIRE

    Laketić, Aleksandar

    2011-01-01

    The aim of this bachelor thesis is to describe historical development of the process of post-war reconstruction. This will be achieved by comparing two examples. One of them is process of post-war reconstruction in countries of Western Europe after the Second World War and the other is process of post-war reconstruction in Bosnia and Herzegovina after the civil war that ended in 1995. Importance of this topic is underlined by an increasing number of low-intensity conflicts. The aim of this th...

  8. Búsqueda de interactores de QQS, proteína de un gen huérfano de Arabidopsis que está relacionada con el pH intracelular y el metabolismo de almidón, mediante dos técnicas de Doble Híbrido.

    OpenAIRE

    SÁEZ SÁEZ, JAVIER

    2016-01-01

    [ES] Datos previos de microarray de los mutantes simples de pérdida de función de las dos principales isoformas de la H+-ATPasa, aha1-6 y aha2-4, ponen en evidencia QQS, él único gen que baja sensiblemente su expresión en ambos mutantes (Haruta et al., 2012). Además, nuestras primeras investigaciones de la línea transgénica pQQS::QQS-GFP de Arabidopsis tratadas a distintos pHs, nos indican que QQS varía mucho su expresión: aumenta en ambientes alcalinos y desaparece su señal en ambientes á...

  9. Kvalitativní výzkum procesu fyzické a psychické přípravy parašutistů a zvládání stresu v průběhu seskoku padákem

    OpenAIRE

    MARTIN, Milan

    2014-01-01

    The aim is to undertake qualitative research based on Grounded theory and findings how the sports and military paratroopers prepare to jump. We try to explain coaching and learning, activation theory, the theory of stress, coping with stress, the influence of music on the activation and stress management in theoretical part. We explain the concept of qualitative research, grounded theory basics using a semi-structured interview method, or. observation in the methodological part. Detected patt...

  10. O ensino médio: órfão de idéias, herdeiro de equívocos La enseñanza secundaria: huérfano de ideas, heredero de equívocos High School: orphan of ideas, heir of misunderstandings

    Directory of Open Access Journals (Sweden)

    Claudio de Moura Castro

    2008-03-01

    Full Text Available Ensino Médio, ponto de encontro das muitas contradições do ensino brasileiro, tem papéis demais. Pode-se dizer que é um nível em crise permanente. O dilema mais grave do médio está entre preparar a metade dos alunos para o trabalho e a outra metade para o superior. São coisas díspares, com maiores distâncias entre valores e atitudes funcionais em cada uma das opções. O ensino médio herda todas os problemas de qualidade do fundamental e soma a eles um modelo inédito no mundo: não há caminhos alternativos nem entre escolas com perfis diferentes (modelo europeu nem a possibilidade de trilhar trajetórias divergentes dentro da mesma escola (modelo americano. Há amplo debate sobre as múltiplas saídas para o nosso ensino médio. Algumas grandes linhas podem ser sugeridas, justamente por lidarem com erros flagrantes, cuja correção se faz necessária. Mas, mais cedo ou mais tarde, porém, será preciso ter a coragem para resolver o impasse de um sistema único que, na teoria, oferece a mesma escola para todos e, na prática, não oferece nada para ninguém, nem um ensino que preste. Ademais, ainda, discrimina os mais pobres. Só o Brasil apresenta esse sistema. Só o Brasil paga o preço dessa utopia impossível.La enseñanza secundaria, punto de encuentro de las muchas contradicciones de la enseñanza brasileña, tiene tareas demasiadas. Se puede decir que es un nivel en crisis permanente. El dilema más grave del curso medio está entre preparar la mitad de los alumnos para el trabajo y la otra mitad para el superior. Son cosas dispares, con grandes distancias entre valores y actitudes funcionales en cada una de las opciones. La enseñanza de grado medio hereda todos los problemas de cualidad de la enseñanza primaria y soma a ellos un modelo inédito en el mundo: no hay caminos alternativos ni entre escuelas con perfiles diferentes (modelo europeo ni la posibilidad de trillar trayectorias divergentes dentro de la misma escuela (modelo americano. Hay amplio debate sobre las múltiplas salidas para la nuestra enseñanza de grado medio. Algunas grandes líneas pueden ser sugeridas, justamente por lidiaren con errores flagrantes, cuya corrección se hace necesaria. Pero, más temprano o más tarde, será preciso tener el coraje para resolver el problema de un sistema único que, en la teoría, ofrece la misma escuela para todos y, en la practica, no ofrece nada para nadie, ni una enseñanza que preste. Además, aún, discrimina los más pobres. Solo Brasil presenta ese sistema. Solo Brasil paga el precio de esa utopía imposible.High School is the meeting point of big contradictions in Brazilian education system because it plays a lot of roles. We can say that it is a level in permanent crises. The major problem of high school is in having to prepare half of its students to work and the other half to higher education. These two things differ a lot from each other; since there's a big distance between values and functional attitudes concerning both. High school inherits all the problems from the primary school and add them new model in the world. There is no alternate route between schools with different faces (European model; and there isn't any possibility of taking different paths in the same school either (American model. There is a wide debate on the solution to our high school system. Some of the big lines can be suggested, principally because they deal with mistakes which corrections are necessary. But, soon, however, it will be necessary to have enough courage to solve the problem concerning the unique system, which in theory, offers the same school to everybody, but in fact, it doesn't offer anything, even a good education. Besides that, it still discriminates the poor people. Only Brazil has this system. Only Brazil pays the price for this impossible utopia.

  11. Influence des rejets d'antibiotiques piscicoles sur l'environnement conchylicole-Première partie-Mise au point d'une méthode de dosage de l'acide oxolinique dans l'eau de mer, le sédiment, l'huître creuse (Crassostrea Gigas) et la palourde (Ruditapes Philippinarum)

    OpenAIRE

    Pouliquen, Hervé

    1993-01-01

    Des piscicultures marines se sont développées sur le littoral Manche Atlantique qui offre de nombreux sites abrités et faciles d'accès. Ces élevages piscicoles, le plus souvent situés à proximité de zones de tradition conchylicole, sont sources de rejets de substances organiques (aliments non consommés, fêces), minérales (produits azotés) et zoosanitaires (médicaments) (Gowen et Bradbury, 1987). Ce n'est que depuis environ cinq ans que des équipes de recherche, pour la plupart scandinaves, se...

  12. Autonomic nervous system activity assessment in recreational half marathon runners [Hodnocení aktivity autonomního nervového systému u rekreačních účastníků půlmaratonského běhu

    OpenAIRE

    David Smékal; Michal Šafář; Pavel Stejskal; Michal Botek

    2011-01-01

    BACKGROUND: Spectral analysis (SA) of heart rate variability (HRV) is considered to be a non invasive method for the quantification of autonomic cardiac activity in relationship to the sinoatrial node. It is well known that autonomic regulation is affected by various stress factors such as anxiety and/or physical activity. OBJECTIVE: The aim of the present study was to evaluate the effect of pre-competitive anxiety on the autonomic nervous system (ANS) activity and, further, to monitor the ti...

  13. Specifické metody sociální práce s rodinou v průběhu řízení o výkonu rodičovské odpovědnosti po rozvodu manželství

    OpenAIRE

    BALOUN, Ingrid

    2016-01-01

    The diploma thesis deals with the specific methods of social work with a family during the post-divorce child custody trial. The goal of my thesis is to find out what methods are applied by social workers during their work with families at child custody trial. I stated the research inquiry as follows: what are the barriers identifed by social workers during their work with families undergoing a post-divorce child custody trial? As for the empirical part of the thesis, I adopted the method of ...

  14. Changes in speed and strength in female volleyball players during and after a plyometric training program Změny rychlostně-silových předpokladů volejbalistek v průběhu a po absolvování plyometrického tréninkového programu

    National Research Council Canada - National Science Library

    Milan Elfmark; Ivona Lamrová; Michal Lehnert

    2009-01-01

    The goal of this article was the validation of a plyometric training program and the evaluation of the changes in monitored speed and explosive power predispositions during and after the end of the training program...

  15. Morální aspekty v příběhu první knihy Letopisů Narnie: Lev, čarodějnice a skříň. Pokus o pohled narativní etiky

    OpenAIRE

    Kozelský, Kamil

    2016-01-01

    C. S. Lewis was one of the greatest Christian apologists of modern times. He did not only write in Christianity defence, he also wrote a lot about morality and its close interrelationship with faith. This work aims, to demonstrate the moral message put into his work for children, specifically in the story I. Part of the Chronicles of Narnia. It tries to answer the question of whether they can be understood as a general parable of Christian life, spiritual warfare, or inner transformation of a...

  16. Кому кризис, а кому и (Hu)mana небесная / Ольга Ищенко

    Index Scriptorium Estoniae

    Ищенко, Ольга

    2011-01-01

    Inimeste huvi kasutatud asjade vastu on pidevalt kasvamas ja neid müüvatel kauplustel läheb järjest paremini. Turul tegutsevad suuremad ettevõtted on Humana Sorteerimiskeskus OÜ, Riidemaailm, US Style Group, Elmaka, Rolekbalt ja Uuskasutuskeskus. Jaekaubandusstatistika juuli 2010-juuli 2011. Tabel

  17. Ošetřovatelská specifika v péči u klientů po vysoké korekční osteotomii proximální tibie v průběhu času

    OpenAIRE

    BAČOVÁ, Emilie

    2017-01-01

    Osteotomy means cutting a bone using a saw most often. It is used to adjust axial deviation, prolongation, or shortening of the bones. Over time, when there were changes in the development of the surgical technique of corrective osteotomy, changes in nursing care also occurred. This breakthrough concerns not only nursing staff, but also clients in particular. Because of the development of the surgical technique, the hospitalization time shortens and if the client does not perform a physically...

  18. Možné změny v partnerských preferencích transsexuálů female-to-male v průběhu procesu přeměny pohlaví

    OpenAIRE

    Málková, Markéta

    2014-01-01

    The main topic of this thesis is investigation of partner preferences and sexual behavior of female-to-male transsexuals. Number of previous studies showed that on average several partner preferences differ between men and women, and our goal was to determine if these preferences vary in female-to-male transsexuals during the process of sex change. The process of sex change includes intensive exposures to external levels of sex hormones, psychological therapy, and the transformation of their ...

  19. Optical determination of rock-forming minerals — Part I determinative tables W.E. Tröger, 1979. English edition of the fourth German edition by H.U. Bambauer, F. Taborszky and H.D. Trochim. Schweizerbartsche Verlagsbuchhandlung, Stuttgart, 188 pp., DM 48.00, U.S. $ 27.00

    NARCIS (Netherlands)

    Sauter, P.C.C.

    1980-01-01

    This book is the English translation of the fourth German edition of Tröger's Optische Bestimmung der gesteinsbildenden Minerale, Tell I: Bestimmungstabellen. Part II, the descriptive text volume, is only available in German. These Determinative Tables contain data on optical,

  20. Erratum. Correction to: Hu X, et al. Acoustic Radiation Force Impulse (ARFI) Elastography for non‑invasive evaluation of hepatic fibrosis in chronic hepatitis B and C patients: a systematic review and meta-analysis. Med Ultrason 2017; 19(1):23-3.

    Science.gov (United States)

    2017-06-01

    The authors have been made aware of the errors that appeared at Corresponding author: correct phone number 86-10-63138297 and correct email qianlinxue2002@163.com, and also at acknowledgements: correct grant no. 2014-3-009.

  1. A novel and simple method for the generation of functional human dendritic cells from unfractionated peripheral blood mononuclear cells within 2 days: its application for induction of HIV-1-reactive CD4+ T cells in the hu-PBL SCID mice

    Directory of Open Access Journals (Sweden)

    Akira eKodama

    2013-09-01

    Full Text Available Because dendritic cells (DCs play a critical role in the regulation of adaptive immune responses, they have been ideal candidates for cell-based immunotherapy of cancers and infections in humans. Generally, monocyte-derived DCs (MDDCs were generated from purified monocytes by multiple steps of time-consuming physical manipulations for an extended period cultivation. In this study, we developed a novel, simple and rapid method for the generation of type-1 helper T cell (Th1-stimulating human DCs directly from bulk peripheral blood mononuclear cells (PBMCs. PBMCs were cultivated in the presence of 20 ng/ml of granulocyte-macrophage colony-stimulating factor (GM-CSF, 20 ng/ml of interleukin-4 (IL-4 and 1,000 U/ml of interferon-β (IFN-β for 24 hours followed by 24 hour maturation with a cytokine cocktail containing 10 ng/ml of tumor necrosis factor-α (TNF-α, 10 ng/ml of IL-1β and 1 μg/ml of prostaglandin E2 (PGE2. The phenotype and biological activity of these new DCs for induction of allogeneic T cell proliferation and cytokine production were comparable to those of the MDDCs. Importantly, these new DCs pulsed with inactivated HIV-1 could generated HIV-1-reactive CD4+ T cell responses in humanized mice reconstituted with autologous PBMCs from HIV-1-negative donors. This simple and quick method for generation of functional DCs will be useful for future studies on DC-mediated immunotherapies.

  2. Hamowanie syntezy chlorofilu i RNA w izolowanych liścieniach ogórka przez N-hydroksymocznik [Inhibition of chlorophyll and RNA synthesis by N-hydroxyurea in detached cucumber cotyledons

    Directory of Open Access Journals (Sweden)

    A. Rennert

    2015-01-01

    Full Text Available N-hydroxyurea (HU at the concentration of 5 x 10-4 M decreased the content of chlorophyll in detached cucumber cotyledons; at this concentration it has no inhibitory effect on growth. Benzylaminopurine, gibberelic acid and KCl partially reversed the inhibitory effect of HU on chlorophyll synthesis. HU stimulated yellowing of barley first leaf sections. The compound had little effect on leucine-14C incorporation to protein, and markedly inhibited uracil-14C incorporation in to RNA of the greening cucumber cotyledons. It is suggested that the inhibition of RNA and chlorophyll synthesis in HU-treated cucumber cotyledons follows the HU-dependent inhibition of DNA replication.

  3. Losartan alleviates hyperuricemia-induced atherosclerosis in a rabbit model.

    Science.gov (United States)

    Zheng, Hongchao; Li, Ning; Ding, Yueyou; Miao, Peizhi

    2015-01-01

    To investigate the mechanisms underlying the therapeutic effects of losartan on hyperuricemia-induced aortic atherosclerosis, in an experimental rabbit model. Male rabbits (n = 48) were divided into control, hyperuricemia (HU), hypercholesterolemia + hyperuricemia (HC + HU) and high-purine with 30-mg/kg/d losartan (HU + losartan) groups. Serum uric acid (UA) and plasma renin and angiotensin II activities were determined. Aortic tissue specimens were analyzed for histological changes and proliferating cell nuclear antigen (PCNA). Liver tissues were sampled for quantitative analyses of liver low-density lipoprotein receptor (LDLR) mRNA and protein via reverse transcription polymerase chain reaction and western blotting. After 12 weeks, serum UA and plasma renin and plasma angiotensin II activities were enhanced in the HU and HU + HC groups (P losartan group plasma renin activity was not different and serum UA concentrations as well as plasma angiotensin II activity were moderately enhanced (P losartan group. In contrast, transcription and expression of LDLR mRNA and protein were significantly higher in the control and HU + losartan groups compared to the HU and HU + HC groups. Both the HU and HU + HC groups had elevated intima thickness and intima areas compared to the control and HU + losartan groups. Losartan can alleviate experimental atherosclerosis induced by hyperuricemia.

  4. A new computed tomography method to identify meningitis-related cochlear ossification and fibrosis before cochlear implantation.

    Science.gov (United States)

    Ichikawa, Kazunori; Kashio, Akinori; Mori, Harushi; Ochi, Atushi; Karino, Shotaro; Sakamoto, Takashi; Kakigi, Akinobu; Yamasoba, Tatsuya

    2014-04-01

    To develop a new method to determine the presence of intracochlear ossification and/or fibrosis in cochlear implantation candidates with bilateral profound deafness following meningitis. Diagnostic test assessment. A university hospital. This study involved 15 ears from 13 patients with profound deafness following meningitis who underwent cochlear implantation. These ears showed normal structures, soft tissue, partial bony occlusion, and complete bony occlusion in 4, 3, 2, and 6 ears, respectively. We measured radiodensity in Hounsfield units (HU) using 0.5-mm-thick axial high-resolution computed tomography image slices at 3 different levels in the basal turn, the fenestration, and inferior and ascending segment sites, located along the electrode-insertion path. Pixel-level analysis on the DICOM viewer yielded actual computed tomography values of intracochlear soft tissues by eliminating the partial volume effect. The values were compared with the intraoperative findings. Values for ossification (n = 12) ranged from +547 HU to +1137 HU; for fibrosis (n = 11), from +154 HU to +574 HU; and for fluid (n = 22), from -49 HU to +255 HU. From these values, we developed 2 presets of window width (WW) and window level (WL): (1) WW: 1800, WL: 1100 (200 HU to 2000 HU) and (2) WW: 1500, WL: 1250 (500 HU to 2000 HU). The results using these 2 presets corresponded well to the intraoperative findings. Our new method is easy and feasible for preoperative determination of the presence of cochlear ossification and/or fibrosis that develops following meningitis.

  5. Albeni Falls Wildlife Protection, Mitigation, and Enhancement Plan, Final Report 1987.

    Energy Technology Data Exchange (ETDEWEB)

    Martin, Robert C.

    1988-08-01

    A wildlife impact assessment and mitigation plan has been developed for the US Army Corps of Engineers Albeni Falls Project in northern Idaho. The Habitat Evaluation Procedure (HEP) was used to evaluate pre- and post-construction habitat conditions at the Albeni Falls Project. There were 6617 acres of wetlands converted to open water due to development and operation of the project. Eight evaluation species were selected with impacts expressed in numbers of Habitat Units (HU's). For a given species, one HU is equivalent to one acre of prime habitat. The Albeni Falls Project resulted in estimated losses of 5985 mallard HU's, 4699 Canada goose HU's, 3379 redhead HU's, 4508 breeding bald eagle HU's, 4365 wintering bald eagle HU's, 2286 black-capped chickadee HU's, 1680 white-tailed deer HU's, and 1756 muskrat HU's. The yellow warbler gained 71 HU's. Therefore, total target species estimated impacts were 28,587 HU's. Impacts on peregrine falcons were not quantified in terms of HU's. Projects have been proposed by an interagency team of biologists to mitigate the impacts of Albeni Falls on wildlife. The HEP was used to estimate benefits of proposed mitigation projects to target species. Through a series of proposed protection and enhancement actions, the mitigation plan will provide benefits of an estimated 28,590 target species HU's to mitigate Albeni Falls wildlife habitat values lost. 52 refs., 9 figs., 14 tabs.

  6. Liquid tissue surrogates for X-ray and CT phantom studies.

    Science.gov (United States)

    FitzGerald, Paul F; Colborn, Robert E; Edic, Peter M; Lambert, Jack W; Bonitatibus, Peter J; Yeh, Benjamin M

    2017-10-07

    To develop a simple method for producing liquid-tissue-surrogate (LTS) materials that accurately represent human soft tissues in terms of density and X-ray attenuation coefficient. We evaluated hypothetical mixtures of water, glycerol, butanol, methanol, sodium chloride, and potassium nitrate; these mixtures were intended to emulate human adipose, blood, brain, kidney, liver, muscle, pancreas, and skin. We compared the hypothetical densities, effective atomic numbers (Zeff ), and calculated discrete-energy CT attenuation [Hounsfield Units (HU)] of the proposed materials with those of human tissue elemental composition as specified in International Commission on Radiation Units (ICRU) Report 46. We then physically produced the proposed LTS materials for adipose, liver, and pancreas tissue, and we measured the polyenergetic CT attenuation (also expressed as HU) of these materials within a 32 cm phantom using a 64-slice clinical CT scanner at 80 kVp, 100 kVp, 120 kVp, and 140 kVp. The predicted densities, Zeff , and calculated discrete-energy CT attenuation of our proposed formulations generally agreed with those of ICRU within densities of our hypothetical materials agreed precisely with ICRU's reported values and were 0.95 g/mL for adipose tissue, 1.04 g/mL for pancreatic tissue, and 1.06 g/mL for liver tissue; the discrete-energy CT attenuation at 60 keV of our hypothetical materials (and ICRU-specified compositions) were -107 HU (-113 HU) for adipose #3, -89 HU (-90 HU) for adipose #2, 56 HU (55 HU) for liver tissue, and 31 HU (31 HU) for pancreatic tissue. The densities of our physically produced materials (compared to ICRU-specified compositions) were 0.947 g/mL (0.0%) for adipose #2, 1.061 g/mL (+2.0%) for pancreatic tissue, and 1.074 g/mL (+1.3%) for liver tissue. The empirical polyenergetic CT attenuation measurements of our LTS materials (and the discrete-energy HU of the ICRU compositions at the mean energy of each spectrum) at 80

  7. Effects of bacteria-produced human alpha, beta, and gamma interferons on in vitro immune functions.

    Science.gov (United States)

    Shalaby, M R; Weck, P K; Rinderknecht, E; Harkins, R N; Frane, J W; Ross, M J

    1984-04-01

    The effects of bacteria-produced human interferons (HuIFN) alpha, beta, and gamma on in vitro immune functions of human peripheral blood mononuclear cells (PBMC) were studied. Proliferative response to phytohemagglutinin was significantly inhibited by the addition of HuIFN-alpha 2 or HuIFN-beta at 10, 100, or 1000 U/ml. In contrast, HuIFN-gamma showed suppressive activities only when added at 1000 U/ml. HuIFN-alpha 2 or HuIFN-beta caused significant inhibition of human mixed-lymphocyte reaction (MLR) as measured by [3H]thymidine incorporation. Similar inhibition was caused by HuIFN-gamma when it was added only at very low concentrations (1 U/ml); 10, 100, or 1000 U/ml resulted in no or only a modest increase in MLR. All three interferons exhibited dose-related effects on PWM-induced immunoglobulin synthesis in cultures of PBMC. These data demonstrate that purified interferons produced by recombinant DNA technology can significantly alter in vitro immune functions and that HuIFN-gamma has properties which are different from those of HuIFN-alpha 2 or HuIFN-beta.

  8. Wildlife Impact Assessment : Bonneville, McNary, The Dalles, and John Day Projects.

    Energy Technology Data Exchange (ETDEWEB)

    Rasmussen, Larry; Wright, Patrick

    1990-10-01

    The Habitat Evaluation Procedures (HEP) were used to evaluate pre- and post-construction habitat conditions of the US Army Corps of Engineers Bonneville project in Oregon and Washington. The project directly impacted 20,749 acres of wildlife habitat. Seven evaluation species were selected with losses and gains expressed in Habitat Units (HU's). One HU is equivalent to 1 acre of prime habitat. The evaluation estimated a gain of 2671 HU's of lesser scaup wintering habitat. Losses of 4300 HU's of great blue heron habitat, 2443 HU's of Canada goose habitat, 2767 HU's of spotted sandpiper habitat, 163 HU's of yellow warbler habitat, 1022 HU's black-capped chickadee habitat, and 1622 HU's of mink habitat occurred as a result of the project. This amounts to a total combined loss of 12,317 HU's. 18 refs., 1 fig., 4 tabs.

  9. Dynamic computed tomography findings of atypical pulmonary hamartoma and it's pathologic correlations: A case report

    Energy Technology Data Exchange (ETDEWEB)

    Hong, Seung Baek; Jeong Yeon Joo Lee, Gee Won; Kim, Yeong Dae; Ahn, Hyo Yeong; Lee, Chang Hoon; Kim, Ah Rong; Lee, Ji Won [Medical Research Institute, Pusan National University Hospital, Busan (Korea, Republic of)

    2016-04-15

    We present the dynamic contrast-enhanced computed tomography (CT) findings of atypical pulmonary hamartoma with a rare histologic pattern in a 20-year-old male. CT showed a 3.4 cm lobulated mass with a 'tip of the iceberg' appearance in the medium bronchus of the right lower lobe. Dynamic contrast-enhanced CT demonstrated a heterogeneously and persistently enhancing mass. The CT Hounsfield unit (HU) measurements were: 17 HU pre-contrast, 32 HU at 1 minute, 44 HU at 2 minutes, 51 HU at 4 minutes, and 64 HU at 15 minutes. Pathologic examination after video-assisted thoracoscopic surgery disclosed a pulmonary hamartoma with a predominant fibroblastic component.

  10. Human umbilical mesenchymal stem cells conditioned medium promote primary wound healing regeneration

    OpenAIRE

    Dwi Liliek Kusindarta3; Hevi Wihadmadyatami; Yuda Heru Fibrianto; Widagdo Sri Nugroho; Heru Susetya; Dewi Kania Musana; Hery Wijayanto; Surya Agus Prihatna; Wahyuni, A. E. T. H.

    2016-01-01

    Aim: This research was conducted to clarify the capability of human umbilical mesenchymal stem cells conditioned medium (HU-MSCM) to promote regenerations of primary wound healing on the incision skin injury. Materials and Methods: In this study, two approaches in vitro and in vivo already done. On in vitro analysis, tube formation was performed using HU vein endothelial cells in the presence of HU-MSCM, in some experiments cells line was incubated prior the presence of lipopolysaccharide ...

  11. Changes in Local Bone Density in Early Thumb Carpometacarpal Joint Osteoarthritis.

    Science.gov (United States)

    Schreiber, Joseph J; McQuillan, Thomas J; Halilaj, Eni; Crisco, Joseph J; Weiss, Arnold-Peter; Patel, Tarpit; Kenney, Deborah; Ladd, Amy L

    2018-01-01

    Thumb carpometacarpal (CMC) osteoarthritis (OA) represents a major source of functional morbidity. The effects of early CMC OA on loading and use patterns potentially lead to changes in local bone density and microarchitecture. Hounsfield units (HU), a quantitative attenuation coefficient obtained from computed tomography (CT) scans, have been shown to be a reliable marker of bone density. We hypothesized that early CMC OA is associated with lower local bone density about the CMC joint as assessed by HU. We examined HU units from CT scans in 23 asymptomatic subjects and 91 patients with early CMC OA. The HU measurements were obtained within cancellous portions of the trapezium, capitate, first and third metacarpal bases, and distal radius. Linear regression models, with age and sex included as covariates, were used to assess the relationship between CMC OA and HU values at each anatomical site. Early OA patients had significantly lower HU than asymptomatic subjects within the trapezium (mean, 377 HU vs 436 HU) and first metacarpal bases (265 HU vs 324 HU). No significant group differences were noted at the capitate, third metacarpal, or distal radius. Male sex and younger age were associated with significantly higher HU at all the anatomical sites, except the first metacarpal base, where age had no significant effect. Subjects presenting with early CMC OA had significantly lower bone density as assessed with HU at the thumb CMC joint (trapezium and first metacarpal base). Early thumb CMC OA and discomfort may lead to diminished loading across the basal joint, producing focal disuse osteopenia. These findings in symptomatic early arthritis suggest a relationship between symptoms, functional use of the CMC joint, and local bone density. Diagnostic II. Copyright © 2018 American Society for Surgery of the Hand. Published by Elsevier Inc. All rights reserved.

  12. Human and rodent amyloid-beta peptides differentially bind heme: relevance to the human susceptibility to Alzheimer's disease.

    Science.gov (United States)

    Atamna, Hani; Frey, William H; Ko, Novie

    2009-07-01

    Amyloid-beta (Abeta) peptides are implicated in the neurodegeneration of Alzheimer's disease (AD). We previously investigated the mechanism of neurotoxicity of Abeta and found that human Abeta (huAbeta) binds and depletes heme, forming an Abeta-heme complex with peroxidase activity. Rodent Abeta (roAbeta) is identical to huAbeta, except for three amino acids within the proposed heme-binding motif (Site-H). We studied and compared heme-binding between roAbeta and huAbeta. Unlike roAbeta, huAbeta binds heme tightly (K(d)=140+/-60 nM) and forms a peroxidase. The plot of bound (huAbeta-heme) vs. unbound heme fits best to a two site binding hyperbola, suggesting huAbeta possesses two heme-binding sites. Consistently, a second high affinity heme-binding site was identified in the lipophilic region (site-L) of huAbeta (K(d)=210+/-80 nM). The plot of (roAbeta-heme) vs. unbound heme, on the other hand, was different as it fits best to a sigmoidal binding curve, indicating different binding and lower affinity of roAbeta for heme (K(d)=1 microM). The effect of heme-binding to site-H on heme-binding to site-L in roAbeta and huAbeta is discussed. While both roAbeta and huAbeta form aggregates equally, rodents lack AD-like neuropathology. High huAbeta/heme ratio increases the peroxidase activity. These findings suggest that depletion of regulatory heme and formation of Abeta-heme peroxidase contribute to huAbeta's neurotoxicity in the early stages of AD. Phylogenic variations in the amino acid sequence of Abeta explain tight heme-binding to huAbeta and likely contribute to the increased human susceptibility to AD.

  13. Detection of human norovirus in intestinal biopsies from immunocompromised transplant patients.

    Science.gov (United States)

    Karandikar, Umesh C; Crawford, Sue E; Ajami, Nadim J; Murakami, Kosuke; Kou, Baijun; Ettayebi, Khalil; Papanicolaou, Genovefa A; Jongwutiwes, Ubonvan; Perales, Miguel-Angel; Shia, Jinru; Mercer, David; Finegold, Milton J; Vinjé, Jan; Atmar, Robert L; Estes, Mary K

    2016-09-01

    Human noroviruses (HuNoVs) can often cause chronic infections in solid organ and haematopoietic stem cell transplant (HSCT) patients. Based on histopathological changes observed during HuNoV infections, the intestine is the presumed site of virus replication in patients; however, the cell types infected by HuNoVs remain unknown. The objective of this study was to characterize histopathological changes during HuNoV infection and to determine the cell types that may be permissive for HuNoV replication in transplant patients. We analysed biopsies from HuNoV-infected and non-infected (control) transplant patients to assess histopathological changes in conjunction with detection of HuNoV antigens to identify the infected cell types. HuNoV infection in immunocompromised patients was associated with histopathological changes such as disorganization and flattening of the intestinal epithelium. The HuNoV major capsid protein, VP1, was detected in all segments of the small intestine, in areas of biopsies that showed histopathological changes. Specifically, VP1 was detected in enterocytes, macrophages, T cells and dendritic cells. HuNoV replication was investigated by detecting the non-structural proteins, RdRp and VPg. We detected RdRp and VPg along with VP1 in duodenal and jejunal enterocytes. These results provide critical insights into histological changes due to HuNoV infection in immunocompromised patients and propose human enterocytes as a physiologically relevant cell type for HuNoV cultivation.

  14. Significance of CT findings and catecholamine determination in peripheral blood of asymptomatic pheochromocytoma and paraganglioma

    Energy Technology Data Exchange (ETDEWEB)

    Saginoya, Toshiyuki; Miyake, Hidetoshi; Kiyosue, Hiro; Okahara, Mika; Hori, Yuko; Hata, Hiroyuki; Mori, Hiromu [Oita Medical Univ., Hasama (Japan)

    2001-01-01

    The purpose of this study was to assess the CT findings and significance of hormone determination in the peripheral blood of asymptomatic patients with pheochromocytoma and paraganglioma. CT findings in 29 patients with surgically proven pheochromocytoma (n=19) and paraganglioma (n=10) were reviewed. Nine patients (31%) were symptomatic and 20 (69%) were asymptomatic. Tumor size ranged from 39 mm to 114 mm (mean: 60 mm) in symptomatic patients and 11 mm to 100 mm (mean: 50 mm) in asymptomatic ones. Of the 9 symptomatic patients and 18 asymptomatic patients, a homogeneous solid pattern was seen in 4 and 4, mixed pattern in 2 and 6, and massive necrotic pattern in 3 and 8 patients, respectively, on CT scans. The CT attenuation values in symptomatic cases ranged from 30 HU to 50 HU (mean: 41 HU) on precontrast CT scans and 60 HU to 111 HU (mean: 77 HU) on postcontrast CT scans, while those in asymptomatic cases ranged from 15 HU to 48 HU (mean: 33 HU) on precontrast CT scans and 66 HU to 133 HU (mean: 95 HU) on postcontrast CT scans. There were no statistically significant differences in tumor size, homogeneity, or CT attenuation values between symptomatic and asymptomatic patients. All symptomatic patients and 17 (89%) of 19 asymptomatic cases showed elevated levels of catecholamine (epinephrine) or norepinephrine in the peripheral blood. Our study showed that the CT findings in asymptomatic patients were similar to those in symptomatic patients, and 89% of asymptomatic patients showed elevation of catecholamine in the peripheral blood. Determination of catecholamine level in the peripheral blood is recommended for preoperative diagnosis in patients suspected of having asymptomatic phenochromocytoma or paraganglioma on CT scans. (author)

  15. Lower preoperative Hounsfield unit values are associated with intra-operative fractures in cementless bipolar hemiarthroplasty.

    Science.gov (United States)

    Kim, Seung-Ju; Park, Hyun-Soo; Lee, Dong-Woo; Kim, Jong Hun

    2017-12-07

    The use of Hounsfield units (HU) from CT scanning to assess regional BMD has been described. Therefore, we evaluated whether HU could be used to identify osteoporosis of the proximal part of the femur. The results showed that HU assessment is associated with the presence of intra-operative fracture during arthroplasty. The aim with this study was to determine the association of preoperative Hounsfield unit (HU) in hip computed tomography (CT) with intra-operative osteoporotic fracture during cementless hemiarthroplasty. In this retrospective study, we reviewed all patients who underwent cementless bipolar hemiarthroplasty for femoral neck fractures between 2014 and 2016. Patients with intra-operative metaphyseal fractures (n = 25) during surgery were identified from a retrospectively collected patient database and matched with nonfracture controls (n = 75) on the basis of age and sex. The differences between patients with intra-operative fractures and without intra-operative fractures were compared regarding preoperative HU. Correlations of HU value of femur neck with BMD and T scores were determined. Analysis of HU values at the fracture level showed a significantly lower value in the fracture group than in the controls (1186 vs 1340, p = 0.005). The correlation between HU and BMD of femur neck was significant (r 2 = 0.347; p operative fracture during bipolar hemiarthroplasty. We believe that HU values of the proximal femur could be used to assess local bone quality.

  16. Homology modeling of human serum paraoxonase1 and its molecular interaction studies with aspirin and cefazolin

    OpenAIRE

    Salman, Mohammed; Malleda, Chandramouli; Suneel, Narayanavari A; Qureshi, Insaf A; Frank, Elizabeth A; D’Souza, Cletus JM

    2011-01-01

    Human serum paraoxonase1 (HuPON1) belongs to the family of A-esterases (EC.3.1.8.1). It is associated with HDL particle and prevents atherosclerosis by cleaving lipid hydroperoxides and other proatherogenic molecules of oxidized low density lipoproteins (LDL). Since the precise structure of HuPON1 is not yet available, the structure-function relationship between HuPON1 and activators/inhibitors is still unknown. Therefore, a theoretical model of HuPON1 was generated using homology modelling a...

  17. Human ES cells: starting culture from frozen cells.

    Science.gov (United States)

    Trish, Erin; Dimos, John; Eggan, Kevin

    2006-11-09

    Here we demonstrate how our lab begins a HuES human embryonic stem cell line culture from a frozen stock. First, a one to two day old ten cm plate of approximately one (to two) million irradiated mouse embryonic fibroblast feeder cells is rinsed with HuES media to remove residual serum and cell debris, and then HuES media added and left to equilibrate in the cell culture incubator. A frozen vial of cells from long term liquid nitrogen storage or a -80 C freezer is sourced and quickly submerged in a 37 C water bath for quick thawing. Cells in freezing media are then removed from the vial and placed in a large volume of HuES media. The large volume of HuES media facilitates removal of excess serum and DMSO, which can cause HuES human embryonic stem cells to differentiate. Cells are gently spun out of suspension, and then re-suspended in a small volume of fresh HuES media that is then used to seed the MEF plate. It is considered important to seed the MEF plate by gently adding the HuES cells in a drop wise fashion to evenly disperse them throughout the plate. The newly established HuES culture plate is returned to the incubator for 48 hrs before media is replaced, then is fed every 24 hours thereafter.

  18. Icariin combined with human umbilical cord mesenchymal stem cells significantly improve the impaired kidney function in chronic renal failure.

    Science.gov (United States)

    Li, Wen; Wang, Li; Chu, Xiaoqian; Cui, Huantian; Bian, Yuhong

    2017-04-01

    At present, the main therapy for chronic renal failure (CRF) is dialysis and renal transplantation, but neither obtains satisfactory results. Human umbilical cord mesenchymal stem cells (huMSCs) are isolated from the fetal umbilical cord which has a high self-renewal and multi-directional differentiation potential. Icariin (ICA), a kidney-tonifying Chinese Medicine can enhance the multipotency of huMSCs. Therefore, this work seeks to employ the use of ICA-treated huMSCs for the treatment of chronic renal failure. Blood urea nitrogen and creatinine (Cr) analyses showed amelioration of functional parameters in ICA-treated huMSCs for the treatment of CRF rats at 3, 7, and 14 days after transplantation. ICA-treated huMSCs can obviously increase the number of cells in injured renal tissues at 3, 7, and 14 days after transplantation by optical molecular imaging system. Hematoxylin-eosin staining demonstrated that ICA-treated huMSCs reduced the levels of fibrosis in CRF rats at 14 days after transplantation. Superoxide dismutase and Malondialdehyde analyses showed that ICA-treated huMSCs reduced the oxidative damage in CRF rats. Moreover, transplantation with ICA-treated huMSCs decreased inflammatory responses, promoted the expression of growth factors, and protected injured renal tissues. Taken together, our findings suggest that ICA-treated huMSCs could improve the kidney function in CRF rats.

  19. Generation and analysis of novel plant-derived antibody-based therapeutic molecules against West Nile virus.

    Directory of Open Access Journals (Sweden)

    Junyun He

    Full Text Available Previously, our group engineered a plant-derived monoclonal antibody (MAb (pHu-E16 that efficiently treated West Nile virus (WNV infection in mice. In this study, we developed several pHu-E16 variants to improve its efficacy. These variants included a single-chain variable fragment (scFv of pHu-E16 fused to the heavy chain (HC constant domains (CH(1-3 of human IgG (pHu-E16scFv-CH(1-3 and a tetravalent molecule (Tetra pHu-E16 assembled from pHu-E16scFv-CH(1-3 with a second pHu-E16scFv fused to the light chain (LC constant region. pHu-E16scFv-CH(1-3 and Tetra pHu-E16 were efficiently expressed and assembled in plants. To assess the impact of differences in N-linked glycosylation on pHu-E16 variant assembly and function, we expressed additional pHu-E16 variants with various combinations of HC and LC components. Our study revealed that proper pairing of HC and LC was essential for the complete N-glycan processing of antibodies in both plant and animal cells. Associated with their distinct N-glycoforms, pHu-E16, pHu-E16scFv-CH(1-3 and Tetra pHu-E16 exhibited differential binding to C1q and specific Fcγ receptors (FcγR. Notably, none of the plant-derived Hu-E16 variants showed antibody-dependent enhancement (ADE activity in CD32A+ human cells, suggesting the potential of plant-produced antibodies to minimize the adverse effect of ADE. Importantly, all plant-derived MAb variants exhibited at least equivalent in vitro neutralization and in vivo protection in mice compared to mammalian cell-produced Hu-E16. This study demonstrates the capacity of plants to express and assemble a large, complex and functional IgG-like tetravalent mAb variant and also provides insight into the relationship between MAb N-glycosylation, FcγR and C1q binding, and ADE. These new insights may allow the development of safer and cost effective MAb-based therapeutics for flaviviruses, and possibly other pathogens.

  20. Expanded repertoire of AAV vector serotypes mediate unique patterns of transduction in mouse brain.

    Science.gov (United States)

    Cearley, Cassia N; Vandenberghe, Luk H; Parente, Michael K; Carnish, Erin R; Wilson, James M; Wolfe, John H

    2008-10-01

    A wide diversity of adeno-associated virus (AAV) structural proteins uncovered from latent genomes in primate tissue has expanded the number of AAV vector serotypes, which can potentially confer unique cell tropism to the vector. We evaluated 17 of these vectors in the mouse brain using green fluorescent protein (GFP) as a reporter gene. A rapid initial evaluation was performed by neonatal lateral ventricle injections. Vectors made with capsids hu.32, hu.37, pi.2, hu.11, rh.8, hu.48R3, and AAV9 for comparison were selected for further analysis based on their ability to transduce large numbers of cells and result in novel patterns of cell transduction. These vectors were injected into adult brains in four major structures (cortex, striatum, hippocampus, and thalamus), and all were found to transduce neurons. In addition, hu.32, hu.11, pi.2, hu.48R3, and rh.8 resulted in GFP expression in some astrocytes or oligodendrocytes. AAVs rh.8, pi.2, hu.32, and hu.11 also appeared to result in neuronal transport of the vector genome. Vector transport was studied by a single unilateral injection into the hippocampus and vector genome was found in projection sites of the hippocampus. These unique patterns of cell transduction expand the potential repertoire for targeting AAV vectors to selected subsets of brain cells.