WorldWideScience

Sample records for hu gengchen wang

  1. Qing Wang

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. Qing Wang. Articles written in Bulletin of Materials Science. Volume 29 Issue 3 June 2006 pp 313-316 Composites. Anisotropic properties of aligned SWNT modified poly (methyl methacrylate) nanocomposites · Weixue Li Qing Wang Jianfeng Dai · More Details Abstract Fulltext ...

  2. Jun Wang

    Indian Academy of Sciences (India)

    0.32O2 solid solution on depositing -alumina washcoat on .... Volume 38 Issue 5 September 2015 pp 1435-1438. High-performance aqueous rechargeable batteries based on zinc anode and NiCo2O4 cathode · Jun Wang Zhijun Jia Songbo Li ...

  3. Zhu Qing Wang

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences. Zhu Qing Wang. Articles written in Journal of Chemical Sciences. Volume 121 Issue 4 July 2009 pp 543-548. Highly sensitive optical chemosensor for the detection of Cu using a rhodamine B spirolatam · Gen Hua Wu Dong Xiang Wang Da Yu Wu Yuan Gao Zhu Qing Wang.

  4. Editorial: Which Wei Wang?

    International Nuclear Information System (INIS)

    Sprouse, Gene D.

    2007-01-01

    The APS journals receive manuscripts from scientists all over the world. For authors whose names cannot be expressed in Latin characters, their names in the byline must be transliterated, a process that is not necessarily bidirectionally unique. For example, the eight Chinese names all transliterate as Wei Wang. To remove some of the ambiguity arising from this unfortunate degeneracy of names, APS will allow some authors the option to include their names in their own language in parentheses after the transliterated name, such as Wei Wang. The option to present names in the article byline in this manner is an experiment initially offered to Chinese, Japanese, and Korean authors, whose names can be expressed in Unicode characters. An example of a Japanese name is Tadanori Minamisono and a Korean name is Chang Kee Jung. In the English text the given name precedes the family name, while the reverse is true for the characters. As we gain experience, we may be able to broaden this offer to other languages. Authors who wish to try this option will need to prepare their manuscripts by following the special instructions at http://authors.aps.org/names.html

  5. Wang Tiles in Computer Graphics

    CERN Document Server

    Lagae, Ares

    2009-01-01

    Many complex signals in computer graphics, such as point distributions and textures, cannot be efficiently synthesized and stored. This book presents tile-based methods based on Wang tiles and corner tiles to solve both these problems. Instead of synthesizing a complex signal when needed, the signal is synthesized beforehand over a small set of Wang tiles or corner tiles. Arbitrary large amounts of that signal can then efficiently be generated when needed by generating a stochastic tiling, and storing only a small set of tiles reduces storage requirements. A tile-based method for generating a

  6. Wang Guowei's Application of Kant

    Directory of Open Access Journals (Sweden)

    JINLI HE

    2015-01-01

    Full Text Available Wang Guowei (1887-1927 was a late Qing scholar who assumed a pioneer role in introducing Western philosophy and is regarded as the founder of Chinese ideas about philosophical and literary-aesthetic modernity. His introduction and interpretation not only has been inspiring later scholars to be interested in European philosophy but also being a “showcase” of the “localness” of a cultural interpretation. This paper focuses on Kant’s influence on Wang Guowei, especially Wang’s use of Kant’s epistemological, ethical and aesthetic theories to reconstruct the important Chinese philosophical conceptions, such as, 'xing'性, 'li'理, 'ming'命, 'ya'雅 and what he called as Confucius’ 'meiyuzhuyi'美育主義(aesthetic educational-ism and aims to achieve a better grasp of the continuity and revolution that accompany the emergence of Chinese modernity as well as a better understanding of comparative culture (philosophy in its “primitive” phase.

  7. HuMax-CD4

    DEFF Research Database (Denmark)

    Skov, Lone; Kragballe, Knud; Zachariae, Claus

    2003-01-01

    BACKGROUND: Psoriasis is characterized by infiltration with mononuclear cells. Especially activated memory CD4+ T cells are critical in the pathogenesis. Interaction between the CD4 receptor and the major histocompatibility complex class II molecule is important for T-cell activation. OBJECTIVE......: To test safety and efficacy of a fully human monoclonal anti-CD4 antibody (HuMax-CD4) in the treatment of psoriasis. DESIGN: Multicenter, double-blind, placebo-controlled, randomized clinical trial. Patients Eighty-five patients with moderate to severe psoriasis. INTERVENTIONS: Subcutaneous infusions...... dose level, 6 (38%) of 16 patients obtained more than 25% reduction of PASI and 3 (19%) obtained more than 50% reduction of PASI. A dose-dependent decrease in total lymphocyte count was seen and was parallel to a dose-dependent decrease in CD4+ T cells. This decrease was due to a decrease in the memory...

  8. The Wang-Landau Sampling Algorithm

    Science.gov (United States)

    Landau, David P.

    2003-03-01

    Over the past several decades Monte Carlo simulations[1] have evolved into a powerful tool for the study of wide-ranging problems in statistical/condensed matter physics. Standard methods sample the probability distribution for the states of the system, usually in the canonical ensemble, and enormous improvements have been made in performance through the implementation of novel algorithms. Nonetheless, difficulties arise near phase transitions, either due to critical slowing down near 2nd order transitions or to metastability near 1st order transitions, thus limiting the applicability of the method. We shall describe a new and different Monte Carlo approach [2] that uses a random walk in energy space to determine the density of states directly. Once the density of states is estimated, all thermodynamic properties can be calculated at all temperatures. This approach can be extended to multi-dimensional parameter spaces and has already found use in classical models of interacting particles including systems with complex energy landscapes, e.g., spin glasses, protein folding models, etc., as well as for quantum models. 1. A Guide to Monte Carlo Simulations in Statistical Physics, D. P. Landau and K. Binder (Cambridge U. Press, Cambridge, 2000). 2. Fugao Wang and D. P. Landau, Phys. Rev. Lett. 86, 2050 (2001); Phys. Rev. E64, 056101-1 (2001).

  9. Pengenalan Pose Tangan Menggunakan HuMoment

    Directory of Open Access Journals (Sweden)

    Dina Budhi Utami

    2017-02-01

    Full Text Available Computer vision yang didasarkan pada pengenalan bentuk memiliki banyak potensi dalam interaksi manusia dan komputer. Pose tangan dapat dijadikan simbol interaksi manusia dengan komputer seperti halnya pada penggunaan berbagai pose tangan pada bahasa isyarat. Berbagai pose tangan dapat digunakan untuk menggantikan fungsi mouse, untuk mengendalikan robot, dan sebagainya. Penelitian ini difokuskan pada pembangunan sistem pengenalan pose tangan menggunakan HuMoment. Proses pengenalan pose tangan dimulai dengan melakukan segmentasi citra masukan untuk menghasilkan citra ROI (Region of Interest yaitu area telapak tangan. Selanjutnya dilakukan proses deteksi tepi. Kemudian dilakukan ekstraksi nilai HuMoment. Nilai HuMoment dikuantisasikan ke dalam bukukode yang dihasilkan dari proses pelatihan menggunakan K-Means. Proses kuantisasi dilakukan dengan menghitung nilai Euclidean Distance terkecil antara nilai HuMomment citra masukan dan bukukode. Berdasarkan hasil penelitian, nilai akurasi sistem dalam mengenali pose tangan adalah 88.57%.

  10. Important contributions of M.C. Wang and C.S. Wang Chang to non-equilibrium statistical physics

    International Nuclear Information System (INIS)

    Liu Jixing

    2004-01-01

    In the middle of the 20th century two Chinese women physicists, Ming-Chen Wang and Cheng-Shu Wang Chang made great contributions to statistical physics. The famous review article 'On the theory of the Brownian motion II' by Ming-Chen Wang and G.E. Uhlenbeck published in Rev. of Mod. Phys. in 1945 provided a complete scientific classification of stochastic processes which is still adopted by the scientific community as the standard classification. The Wang-Chang-Uhlenbeck (WCU) equation proposed jointly by C.S. Wang-Chang and Uhlenbeck became the fundamental kinetic equation for the treatment of transport properties of multi-atomic gases with internal degrees of freedom in the physics literature. These important scientific contributions are analyzed and reviewed

  11. Infecciones en huéspedes inmunocomprometidos

    OpenAIRE

    Cuéllar Ponce de León, Luis Ernesto

    2013-01-01

    Las infecciones son causa frecuente de morbimortalidad en huéspedes inmunocomprometidos. La frecuencia y diversidad de infecciones en esta población dependerá del tipo de inmunocompromiso, tratamiento recibido y aspecto epidemiológico. Los huéspedes con neutropenia desarrollan infecciones por bacterias extracelulares no encapsuladas y hongos levaduriformes y filamentosos; el diagnóstico precoz y tratamiento oportuno de las mismas son considerados una emergencia por su severidad y gran mortali...

  12. The Rubber Band Revisited: Wang-Landau Simulation

    OpenAIRE

    Ferreira, Lucas S.; Caparica, Alvaro A.; Neto, Minos A.; Galiceanu, Mircea D.

    2012-01-01

    In this work we apply Wang-Landau simulations to a simple model which has exact solutions both in the microcanonical and canonical formalisms. The simulations were carried out by using an updated version of the Wang-Landau sampling. We consider a homopolymer chain consisting of $N$ monomers units which may assume any configuration on the two-dimensional lattice. By imposing constraints to the moves of the polymers we obtain three different models. Our results show that updating the density of...

  13. Spatial chaos of Wang tiles with two symbols

    Science.gov (United States)

    Chen, Jin-Yu; Chen, Yu-Jie; Hu, Wen-Guei; Lin, Song-Sun

    2016-02-01

    This investigation completely classifies the spatial chaos problem in plane edge coloring (Wang tiles) with two symbols. For a set of Wang tiles B , spatial chaos occurs when the spatial entropy h ( B ) is positive. B is called a minimal cycle generator if P ( B ) ≠ 0̸ and P ( B ' ) = 0̸ whenever B ' ⫋ B , where P ( B ) is the set of all periodic patterns on ℤ2 generated by B . Given a set of Wang tiles B , write B = C 1 ∪ C 2 ∪ ⋯ ∪ C k ∪ N , where Cj, 1 ≤ j ≤ k, are minimal cycle generators and B contains no minimal cycle generator except those contained in C1∪C2∪⋯∪Ck. Then, the positivity of spatial entropy h ( B ) is completely determined by C1∪C2∪⋯∪Ck. Furthermore, there are 39 equivalence classes of marginal positive-entropy sets of Wang tiles and 18 equivalence classes of saturated zero-entropy sets of Wang tiles. For a set of Wang tiles B , h ( B ) is positive if and only if B contains a MPE set, and h ( B ) is zero if and only if B is a subset of a SZE set.

  14. A probabilistic Hu-Washizu variational principle

    Science.gov (United States)

    Liu, W. K.; Belytschko, T.; Besterfield, G. H.

    1987-01-01

    A Probabilistic Hu-Washizu Variational Principle (PHWVP) for the Probabilistic Finite Element Method (PFEM) is presented. This formulation is developed for both linear and nonlinear elasticity. The PHWVP allows incorporation of the probabilistic distributions for the constitutive law, compatibility condition, equilibrium, domain and boundary conditions into the PFEM. Thus, a complete probabilistic analysis can be performed where all aspects of the problem are treated as random variables and/or fields. The Hu-Washizu variational formulation is available in many conventional finite element codes thereby enabling the straightforward inclusion of the probabilistic features into present codes.

  15. Hu on poolel teel / James Miles

    Index Scriptorium Estoniae

    Miles, James

    2006-01-01

    2007. aastal toimuv kommunistliku partei 17. kongress tähistab Hiina presidendi Hu Jintao jaoks oma võimuaja poole peale jõudmist, ees ootavad sellised väljakutsed nagu olümpiamängude korraldamine, valimiskeeris Taiwanis ning hullunud majanduse stabiliseerimine. Vt samas: Hiina avanemise pidu

  16. Infecciones en huéspedes inmunocomprometidos

    Directory of Open Access Journals (Sweden)

    Luis Ernesto Cuéllar Ponce de León

    2013-04-01

    Full Text Available Las infecciones son causa frecuente de morbimortalidad en huéspedes inmunocomprometidos. La frecuencia y diversidad de infecciones en esta población dependerá del tipo de inmunocompromiso, tratamiento recibido y aspecto epidemiológico. Los huéspedes con neutropenia desarrollan infecciones por bacterias extracelulares no encapsuladas y hongos levaduriformes y filamentosos; el diagnóstico precoz y tratamiento oportuno de las mismas son considerados una emergencia por su severidad y gran mortalidad asociada. El compromiso de la inmunidad humoral se relaciona con infecciones por microorganismos encapsulados (bacterias extracelulares y hongos; la secuencia clínica presentada en estas infecciones es neumonía aguda-bacteremia/fungemia-meningoencefalitis aguda/crónica. Muchas de estas infecciones son inmunoprevenibles. Los huéspedes con compromiso de la inmunidad celular desarrollan infecciones por microorganismos intracelulares y también por algunos extracelulares; muchas de las infecciones ocurren por reactivación; a menudo requieren profilaxis antimicrobiana tanto primaria como secundaria. El tratamiento medicamentoso (quimioterapia, drogas inmunosupresoras, etc. y los procedimientos invasivos facilitan el desarrollo de determinadas infecciones. El aspecto epidemiológico, que incluye el estilo de vida, ocupación, viajes previos, etc. permite evaluar y determinar el riesgo de potenciales infecciones. En conclusión, la prevención de las infecciones y el uso racional de antimicrobianos son los pilares fundamentales en el manejo efectivo de los huéspedes inmunocomprometidos.

  17. Dynamics analysis of fractional order Yu-Wang system

    Science.gov (United States)

    Bhalekar, Sachin

    2013-10-01

    Fractional order version of a dynamical system introduced by Yu and Wang (Engineering, Technology & Applied Science Research, 2, (2012) 209-215) is discussed in this article. The basic dynamical properties of the system are studied. Minimum effective dimension 0.942329 for the existence of chaos in the proposed system is obtained using the analytical result. For chaos detection, we have calculated maximum Lyapunov exponents for various values of fractional order. Feedback control method is then used to control chaos in the system. Further, the system is synchronized with itself and with fractional order financial system using active control technique. Modified Adams-Bashforth-Moulton algorithm is used for numerical simulations.

  18. On a conjecture of Chen-Guo-Wang

    OpenAIRE

    Ning, Bo; Zheng, Yu

    2015-01-01

    Towards confirming Sun's conjecture on the strict log-concavity of combinatorial sequence involving the n$th$ Bernoulli number, Chen, Guo and Wang proposed a conjecture about the log-concavity of the function $\\theta(x)=\\sqrt[x]{2\\zeta(x)\\Gamma(x+1)}$ for $x\\in (6,\\infty)$, where $\\zeta(x)$ is the Riemann zeta function and $\\Gamma(x)$ is the Gamma function. In this paper, we first prove this conjecture along the spirit of Zhu's previous work. Second, we extend Chen et al.'s conjecture in the ...

  19. THE APPLICATION OF SURVEY IN ER WANG TEMPLE RESTITUTING

    Directory of Open Access Journals (Sweden)

    W. Shuai

    2013-07-01

    Full Text Available Er Wang Temple, in World Heritage Site "Dujiang Weirs and Qingchengshan Mountai", was severely destroyed in Wenchuan earthquake of May 2008. There are several problems at different level in every building, such as structural distortion, foundation displacement, wall fracture, roof damage, etc. The stage was completely collapsed in the earthquake. Tableland the stage situated had a huge crack and slope collapse. This article is for the stage renovation. The survey of damage in earthquake is the basis of Er Wang Temple restituting. Survey including field survey after the earthquake and the measurement and investigation for the remained construction member of the main wood structure. For field survey, the basis of pillars which had not have significantly affects in earthquake could be seem as the reference points for measurement. The investigation of remained main wood construction member, especially the size of the key structures and site and manufacture method of the joints, is the important basis for recovery stage. Our team did our utmost to restore the original appearance of stage in design, materials and craft by various tools, which include measured drawings in different times, old images collection, fine measuring by 3D laser scan, measurement of leftover pieces, logical inference.

  20. Notas sobre el paisaje de Huánuco Pampa

    OpenAIRE

    Román Godines, Oscar; Ministerio de Cultura

    2013-01-01

    El complejo arqueológico Huánuco Pampa se encuentra ubicado en la provincia Dos de Mayo en el departamento de Huánuco y en la actualidad es quizás el principal vestigio de la cosmovisión y la planificación urbana inca.

  1. Sparks sädeleb Rabarocki öös. Ettevaatust! Eliidi rünnak. Hu? Hu da hell?

    Index Scriptorium Estoniae

    2007-01-01

    Ameerika ansamblist Sparks. Vaiko Eplik & Eliit heliplaatidest "1: Aastaajad", "2: Aastaajad" ja "3: Kosmoseodüsseia", esinemisest festivalil Rabarock. Hannaliisa Uusma, Leslie Da Bassi ja DJ Criticali projektist HU?, singlitest "Kosmos" ja "Absoluutselt" (Rabarockil esitusel materjal HU? debüütalbumilt "Film")

  2. Multiple Walkers in the Wang-Landau Algorithm

    Energy Technology Data Exchange (ETDEWEB)

    Brown, G

    2005-12-28

    The mean cost for converging an estimated density of states using the Wang-Landau algorithm is measured for the Ising and Heisenberg models. The cost increases in a power-law fashion with the number of spins, with an exponent near 3 for one-dimensional models, and closer to 2.4 for two-dimensional models. The effect of multiple, simultaneous walkers on the cost is also measured. For the one-dimensional Ising model the cost can increase with the number of walkers for large systems. For both the Ising and Heisenberg models in two-dimensions, no adverse impact on the cost is observed. Thus multiple walkers is a strategy that should scale well in a parallel computing environment for many models of magnetic materials.

  3. The Wang-Meng interacting model and the gravitational collapse

    International Nuclear Information System (INIS)

    Campos, Miguel de

    2013-01-01

    Full text: Several alternatives have appear in the literature to supply the accelerated process of universal expansion, and the simplest possibility is to consider the inclusion of a cosmological constant. The inclusion can be realized in both sides of the Einstein field equations, furnishing different physical interpretations in accord with the side of the Einstein field equations where the Λ is added. Considering the inclusion of the cosmological constant in the energy momentum tensor, this additional content is generally interpreted as the energy storage on the vacuum state of all fields in the universe. The inclusion of a vacuum component in the universal fluid furnishes an excellent description of the observed universe, but from the theoretical point of view we do not understand why the vacuum energy is so small and of the same order of magnitude of the matter density (cosmological constant problem). Depending on the point of view of the cosmological constant problem, competing approaches were developed considering a dynamical cosmological 'constant'. A more richer possibility is to consider a non-gravitational interaction models, where the interaction can occur between the dark components, the ordinary matter, and they do not evolve separately. The coupling between dark matter and dark energy has been considered in the literature in a three different ways: dark matter decaying to dark energy; dark energy decaying to dark matter; interacting in both directions. Wang and Meng (CQG 22, 283,2005) considered an alternative to the usual approach for the decay law of the Λ-term assuming the effect of the vacuum in the matter expansion rate. The simple manner adopt by the authors unified several current models that includes a vacuum decaying component interacting with matter content. The vacuum component alters the dynamics of the universal expansion process, then is a natural question: how is the influence of the vacuum energy in the gravitational collapse with a

  4. Quantitative assessment of periimplant bone density (HU) on CBCT image

    International Nuclear Information System (INIS)

    Goo, Jong Gook; Kim, Jin Soo; Kim, Jae Duk

    2008-01-01

    The primary aims of this retrospective study were to compare subjective bone quality and bone quality based on the Hounsfield scale in different segments of the edentulous jaw, and to establish quantitative and objective assessment of the bone quality. Twenty eight randomly selected cone-beam computed tomographic (CBCT) scans were analyzed. For evaluation one hundred and twelve edentulous areas were selected. Implant recipient sites were evaluated visually for Lekholm and Zarb classification. The same sites were subsequently evaluated digitally using the Hounsfield scale with Vimplant 2.0 TM , and the results were correlated with visual classification. Data was subject for statistical analysis in order to determine correlation between recorded HU and the regions of the mouth with the Kruskal-Wallis test. The highest unit/mean density value (311 HU) was found in the anterior mandible, followed by 259 HU for the posterior mandible, 216 HU for the anterior maxilla, and 127 HU for the posterior maxilla. These results demonstrate a strong correlation for HU depending on the region of the mouth (p TM with Vimplant TM software.

  5. Rigorous lower bound on the dynamic critical exponent of some multilevel Swendsen-Wang algorithms

    International Nuclear Information System (INIS)

    Li, X.; Sokal, A.D.

    1991-01-01

    We prove the rigorous lower bound z exp ≥α/ν for the dynamic critical exponent of a broad class of multilevel (or ''multigrid'') variants of the Swendsen-Wang algorithm. This proves that such algorithms do suffer from critical slowing down. We conjecture that such algorithms in fact lie in the same dynamic universality class as the stanard Swendsen-Wang algorithm

  6. Dr. Yu Wang, Director, Natural Science Division, National Science Council, Taiwan

    CERN Document Server

    Patrice Loïez

    2001-01-01

    Photo 01: L. to r.: Dr. Philippe Bloch, CERN CMS ECAL Deputy Project Manager, Dr. Yu Wang, Dr. Etiennette Auffray, CERN, responsible of the CERN ECAL Regional Centre. Photo 02: L. to r.: Dr. Yu Wang, Dr. Philippe Bloch, Dr. Apollo GO, National Central University, Taiwan, Dr. Etiennette Auffray.

  7. Subunit-specific phenotypes of Salmonella typhimurium HU mutants.

    OpenAIRE

    Hillyard, D R; Edlund, M; Hughes, K T; Marsh, M; Higgins, N P

    1990-01-01

    Salmonella hupA and hupB mutants were studied to determine the reasons for the high degree of conservation in HU structure in bacteria. We found one HU-1-specific effect; the F'128 plasmid was 25-fold less stable in hupB compared with hupA or wild-type cells. F' plasmids were 120-fold more unstable in hupA hupB double mutants compared with wild-type cells, and the double mutant also had a significant alteration in plasmid DNA structure. pBR322 DNA isolated from hupA hupB strains was deficient...

  8. Yue Joseph Wang named Grant A. Dove Professor of Electrical and Computer Engineering

    OpenAIRE

    Owczarski, Mark

    2009-01-01

    Yue Joseph Wang, professor of electrical and computer engineering in the College of Engineering at Virginia Tech, has been named the Grant A. Dove Professor of Electrical and Computer Engineering by the Virginia Tech Board of Visitors.

  9. Abundances of the planetary nebula Hu 1-2

    NARCIS (Netherlands)

    Pottasch, [No Value; Hyung, S; Aller, LH; Beintema, DA; Bernard-Salas, J; Feibelman, WA; Klockner, HR

    The ISO and IUE spectra of the "elliptical" nebula Hu 1-2 are presented. These spectra are combined with new, high resolution spectra in the visual wavelength region to obtain a complete, extinction corrected, spectrum. The chemical composition of the nebula is then calculated and compared to

  10. A note on Wang et al's attack on Zhang et al's multiparty quantum secret sharing

    International Nuclear Information System (INIS)

    Gao Gan

    2012-01-01

    Recently, Wang et al (2008 Phys. Lett. A 373 65) proposed an attack on Zhang et al's (2007 Opt. Commun. 269 418) multiparty quantum secret sharing scheme, in which the first and the last agent are reported to be able to cooperatively eavesdrop on all the secret messages without being detected. In this paper, we show that in Wang et al's attack, on average no more than half the secret messages can be eavesdropped. (paper)

  11. Targeting Mycobacterium tuberculosis nucleoid-associated protein HU with structure-based inhibitors

    Science.gov (United States)

    Bhowmick, Tuhin; Ghosh, Soumitra; Dixit, Karuna; Ganesan, Varsha; Ramagopal, Udupi A.; Dey, Debayan; Sarma, Siddhartha P.; Ramakumar, Suryanarayanarao; Nagaraja, Valakunja

    2014-06-01

    The nucleoid-associated protein HU plays an important role in maintenance of chromosomal architecture and in global regulation of DNA transactions in bacteria. Although HU is essential for growth in Mycobacterium tuberculosis (Mtb), there have been no reported attempts to perturb HU function with small molecules. Here we report the crystal structure of the N-terminal domain of HU from Mtb. We identify a core region within the HU-DNA interface that can be targeted using stilbene derivatives. These small molecules specifically inhibit HU-DNA binding, disrupt nucleoid architecture and reduce Mtb growth. The stilbene inhibitors induce gene expression changes in Mtb that resemble those induced by HU deficiency. Our results indicate that HU is a potential target for the development of therapies against tuberculosis.

  12. Estimating the Partition Function Zeros by Using the Wang-Landau Monte Carlo Algorithm

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Seung-Yeon [Korea National University of Transportation, Chungju (Korea, Republic of)

    2017-03-15

    The concept of the partition function zeros is one of the most efficient methods for investigating the phase transitions and the critical phenomena in various physical systems. Estimating the partition function zeros requires information on the density of states Ω(E) as a function of the energy E. Currently, the Wang-Landau Monte Carlo algorithm is one of the best methods for calculating Ω(E). The partition function zeros in the complex temperature plane of the Ising model on an L × L square lattice (L = 10 ∼ 80) with a periodic boundary condition have been estimated by using the Wang-Landau Monte Carlo algorithm. The efficiency of the Wang-Landau Monte Carlo algorithm and the accuracies of the partition function zeros have been evaluated for three different, 5%, 10%, and 20%, flatness criteria for the histogram H(E).

  13. Cryptanalysis of Wang et al.’s lattice-based key exchange protocol

    Directory of Open Access Journals (Sweden)

    Daya Sagar Gupta

    2016-09-01

    Full Text Available Wang et al. proposed a new hard problem on lattices which is an extension of the small integer solution (SIS on lattices. This new generated hard problem is named to be bilateral in-homogeneous small integer solution (Bi-ISIS. Using the hardness of Bi-ISIS, Wang et al. proposed a new key exchange protocol, which is based on the lattice-based cryptography. In this paper, we signalize that Wang et al.’s lattice-based key exchange protocol is vulnerable to an attack, namely, man-in-the-middle (MITM attack. Through this attack, Eavesdropper can intercept the authenticated messages and communicate the unauthentic messages among the communicating parties.

  14. [Professor WANG Fuchun's experience in the acupoint selection of clinical treatment with acupuncture and moxibustion].

    Science.gov (United States)

    Jiang, Hailin; Liu, Chengyu; Ha, Lijuan; Li, Tie

    2017-11-12

    Professor WANG Fuchun 's experience in the acupoint selection of clinical treatment with acupuncture and moxibustion was summarized. The main acupoints are selected by focusing on the chief symptoms of disease, the supplementary points are selected by differentiating the disorders. The acupoints are modified in terms of the changes of sickness. The effective acupoints are selected flexibly in accordance with the specific effects of points. The summary on the acupoint selection reflects professor WANG Fuchun 's academic thoughts and clinical experience and effectively instructs the clinical practice of acupuncture and moxibustion.

  15. Cytoplasmic Hu-Antigen R (HuR) Expression is Associated with Poor Survival in Patients with Surgically Resected Cholangiocarcinoma Treated with Adjuvant Gemcitabine-Based Chemotherapy.

    Science.gov (United States)

    Toyota, Kazuhiro; Murakami, Yoshiaki; Kondo, Naru; Uemura, Kenichiro; Nakagawa, Naoya; Takahashi, Shinya; Sueda, Taijiro

    2018-05-01

    Hu-antigen R (HuR) is an RNA-binding protein that regulates the stability, translation, and nucleus-to-cytoplasm translocation of messenger RNAs (mRNAs). The aim of this study was to investigate the prognostic significance of HuR in cholangiocarcinoma patients who received adjuvant gemcitabine-based chemotherapy (AGC) after surgical resection. Nuclear and cytoplasmic HuR expression was investigated immunohistochemically in 131 patients with resected cholangiocarcinoma, including 91 patients administered AGC and 40 patients who did not receive adjuvant chemotherapy. The correlation between HuR expression and survival was evaluated by statistical analysis. High nuclear and cytoplasmic HuR expression was observed in 67 (51%) and 45 (34%) patients, respectively. Cytoplasmic HuR expression was significantly associated with lymph node metastasis (p < 0.01), while high cytoplasmic HuR expression was significantly associated with poor disease-free survival [DFS] (p = 0.03) and overall survival [OS] (p = 0.001) in the 91 patients who received AGC, but not in the 40 patients who did not receive AGC (DFS p = 0.17; OS p = 0.07). In the multivariate analysis of patients who received AGC, high cytoplasmic HuR expression was an independent predictor of poor DFS (hazard ratio [HR] 1.77; p = 0.04) and OS (HR 2.09; p = 0.02). Nuclear HuR expression did not affect the survival of enrolled patients. High cytoplasmic HuR expression was closely associated with the efficacy of AGC in patients with cholangiocarcinoma. The current findings warrant further investigations to optimize adjuvant chemotherapy regimens for resectable cholangiocarcinoma.

  16. New Wang-Landau approach to obtain phase diagrams for multicomponent alloys

    Science.gov (United States)

    Takeuchi, Kazuhito; Tanaka, Ryohei; Yuge, Koretaka

    2017-10-01

    We develop an approach to apply the Wang-Landau algorithm to multicomponent alloys in a semi-grand-canonical ensemble. Although the Wang-Landau algorithm has great advantages over conventional sampling methods, there are few applications to alloys. This is because calculating compositions in a semi-grand-canonical ensemble via the Wang-Landau algorithm requires a multidimensional density of states in terms of total energy and compositions, and constructing it is difficult from the viewpoints of both implementation and computational cost. In this study, we develop a simple approach to calculate the alloy phase diagram based on the Wang-Landau algorithm, and show that a number of one-dimensional densities of states could lead to compositions in a semi-grand-canonical ensemble as a multidimensional density of states could. Finally, we apply the present method to Cu-Au and Pd-Rh alloys and confirm that the present method successfully describes the phase diagram with high efficiency, validity, and accuracy.

  17. Evaluating Small Sphere Limit of the Wang-Yau Quasi-Local Energy

    Science.gov (United States)

    Chen, Po-Ning; Wang, Mu-Tao; Yau, Shing-Tung

    2018-01-01

    In this article, we study the small sphere limit of the Wang-Yau quasi-local energy defined in Wang and Yau (Phys Rev Lett 102(2):021101, 2009, Commun Math Phys 288(3):919-942, 2009). Given a point p in a spacetime N, we consider a canonical family of surfaces approaching p along its future null cone and evaluate the limit of the Wang-Yau quasi-local energy. The evaluation relies on solving an "optimal embedding equation" whose solutions represent critical points of the quasi-local energy. For a spacetime with matter fields, the scenario is similar to that of the large sphere limit found in Chen et al. (Commun Math Phys 308(3):845-863, 2011). Namely, there is a natural solution which is a local minimum, and the limit of its quasi-local energy recovers the stress-energy tensor at p. For a vacuum spacetime, the quasi-local energy vanishes to higher order and the solution of the optimal embedding equation is more complicated. Nevertheless, we are able to show that there exists a solution that is a local minimum and that the limit of its quasi-local energy is related to the Bel-Robinson tensor. Together with earlier work (Chen et al. 2011), this completes the consistency verification of the Wang-Yau quasi-local energy with all classical limits.

  18. HuPSON: the human physiology simulation ontology.

    Science.gov (United States)

    Gündel, Michaela; Younesi, Erfan; Malhotra, Ashutosh; Wang, Jiali; Li, Hui; Zhang, Bijun; de Bono, Bernard; Mevissen, Heinz-Theodor; Hofmann-Apitius, Martin

    2013-11-22

    Large biomedical simulation initiatives, such as the Virtual Physiological Human (VPH), are substantially dependent on controlled vocabularies to facilitate the exchange of information, of data and of models. Hindering these initiatives is a lack of a comprehensive ontology that covers the essential concepts of the simulation domain. We propose a first version of a newly constructed ontology, HuPSON, as a basis for shared semantics and interoperability of simulations, of models, of algorithms and of other resources in this domain. The ontology is based on the Basic Formal Ontology, and adheres to the MIREOT principles; the constructed ontology has been evaluated via structural features, competency questions and use case scenarios.The ontology is freely available at: http://www.scai.fraunhofer.de/en/business-research-areas/bioinformatics/downloads.html (owl files) and http://bishop.scai.fraunhofer.de/scaiview/ (browser). HuPSON provides a framework for a) annotating simulation experiments, b) retrieving relevant information that are required for modelling, c) enabling interoperability of algorithmic approaches used in biomedical simulation, d) comparing simulation results and e) linking knowledge-based approaches to simulation-based approaches. It is meant to foster a more rapid uptake of semantic technologies in the modelling and simulation domain, with particular focus on the VPH domain.

  19. SUPPORT FOR HU CFRT SUMMER HIGH SCHOOL FUSION WORKSHOP

    International Nuclear Information System (INIS)

    Punjabi, Alkesh

    2010-01-01

    Nine summer fusion science research workshops for minority and female high school students were conducted at the Hampton University Center for Fusion Research and Training from 1996 to 2005. Each workshop was of the duration of eight weeks. In all 35 high school students were mentored. The students presented 28 contributed papers at the annual meetings of the American Physical Society Division of Plasma Physics. These contributed papers were very well received by the plasma physics and fusion science research community. The students won a number of prestigious local, state, and national honors, awards, prizes, and scholarships. The notable among these are the two regional finalist positions in the 1999 Siemens-Westinghouse Science and Technology Competitions; 1st Place U.S. Army Award, 2006; 1st Place U.S. Naval Science Award, 2006; Yale Science and Engineering Association Best 11th Grade Project, 2006; Society of Physics Students Book Award, 2006; APS Corporate Minority Scholarship and others. This workshop program conducted by the HU CFRT has been an exemplary success, and served the minority and female students exceptionally fruitfully. The Summer High School Fusion Science Workshop is an immensely successful outreach activity conducted by the HU CFRT. In this workshop, we train, motivate, and provide high quality research experiences to young and talented high school scholars with emphasis on under-represented minorities and female students in fusion science and related areas. The purpose of this workshop is to expose minority and female students to the excitement of research in science at an early stage in their academic lives. It is our hope that this may lead the high school students to pursue higher education and careers in physical sciences, mathematics, and perhaps in fusion science. To our knowledge, this workshop is the first and only one to date, of fusion science for under-represented minorities and female high school students at an HBCU. The faculty

  20. Temperature dependence of HU values for various water equivalent phantom materials

    International Nuclear Information System (INIS)

    Homolka, P.; Nowotny, R.; Gahleitner, A.

    2002-01-01

    The temperature dependence of water equivalent phantom materials used in radiotherapy and diagnostic imaging has been investigated. Samples of phantom materials based on epoxy resin, polyethylene, a polystyrene-polypropylene mixture and commercially available phantom materials (Solid Water TM , Gammex RMI and Plastic Water TM , Nuclear Associates) were scanned at temperatures from 15 to 40 deg. C and HU values determined. At a reference temperature of 20 deg. C materials optimized for CT applications give HU values close to zero while the commercial materials show an offset of 119.77 HU (Plastic Water) and 27.69 HU (Solid Water). Temperature dependence was lowest for epoxy-based materials (EPX-W: -0.23 HU deg. C -1 ; Solid Water: -0.25 HU deg. C -1 ) and highest for a polyethylene-based material (X0: -0.72 HU deg. C -1 ). A material based on a mixture of polystyrene and polypropylene (PSPP1: -0.27 HU deg. C -1 ) is comparable to epoxy-based materials and water (-0.29 HU deg. C -1 ). (author)

  1. Deterministic integer multiple firing depending on initial state in Wang model

    Energy Technology Data Exchange (ETDEWEB)

    Xie Yong [Institute of Nonlinear Dynamics, MSSV, Department of Engineering Mechanics, Xi' an Jiaotong University, Xi' an 710049 (China)]. E-mail: yxie@mail.xjtu.edu.cn; Xu Jianxue [Institute of Nonlinear Dynamics, MSSV, Department of Engineering Mechanics, Xi' an Jiaotong University, Xi' an 710049 (China); Jiang Jun [Institute of Nonlinear Dynamics, MSSV, Department of Engineering Mechanics, Xi' an Jiaotong University, Xi' an 710049 (China)

    2006-12-15

    We investigate numerically dynamical behaviour of the Wang model, which describes the rhythmic activities of thalamic relay neurons. The model neuron exhibits Type I excitability from a global view, but Type II excitability from a local view. There exists a narrow range of bistability, in which a subthreshold oscillation and a suprathreshold firing behaviour coexist. A special firing pattern, integer multiple firing can be found in the certain part of the bistable range. The characteristic feature of such firing pattern is that the histogram of interspike intervals has a multipeaked structure, and the peaks are located at about integer multiples of a basic interspike interval. Since the Wang model is noise-free, the integer multiple firing is a deterministic firing pattern. The existence of bistability leads to the deterministic integer multiple firing depending on the initial state of the model neuron, i.e., the initial values of the state variables.

  2. Deterministic integer multiple firing depending on initial state in Wang model

    International Nuclear Information System (INIS)

    Xie Yong; Xu Jianxue; Jiang Jun

    2006-01-01

    We investigate numerically dynamical behaviour of the Wang model, which describes the rhythmic activities of thalamic relay neurons. The model neuron exhibits Type I excitability from a global view, but Type II excitability from a local view. There exists a narrow range of bistability, in which a subthreshold oscillation and a suprathreshold firing behaviour coexist. A special firing pattern, integer multiple firing can be found in the certain part of the bistable range. The characteristic feature of such firing pattern is that the histogram of interspike intervals has a multipeaked structure, and the peaks are located at about integer multiples of a basic interspike interval. Since the Wang model is noise-free, the integer multiple firing is a deterministic firing pattern. The existence of bistability leads to the deterministic integer multiple firing depending on the initial state of the model neuron, i.e., the initial values of the state variables

  3. [Professor WANG Linpeng's experience of acupuncture for migraine based on different stages and types].

    Science.gov (United States)

    Wang, Shaosong

    2016-07-12

    By using the methods of experience summary and case report, professor WANG Linpeng 's clinical experience of acupuncture for migraine was summarized.Professor WANG proposed the different acupuncture plans should be established according to the active stage and remission stage of migraine; in the active stage acupuncture should be applied at gallbladder meridian with penetration needling technique to reinforce the stimulation intensity; in the remission stage the aim was to regulate zang-fu and back- shu points should be emphasized.In addition, attention should be paid on acupuncture technique and preventive treatment.For menstruation-type and psychological disorder-type migraine, different acupuncture plans should be adopted and regulating meridian and spirit was essential in the treatment.

  4. [Experience summary of professor WANG Fuchun's "Zhenjing Anshen" acupuncture method for insomnia].

    Science.gov (United States)

    Li, Tie; Ha, Lijuan; Cao, Fang; Zhi, Mujun; Wang, Fuchun

    2015-11-01

    The experience of "Zhenjing Anshen" acupuncture method originally created by professor WANG Fuchun for treatment of insomnia was introduced in this paper. From aspects of insomnia pathogenesis, theoretical foundation, characteristics of acupoint selection, needing methods, needing time, etc., the experience of Professor WANG Fuchun for treatment of insomnia was explained. The "Zhenjing Anshen" acupuncture method proposed, for the first time, "new three layers" method of acupoint selection, including Sishencong (EX-HN 1), Shenmen (HT 7), Sanyinjiao (SP 6). This method presents the principles of acupoint selection along meridian, acupoint selection based on essence-qi-spirit, harmony of yin and yang. The acupuncture manipulation is emphasized, and treating time (the period of the day from 3 pm to 5 pm) is focused on; acupoint selection is simple but essential, and acupoint combination is scientific, which receives notable therapeutic effect in clinic.

  5. Wang-Landau Reaction Ensemble Method: Simulation of Weak Polyelectrolytes and General Acid-Base Reactions.

    Science.gov (United States)

    Landsgesell, Jonas; Holm, Christian; Smiatek, Jens

    2017-02-14

    We present a novel method for the study of weak polyelectrolytes and general acid-base reactions in molecular dynamics and Monte Carlo simulations. The approach combines the advantages of the reaction ensemble and the Wang-Landau sampling method. Deprotonation and protonation reactions are simulated explicitly with the help of the reaction ensemble method, while the accurate sampling of the corresponding phase space is achieved by the Wang-Landau approach. The combination of both techniques provides a sufficient statistical accuracy such that meaningful estimates for the density of states and the partition sum can be obtained. With regard to these estimates, several thermodynamic observables like the heat capacity or reaction free energies can be calculated. We demonstrate that the computation times for the calculation of titration curves with a high statistical accuracy can be significantly decreased when compared to the original reaction ensemble method. The applicability of our approach is validated by the study of weak polyelectrolytes and their thermodynamic properties.

  6. A power law of order 1/4 for critical mean field Swendsen-Wang dynamics

    CERN Document Server

    Long, Yun; Ning, Weiyang; Peres, Yuval

    2014-01-01

    The Swendsen-Wang dynamics is a Markov chain widely used by physicists to sample from the Boltzmann-Gibbs distribution of the Ising model. Cooper, Dyer, Frieze and Rue proved that on the complete graph K_n the mixing time of the chain is at most O(\\sqrt{n}) for all non-critical temperatures. In this paper the authors show that the mixing time is \\Theta(1) in high temperatures, \\Theta(\\log n) in low temperatures and \\Theta(n^{1/4}) at criticality. They also provide an upper bound of O(\\log n) for Swendsen-Wang dynamics for the q-state ferromagnetic Potts model on any tree of n vertices.

  7. HU deviation in lung and bone tissues: Characterization and a corrective strategy.

    Science.gov (United States)

    Ai, Hua A; Meier, Joseph G; Wendt, Richard E

    2018-05-01

    In the era of precision medicine, quantitative applications of x-ray Computed Tomography (CT) are on the rise. These require accurate measurement of the CT number, also known as the Hounsfield Unit. In this study, we evaluated the effect of patient attenuation-induced beam hardening of the x-ray spectrum on the accuracy of the HU values and a strategy to correct for the resulting deviations in the measured HU values. A CIRS electron density phantom was scanned on a Siemens Biograph mCT Flow CT scanner and a GE Discovery 710 CT scanner using standard techniques that are employed in the clinic to assess the HU deviation caused by beam hardening in different tissue types. In addition, an anthropomorphic ATOM adult male upper torso phantom was scanned on the GE Discovery 710 scanner. Various amounts of Superflab bolus material were wrapped around the phantoms to simulate different patient sizes. The mean HU values that were measured in the phantoms were evaluated as a function of the water-equivalent area (A w ), a parameter that is described in the report of AAPM Task Group 220. A strategy by which to correct the HU values was developed and tested. The variation in the HU values in the anthropomorphic ATOM phantom under different simulated body sizes, both before and after correction, were compared, with a focus on the lung and bone tissues. Significant HU deviations that depended on the simulated patient size were observed. A positive correlation between HU and A w was observed for tissue types that have an HU of less than zero, while a negative correlation was observed for tissue types with HU values that are greater than zero. The magnitude of the difference increases as the underlying attenuation property deviates further away from that of water. In the electron density phantom study, the maximum observed HU differences between the measured and reference values in the cortical bone and lung materials were 426 and 94 HU, respectively. In the anthropomorphic phantom

  8. An Interview with Shiang-Kwei Wang: Digital Immigrants versus Digital Natives

    OpenAIRE

    Shaughnessy, Michael F; Kleyn Kennedy, Cynthia Anne

    2015-01-01

    In the field of instructional technology and educational technology, there has always been a discussion about the “great divide“ between digital immigrants and digital natives. Teachers often express exasperation as to the lack of skills that students often possess, and the general consensus that purports that the pupils of today are technologically literate and that their “learning curve” is vastly superior to those of past generations. In this interview, Dr. Shiang-Wei Wang responds to ques...

  9. Two alternate proofs of Wang's lune formula for sparse distributed memory and an integral approximation

    Science.gov (United States)

    Jaeckel, Louis A.

    1988-01-01

    In Kanerva's Sparse Distributed Memory, writing to and reading from the memory are done in relation to spheres in an n-dimensional binary vector space. Thus it is important to know how many points are in the intersection of two spheres in this space. Two proofs are given of Wang's formula for spheres of unequal radii, and an integral approximation for the intersection in this case.

  10. [Professor WANG Yin's academic thoughts and clinical application of acupuncture for spleen-sto-mach care].

    Science.gov (United States)

    Niu, Hua; Cao, Haibo; Wang, Yin

    Professor WANG Yin 's academic thoughts and clinical application for difficult and miscellaneous di-seases, especially acupuncture for spleen-stomach care, are introduced. Based on TCM basic theory and "ten needles for elderly" by WANG Yueting , Professor WANG Yin proposes the acupuncture for spleen-stomach care. In this method, three-element acupoint selection is applied; the conception vessel, spleen meridian of foot taiyin and stomach meridian of foot yangming were selected. The deep and penetration acupuncture with 0.4 mm×100 mm elongated needles is used at Zhongwan (CV 12), Qihai (CV 6) and Zigong (EX-CA 1), and the mild reinforcing-reducing method is used at remaining acupoints. According to the severity of diseases, fire acupuncture combined with blood-letting cupping is applied at Tianshu (ST 25), Xuehai (SP 10) and Yinlingquan (SP 9); gene-rally, two acupoints are selected and 1 to 3 mL blood-letting is appropriate. The modification based on this me-thod can be applied for various difficult and miscellaneous diseases, leading to superior efficacy.

  11. The ABCs of Chinese Pop: Wang Leehom and the Marketing of a Global Chinese Celebrity

    Directory of Open Access Journals (Sweden)

    Grace Wang

    2012-06-01

    Full Text Available How did singer Wang Leehom, a Chinese American raised in the suburbs of New York, end up becoming one of the industry heavyweights of Mandopop (Mandarin-language pop music? This essay uses Wang as a case study to investigate how discourses of race, market, and belonging are reworked in global contexts. Drawing on Sau-ling Wong’s theoretical insights on transnational processes of race, citizenship, and belonging, it argues that Wang capitalizes on a fluid dynamic of sameness and difference to appeal to a heterogeneous Chinese-speaking audience that stretches across China to Taiwan, Hong Kong, Southeast Asia, and the greater Chinese diaspora. Through an examination of the racial and national contexts that frame Wang’s participation in Mandopop, this essay analyzes the particular calibrations of Chineseness that emerge from the singer’s music and public image and the imperfect translation of identities such as Chinese American, Chinese diasporic, and Chinese across diverse linguistic and national communities.

  12. HuD Regulates Coding and Noncoding RNA to Induce APP→Aβ Processing

    Directory of Open Access Journals (Sweden)

    Min-Ju Kang

    2014-06-01

    Full Text Available The primarily neuronal RNA-binding protein HuD is implicated in learning and memory. Here, we report the identification of several HuD target transcripts linked to Alzheimer’s disease (AD pathogenesis. HuD interacted with the 3′ UTRs of APP mRNA (encoding amyloid precursor protein and BACE1 mRNA (encoding β-site APP-cleaving enzyme 1 and increased the half-lives of these mRNAs. HuD also associated with and stabilized the long noncoding (lncRNA BACE1AS, which partly complements BACE1 mRNA and enhances BACE1 expression. Consistent with HuD promoting production of APP and APP-cleaving enzyme, the levels of APP, BACE1, BACE1AS, and Aβ were higher in the brain of HuD-overexpressing mice. Importantly, cortex (superior temporal gyrus from patients with AD displayed significantly higher levels of HuD and, accordingly, elevated APP, BACE1, BACE1AS, and Aβ than did cortical tissue from healthy age-matched individuals. We propose that HuD jointly promotes the production of APP and the cleavage of its amyloidogenic fragment, Aβ.

  13. A series solution of the Falkner-Skan equation using the crocco-wang transformation

    Science.gov (United States)

    Asaithambi, Asai

    A direct series solution for the Falkner-Skan equation is obtained by first transforming the problem using the Crocco-Wang transformation. The transformation converts the third-order problem to a second-order two-point boundary value problem. The method first constructs a series involving the unknown skin-friction coefficient α. Then, α is determined by using the secant method or Newton’s method. The derivative needed for Newton’s method is also computed using a series derived from the transformed differential equation. The method is validated by solving the Falkner-Skan equation for several cases reported previously in the literature.

  14. Comments on "Adaptive resolution simulation in equilibrium and beyond" by H. Wang and A. Agarwal

    Science.gov (United States)

    Klein, R.

    2015-09-01

    Wang and Agarwal (Eur. Phys. J. Special Topics, this issue, 2015, doi: 10.1140/epjst/e2015-02411-2) discuss variants of Adaptive Resolution Molecular Dynamics Simulations (AdResS), and their applications. Here we comment on their report, addressing scaling properties of the method, artificial forcings implemented to ensure constant density across the full simulation despite changing thermodynamic properties of the simulated media, the possible relation between an AdResS system on the one hand and a phase transition phenomenon on the other, and peculiarities of the SPC/E water model.

  15. Security analysis of boolean algebra based on Zhang-Wang digital signature scheme

    International Nuclear Information System (INIS)

    Zheng, Jinbin

    2014-01-01

    In 2005, Zhang and Wang proposed an improvement signature scheme without using one-way hash function and message redundancy. In this paper, we show that this scheme exits potential safety concerns through the analysis of boolean algebra, such as bitwise exclusive-or, and point out that mapping is not one to one between assembly instructions and machine code actually by means of the analysis of the result of the assembly program segment, and which possibly causes safety problems unknown to the software

  16. Ning Wang, Making a Market Economy; Yan Sun, Corruption and Market in Contemporary China

    OpenAIRE

    Guiheux, Gilles

    2008-01-01

    These two works shed light on the conditions under which, in the course of the last 25 years, the command economy has been dismantled and gradually replaced by a market system in China . Yan Sun, a professor of political science, is interested in corruption from a double perspective, both at the macro and the micro level. Ning Wang, a neo-institutionalist economist, asks how, thanks to the reforms, a region (Jingzhou, south of Hubei ) has been converted to pisciculture. Corruption is a crucia...

  17. Security analysis of boolean algebra based on Zhang-Wang digital signature scheme

    Energy Technology Data Exchange (ETDEWEB)

    Zheng, Jinbin, E-mail: jbzheng518@163.com [School of Mathematics and Computer Science, Long Yan University, Longyan 364012 (China)

    2014-10-06

    In 2005, Zhang and Wang proposed an improvement signature scheme without using one-way hash function and message redundancy. In this paper, we show that this scheme exits potential safety concerns through the analysis of boolean algebra, such as bitwise exclusive-or, and point out that mapping is not one to one between assembly instructions and machine code actually by means of the analysis of the result of the assembly program segment, and which possibly causes safety problems unknown to the software.

  18. OPTIMIZATION-BASED APPROACH TO TILING OF FINITE AREAS WITH ARBITRARY SETS OF WANG TILES

    Directory of Open Access Journals (Sweden)

    Marek Tyburec

    2017-11-01

    Full Text Available Wang tiles proved to be a convenient tool for the design of aperiodic tilings in computer graphics and in materials engineering. While there are several algorithms for generation of finite-sized tilings, they exploit the specific structure of individual tile sets, which prevents their general usage. In this contribution, we reformulate the NP-complete tiling generation problem as a binary linear program, together with its linear and semidefinite relaxations suitable for the branch and bound method. Finally, we assess the performance of the established formulations on generations of several aperiodic tilings reported in the literature, and conclude that the linear relaxation is better suited for the problem.

  19. Measurement of hard tissue density of head phantom based on the HU by using CBCT

    International Nuclear Information System (INIS)

    Kim, Moon Sun; Kang, Dong Wan; Kim, Jae Duk

    2009-01-01

    The purpose of this study was to determine a conversion coefficient for Hounsfield Units(HU) to material density (g cm -3 ) obtained from cone-beam computed tomography (CBMercuRay TM ) data and to measure the hard tissue density based on the Hounsfield scale on dental head phantom. CT Scanner Phantom (AAPM) equipped with CT Number Insert consists of five cylindrical pins of materials with different densities and teflon ring was scanned by using the CBMercuRay TM (Hitachi, Tokyo, Japan) volume scanner. The raw data were converted into DICOM format and the HU of different areas of CT number insert measured by using CBWorks TM . Linear regression analysis and Student t-test were performed statistically. There was no significant difference (P>0.54) between real densities and measured densities. A linear regression was performed using the density, ρ (g cm -3 ), as the dependent variable in terms of the HU (H). The regression equation obtained was ρ=0.00072 H-0.01588 with an R2 value of 0.9968. Density values based on the Hounsfield scale was 1697.1 ± 24.9 HU in cortical bone, 526.5 ± 44.4 HU in trabecular bone, 2639.1 ± 48.7 HU in enamel, 1246.1 ± 39.4 HU in dentin of dental head phantom. CBCT provides an effective option for determination of material density expressed as Hounsfield Units.

  20. Nanosystems based on siRNA silencing HuR expression counteract diabetic retinopathy in rat.

    Science.gov (United States)

    Amadio, Marialaura; Pascale, Alessia; Cupri, Sarha; Pignatello, Rosario; Osera, Cecilia; D Agata, Velia; D Amico, Agata Grazia; Leggio, Gian Marco; Ruozi, Barbara; Govoni, Stefano; Drago, Filippo; Bucolo, Claudio

    2016-09-01

    We evaluated whether specifically and directly targeting human antigen R (HuR), a member of embryonic lethal abnormal vision (ELAV) proteins family, may represent a new potential therapeutic strategy to manage diabetic retinopathy. Nanosystems loaded with siRNA silencing HuR expression (lipoplexes), consisting of solid lipid nanoparticles (SLN) and liposomes (SUV) were prepared. Photon correlation spectroscopy analysis, Zeta potential measurement and atomic force microscopy (AFM) studies were carried out to characterize the complexation of siRNA with the lipid nanocarriers. Nanosystems were evaluated by using AFM and scanning electron microscopy. The lipoplexes were injected into the eye of streptozotocin (STZ)-induced diabetic rats. Retinal HuR and VEGF levels were detected by Western blot and ELISA, respectively. Retinal histology was also carried out. The results demonstrated that retinal HuR and VEGF are significantly increased in STZ-rats and are blunted by HuR siRNA treatment. Lipoplexes with a weak positive surface charge and with a 4:1 N/P (cationic lipid nitrogen to siRNA phosphate) ratio exert a better transfection efficiency, significantly dumping retinal HuR and VEGF levels. In conclusion, we demonstrated that siRNA can be efficiently delivered into the rat retina using lipid-based nanocarriers, and some of the lipoplexes loaded with siRNA silencing HuR expression are potential candidates to manage retinal diseases. Copyright © 2016 Elsevier Ltd. All rights reserved.

  1. Occurrence of chai hu (Bupleuri radix) in prescriptions of Chinese herbal medicine in Switzerland.

    Science.gov (United States)

    Klein, Sabine D; Becker, Simon; Wolf, Ursula

    2012-01-01

    Chai hu (Bupleuri radix), one of the most frequently used herbs in Chinese herbal medicine, has 3 major functions, depending on dosage and combination with other herbs. The aim of this study was to investigate how chai hu is prescribed in everyday practice in Switzerland, and whether these prescription patterns reflect its various applications. A random sample of 1,053 prescriptions was drawn from the database of Lian Chinaherb AG, Wollerau, Switzerland, and analyzed regarding the most frequently used classical formulas containing chai hu, daily dosages and combinations with other herbs. 29.0% of all prescriptions contained chai hu, and 98.0% of these were in granular form. The most frequently used classical formulas were xiao yao san ('rambling powder'), jia wei xiao yao san ('augmented rambling powder') and chai hu shu gan san ('Bupleurum powder to spread the liver'). In more than half of the prescriptions, chai hu was combined with bai shao (Paeoniae Radix Alba), dang gui (Angelicae sinensis radix) or fu ling (Poria). 51.8% of the prescriptions contained a low daily dosage of chai hu, 24.9% a medium and 15.1% a high dosage. Chai hu was generally prescribed in classic combinations with other herbs and in a medium dosage. Due to the addition of supplementary herbs to classical formulas, its daily dose was often diminished from a high or medium dose to a low dose. This raises the question if chai hu would then still exert its desired function of, e.g., moving liver-qi in these prescriptions.

  2. Metabolic aspects of growth in HU-treated crown-gall tissue cultures. II. Helianthus annuus

    Directory of Open Access Journals (Sweden)

    Aldona Rennert

    2015-01-01

    Full Text Available The dynamics of growth and changes in nucleic acid and protein contents in sunflower calluses and tumours cultured in hydroxyurea (HU containing media were examined. HU-induced changes in healthy tissues ran in parallel always in the same direction, in tumourous ones however an uncoupling between DNA synthesis and tissue growth on one hand and RNA and protein synthesis on the other took place. A detailed analysis of the results allows to suppose that the specific activity of HU on tumourous tissue could be an index of: 1 quantitative disturbances in its genes function (2 degree of the lass of sensitivity to the factors of regulation.

  3. Blocking Breast Cancer Metastasis by Targeting RNA-Binding Protein HuR

    Science.gov (United States)

    2017-10-01

    AWARD NUMBER: W81XWH-16-1-0730 TITLE: Blocking Breast Cancer Metastasis by Targeting RNA-Binding Protein HuR PRINCIPAL INVESTIGATOR: Danny Welch...NUMBER Blocking Breast Cancer Metastasis by Targeting RNA-Binding Protein HuR 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER 6. AUTHOR(S) 5d. PROJECT...increased aggressiveness in breast cancer , the primary objective of this proposal is to assess whether HuR (or analogs) prevent and/or treat metastasis and/or

  4. High quality draft genome sequence of Staphylococcus cohnii subsp. cohnii strain hu-01

    OpenAIRE

    Hu, XinJun; Li, Ang; Lv, LongXian; Yuan, Chunhui; Guo, Lihua; Jiang, Xiawei; Jiang, Haiyin; Qian, GuiRong; Zheng, BeiWen; Guo, Jing; Li, LanJuan

    2014-01-01

    Staphylococcus cohnii subsp. cohnii belongs to the family Staphylococcaceae in the order Bacillales , class Bacilli and phylum Firmicutes . The increasing relevance of S. cohnii to human health prompted us to determine the genomic sequence of Staphylococcus cohnii subsp. cohnii strain hu-01, a multidrug-resistant isolate from a hospital in China. Here we describe the features of S. cohnii subsp. cohnii strain hu-01, together with the genome sequence and its annotation. This is the first genom...

  5. Zebrafish transgenic line huORFZ is an effective living bioindicator for detecting environmental toxicants.

    Directory of Open Access Journals (Sweden)

    Hung-Chieh Lee

    Full Text Available Reliable animal models are invaluable for monitoring the extent of pollution in the aquatic environment. In this study, we demonstrated the potential of huORFZ, a novel transgenic zebrafish line that harbors a human upstream open reading frame of the chop gene fused with GFP reporter, as an animal model for monitoring environmental pollutants and stress-related cellular processes. When huORFZ embryos were kept under normal condition, no leaked GFP signal could be detected. When treated with hazardous chemicals, including heavy metals and endocrine-disrupting chemicals near their sublethal concentrations (LC50, huORFZ embryos exhibited different tissue-specific GFP expression patterns. For further analysis, copper (Cu2+, cadmium (Cd2+ and Chlorpyrifos were applied. Cu2+ triggered GFP responses in skin and muscle, whereas Cd2+ treatment triggered GFP responses in skin, olfactory epithelium and pronephric ducts. Moreover, fluorescence intensity, as exhibited by huORFZ embryos, was dose-dependent. After surviving treated embryos were returned to normal condition, survival rates, as well as TUNEL signals, returned to pretreatment levels with no significant morphological defects observed. Such results indicated the reversibility of treatment conditions used in this study, as long as embryos survived such conditions. Notably, GFP signals decreased along with recovery, suggesting that GFP signaling of huORFZ embryos likely reflected the overall physiological condition of the individual. To examine the performance of the huORFZ line under real-world conditions, we placed huORFZ embryos in different river water samples. We found that the huORFZ embryos correctly detected the presence of various kinds of pollutants. Based on these findings, we concluded that such uORFchop-based system can be integrated into a first-line water alarm system monitoring the discharge of hazardous pollutants.

  6. Zebrafish Transgenic Line huORFZ Is an Effective Living Bioindicator for Detecting Environmental Toxicants

    Science.gov (United States)

    Chu, Chien; Li, Hong-Ping; Tsai, Huai-Jen

    2014-01-01

    Reliable animal models are invaluable for monitoring the extent of pollution in the aquatic environment. In this study, we demonstrated the potential of huORFZ, a novel transgenic zebrafish line that harbors a human upstream open reading frame of the chop gene fused with GFP reporter, as an animal model for monitoring environmental pollutants and stress-related cellular processes. When huORFZ embryos were kept under normal condition, no leaked GFP signal could be detected. When treated with hazardous chemicals, including heavy metals and endocrine-disrupting chemicals near their sublethal concentrations (LC50), huORFZ embryos exhibited different tissue-specific GFP expression patterns. For further analysis, copper (Cu2+), cadmium (Cd2+) and Chlorpyrifos were applied. Cu2+ triggered GFP responses in skin and muscle, whereas Cd2+ treatment triggered GFP responses in skin, olfactory epithelium and pronephric ducts. Moreover, fluorescence intensity, as exhibited by huORFZ embryos, was dose-dependent. After surviving treated embryos were returned to normal condition, survival rates, as well as TUNEL signals, returned to pretreatment levels with no significant morphological defects observed. Such results indicated the reversibility of treatment conditions used in this study, as long as embryos survived such conditions. Notably, GFP signals decreased along with recovery, suggesting that GFP signaling of huORFZ embryos likely reflected the overall physiological condition of the individual. To examine the performance of the huORFZ line under real-world conditions, we placed huORFZ embryos in different river water samples. We found that the huORFZ embryos correctly detected the presence of various kinds of pollutants. Based on these findings, we concluded that such uORFchop-based system can be integrated into a first-line water alarm system monitoring the discharge of hazardous pollutants. PMID:24594581

  7. dNTP deficiency induced by HU via inhibiting ribonucleotide reductase affects neural tube development

    International Nuclear Information System (INIS)

    Guan, Zhen; Wang, Xiuwei; Dong, Yanting; Xu, Lin; Zhu, Zhiqiang; Wang, Jianhua; Zhang, Ting; Niu, Bo

    2015-01-01

    Highlights: • Murine NTDs were successfully induced by means of hydroxyurea (HU). • The impairment of dNTP was induced via inhibition of ribonucleotide reductase. • dNTP deficiency induced by HU caused defective DNA synthesis and repair. • Abnormal apoptosis and proliferation induced by HU affected neural tube development. - Abstract: Exposure to environmental toxic chemicals in utero during the neural tube development period can cause developmental disorders. To evaluate the disruption of neural tube development programming, the murine neural tube defects (NTDs) model was induced by interrupting folate metabolism using methotrexate in our previous study. The present study aimed to examine the effects of dNTP deficiency induced by hydroxyurea (HU), a specific ribonucleotide reductase (RNR) inhibitor, during murine neural tube development. Pregnant C57BL/6J mice were intraperitoneally injected with various doses of HU on gestation day (GD) 7.5, and the embryos were checked on GD 11.5. RNR activity and deoxynucleoside triphosphate (dNTP) levels were measured in the optimal dose. Additionally, DNA damage was examined by comet analysis and terminal deoxynucleotidyl transferase mediated dUTP nick end-labeling (TUNEL) assay. Cellular behaviors in NTDs embryos were evaluated with phosphorylation of histone H3 (PH-3) and caspase-3 using immunohistochemistry and western blot analysis. The results showed that NTDs were observed mostly with HU treatment at an optimal dose of 225 mg/kg b/w. RNR activity was inhibited and dNTP levels were decreased in HU-treated embryos with NTDs. Additionally, increased DNA damage, decreased proliferation, and increased caspase-3 were significant in NTDs embryos compared to the controls. Results indicated that HU induced murine NTDs model by disturbing dNTP metabolism and further led to the abnormal cell balance between proliferation and apoptosis

  8. Different modes of interaction by TIAR and HuR with target RNA and DNA.

    Science.gov (United States)

    Kim, Henry S; Wilce, Matthew C J; Yoga, Yano M K; Pendini, Nicole R; Gunzburg, Menachem J; Cowieson, Nathan P; Wilson, Gerald M; Williams, Bryan R G; Gorospe, Myriam; Wilce, Jacqueline A

    2011-02-01

    TIAR and HuR are mRNA-binding proteins that play important roles in the regulation of translation. They both possess three RNA recognition motifs (RRMs) and bind to AU-rich elements (AREs), with seemingly overlapping specificity. Here we show using SPR that TIAR and HuR bind to both U-rich and AU-rich RNA in the nanomolar range, with higher overall affinity for U-rich RNA. However, the higher affinity for U-rich sequences is mainly due to faster association with U-rich RNA, which we propose is a reflection of the higher probability of association. Differences between TIAR and HuR are observed in their modes of binding to RNA. TIAR is able to bind deoxy-oligonucleotides with nanomolar affinity, whereas HuR affinity is reduced to a micromolar level. Studies with U-rich DNA reveal that TIAR binding depends less on the 2'-hydroxyl group of RNA than HuR binding. Finally we show that SAXS data, recorded for the first two domains of TIAR in complex with RNA, are more consistent with a flexible, elongated shape and not the compact shape that the first two domains of Hu proteins adopt upon binding to RNA. We thus propose that these triple-RRM proteins, which compete for the same binding sites in cells, interact with their targets in fundamentally different ways.

  9. NOTES AND CORRESPONDENCE Evaluation of Tidal Removal Method Using Phase Average Technique from ADCP Surveys along the Peng-Hu Channel in the Taiwan Strait

    Directory of Open Access Journals (Sweden)

    Yu-Chia Chang

    2008-01-01

    Full Text Available Three cruises with shipboard Acoustic Doppler Current Profiler (ADCP were performed along a transect across the Peng-hu Channel (PHC in the Taiwan Strait during 2003 - 2004 in order to investigate the feasibility and accuracy of the phase-averaging method to eliminate tidal components from shipboard ADCP measurement of currents. In each cruise measurement was repeated a number of times along the transect with a specified time lag of either 5, 6.21, or 8 hr, and the repeated data at the same location were averaged to eliminate the tidal currents; this is the so-called ¡§phase-averaging method¡¨. We employed 5-phase-averaging, 4-phase-averaging, 3-phase-averaging, and 2-phase-averaging methods in this study. The residual currents and volume transport of the PHC derived from various phase-averaging methods were intercompared and were also compared with results of the least-square harmonic reduction method proposed by Simpson et al. (1990 and the least-square interpolation method using Gaussian function (Wang et al. 2004. The estimated uncertainty of the residual flow through the PHC derived from the 5-phase-averaging, 4-phase-averaging, 3-phase-averaging, and 2-phase-averaging methods is 0.3, 0.3, 1.3, and 4.6 cm s-1, respectively. Procedures for choosing a best phase average method to remove tidal currents in any particular region are also suggested.

  10. Surface adsorption of lattice HP proteins: Thermodynamics and structural transitions using Wang-Landau sampling

    International Nuclear Information System (INIS)

    Li Yingwai; Landau, David P; Wüst, Thomas

    2012-01-01

    Wang-Landau sampling has been applied to investigate the thermodynamics and structural properties of a lattice hydrophobic-polar heteropolymer (the HP protein model) interacting with an attractive substrate. For simplicity, we consider a short HP sequence consisting of only 36 monomers interacting with a substrate which attracts all monomers in the sequence. The conformational “phase transitions” have been identified by a canonical analysis of the specific heat and suitable structural observables. Three major “transitions”, namely, adsorption, hydrophobic core formation and “flattening” of adsorbed structures, are observed. Depending on the surface attractive strength relative to the intra-protein attraction among the H monomers, these processes take place in different sequences upon cooling.

  11. Chen-Nester-Tung quasi-local energy and Wang-Yau quasi-local mass

    Science.gov (United States)

    Liu, Jian-Liang; Yu, Chengjie

    2017-10-01

    In this paper, we show that the Chen-Nester-Tung (CNT) quasi-local energy with 4D isometric matching references is closely related to the Wang-Yau (WY) quasi-local energy. As a particular example, we compute the second variation of the CNT quasi-local energy for axially symmetric Kerr-like spacetimes with axially symmetric embeddings at the obvious critical point (0 , 0) and find that it is a saddle critical point in most of the cases. Also, as a byproduct, we generalize a previous result about the coincidence of the CNT quasi-local energy and Brown-York mass for axially symmetric Kerr-like spacetimes by Tam and the first author Liu and Tam (2016) to general spacetimes.

  12. Interview with Xiaoli Wang PhD winner of CACA 2016 Young Investigator Award

    Directory of Open Access Journals (Sweden)

    Xiaoli Wang

    2016-07-01

    Full Text Available Xiaoli Wang is currently an R&D Senior Scientist in Agilent’s HPLC instrument R&D group at Agilent Technologies, Waldbronn, Germany. Prior to this, he was an R&D manager in Agilent’s CrossLab Group in the US focusing on development of novel chromatographic columns. He has a B.S. degree in Chemistry from Peking University, Beijing China and a PhD. degree in Analytical Chemistry from the University of Minnesota in 2006. He started his industrial career in the pharmaceutical industry at AstraZeneca for four years before joining Agilent Technologies in 2010. Recently, he won the prestigious 2016 Young Investigator Award from Chinese American Chromatography Association (CACA. This interview was conducted by Roland J.W. Meesters PhD, Editor-in-Chief of Journal of Applied Bioanalysis.

  13. From Wang-Chen System with Only One Stable Equilibrium to a New Chaotic System Without Equilibrium

    Science.gov (United States)

    Pham, Viet-Thanh; Wang, Xiong; Jafari, Sajad; Volos, Christos; Kapitaniak, Tomasz

    2017-06-01

    Wang-Chen system with only one stable equilibrium as well as the coexistence of hidden attractors has attracted increasing interest due to its striking features. In this work, the effect of state feedback on Wang-Chen system is investigated by introducing a further state variable. It is worth noting that a new chaotic system without equilibrium is obtained. We believe that the system is an interesting example to illustrate the conversion of hidden attractors with one stable equilibrium to hidden attractors without equilibrium.

  14. The synthetic cannabinoid HU210 induces spatial memory deficits and suppresses hippocampal firing rate in rats.

    Science.gov (United States)

    Robinson, L; Goonawardena, A V; Pertwee, R G; Hampson, R E; Riedel, G

    2007-07-01

    Previous work implied that the hippocampal cannabinoid system was particularly important in some forms of learning, but direct evidence for this hypothesis is scarce. We therefore assessed the effects of the synthetic cannabinoid HU210 on memory and hippocampal activity. HU210 (100 microg kg(-1)) was administered intraperitoneally to rats under three experimental conditions. One group of animals were pre-trained in spatial working memory using a delayed-matching-to-position task and effects of HU210 were assessed in a within-subject design. In another, rats were injected before acquisition learning of a spatial reference memory task with constant platform location. Finally, a separate group of animals was implanted with electrode bundles in CA1 and CA3 and single unit responses were isolated, before and after HU210 treatment. HU210 treatment had no effect on working or short-term memory. Relative to its control Tween 80, deficits in acquisition of a reference memory version of the water maze were obtained, along with drug-related effects on anxiety, motor activity and spatial learning. Deficits were not reversed by the CB(1) receptor antagonists SR141716A (3 mg kg(-1)) or AM281 (1.5 mg kg(-1)). Single unit recordings from principal neurons in hippocampal CA3 and CA1 confirmed HU210-induced attenuation of the overall firing activity lowering both the number of complex spikes fired and the occurrence of bursts. These data provide the first direct evidence that the underlying mechanism for the spatial memory deficits induced by HU210 in rats is the accompanying abnormality in hippocampal cell firing.

  15. HuR represses Wnt/β-catenin-mediated transcriptional activity by promoting cytoplasmic localization of β-catenin

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Inae; Hur, Jung; Jeong, Sunjoo, E-mail: sjsj@dankook.ac.kr

    2015-01-30

    Highlights: • Wnt signaling as well as β-catenin overexpression enhance HuR cytoplasmic export. • HuR overexpression promotes cytoplasmic localization of β-catenin from the perinuclear fraction. • Wnt/β-catenin-mediated transcriptional activity is repressesed by HuR. - Abstract: β-Catenin is the key transcriptional activator of canonical Wnt signaling in the nucleus; thus, nuclear accumulation of β-catenin is a critical step for expressing target genes. β-Catenin accumulates in the nucleus of cancer cells where it activates oncogenic target genes. Hu antigen R (HuR) is a RNA binding protein that regulates multiple post-transcriptional processes including RNA stability. Thus, cytoplasmic HuR protein may be involved in tumorigenesis by stabilizing oncogenic transcripts, but the molecular mechanism remains unclear. Here, we observed that Wnt/β-catenin signaling induced export of the HuR protein, whereas HuR overexpression promoted accumulation of the β-catenin protein in the cytoplasm. Thus, Wnt/β-catenin-mediated transcriptional activity in the nucleus was reduced by overexpressing HuR. These results suggest novel and uncharacterized cytoplasmic β-catenin functions related to HuR-mediated RNA metabolism in cancer cells.

  16. HuR represses Wnt/β-catenin-mediated transcriptional activity by promoting cytoplasmic localization of β-catenin

    International Nuclear Information System (INIS)

    Kim, Inae; Hur, Jung; Jeong, Sunjoo

    2015-01-01

    Highlights: • Wnt signaling as well as β-catenin overexpression enhance HuR cytoplasmic export. • HuR overexpression promotes cytoplasmic localization of β-catenin from the perinuclear fraction. • Wnt/β-catenin-mediated transcriptional activity is repressesed by HuR. - Abstract: β-Catenin is the key transcriptional activator of canonical Wnt signaling in the nucleus; thus, nuclear accumulation of β-catenin is a critical step for expressing target genes. β-Catenin accumulates in the nucleus of cancer cells where it activates oncogenic target genes. Hu antigen R (HuR) is a RNA binding protein that regulates multiple post-transcriptional processes including RNA stability. Thus, cytoplasmic HuR protein may be involved in tumorigenesis by stabilizing oncogenic transcripts, but the molecular mechanism remains unclear. Here, we observed that Wnt/β-catenin signaling induced export of the HuR protein, whereas HuR overexpression promoted accumulation of the β-catenin protein in the cytoplasm. Thus, Wnt/β-catenin-mediated transcriptional activity in the nucleus was reduced by overexpressing HuR. These results suggest novel and uncharacterized cytoplasmic β-catenin functions related to HuR-mediated RNA metabolism in cancer cells

  17. Estudo da anomalia de Pelger-Huët em núcleo familiar Pelger-Huët anomaly study in a family

    Directory of Open Access Journals (Sweden)

    Patrícia H. O. Calderan

    2008-02-01

    Full Text Available The Pelger-Huët anomaly is a dominant autosomal disease, characterized by the incomplete segmentation of the granulocytes nucleus without lost of the cellular function. The heterozygotes form of this anomaly is assintomatic and it did not possess physic meant, while the homozygote form is rare and can be lethal, being therefore, important differentiates of other infectious alterations. The pseudo-anomaly can occasionally be observed in cases of granulocitic leukemia, mieloproliferatives Diseases, some infections and after exposition the determined drugs. We evaluate eleven members of a familiar nucleus and, after the blood cells analysis, six of then had presented neutrophils and eosinophils with nuclei characteristic of the heterozygotes form of the Pelger-Huët anomaly. The recognition of this leukocyte anomaly, mainly in patients without infection and presenting great number of not segmented neutrophils, can prevent wrong interpretations of the blood cells count and unnecessary clinical and therapeutically behaviors.

  18. Activity-dependent expression of ELAV/Hu RBPs and neuronal mRNAs in seizure and cocaine brain.

    Science.gov (United States)

    Tiruchinapalli, Dhanrajan M; Caron, Marc G; Keene, Jack D

    2008-12-01

    Growing evidence indicates that both seizure (glutamate) and cocaine (dopamine) treatment modulate synaptic plasticity within the mesolimbic region of the CNS. Activation of glutamatergic neurons depends on the localized translation of neuronal mRNA products involved in modulating synaptic plasticity. In this study, we demonstrate the dendritic localization of HuR and HuD RNA-binding proteins (RBPs) and their association with neuronal mRNAs following these two paradigms of seizure and cocaine treatment. Both the ubiquitously expressed HuR and neuronal HuD RBPs were detected in different regions as well as within dendrites of the brain and in dissociated neurons. Quantitative analysis revealed an increase in HuR, HuD and p-glycogen synthase kinase 3beta (GSK3beta) protein levels as well as neuronal mRNAs encoding Homer, CaMKIIalpha, vascular early response gene, GAP-43, neuritin, and neuroligin protein products following either seizure or cocaine treatment. Inhibition of the Akt/GSK3beta signaling pathway by acute or chronic LiCl treatment revealed changes in HuR, HuD, pGSK3beta, p-Akt, and beta-catenin protein levels. In addition, a genetically engineered hyperdopaminergic mouse model (dopamine transporter knockout) revealed decreased expression of HuR protein levels, but no significant change was observed in HuD or fragile-X mental retardation protein RBPs. Finally, our data suggest that HuR and HuD RBPs potentially interact directly with neuronal mRNAs important for differentiation and synaptic plasticity.

  19. An experimental study of mechanism in treatment for endometriosis with Xiao Chai Hu Tang in rats

    International Nuclear Information System (INIS)

    Zhang Hui; Zuo Liandong; Li Hongyi

    2005-01-01

    To explore the mechanism of Xiao Chai Hu Tang in treatment for endometriosis in rats, the rat model of endometriosis was established. Using immunohistochemistry method, Fas and Caspase-3 protein expression in endometrium and endometriotic tissue of each group were observed. The results showed that in the group treated with Xiao Chai Hu Tang, the protein expressions of Fas and Caspase-3 in endometriotic tissue were higher than those in endometrium, while in the control group, the result was just opposite. The difference was not obvious in the group treated with Danazol . The higher levels of the protein expression of Fas in endometriotic tissue may related to the pathogenesis of the endometriosis. The mechanism of Xiao Chai Hu Tang treatment may be partly to increase apoptosis in endometriotic tissue. (authors)

  20. Effets des sels organiques de tributyletain sur l'huître adulte Crassostrea gigas

    OpenAIRE

    Heral, Maurice; Alzieu, Claude; Caux, O.; Razet, Daniel; Garnier, Jacqueline

    1983-01-01

    La toxicité des composés organostanniques a été mise en évidence à l'égard de l'huître Crassostrea gigas tant aux stades larvaires (His & Robert, 1980) que chez l'adulte (Alzieu & al., 1980, 1981). Parallèlement ces mêmes auteurs ont montré l'accumulation d'étain dans les huîtres contaminées expérimentalement ainsi que le rôle que peut jouer le fluorure de TBT dans la perturbation de la croissance (Héral & al. 1981) et dans la malformation de la coquille des huîtres (Alzieu & al., 1981). Dans...

  1. Nilai Kalor Bakar Limbah Padat (HuWAC Sebagai Bahan Bakar Alternatif dalam Produksi Batu Bata

    Directory of Open Access Journals (Sweden)

    Soeparjono Soeparjono

    2009-02-01

    Full Text Available Menipisnya persediaan minyak bumi dan sulitnya mendapatkan kayu bakar dengan harga murah sebagai bahan bakar untuk kalangan industri kecil produksi batu bata, diperlukan adanya pemikiran mencari bahan bakar alternatif dan murah. Penelitian ini bertujuan mengetahui nilai kalor bakar limbah HuWAC sebagai bahan bakar alternatif untuk produksi batu merah. Sasarannya limbah HuWAC pabrik monosodium glutamat AJINOMOTO Mojokerto dengan sampel acak yang dikeringkan panas matahari. Penelitian menggunakan pendekatan kuantitatif rancangan deskriptif. Unsur-unsur yang terbakar dalam sampel dilakukan koreksi. Pengambilan data dilakukan secara langsung dengan alat Kalorimeter. Hasil penelitian menunjukkan bahwa nilai kalor bakar yang dihitung dengan formula Dulong, LVH = 2614 kcal/kg dan HHV = 2745 kcal/kg, sedangkan dari alat Kalorimeter Hgr = 2728 kcal/kg. Hal ini menunjukkan bahwa HuWAC dapat digunakan sebagai bahan bakar alternatif di kalangan industri kecil produksi batu bata.

  2. HuMOVE: a low-invasive wearable monitoring platform in sexual medicine.

    Science.gov (United States)

    Ciuti, Gastone; Nardi, Matteo; Valdastri, Pietro; Menciassi, Arianna; Basile Fasolo, Ciro; Dario, Paolo

    2014-10-01

    To investigate an accelerometer-based wearable system, named Human Movement (HuMOVE) platform, designed to enable quantitative and continuous measurement of sexual performance with minimal invasiveness and inconvenience for users. Design, implementation, and development of HuMOVE, a wearable platform equipped with an accelerometer sensor for monitoring inertial parameters for sexual performance assessment and diagnosis, were performed. The system enables quantitative measurement of movement parameters during sexual intercourse, meeting the requirements of wearability, data storage, sampling rate, and interfacing methods, which are fundamental for human sexual intercourse performance analysis. HuMOVE was validated through characterization using a controlled experimental test bench and evaluated in a human model during simulated sexual intercourse conditions. HuMOVE demonstrated to be a robust and quantitative monitoring platform and a reliable candidate for sexual performance evaluation and diagnosis. Characterization analysis on the controlled experimental test bench demonstrated an accurate correlation between the HuMOVE system and data from a reference displacement sensor. Experimental tests in the human model during simulated intercourse conditions confirmed the accuracy of the sexual performance evaluation platform and the effectiveness of the selected and derived parameters. The obtained outcomes also established the project expectations in terms of usability and comfort, evidenced by the questionnaires that highlighted the low invasiveness and acceptance of the device. To the best of our knowledge, HuMOVE platform is the first device for human sexual performance analysis compatible with sexual intercourse; the system has the potential to be a helpful tool for physicians to accurately classify sexual disorders, such as premature or delayed ejaculation. Copyright © 2014 Elsevier Inc. All rights reserved.

  3. Pengaruh insektisida deltametrin terhadap perilaku orientasi parasitoid Anagrus nilaparvatae (Pang et Wang (Hymenoptera: Mymaridae

    Directory of Open Access Journals (Sweden)

    Araz Meilin

    2016-09-01

    Full Text Available Host searching behaviour by a parasitoid includes orientation to the volatile compounds (odor relesead by host or host plant. The aim of this study was to determine the changes in the orientation behaviour of Anagrus nilaparvatae (Pang et Wang, the egg parasitoid of rice brown planthoppers (Nilaparvata lugens (Stål, after being exposed to sublethal concentrations of deltamethrin. The impact of residue on plants to the behaviour of parasitoid was also studied. The sublethal concentrations (LC10 and LC40 used were 0.023 ppm and 2.235 ppm, respectively. Deltamethrin applied to the rice plants were 12.5 ppm and 6.25 ppm, and its effect was observed at 3 hours, 1, 3 and 7 days after application. Orientation behavior was studied using Y-tube olfactometer. Application of deltamethrin at subletal concentration reduced the ability of surviving A. nilaparvatae to detect odors (volatile ompounds released by the host, N. lugens. The higher the concentration of deltamethrin applied to the parasitoid or to the rice plants, the more prominent effect observed in the changing in the parasitoid behavious, in particular disruption to the parasitoid’s orientation to find their host. As consequences, effects of deltamethrin may lead to reduce the effectiveness of A. nilaparvatae as biological control agents in the field as a result of declining their searching capacity. 

  4. High quality draft genome sequence of Staphylococcus cohnii subsp. cohnii strain hu-01.

    Science.gov (United States)

    Hu, XinJun; Li, Ang; Lv, LongXian; Yuan, Chunhui; Guo, Lihua; Jiang, Xiawei; Jiang, Haiyin; Qian, GuiRong; Zheng, BeiWen; Guo, Jing; Li, LanJuan

    2014-06-15

    Staphylococcus cohnii subsp. cohnii belongs to the family Staphylococcaceae in the order Bacillales, class Bacilli and phylum Firmicutes. The increasing relevance of S. cohnii to human health prompted us to determine the genomic sequence of Staphylococcus cohnii subsp. cohnii strain hu-01, a multidrug-resistant isolate from a hospital in China. Here we describe the features of S. cohnii subsp. cohnii strain hu-01, together with the genome sequence and its annotation. This is the first genome sequence of the species Staphylococcus cohnii.

  5. Different modes of interaction by TIAR and HuR with target RNA and DNA

    OpenAIRE

    Kim, Henry S.; Wilce, Matthew C. J.; Yoga, Yano M. K.; Pendini, Nicole R.; Gunzburg, Menachem J.; Cowieson, Nathan P.; Wilson, Gerald M.; Williams, Bryan R. G.; Gorospe, Myriam; Wilce, Jacqueline A.

    2011-01-01

    TIAR and HuR are mRNA-binding proteins that play important roles in the regulation of translation. They both possess three RNA recognition motifs (RRMs) and bind to AU-rich elements (AREs), with seemingly overlapping specificity. Here we show using SPR that TIAR and HuR bind to both U-rich and AU-rich RNA in the nanomolar range, with higher overall affinity for U-rich RNA. However, the higher affinity for U–rich sequences is mainly due to faster association with U-rich RNA, which we propose i...

  6. Nuevos centros de almacenamiento inca en Huánuco Pampa

    OpenAIRE

    Ordóñez Inga, Carlo José Alonso

    2013-01-01

    Se proporcionan nuevos alcances sobre la identificación y el estudio de nuevos lugares de almacenamiento o colcas asociados al Centro Administrativo Inca de Huánuco Pampa, los mismos que no fueron reconocidos por otros investigadores que trabajaron en la zona.

  7. Rare Association of Anti-Hu Antibody Positive Paraneoplastic Neurological Syndrome and Transitional Cell Bladder Carcinoma

    Directory of Open Access Journals (Sweden)

    S. Lukacs

    2012-01-01

    Full Text Available Introduction. Paraneoplastic encephalomyelitis (PEM and subacute sensory neuronopathy (SSN are remote effects of cancer, usually associated with small-cell lung carcinoma and positive anti-Hu antibody. We describe the rare association of bladder transitional cell carcinoma (TCC with anti-Hu antibody positivity resulting in this paraneoplastic neurological syndrome. Patient. A 76-year-old female presented with bilateral muscle weakness and paraesthesia of the upper and lower limbs in a length-dependent “glove and stocking” distribution. Central nervous system symptoms included cognitive problems, personality change, and truncal ataxia. Case notes and the literature were reviewed. Result. Autoantibody screening was positive for anti-Hu antibody (recently renamed antineuronal nuclear antibody 1, ANNA-1. The diagnosis of PEM and SSN was supported by MRI and lumbar puncture results. A superficial bladder TCC was demonstrated on CT and subsequently confirmed on histology. No other primary neoplasm was found on full-body imaging. The neurological symptoms were considered to be an antibody-mediated paraneoplastic neurological syndrome and improved after resection of the tumour. Discussion. The association of anti-Hu positive paraneoplastic neurological syndrome and TCC has not been described in the literature previously. We emphasize the need for detailed clinical examination and the importance of a multidisciplinary thought process and encourage further awareness of this rare association.

  8. The herbal mixture Xiao-Chai-Hu Tang (XCHT) induces apoptosis of ...

    African Journals Online (AJOL)

    Background: Xiao-Chai-Hu Tang (XCHT) is an extract of seven herbs with anticancer properties, but its mechanism of action is unknown. In this study, we evaluated XCHT-treated hepatocellular carcinoma (HCC) for anti-proliferative and pro-apoptotic effects. Materials and Methods: Using a hepatic cancer xenograft model, ...

  9. Extended Hu¨ckel Calculations on Solids Using the Avogadro Molecular Editor and Visualizer

    Science.gov (United States)

    Avery, Patrick; Ludoweig, Herbert; Autschbach, Jochen; Zurek, Eva

    2018-01-01

    The "Yet Another extended Hu¨ckel Molecular Orbital Package" (YAeHMOP) has been merged with the Avogadro open-source molecular editor and visualizer. It is now possible to perform YAeHMOP calculations directly from the Avogadro graphical user interface for materials that are periodic in one, two, or three dimensions, and to visualize…

  10. Simultaneous Administration of ADSCs-Based Therapy and Gene Therapy Using Ad-huPA Reduces Experimental Liver Fibrosis.

    Science.gov (United States)

    Meza-Ríos, Alejandra; García-Benavides, Leonel; García-Bañuelos, Jesus; Salazar-Montes, Adriana; Armendáriz-Borunda, Juan; Sandoval-Rodríguez, Ana

    2016-01-01

    hADSCs transplantation in cirrhosis models improves liver function and reduces fibrosis. In addition, Ad-huPA gene therapy diminished fibrosis and increased hepatocyte regeneration. In this study, we evaluate the combination of these therapies in an advanced liver fibrosis experimental model. hADSCs were expanded and characterized before transplantation. Ad-huPA was simultaneously administrated via the ileac vein. Animals were immunosuppressed by CsA 24 h before treatment and until sacrifice at 10 days post-treatment. huPA liver expression and hADSCs biodistribution were evaluated, as well as the percentage of fibrotic tissue, hepatic mRNA levels of Col-αI, TGF-β1, CTGF, α-SMA, PAI-I, MMP2 and serum levels of ALT, AST and albumin. hADSCs homed mainly in liver, whereas huPA expression was similar in Ad-huPA and hADSCs/Ad-huPA groups. hADSCs, Ad-huPA and hADSCs/Ad-huPA treatment improves albumin levels, reduces liver fibrosis and diminishes Collagen α1, CTGF and α-SMA mRNA liver levels. ALT and AST serum levels showed a significant decrease exclusively in the hADSCs group. These results showed that combinatorial effect of cell and gene-therapy does not improve the antifibrogenic effects of individual treatments, whereas hADSCs transplantation seems to reduce liver fibrosis in a greater proportion.

  11. Immunostimulatory effects of natural human interferon-alpha (huIFN-alpha) on carps Cyprinus carpio L.

    Science.gov (United States)

    Watanuki, Hironobu; Chakraborty, Gunimala; Korenaga, Hiroki; Kono, Tomoya; Shivappa, R B; Sakai, Masahiro

    2009-10-15

    Human interferon-alpha (huIFN-alpha) is an important immunomodulatory substance used in the treatment and prevention of numerous infectious and immune-related diseases in animals. However, the immunostimulatory effects of huIFN-alpha in fish remain to be investigated. In the current study, the immune responses of the carp species Cyprinus carpio L. to treatment with huIFN-alpha were analyzed via measurement of superoxide anion production, phagocytic activity and the expression of cytokine genes including interleukin-1beta, tumor necrosis factor-alpha and interleukin 10. Low doses of huIFN-alpha were administered orally once a day for 3 days, and sampling was carried out at 1, 3 and 5 days post-treatment. Our results indicate that a low dose of huIFN-alpha significantly increased phagocytic activity and superoxide anion production in the carp kidney. The huIFN-alpha-treated fish also displayed a significant upregulation in cytokine gene expression. The current study demonstrates the stimulatory effects of huIFN-alpha on the carp immune system and highlights the immunomodulatory role of huIFN-alpha in fish.

  12. Drug Transporter Expression and Activity in Human Hepatoma HuH-7 Cells

    Directory of Open Access Journals (Sweden)

    Elodie Jouan

    2016-12-01

    Full Text Available Human hepatoma cells may represent a valuable alternative to the use of human hepatocytes for studying hepatic drug transporters, which is now a regulatory issue during drug development. In the present work, we have characterized hepatic drug transporter expression, activity and regulation in human hepatoma HuH-7 cells, in order to determine the potential relevance of these cells for drug transport assays. HuH-7 cells displayed notable multidrug resistance-associated protein (MRP activity, presumed to reflect expression of various hepatic MRPs, including MRP2. By contrast, they failed to display functional activities of the uptake transporters sodium taurocholate co-transporting polypeptide (NTCP, organic anion-transporting polypeptides (OATPs and organic cation transporter 1 (OCT1, and of the canalicular transporters P-glycoprotein and breast cancer resistance protein (BCRP. Concomitantly, mRNA expressions of various sinusoidal and canalicular hepatic drug transporters were not detected (NTCP, OATP1B1, organic anion transporter 2 (OAT2, OCT1 and bile salt export pump or were found to be lower (OATP1B3, OATP2B1, multidrug and toxin extrusion protein 1, BCRP and MRP3 in hepatoma HuH-7 cells than those found in human hepatocytes, whereas other transporters such as OAT7, MRP4 and MRP5 were up-regulated. HuH-7 cells additionally exhibited farnesoid X receptor (FXR- and nuclear factor erythroid 2-related factor 2 (Nrf2-related up-regulation of some transporters. Such data indicate that HuH-7 cells, although expressing rather poorly some main hepatic drug transporters, may be useful for investigating interactions of drugs with MRPs, notably MRP2, and for studying FXR- or Nrf2-mediated gene regulation.

  13. Comparison of the Wang and Wachsmuth models for π production with measurements at 12 GeV/c

    International Nuclear Information System (INIS)

    Fernow, R.C.

    1996-01-01

    We converted the invariant cross section measurements of Blobel et al. at 12 GeV/c into the form d 2 σ/dΩdp as a function of the LAB total momentum p and p T . We adjusted the parameters of the pion production models of Wang and of Wachsmuth-Hagedorn-Ranft to obtain the best fit to the data. Neither model gave a statistically accurate fit to the data. copyright 1995 American Institute of Physics

  14. Becoming an International Scientist in South Korea: Ho Wang Lee’s Research Activity about Epidemic Hemorrhagic Fever

    Directory of Open Access Journals (Sweden)

    Miyoung SHIN

    2017-04-01

    Full Text Available In the 1960-70s, South Korea was still in the position of a science latecomer. Although the scientific research environment in South Korea at that time was insufficient, there was a scientist who achieved outcomes that could be recognized internationally while acting in South Korea. He was Ho Wang Lee(1928~ who found Hantann Virus that causes epidemic hemorrhagic fever for the first time in the world. It became a clue to identify causative viruses of hemorrhagic diseases that were scattered here and there throughout the world. In addition, these outcomes put Ho Wang Lee on the global center of research into epidemic hemorrhagic fever. This paper examines how a Korean scientist who was in the periphery of virology could go into the central area of virology. Also this article shows the process through which the virus found by Ho Wang Lee was registered with the international academia and he proceeded with follow-up research based on this progress to reach the level at which he generalized epidemic hemorrhagic fever related studies throughout the world. While he was conducting the studies, experimental methods that he had never experienced encountered him as new difficulties. He tried to solve the new difficulties faced in his changed status through devices of cooperation and connection. Ho Wang Lee’s growth as a researcher can be seen as well as a view of a researcher that grew from a regional level to an international level and could advance from the area of non-mainstream into the mainstream. This analytic tool is meaningful in that it can be another method of examining the growth process of scientists in South Korea or developing countries.

  15. Influence of yield on in vitro accumulation of aflatoxins in pecan (Carya illinoensis (Wang.) K. Koch) nutmeats.

    Science.gov (United States)

    McMeans, J L

    1983-02-01

    Pecans were harvested from trees (Carya illinoensis (Wang.) K. Koch) in November of 1977 through 1979. Kernel meals from high-, medium-, and low-yielding trees were inoculated with a spore suspension of Aspergillus parasiticus and incubated for 7 days at 25 degrees C. Significant differences in aflatoxin accumulation were found among the three substrates, with a direct correlation between high aflatoxin concentration and tree yield.

  16. Influence of yield on in vitro accumulation of aflatoxins in pecan (Carya illinoensis (Wang.) K. Koch) nutmeats.

    OpenAIRE

    McMeans, J L

    1983-01-01

    Pecans were harvested from trees (Carya illinoensis (Wang.) K. Koch) in November of 1977 through 1979. Kernel meals from high-, medium-, and low-yielding trees were inoculated with a spore suspension of Aspergillus parasiticus and incubated for 7 days at 25 degrees C. Significant differences in aflatoxin accumulation were found among the three substrates, with a direct correlation between high aflatoxin concentration and tree yield.

  17. Transcriptomic-Wide Discovery of Direct and Indirect HuR RNA Targets in Activated CD4+ T Cells.

    Directory of Open Access Journals (Sweden)

    Patsharaporn Techasintana

    Full Text Available Due to poor correlation between steady state mRNA levels and protein product, purely transcriptomic profiling methods may miss genes posttranscriptionally regulated by RNA binding proteins (RBPs and microRNAs (miRNAs. RNA immunoprecipitation (RIP methods developed to identify in vivo targets of RBPs have greatly elucidated those mRNAs which may be regulated via transcript stability and translation. The RBP HuR (ELAVL1 and family members are major stabilizers of mRNA. Many labs have identified HuR mRNA targets; however, many of these analyses have been performed in cell lines and oftentimes are not independent biological replicates. Little is known about how HuR target mRNAs behave in conditional knock-out models. In the present work, we performed HuR RIP-Seq and RNA-Seq to investigate HuR direct and indirect targets using a novel conditional knock-out model of HuR genetic ablation during CD4+ T activation and Th2 differentiation. Using independent biological replicates, we generated a high coverage RIP-Seq data set (>160 million reads that was analyzed using bioinformatics methods specifically designed to find direct mRNA targets in RIP-Seq data. Simultaneously, another set of independent biological replicates were sequenced by RNA-Seq (>425 million reads to identify indirect HuR targets. These direct and indirect targets were combined to determine canonical pathways in CD4+ T cell activation and differentiation for which HuR plays an important role. We show that HuR may regulate genes in multiple canonical pathways involved in T cell activation especially the CD28 family signaling pathway. These data provide insights into potential HuR-regulated genes during T cell activation and immune mechanisms.

  18. Entropic sampling of simple polymer models within Wang-Landau algorithm

    International Nuclear Information System (INIS)

    Vorontsov-Velyaminov, P N; Volkov, N A; Yurchenko, A A

    2004-01-01

    In this paper we apply a new simulation technique proposed in Wang and Landau (WL) (2001 Phys. Rev. Lett. 86 2050) to sampling of three-dimensional lattice and continuous models of polymer chains. Distributions obtained by homogeneous (unconditional) random walks are compared with results of entropic sampling (ES) within the WL algorithm. While homogeneous sampling gives reliable results typically in the range of 4-5 orders of magnitude, the WL entropic sampling yields them in the range of 20-30 orders and even larger with comparable computer effort. A combination of homogeneous and WL sampling provides reliable data for events with probabilities down to 10 -35 . For the lattice model we consider both the athermal case (self-avoiding walks, SAWs) and the thermal case when an energy is attributed to each contact between nonbonded monomers in a self-avoiding walk. For short chains the simulation results are checked by comparison with the exact data. In WL calculations for chain lengths up to N = 300 scaling relations for SAWs are well reproduced. In the thermal case distribution over the number of contacts is obtained in the N-range up to N = 100 and the canonical averages - internal energy, heat capacity, excess canonical entropy, mean square end-to-end distance - are calculated as a result in a wide temperature range. The continuous model is studied in the athermal case. By sorting conformations of a continuous phantom freely joined N-bonded chain with a unit bond length over a stochastic variable, the minimum distance between nonbonded beads, we determine the probability distribution for the N-bonded chain with hard sphere monomer units over its diameter a in the complete diameter range, 0 ≤ a ≤ 2, within a single ES run. This distribution provides us with excess specific entropy for a set of diameters a in this range. Calculations were made for chain lengths up to N = 100 and results were extrapolated to N → ∞ for a in the range 0 ≤ a ≤ 1.25

  19. WE-AB-202-06: Correlating Lung CT HU with Transformation-Based and Xe-CT Derived Ventilation

    International Nuclear Information System (INIS)

    Du, K; Patton, T; Bayouth, J; Reinhardt, J; Christensen, G

    2016-01-01

    Purpose: Regional lung ventilation is useful to reduce radiation-induced function damage during lung cancer radiation therapy. Recently a new direct HU (Hounsfield unit)-based method was proposed to estimate the ventilation potential without image registration. The purpose of this study is to examine if there is a functional dependence between HU values and transformation-based or Xe-CT derived ventilation. Methods: 4DCT images acquired from 13 patients prior to radiation therapy and 4 mechanically ventilated sheep subjects which also have associated Xe-CT images were used for this analysis. Transformation-based ventilation was computed using Jacobian determinant of the transformation field between peak-exhale and peak-inhale 4DCT images. Both transformation and Xe-CT derived ventilation was computed for each HU bin. Color scatter plot and cumulative histogram were used to compare and validate the direct HU-based method. Results: There was little change of the center and shape of the HU histograms between free breathing CT and 4DCT average, with or without smoothing, and between the repeated 4DCT scans. HU of −750 and −630 were found to have the greatest transformation-based ventilation for human and sheep subjects, respectively. Maximum Xe-CT derived ventilation was found to locate at HU of −600 in sheep subjects. The curve between Xe-CT ventilation and HU was noisy for tissue above HU −400, possibly due to less intensity change of Xe gas during wash-out and wash-in phases. Conclusion: Both transformation-based and Xe-CT ventilation demonstrated that lung tissues with HU values in the range of (-750, −600) HU have the maximum ventilation potential. The correlation between HU and ventilation suggests that HU might be used to help guide the ventilation calculation and make it more robust to noise and image registration errors. Research support from NIH grants CA166703 and CA166119 and a gift from Roger Koch.

  20. WE-AB-202-06: Correlating Lung CT HU with Transformation-Based and Xe-CT Derived Ventilation

    Energy Technology Data Exchange (ETDEWEB)

    Du, K; Patton, T; Bayouth, J [University of Wisconsin, Madison, WI (United States); Reinhardt, J; Christensen, G [The University of Iowa, Iowa City, IA (United States)

    2016-06-15

    Purpose: Regional lung ventilation is useful to reduce radiation-induced function damage during lung cancer radiation therapy. Recently a new direct HU (Hounsfield unit)-based method was proposed to estimate the ventilation potential without image registration. The purpose of this study is to examine if there is a functional dependence between HU values and transformation-based or Xe-CT derived ventilation. Methods: 4DCT images acquired from 13 patients prior to radiation therapy and 4 mechanically ventilated sheep subjects which also have associated Xe-CT images were used for this analysis. Transformation-based ventilation was computed using Jacobian determinant of the transformation field between peak-exhale and peak-inhale 4DCT images. Both transformation and Xe-CT derived ventilation was computed for each HU bin. Color scatter plot and cumulative histogram were used to compare and validate the direct HU-based method. Results: There was little change of the center and shape of the HU histograms between free breathing CT and 4DCT average, with or without smoothing, and between the repeated 4DCT scans. HU of −750 and −630 were found to have the greatest transformation-based ventilation for human and sheep subjects, respectively. Maximum Xe-CT derived ventilation was found to locate at HU of −600 in sheep subjects. The curve between Xe-CT ventilation and HU was noisy for tissue above HU −400, possibly due to less intensity change of Xe gas during wash-out and wash-in phases. Conclusion: Both transformation-based and Xe-CT ventilation demonstrated that lung tissues with HU values in the range of (-750, −600) HU have the maximum ventilation potential. The correlation between HU and ventilation suggests that HU might be used to help guide the ventilation calculation and make it more robust to noise and image registration errors. Research support from NIH grants CA166703 and CA166119 and a gift from Roger Koch.

  1. The Societal Security Standardization Promotes Social Management Sdentification——Interview with Wang Zhongmin, President of CNIS

    Institute of Scientific and Technical Information of China (English)

    2012-01-01

    China Standardization:In February 2011,President Hu Jintao gave an important speech on the opening ceremony of the seminar of social management and its innovation for provincial and ministerial level leaders,stressing that the scientific level of social management must be raised and building a social management system with Chinese socialism charactetistics.Would you please talk about the role of the societal security standardization in improving the scientific social manageraent?

  2. The Elav-like protein HuR exerts translational control of viral internal ribosome entry sites

    International Nuclear Information System (INIS)

    Rivas-Aravena, Andrea; Ramdohr, Pablo; Vallejos, Maricarmen; Valiente-Echeverria, Fernando; Dormoy-Raclet, Virginie; Rodriguez, Felipe; Pino, Karla; Holzmann, Cristian; Huidobro-Toro, J. Pablo; Gallouzi, Imed-Eddine; Lopez-Lastra, Marcelo

    2009-01-01

    The human embryonic-lethal abnormal vision (ELAV)-like protein, HuR, has been recently found to be involved in the regulation of protein synthesis. In this study we show that HuR participates in the translational control of the HIV-1 and HCV IRES elements. HuR functions as a repressor of HIV-1 IRES activity and acts as an activator of the HCV IRES. The effect of HuR was evaluated in three independent experimental systems, rabbit reticulocyte lysate, HeLa cells, and Xenopus laevis oocytes, using both overexpression and knockdown approaches. Furthermore, results suggest that HuR mediated regulation of HIV-1 and HCV IRESes does not require direct binding of the protein to the RNA nor does it need the nuclear translocation of the IRES-containing RNAs. Finally, we show that HuR has a negative impact on post-integration steps of the HIV-1 replication cycle. Thus, our observations yield novel insights into the role of HuR in the post-transcriptional regulation of HCV and HIV-1 gene expression.

  3. HuR/ELAVL1 RNA binding protein modulates interleukin-8 induction by muco-active ribotoxin deoxynivalenol

    International Nuclear Information System (INIS)

    Choi, Hye Jin; Yang, Hyun; Park, Seong Hwan; Moon, Yuseok

    2009-01-01

    HuR/Elav-like RNA binding protein 1 (ELAVL1) positively regulates mRNA stability of AU-rich elements (ARE)-containing transcript such as pro-inflammatory cytokines. Ribotoxic stresses can trigger the production of pro-inflammatory mediators by enhancing mRNA stability and the transcriptional activity. We investigated the effects of ribotoxin deoxynivalenol (DON) on HuR translocation and its involvement in the regulation of the pro-inflammatory interleukin-8 (IL-8) mRNA stability. Exposure to the muco-active DON induced nuclear export of both endogenous and exogenous HuR RNA binding protein in human intestinal epithelial cells. Moreover, the interference with HuR protein production suppressed ribotoxic DON-induced IL-8 secretion and its mRNA stability. Cytoplasmic HuR protein interacted with IL-8 mRNA and the complex stabilization was due to the presence of 3'-untranslated region of the transcript. Partly in terms of IL-8-modulating transcription factors, HuR protein was demonstrated to be positively and negatively associated with DON-induced early growth response gene 1 (EGR-1) and activating transcription factor 3 (ATF3), respectively. HuR was a critical mechanistic link between ribotoxic stress and the pro-inflammatory cytokine production, and may have a broader functional significance with regard to mucosal insults since ribotoxic stress responses are also produced upon interactions with the diverse environment of gut.

  4. SU-E-T-470: Importance of HU-Mass Density Calibration Technique in Proton Pencil Beam Dose Calculation

    Energy Technology Data Exchange (ETDEWEB)

    Penfold, S; Miller, A [University of Adelaide, Adelaide, SA (Australia)

    2015-06-15

    Purpose: Stoichiometric calibration of Hounsfield Units (HUs) for conversion to proton relative stopping powers (RStPs) is vital for accurate dose calculation in proton therapy. However proton dose distributions are not only dependent on RStP, but also on relative scattering power (RScP) of patient tissues. RScP is approximated from material density but a stoichiometric calibration of HU-density tables is commonly neglected. The purpose of this work was to quantify the difference in calculated dose of a commercial TPS when using HU-density tables based on tissue substitute materials and stoichiometric calibrated ICRU tissues. Methods: Two HU-density calibration tables were generated based on scans of the CIRS electron density phantom. The first table was based directly on measured HU and manufacturer quoted density of tissue substitute materials. The second was based on the same CT scan of the CIRS phantom followed by a stoichiometric calibration of ICRU44 tissue materials. The research version of Pinnacle{sup 3} proton therapy was used to compute dose in a patient CT data set utilizing both HU-density tables. Results: The two HU-density tables showed significant differences for bone tissues; the difference increasing with increasing HU. Differences in density calibration table translated to a difference in calculated RScP of −2.5% for ICRU skeletal muscle and 9.2% for ICRU femur. Dose-volume histogram analysis of a parallel opposed proton therapy prostate plan showed that the difference in calculated dose was negligible when using the two different HU-density calibration tables. Conclusion: The impact of HU-density calibration technique on proton therapy dose calculation was assessed. While differences were found in the calculated RScP of bony tissues, the difference in dose distribution for realistic treatment scenarios was found to be insignificant.

  5. Metabolic aspects of growth in HU-treated crown-gall tissue cultures. I. Nicotiana tabacum

    Directory of Open Access Journals (Sweden)

    Aldona Rennert

    2015-01-01

    Full Text Available An influence of hydroxyurea (HU on the growth, DNA and RNA contents and protein synthesis in the tobacco tumour tissue culture was studied in comparison with a homologous callus tissue. In conformity with expectations considerable decrease of DNA level in both tissues is a primary effect of HU activity. This results in the growth inhibition and in the secondary metabolic effects; these effects depend not only on the concentration of inhibitor but also on the age of tissue. In spite of some common features the character of these changes shows a distinct differentiation depending on the tissue type. TMs points to specific modifications of the biochemical regulation of growth in a tumour.

  6. Cooperative interplay of let-7 mimic and HuR with MYC RNA.

    Science.gov (United States)

    Gunzburg, Menachem J; Sivakumaran, Andrew; Pendini, Nicole R; Yoon, Je-Hyun; Gorospe, Myriam; Wilce, Matthew C J; Wilce, Jacqueline A

    2015-01-01

    Both RNA-binding proteins (RBP) and miRNA play important roles in the regulation of mRNA expression, often acting together to regulate a target mRNA. In some cases the RBP and miRNA have been reported to act competitively, but in other instances they function cooperatively. Here, we investigated HuR function as an enhancer of let-7-mediated translational repression of c-Myc despite the separation of their binding sites. Using an in vitro system, we determined that a let-7 mimic, consisting of single-stranded (ss)DNA complementary to the let-7 binding site, enhanced the affinity of HuR for a 122-nt MYC RNA encompassing both binding sites. This finding supports the biophysical principle of cooperative binding by an RBP and miRNA purely through interactions at distal mRNA binding sites.

  7. Acute Hepatitis Induced by Chinese Hepatoprotective Herb, Xiao-Chai-Hu-Tang

    Directory of Open Access Journals (Sweden)

    Li-Ming Hsu

    2006-02-01

    Full Text Available Xiao-chai-hu-tang (syo-saiko-to in Japanese is a herbal remedy that has been widely used in China for treatment of respiratory, hepatobiliary, and gastrointestinal diseases, particularly among patients with chronic liver disease. However, its safety has recently been challenged. We, herein, report a Chinese patient with acute hepatitis induced by this herb. A 52-year-old woman presented with weakness, fatigue, and tea-colored urine after continual consumption of the decoction of xiao-chai-hu-tang for 1.5 months. Laboratory studies disclosed acute hepatitis even though all of the viral hepatitis markers were negative. Liver biopsy also revealed a picture of acute hepatocellular hepatitis. The symptoms improved after discontinuing the drug, and liver biochemical tests normalized 2 months later. The case report reminds us of the probable adverse drug reaction of herbs, even in some that are claimed to have hepatoprotective effects.

  8. Breast cancer detection via Hu moment invariant and feedforward neural network

    Science.gov (United States)

    Zhang, Xiaowei; Yang, Jiquan; Nguyen, Elijah

    2018-04-01

    One of eight women can get breast cancer during all her life. This study used Hu moment invariant and feedforward neural network to diagnose breast cancer. With the help of K-fold cross validation, we can test the out-of-sample accuracy of our method. Finally, we found that our methods can improve the accuracy of detecting breast cancer and reduce the difficulty of judging.

  9. Downregulation of β-Adrenoceptors in Isoproterenol-Induced Cardiac Remodeling through HuR.

    Directory of Open Access Journals (Sweden)

    Qian Yin

    Full Text Available β-adrenergic receptors (β-ARs play an important role in cardiac remodeling, which is the key pathological process in various heart diseases and leads to heart failure. However, the regulation of β-AR expression in remodeling hearts is still unclear. This study aims to clarify the possible mechanisms underlying the regulation of β1- and β2-AR expression in cardiac remodeling. The rat model of cardiac remodeling was established by subcutaneous injection of isoproterenol(ISO at the dose of 0.25 mg·kg(-1·d(-1 for 7 days. We found that the expression of β1- and β2-ARs decreased in the remodeling heart. The mechanisms may include the inhibition of DNA transcription and the increase of mRNA degradation. cAMP-response element binding protein(CREB is a well-known transcription factor of β-AR. However, the expression and activation of CREB was not changed in the remodeling heart. Further, human Antigen-R (HuR, a RNA binding protein, which binds to the 3'-untranslated region of the β-AR mRNA and promotes RNA degradation, was increased in the remodeling model. And in vitro, HuR deficiency reversed the reduction of β-AR mRNA induced by ISO. Therefore, the present findings indicate that HuR, but not CREB, is responsible for the reduction of β-AR expression in ISO induced cardiac remodeling.

  10. HuAc: Human Activity Recognition Using Crowdsourced WiFi Signals and Skeleton Data

    Directory of Open Access Journals (Sweden)

    Linlin Guo

    2018-01-01

    Full Text Available The joint of WiFi-based and vision-based human activity recognition has attracted increasing attention in the human-computer interaction, smart home, and security monitoring fields. We propose HuAc, the combination of WiFi-based and Kinect-based activity recognition system, to sense human activity in an indoor environment with occlusion, weak light, and different perspectives. We first construct a WiFi-based activity recognition dataset named WiAR to provide a benchmark for WiFi-based activity recognition. Then, we design a mechanism of subcarrier selection according to the sensitivity of subcarriers to human activities. Moreover, we optimize the spatial relationship of adjacent skeleton joints and draw out a corresponding relationship between CSI and skeleton-based activity recognition. Finally, we explore the fusion information of CSI and crowdsourced skeleton joints to achieve the robustness of human activity recognition. We implemented HuAc using commercial WiFi devices and evaluated it in three kinds of scenarios. Our results show that HuAc achieves an average accuracy of greater than 93% using WiAR dataset.

  11. Coordination of genomic structure and transcription by the main bacterial nucleoid-associated protein HU

    Science.gov (United States)

    Berger, Michael; Farcas, Anca; Geertz, Marcel; Zhelyazkova, Petya; Brix, Klaudia; Travers, Andrew; Muskhelishvili, Georgi

    2010-01-01

    The histone-like protein HU is a highly abundant DNA architectural protein that is involved in compacting the DNA of the bacterial nucleoid and in regulating the main DNA transactions, including gene transcription. However, the coordination of the genomic structure and function by HU is poorly understood. Here, we address this question by comparing transcript patterns and spatial distributions of RNA polymerase in Escherichia coli wild-type and hupA/B mutant cells. We demonstrate that, in mutant cells, upregulated genes are preferentially clustered in a large chromosomal domain comprising the ribosomal RNA operons organized on both sides of OriC. Furthermore, we show that, in parallel to this transcription asymmetry, mutant cells are also impaired in forming the transcription foci—spatially confined aggregations of RNA polymerase molecules transcribing strong ribosomal RNA operons. Our data thus implicate HU in coordinating the global genomic structure and function by regulating the spatial distribution of RNA polymerase in the nucleoid. PMID:20010798

  12. The inhibition, reactivation and mechanism of VX-, sarin-, fluoro-VX and fluoro-sarin surrogates following their interaction with HuAChE and HuBuChE.

    Science.gov (United States)

    Chao, Chih-Kai; Balasubramanian, Narayanaganesh; Gerdes, John M; Thompson, Charles M

    2018-06-16

    In this study, the mechanisms of HuAChE and HuBChE inhibition by Me-P(O) (OPNP) (OR) [PNP = p-nitrophenyl; R = CH 2 CH 3 , CH 2 CH 2 F, OCH(CH 3 ) 2 , OCH(CH 3 ) (CH 2 F)] representing surrogates and fluoro-surrogates of VX and sarin were studied by in vitro kinetics and mass spectrometry. The in vitro measures showed that the VX- and fluoro-VX surrogates were relatively strong inhibitors of HuAChE and HuBChE (k i  ∼ 10 5 -10 6  M -1 min -1 ) and underwent spontaneous and 2-PAM-mediated reactivation within 30 min. The sarin surrogates were weaker inhibitors of HuAChE and HuBChE (k i  ∼ 10 4 -10 5  M -1 min -1 ), and in general did not undergo spontaneous reactivation, although HuAChE adducts were partially reactivatable at 18 h using 2-PAM. The mechanism of HuAChE and HuBChE inhibition by the surrogates was determined by Q-TOF and MALDI-TOF mass spectral analyses. The surrogate-adducted proteins were trypsin digested and the active site-containing peptide bearing the OP-modified serine identified by Q-TOF as triply- and quadruply-charged ions representing the respective increase in mass of the attached OP moiety. Correspondingly, monoisotopic ions of the tryptic peptides representing the mass increase of the OP-adducted peptide was identified by MALDI-TOF. The mass spectrometry analyses validated the identity of the OP moiety attached to HuAChE or HuBChE as MeP(O) (OR)-O-serine peptides (loss of the PNP leaving group) via mechanisms consistent with those found with chemical warfare agents. MALDI-TOF MS analyses of the VX-modified peptides versus time showed a steady reduction in adduct versus parent peptide (reactivation), whereas the sarin-surrogate-modified peptides remained largely intact over the course of the experiment (24 h). Overall, the presence of a fluorine atom on the surrogate modestly altered the rate constants of inhibition and reactivation, however, the mechanism of inhibition (ejection of PNP group) did not change

  13. Computed tomography imaging for the characterisation of drugs with radiation density measurements and HU spectroscopy.

    Science.gov (United States)

    Sieron, Dominik A; Steib, Moritz; Suter, Dominik; Obmann, Verena C; Huber, Adrian T; Ebner, Lukas; Inderbitzin, Daniel; Christe, Andreas

    2018-01-29

    To investigate the computed tomography (CT) density of frequently administered medications (1) for the better characterisation of substances on abdominal CT, (2) to allow radiologists to narrow down possibilities in the identification of hyperdense material in the bowel and (3) to provide forensic doctors with a tool to identify gastric contents before an autopsy. From the list of the local hospital pharmacy, the 50 most frequently used medications were identified and scanned twice with a 128 row CT scanner (Acquillion, Toshiba, Tokyo, Japan). The protocol comprised two tube voltages of 100 kVp and 120 kVp, with a tube current of 100 mAs, a collimation of 0.5 mm and a slice thickness of 0.5 mm. Two readers were asked to measure the density (in Hounsfield units) and the noise (standard deviation of the Hounsfield units) of each pill in the two scans (100/120 kVp). After 4 weeks, both readers repeated the measurements to test repeatability (intra-rater agreement). The behaviour of each pill in hydrochloric acid (pH 2) was examined and the dissolution time was determined. The most dense pill was Cordarone (7265 HU), and the least was Perenterol (529 HU), with an attenuation that was lower than fat density (standard deviation of pixel density (noise) reflects inhomogeneity of the pharmacological product, varying from 9 to 1592 HU among the different pills (at 120 kVp). The absolute average HU increase per pill when changing to lower voltage was 78 ± 253 HU, with a linear fitting line with a slope of 0.21 as a constant variable in the density spectroscopy. After 4 hours in hydrochloric acid, only six tablets were still intact, including Flagyl and Dafalgan. The intra- and inter-rater agreements for all measurements were nearly perfect, with a correlation coefficient r of ≥0.99 (p <0.0001). Our data suggest that measuring the attenuation of drugs on CT images, including the homogeneity, and applying CT spectroscopy can narrow down possible identities of the most

  14. ¿Cómo podemos usar el móvil para comunicarnos mediante el pensamiento? Entrevista con Yijun Wang

    Directory of Open Access Journals (Sweden)

    Ángel Correa

    2011-01-01

    Full Text Available Un equipo de neurocientíficos ha desarrollado una interfaz cerebro ordenador basada en un teléfono móvil. Las personas con movilidad reducida podrían beneficiarse de este innovador sistema en un futuro próximo. En el experimento que aparece en la fotografía de portada, el participante utiliza únicamente su pensamiento para marcar un número de teléfono. Ciencia Cognitiva ha entrevistado al Dr. Yijun Wang, ingeniero biomédico de la Universidad de California en San Diego, que trabaja en este proyecto.

  15. Systematic errors due to linear congruential random-number generators with the Swendsen-Wang algorithm: a warning.

    Science.gov (United States)

    Ossola, Giovanni; Sokal, Alan D

    2004-08-01

    We show that linear congruential pseudo-random-number generators can cause systematic errors in Monte Carlo simulations using the Swendsen-Wang algorithm, if the lattice size is a multiple of a very large power of 2 and one random number is used per bond. These systematic errors arise from correlations within a single bond-update half-sweep. The errors can be eliminated (or at least radically reduced) by updating the bonds in a random order or in an aperiodic manner. It also helps to use a generator of large modulus (e.g., 60 or more bits).

  16. The cytoskeletal inhibitors latrunculin A and blebbistatin exert antitumorigenic properties in human hepatocellular carcinoma cells by interfering with intracellular HuR trafficking

    Energy Technology Data Exchange (ETDEWEB)

    Doller, Anke; Badawi, Amel [Pharmazentrum Frankfurt/ZAFES, Klinikum der Goethe-Universität Frankfurt, Frankfurt/Main (Germany); Schmid, Tobias; Brauß, Thilo [Institut für Biochemie I (Pathobiochemie), Klinikum der Goethe-Universität Frankfurt, Frankfurt/Main (Germany); Pleli, Thomas [Medizinische Klinik 1, Schwerpunkt Gastroenterologie und Hepatologie, Klinikum der Goethe-Universität Frankfurt, Frankfurt/Main (Germany); Meyer zu Heringdorf, Dagmar [Pharmazentrum Frankfurt/ZAFES, Klinikum der Goethe-Universität Frankfurt, Frankfurt/Main (Germany); Piiper, Albrecht [Medizinische Klinik 1, Schwerpunkt Gastroenterologie und Hepatologie, Klinikum der Goethe-Universität Frankfurt, Frankfurt/Main (Germany); Pfeilschifter, Josef [Pharmazentrum Frankfurt/ZAFES, Klinikum der Goethe-Universität Frankfurt, Frankfurt/Main (Germany); Eberhardt, Wolfgang, E-mail: w.eberhardt@em.uni-frankfurt.de [Pharmazentrum Frankfurt/ZAFES, Klinikum der Goethe-Universität Frankfurt, Frankfurt/Main (Germany)

    2015-01-01

    The impact of the RNA-binding protein HuR for the post-transcriptional deregulation of tumor-relevant genes is well established. Despite of elevations in HuR expression levels, an increase in cytoplasmic HuR abundance in many cases correlates with a high grade of malignancy. Here, we demonstrated that administration of the actin-depolymerizing macrolide latrunculin A, or blebbistatin, an inhibitor of myosin II ATPase activity, caused a dose- and time-dependent reduction in the high cytoplasmic HuR content of HepG2 and Huh7 hepatocellular carcinoma (HCC) cells. Subcellular fractionation revealed that in addition, both inhibitors strongly attenuated cytoskeletal and membrane-bound HuR abundance and conversely increased the HuR amount in nuclear cell fractions. Concomitant with changes in intracellular HuR localization, both cytoskeletal inhibitors markedly decreased the half-lives of cyclooxygenase-2 (COX-2), cyclin A and cyclin D{sub 1} encoding mRNAs resulting in a significant reduction in their expression levels in HepG2 cells. Importantly, a similar reduction in the expression of these HuR targets was achieved by a RNA interference (RNAi)-mediated knockdown of either HuR or nonmuscle myoin IIA. Using polysomal fractionation, we further demonstrate that the decrease in cytoplasmic HuR by latrunculin A or blebbistatin is accompanied by a marked change in the allocation of HuR and its mRNA cargo from polysomes to ribonucleoprotein (RNP) particles. Functionally, the basal migration and prostaglandin E{sub 2} synthesis are similarly impaired in inhibitor-treated and stable HuR-knockdown HepG2 cells. Our data demonstrate that interfering with the actomyosin-dependent HuR trafficking may comprise a valid therapeutic option for antagonizing pathologic posttranscriptional gene expression by HuR and furthermore emphasize the potential benefit of HuR inhibitory strategies for treatment of HCC. - Highlights: • We tested the effects of latrunculin A and blebbistatin on

  17. The cytoskeletal inhibitors latrunculin A and blebbistatin exert antitumorigenic properties in human hepatocellular carcinoma cells by interfering with intracellular HuR trafficking

    International Nuclear Information System (INIS)

    Doller, Anke; Badawi, Amel; Schmid, Tobias; Brauß, Thilo; Pleli, Thomas; Meyer zu Heringdorf, Dagmar; Piiper, Albrecht; Pfeilschifter, Josef; Eberhardt, Wolfgang

    2015-01-01

    The impact of the RNA-binding protein HuR for the post-transcriptional deregulation of tumor-relevant genes is well established. Despite of elevations in HuR expression levels, an increase in cytoplasmic HuR abundance in many cases correlates with a high grade of malignancy. Here, we demonstrated that administration of the actin-depolymerizing macrolide latrunculin A, or blebbistatin, an inhibitor of myosin II ATPase activity, caused a dose- and time-dependent reduction in the high cytoplasmic HuR content of HepG2 and Huh7 hepatocellular carcinoma (HCC) cells. Subcellular fractionation revealed that in addition, both inhibitors strongly attenuated cytoskeletal and membrane-bound HuR abundance and conversely increased the HuR amount in nuclear cell fractions. Concomitant with changes in intracellular HuR localization, both cytoskeletal inhibitors markedly decreased the half-lives of cyclooxygenase-2 (COX-2), cyclin A and cyclin D 1 encoding mRNAs resulting in a significant reduction in their expression levels in HepG2 cells. Importantly, a similar reduction in the expression of these HuR targets was achieved by a RNA interference (RNAi)-mediated knockdown of either HuR or nonmuscle myoin IIA. Using polysomal fractionation, we further demonstrate that the decrease in cytoplasmic HuR by latrunculin A or blebbistatin is accompanied by a marked change in the allocation of HuR and its mRNA cargo from polysomes to ribonucleoprotein (RNP) particles. Functionally, the basal migration and prostaglandin E 2 synthesis are similarly impaired in inhibitor-treated and stable HuR-knockdown HepG2 cells. Our data demonstrate that interfering with the actomyosin-dependent HuR trafficking may comprise a valid therapeutic option for antagonizing pathologic posttranscriptional gene expression by HuR and furthermore emphasize the potential benefit of HuR inhibitory strategies for treatment of HCC. - Highlights: • We tested the effects of latrunculin A and blebbistatin on different Hu

  18. Innate Immune Activation Can Trigger Experimental Spondyloarthritis in HLA-B27/Huβ2m Transgenic Rats

    NARCIS (Netherlands)

    van Tok, Melissa N.; Satumtira, Nimman; Dorris, Martha; Pots, Desirée; Slobodin, Gleb; van de Sande, Marleen G.; Taurog, Joel D.; Baeten, Dominique L.; van Duivenvoorde, Leonie M.

    2017-01-01

    Spondyloarthritis (SpA) does not display the typical features of auto-immune disease. Despite the strong association with MHC class I, CD8(+) T cells are not required for disease induction in the HLA-B27/Huβ2m transgenic rats. We used Lewis HLA-B27/Huβ2m transgenic rats [21-3 × 283-2]F1,

  19. HuR binds to a single site on the C/EBPβ mRNA of 3T3-L1 adipocytes

    International Nuclear Information System (INIS)

    Jones, Heath; Carver, Melinda; Pekala, Phillip H.

    2007-01-01

    HuR is a ligand for nuclear mRNAs containing adenylate-uridylate rich elements in the 3'-untranslated region. Once bound to the mRNA, HuR is recognized by adapter proteins which then facilitate nuclear export of the complex. In the cytosol HuR is thought to function to control stability and translation of its ligand message. In the 3T3-L1 cells HuR is constitutively expressed and localized predominantly to the nucleus in the preadipocytes. However within 30 min of exposure to the differentiation stimulus, the HuR content in the cytosol increases consistent with HuR regulating the availability of relevant mRNAs for translation. Using in vitro RNA gel shifts, we have demonstrated that the C/EBPβ message is a ligand for HuR and that the single binding site is an adenylate-uridylate rich element in the 3'-untranslated region

  20. A kinetic analysis of kappa-opioid agonist binding using the selective radioligand (/sup 3/H)U69593

    Energy Technology Data Exchange (ETDEWEB)

    Smith, J.A.; Hunter, J.C.; Hill, R.G.; Hughes, J.

    1989-07-01

    The interaction of the nonselective opioid ligand (3H)bremazocine and of the kappa-opioid (3H)U69593 with the kappa-receptor was investigated in guinea-pig cortical membranes. Each radioligand bound to a single population of high-affinity sites, although (3H)U69593 apparently recognised only 70% of those sites labelled by (3H)bremazocine. Naloxone and the kappa-selective ligands U69593 and PD117302 exhibited full inhibition of the binding of both radioligands. Kinetic analysis demonstrated biphasic rates of association and dissociation for both (3H)bremazocine and (3H)U69593. Detailed analysis of the binding of (3H)U69593 revealed that the fast rate of association was dependent on radioligand concentration, in contrast to the slow rate, which was independent of ligand concentration. Guanylyl-5'-imidodiphosphate (GppNHp) inhibited binding of (3H)U69593; saturation analysis demonstrated that the inhibitory effects of GppNHp resulted in a decrease in affinity without any significant change in binding capacity. GppNHp attenuated the formation of the slow component of (3H)U69593 binding, while accelerating the fast component. The data are consistent with the formation of a high-affinity complex between the kappa-receptor and a guanine nucleotide binding protein. Guanine nucleotides promote the dissociation of this ternary complex and the stabilisation of a lower-affinity state of the receptor.

  1. Predictive Control of the Blood Glucose Level in Type I Diabetic Patient Using Delay Differential Equation Wang Model.

    Science.gov (United States)

    Esna-Ashari, Mojgan; Zekri, Maryam; Askari, Masood; Khalili, Noushin

    2017-01-01

    Because of increasing risk of diabetes, the measurement along with control of blood sugar has been of great importance in recent decades. In type I diabetes, because of the lack of insulin secretion, the cells cannot absorb glucose leading to low level of glucose. To control blood glucose (BG), the insulin must be injected to the body. This paper proposes a method for BG level regulation in type I diabetes. The control strategy is based on nonlinear model predictive control. The aim of the proposed controller optimized with genetics algorithms is to measure BG level each time and predict it for the next time interval. This merit causes a less amount of control effort, which is the rate of insulin delivered to the patient body. Consequently, this method can decrease the risk of hypoglycemia, a lethal phenomenon in regulating BG level in diabetes caused by a low BG level. Two delay differential equation models, namely Wang model and Enhanced Wang model, are applied as controller model and plant, respectively. The simulation results exhibit an acceptable performance of the proposed controller in meal disturbance rejection and robustness against parameter changes. As a result, if the nutrition of the person decreases instantly, the hypoglycemia will not happen. Furthermore, comparing this method with other works, it was shown that the new method outperforms previous studies.

  2. Macroscopically constrained Wang-Landau method for systems with multiple order parameters and its application to drawing complex phase diagrams

    Science.gov (United States)

    Chan, C. H.; Brown, G.; Rikvold, P. A.

    2017-05-01

    A generalized approach to Wang-Landau simulations, macroscopically constrained Wang-Landau, is proposed to simulate the density of states of a system with multiple macroscopic order parameters. The method breaks a multidimensional random-walk process in phase space into many separate, one-dimensional random-walk processes in well-defined subspaces. Each of these random walks is constrained to a different set of values of the macroscopic order parameters. When the multivariable density of states is obtained for one set of values of fieldlike model parameters, the density of states for any other values of these parameters can be obtained by a simple transformation of the total system energy. All thermodynamic quantities of the system can then be rapidly calculated at any point in the phase diagram. We demonstrate how to use the multivariable density of states to draw the phase diagram, as well as order-parameter probability distributions at specific phase points, for a model spin-crossover material: an antiferromagnetic Ising model with ferromagnetic long-range interactions. The fieldlike parameters in this model are an effective magnetic field and the strength of the long-range interaction.

  3. Domain-specific phosphomimetic mutation allows dissection of different protein kinase C (PKC) isotype-triggered activities of the RNA binding protein HuR.

    Science.gov (United States)

    Schulz, Sebastian; Doller, Anke; Pendini, Nicole R; Wilce, Jacqueline A; Pfeilschifter, Josef; Eberhardt, Wolfgang

    2013-12-01

    The ubiquitous mRNA binding protein human antigen R (HuR) participates in the post-transcriptional regulation of many AU-rich element (ARE)-bearing mRNAs. Previously, by using in vitro kinase assay, we have identified serines (Ser) 158, 221 and 318 as targets of protein kinase C (PKC)-triggered phosphorylation. In this study, we tested whether GFP- or GST-tagged HuR constructs bearing a phosphomimetic Ser (S)-to-Asp (D) substitution at the different PKC target sites, would affect different HuR functions including HuR nucleo-cytoplasmic redistribution and binding to different types of ARE-containing mRNAs. The phosphomimetic GFP-tagged HuR protein bearing a phosphomimetic substitution in the hinge region of HuR (HuR-S221D) showed an increased cytoplasmic abundance when compared to wild-type HuR. Conversely, data from in vitro kinase assay and electrophoretic mobility shift assay (EMSA), implicates that phosphorylation at Ser 221 is not relevant for mRNA binding of HuR. Quantification of in vitro binding affinities of GST-tagged wild-type HuR and corresponding HuR proteins bearing a phosphomimetic substitution in either RRM2 (HuR-S158D) or in RRM3 (HuR-S318D) by microscale thermophoresis (MST) indicates a specific binding of wild-type HuR to type I, II or type III-ARE-oligonucleotides in the high nanomolar range. Interestingly, phosphomimetic mutation at position 158 or 318 had a negative influence on HuR binding to type I- and type II-ARE-mRNAs whereas it significantly enhanced HuR affinity to a type III-ARE substrate. Our data suggest that differential phosphorylation of HuR by PKCs at different HuR domains coordinates subcellular HuR distribution and leads to a preferential binding to U-rich bearing target mRNA. © 2013.

  4. 'Hu Hong' (bad thing): parental perceptions of teenagers' sexuality in urban Vietnam.

    Science.gov (United States)

    Do, Lan Anh Thi; Boonmongkon, Pimpawun; Paek, Seung Chun; Guadamuz, Thomas E

    2017-02-28

    Teenagers under 18 years old in Vietnam are considered as minors who usually lack the autonomy to make decisions. They are also sometimes viewed as contributors to social evils including crime, violence and substance use. Moreover, most Vietnamese teenagers have unsafe sex before marriage. The objective of this study is to explore the parental perceptions relating to their teenagers' sexuality, particularly the social and cultural forces, that may hinder access to sexuality information. Guided by a Community Advisory Board (CAB), this qualitative study uses four focus group discussions (FGDs) consisting of 12 mothers and 12 fathers, as well as twelve individual in-depth interviews (IDIs) with a diverse sample of parents of teens in Ho Chi Minh City (HCMC), Vietnam. Content and discourse analysis were conducted, based on Foucauldian concepts. Four themes emerged: 1) Meanings of sexuality and sexuality education, 2) Early sexual intercourse destroys teenagers' future, 3) Teenagers are not hu hong (spoil/bad thing), are innocent and virgin, and 4) Policing and controlling of sexual intercourse among teens. Parents did not view their teenage children as sexual beings; those who are sexual are considered hu hong. Parents believed that teens need to be policed and controlled to prevent them from becoming hu hong, particularly girls. Controlling of sexuality information by parents was therefore common in HCMC, but differed by gender and educational levels of parents. For example, fathers more than mothers were not comfortable teaching their teenage children about sex and sexuality. Parents with higher education police their teenage children's usage of the Internet and social media, while parents with lower education control who can be friends with their teenage children. Vietnamese parents in general have negative views of sex and sexuality education for their teenage children. Recognizing that many Vietnamese teenagers have unsafe sex before marriage, parents need to

  5. Effects of weaning age on growth, nutrient digestibility and metabolism, and serum parameters in Hu lambs

    Directory of Open Access Journals (Sweden)

    Jianmin Chai

    2015-12-01

    Full Text Available This study was conducted to investigate the effect of weaning age on growth performance, nutrient digestion and metabolism, and serological indicators, and to obtain an optimal weaning age in Hu lambs. Forty-eight newborn Hu lambs (birth weight, 2.53 ± 0.14 kg were randomly divided into 4 groups. The lambs in control group (ER suckled their dams. The lambs in other three experimental groups were weaned on milk replacer at 10, 20, and 30 days of age (EW10, EW20, and EW30 groups, respectively. The results were as follows: 1 lambs in EW10 and EW30 groups had a lower (P  0.05 among groups; however, the apparent digestibility and deposition of calcium in early weaned lambs were lower (P < 0.05 than those in ewe-reared lambs. 4 The albumin content in EW30 group was lower (P < 0.05 than that in ER group; the globulin content in EW30 group was higher (P < 0.05 than that in other groups; the content of serum insulin-like growth factor-Ⅰ in weaned lambs tended to increase compared with lambs in ER group. Finally, the growth rate of lambs decreased within 10 days post-weaning, but early weaning boosted creep feed intake, leading to better growth and health later in life. The Hu lambs can be weaned on milk replacer and creep feed at 10 days of age.

  6. Preferencias de los huéspedes de hostels de la ciudad de La Plata

    OpenAIRE

    De la Cruz, Gastón Miguel

    2013-01-01

    La presente tesis tiene como objeto estudiar las preferencias de huéspedes de un grupo de hostels de la ciudad de La Plata, con el fin de determinar la existencia de una demanda que tenga como principal preferencia a un atributo de índole social. Para cumplir con este objetivo se utilizó la técnica estadística análisis conjunto (conjoint analysis en inglés) la cual obligó a descomponer el concepto hostel en seis (6) atributos, de los cuales tres (3) atributos entran en la definición de índole...

  7. Cooperative interplay of let-7 mimic and HuR with MYC RNA

    OpenAIRE

    Gunzburg, Menachem J; Sivakumaran, Andrew; Pendini, Nicole R; Yoon, Je-Hyun; Gorospe, Myriam; Wilce, Matthew Cj; Wilce, Jacqueline A

    2015-01-01

    Both RNA-binding proteins (RBP) and miRNA play important roles in the regulation of mRNA expression, often acting together to regulate a target mRNA. In some cases the RBP and miRNA have been reported to act competitively, but in other instances they function cooperatively. Here, we investigated HuR function as an enhancer of let-7-mediated translational repression of c-Myc despite the separation of their binding sites. Using an in vitro system, we determined that a let-7 mimic, consisting of...

  8. Inhibition of cell division in hupA hupB mutant bacteria lacking HU protein.

    OpenAIRE

    Dri, A M; Rouviere-Yaniv, J; Moreau, P L

    1991-01-01

    Escherichia coli hupA hypB double mutants that lack HU protein have severe cellular defects in cell division, DNA folding, and DNA partitioning. Here we show that the sfiA11 mutation, which alters the SfiA cell division inhibitor, reduces filamentation and production of anucleate cells in AB1157 hupA hupB strains. However, lexA3(Ind-) and sfiB(ftsZ)114 mutations, which normally counteract the effect of the SfiA inhibitor, could not restore a normal morphology to hupA hupB mutant bacteria. The...

  9. MicroRNA-16 Modulates HuR Regulation of Cyclin E1 in Breast Cancer Cells

    Directory of Open Access Journals (Sweden)

    Xun Guo

    2015-03-01

    Full Text Available RNA binding protein (RBPs and microRNAs (miRNAs or miRs are post-transcriptional regulators of gene expression that are implicated in development of cancers. Although their individual roles have been studied, the crosstalk between RBPs and miRNAs is under intense investigation. Here, we show that in breast cancer cells, cyclin E1 upregulation by the RBP HuR is through specific binding to regions in the cyclin E1 mRNA 3' untranslated region (3'UTR containing U-rich elements. Similarly, miR-16 represses cyclin E1, dependent on its cognate binding sites in the cyclin E1 3'UTR. Evidence in the literature indicates that HuR can regulate miRNA expression and recruit or dissociate RNA-induced silencing complexes (RISC. Despite this, miR-16 and HuR do not affect the other’s expression level or binding to the cyclin E1 3'UTR. While HuR overexpression partially blocks miR-16 repression of a reporter mRNA containing the cyclin E1 3'UTR, it does not block miR-16 repression of endogenous cyclin E1 mRNA. In contrast, miR-16 blocks HuR-mediated upregulation of cyclin E1. Overall our results suggest that miR-16 can override HuR upregulation of cyclin E1 without affecting HuR expression or association with the cyclin E1 mRNA.

  10. HuH-7 reference genome profile: complex karyotype composed of massive loss of heterozygosity.

    Science.gov (United States)

    Kasai, Fumio; Hirayama, Noriko; Ozawa, Midori; Satoh, Motonobu; Kohara, Arihiro

    2018-05-17

    Human cell lines represent a valuable resource as in vitro experimental models. A hepatoma cell line, HuH-7 (JCRB0403), has been used extensively in various research fields and a number of studies using this line have been published continuously since it was established in 1982. However, an accurate genome profile, which can be served as a reliable reference, has not been available. In this study, we performed M-FISH, SNP microarray and amplicon sequencing to characterize the cell line. Single cell analysis of metaphases revealed a high level of heterogeneity with a mode of 60 chromosomes. Cytogenetic results demonstrated chromosome abnormalities involving every chromosome in addition to a massive loss of heterozygosity, which accounts for 55.3% of the genome, consistent with the homozygous variants seen in the sequence analysis. We provide empirical data that the HuH-7 cell line is composed of highly heterogeneous cell populations, suggesting that besides cell line authentication, the quality of cell lines needs to be taken into consideration in the future use of tumor cell lines.

  11. Inhibition of cell division in hupA hupB mutant bacteria lacking HU protein.

    Science.gov (United States)

    Dri, A M; Rouviere-Yaniv, J; Moreau, P L

    1991-01-01

    Escherichia coli hupA hypB double mutants that lack HU protein have severe cellular defects in cell division, DNA folding, and DNA partitioning. Here we show that the sfiA11 mutation, which alters the SfiA cell division inhibitor, reduces filamentation and production of anucleate cells in AB1157 hupA hupB strains. However, lexA3(Ind-) and sfiB(ftsZ)114 mutations, which normally counteract the effect of the SfiA inhibitor, could not restore a normal morphology to hupA hupB mutant bacteria. The LexA repressor, which controls the expression of the sfiA gene, was present in hupA hupB mutant bacteria in concentrations half of those of the parent bacteria, but this decrease was independent of the specific cleavage of the LexA repressor by activated RecA protein. One possibility to account for the filamentous morphology of hupA hupB mutant bacteria is that the lack of HU protein alters the expression of specific genes, such as lexA and fts cell division genes. Images PMID:2019558

  12. Reflection and transmission characteristics of a layer obeying the two-pressure field poroelastic phenomenological model of Berryman and Wang.

    Science.gov (United States)

    Kachkouch, F; Franklin, H; Tinel, A

    2018-07-01

    The characteristics of the reflection and transmission by a fluid-loaded double porosity layer are studied. The medium obeys the two-pressure field poroelastic phenomenological model of Berryman and Wang. The open pore hydraulic conditions applied at the interfaces yield factorized expressions for the coefficients exhibiting on the one hand a separation allowing to distinguish between symmetrical and antisymmetrical motions and on the other hand the way each of the three dilatational waves associate with the shear wave. The numerical study done for a layer of Berea sandstone saturated by water shows clearly the role of each of the dilatational waves. There are peculiarities such as the absence of the fundamental antisymmetrical mode (zero order) and a singular behaviour of the symmetrical fundamental mode. The low frequency approximation for this latter is derived from the proposed formulas and compared with the numerical results. Copyright © 2018 Elsevier B.V. All rights reserved.

  13. Validation of whole-blood transcriptome signature during microdose recombinant human erythropoietin (rHuEpo) administration.

    Science.gov (United States)

    Wang, Guan; Durussel, Jérôme; Shurlock, Jonathan; Mooses, Martin; Fuku, Noriyuki; Bruinvels, Georgie; Pedlar, Charles; Burden, Richard; Murray, Andrew; Yee, Brendan; Keenan, Anne; McClure, John D; Sottas, Pierre-Edouard; Pitsiladis, Yannis P

    2017-11-14

    Recombinant human erythropoietin (rHuEpo) can improve human performance and is therefore frequently abused by athletes. As a result, the World Anti-Doping Agency (WADA) introduced the Athlete Biological Passport (ABP) as an indirect method to detect blood doping. Despite this progress, challenges remain to detect blood manipulations such as the use of microdoses of rHuEpo. Forty-five whole-blood transcriptional markers of rHuEpo previously derived from a high-dose rHuEpo administration trial were used to assess whether microdoses of rHuEpo could be detected in 14 trained subjects and whether these markers may be confounded by exercise (n = 14 trained subjects) and altitude training (n = 21 elite runners and n = 4 elite rowers, respectively). Differential gene expression analysis was carried out following normalisation and significance declared following application of a 5% false discovery rate (FDR) and a 1.5 fold-change. Adaptive model analysis was also applied to incorporate these markers for the detection of rHuEpo. ALAS2, BCL2L1, DCAF12, EPB42, GMPR, SELENBP1, SLC4A1, TMOD1 and TRIM58 were differentially expressed during and throughout the post phase of microdose rHuEpo administration. The CD247 and TRIM58 genes were significantly up- and down-regulated, respectively, immediately following exercise when compared with the baseline both before and after rHuEpo/placebo. No significant gene expression changes were found 30 min after exercise in either rHuEpo or placebo groups. ALAS2, BCL2L1, DCAF12, SLC4A1, TMOD1 and TRIM58 tended to be significantly expressed in the elite runners ten days after arriving at altitude and one week after returning from altitude (FDR > 0.059, fold-change varying from 1.39 to 1.63). Following application of the adaptive model, 15 genes showed a high sensitivity (≥ 93%) and specificity (≥ 71%), with BCL2L1 and CSDA having the highest sensitivity (93%) and specificity (93%). Current results provide further evidence that

  14. Smoke (Paul Auster et Wayne Wang, 1995 : une œuvre à la croisée des arts

    Directory of Open Access Journals (Sweden)

    Delphine Letort

    2011-04-01

    Full Text Available The adaptation of the short story entitled “Auggie Wren’s Christmas Story” (1990 gathered the writer Paul Auster and the director Wayne Wang around a film project that allowed them to share their artistic practices in a collaborative work. This paper examines the question that underpins the narrative of the short-story by grappling with the appropriations of the real in other artistic modes. Paul Auster’s first encounter with the cinema points out the convergence between aural writing and cinematic writing, evoked through the double figure of the writer and that of the tale-teller/photographer in both the film and the short story.L’adaptation de la nouvelle « Auggie Wren’s Christmas Story » (1990 réunit l’écrivain Paul Auster et le réalisateur Wayne Wang autour d’un projet qui leur permit de croiser leurs pratiques artistiques dans un travail de collaboration. Cet article prolonge le questionnement artistique qui sous-tend le récit de la nouvelle en interrogeant les modalités de l’appropriation du réel par d’autres arts. La première rencontre entre Paul Auster et le cinéma met en relief les points de convergence entre écriture verbale et écriture cinématographique, évoqués autour de la double figure de l’écrivain et du conteur/photographe dans le film et dans la nouvelle.

  15. The Use of Soluble Transferrin Receptor in the Detection of rHuEPO abuse in Sports

    Directory of Open Access Journals (Sweden)

    Donovan McGrowder

    2010-01-01

    Full Text Available Erythropoietin (EPO increases the number of circulating erythrocytes and muscle oxygenation. The recombinant forms of EPO have indiscriminately been used by athletes, mainly in endurance sports to increase their erythrocytes concentration, thus generating a better delivery of oxygen to the muscle tissue. The administration of recombinant human erythropoietin (rHuEPO except for therapeutic use was prohibited by the International Olympic Committee (IOC and its unauthorized use considered as doping. In the last few years, a number of studies using parameters indicative of accelerated erythropoiesis have investigated a number of indirect methods for the detection of rHuEPO abuse. No single indirect marker has been found that can satisfactorily demonstrated rHuEPO misuse. Soluble transferrin receptor (sTfR is a new marker of iron status and erythropoietic activity. It has been included in multivariable blood testing models for the detection of performance enhancing EPO abuse in sports. Indirect markers of altered erythropoiesis give reliable evidence of current or discontinued rHuEPO usage. This review describes the physical, biological and pharmacokinetic properties of endogenous EPO and its recombinant form. It also discusses the available strategies for the detection of rHuEPO abuse in sports, involving the use of sTfR concentration directly or in mathematical multivariate models.

  16. HuR binding to AU-rich elements present in the 3' untranslated region of Classical swine fever virus

    Directory of Open Access Journals (Sweden)

    Huang Chin-Cheng

    2011-07-01

    Full Text Available Abstract Background Classical swine fever virus (CSFV is the member of the genus Pestivirus under the family Flaviviridae. The 5' untranslated region (UTR of CSFV contains the IRES, which is a highly structured element that recruits the translation machinery. The 3' UTR is usually the recognition site of the viral replicase to initiate minus-strand RNA synthesis. Adenosine-uridine rich elements (ARE are instability determinants present in the 3' UTR of short-lived mRNAs. However, the presence of AREs in the 3' UTR of CSFV conserved in all known strains has never been reported. This study inspects a possible role of the ARE in the 3' UTR of CSFV. Results Using RNA pull-down and LC/MS/MS assays, this study identified at least 32 possible host factors derived from the cytoplasmic extracts of PK-15 cells that bind to the CSFV 3' UTR, one of which is HuR. HuR is known to bind the AREs and protect the mRNA from degradation. Using recombinant GST-HuR, this study demonstrates that HuR binds to the ARE present in the 3' UTR of CSFV in vitro and that the binding ability is conserved in strains irrespective of virulence. Conclusions This study identified one of the CSFV 3' UTR binding proteins HuR is specifically binding to in the ARE region.

  17. Comparison of the Debye–Hückel and the Mean Spherical Approximation Theories for Electrolyte Solutions

    DEFF Research Database (Denmark)

    Maribo-Mogensen, Bjørn; Kontogeorgis, Georgios M.; Thomsen, Kaj

    2012-01-01

    The thermodynamics of electrolyte solutions has been investigated by many scientists throughout the last century. While several theories have been presented, the most popular models for the electrostatic interactions are based on the Debye–Hückel and mean spherical approximation (MSA) theories....... In this paper we investigate the differences between the Debye–Hückel and the MSA theories, and comparisons of the numerical results for the Helmholtz energy and its derivatives with respect to temperature, volume and composition are presented. The investigation shows that the nonrestricted primitive MSA...... theory performs similarly to Debye–Hückel, despite the differences in the derivation. We furthermore show that the static permittivity is a key parameter for both models and that in many cases it completely dominates the results obtained from the two models. Consequently, we conclude that the simpler...

  18. Hu Hong’ (bad thing: parental perceptions of teenagers’ sexuality in urban Vietnam

    Directory of Open Access Journals (Sweden)

    Lan Anh Thi Do

    2017-02-01

    Full Text Available Abstract Background Teenagers under 18 years old in Vietnam are considered as minors who usually lack the autonomy to make decisions. They are also sometimes viewed as contributors to social evils including crime, violence and substance use. Moreover, most Vietnamese teenagers have unsafe sex before marriage. The objective of this study is to explore the parental perceptions relating to their teenagers’ sexuality, particularly the social and cultural forces, that may hinder access to sexuality information. Methods Guided by a Community Advisory Board (CAB, this qualitative study uses four focus group discussions (FGDs consisting of 12 mothers and 12 fathers, as well as twelve individual in-depth interviews (IDIs with a diverse sample of parents of teens in Ho Chi Minh City (HCMC, Vietnam. Content and discourse analysis were conducted, based on Foucauldian concepts. Results Four themes emerged: 1 Meanings of sexuality and sexuality education, 2 Early sexual intercourse destroys teenagers’ future, 3 Teenagers are not hu hong (spoil/bad thing, are innocent and virgin, and 4 Policing and controlling of sexual intercourse among teens. Parents did not view their teenage children as sexual beings; those who are sexual are considered hu hong. Parents believed that teens need to be policed and controlled to prevent them from becoming hu hong, particularly girls. Controlling of sexuality information by parents was therefore common in HCMC, but differed by gender and educational levels of parents. For example, fathers more than mothers were not comfortable teaching their teenage children about sex and sexuality. Parents with higher education police their teenage children’s usage of the Internet and social media, while parents with lower education control who can be friends with their teenage children. Conclusions Vietnamese parents in general have negative views of sex and sexuality education for their teenage children. Recognizing that many

  19. Characterization of the hypothermic effect of the synthetic cannabinoid HU-210 in the rat. Relation to the adrenergic system and endogenous pyrogens.

    Science.gov (United States)

    Ovadia, H; Wohlman, A; Mechoulam, R; Weidenfeld, J

    1995-02-01

    In the present study we have characterized the hypothermic effect of the psychoactive cannabinoid HU-210, by investigating its interaction with the endogenous pyrogens, IL-1 and PGE2. We also studied the involvement of the adrenergic system in mediation of this hypothermic effect. Injection of HU-210 directly into the preoptic area caused a dose dependent reduction of rectal temperature from 37 to 32.1 degrees C. Injection of the non-psychoactive analog, HU-211 which does not bind to brain cannabinoid receptor, did not affect body temperature. Injection of the adrenergic agonists, CGP-12177 and clonidine (beta, and alpha adrenergic agonists, respectively) abrogated the hypothermia induced by HU-210. Injection of the adrenergic antagonists, prazosin (alpha 1) and propranolol (beta) enhanced the hypothermic effect of HU-210. Intracerebral administration of IL-1 or PGE2 to rats pretreated with HU-210 caused a transient inhibition of the hypothermia. The ex vivo rate of basal or bacterial endotoxin-induced synthesis of PGE2 by different brain regions, including the preoptic area was not affected by HU-210 administration. These results suggest that the synthetic cannabinoid HU-210 acts in the preoptic area, probably via the brain cannabinoid receptor to induce hypothermia. The hypothermic effect can be antagonized by adrenergic agonists and enhanced by adrenergic antagonists. HU-210 does not interfere with the pyrogenic effect of IL-1 or PGE2.

  20. Iodine-131-labelled CDR grafted monoclonal antibody huA33 metastatic colorectal carcinoma: A case study

    International Nuclear Information System (INIS)

    Thomas, D.L.; Lee, F.T.; Scott, A.M.

    1997-01-01

    Full text: A 58-year-old woman was diagnosed with metastatic colorectal carcinoma two years after initial surgery for sigmoid carcinoma. As part of the staging work-up she was initially referred for a 18 F-FDG PET scan at the PET Centre. FDG PET scans of the abdomen and pelvis demonstrated multiple hepatic lesions, but there was no evidence of disease outside the liver. On the basis of extensive hepatic disease, the patient was scheduled for a laparotomy for insertion of an hepatic artery catheter for chemotherapy. In view of her clinical presentation, the patient was eligible for a Phase 1 trial with 131 l-labelled huA33, and agreed to participate. HuA33 is a humanised CDR-grafted recombinant monoclonal antibody directed against an antigen found on >95 per cent of all colorectal carcinomas, and on small bowel and colonic mucosa. The phase 1 trial is a protein dose escalation study designed to examine the biodistribution, pharmacokinetics, dosimetry and safety profile of huA33, and sequential gamma camera images of the whole body were obtained daily until seven days post infusion. SPECT images were obtained on day 6. Excellent localisation of 131 l-huA33 was seen in hepatic lesions. Calculation of whole body retention and tumour uptake was performed, and pharmacokinetic analysis also undertaken. Biopsies of tumour obtained at surgery were used to quantitate tumour uptake and cellular trafficking of 131 l-huA33. On the basis of this phase 1 study, future therapeutic trials of 131 I-huA33 are planned

  1. National Cooperative rHu Erythropoietin Study in patients with chronic renal failure--an interim report. The National Cooperative rHu Erythropoietin Study Group.

    Science.gov (United States)

    Levin, N W; Lazarus, J M; Nissenson, A R

    1993-08-01

    This second interim report of the National Cooperative rHu Erythropoietin Study presents data from 324 patients new to recombinant human erythropoietin (Epoetin alfa) who completed at least 12 months of study participation. Mean hematocrit levels increased to approximately 30% by month 3 in patients on hemodialysis (n = 293) and stabilized for the remainder of the study whether Epoetin alfa was administered by the intravenous (n = 250) or subcutaneous (n = 42) route. The intravenous dosage level ranged between 106.9 and 121.6 U/kg/wk; subcutaneous dosing ranged between 87.4 and 108.0 U/kg/wk; dosing levels in patients on peritoneal dialysis (n = 31) were similar, although there was a trend towards slightly higher hematocrit levels. Throughout the 12 months of the study, there was no relationship between blood pressure and either hematocrit level or Epoetin alfa dose. Approximately two thirds of the patients were receiving iron supplementation at any given time, and there was a trend towards the increased use of oral iron supplements. The incidence of adverse events in this cohort of patients was low throughout the study, and there was no relationship between the incidence of adverse events and either hematocrit level or Epoetin alfa dose. Based on an analysis of data from baseline to first follow-up, Epoetin alfa therapy resulted in improvement in several quality-of-life factors, most notable of which was vitality. Improvement occurred in all patient subgroups with some variability in the level and intensity of effect. Overall, these data demonstrate that Epoetin alfa therapy is safe and effective when used in a broad cross-section of patients on dialysis.(ABSTRACT TRUNCATED AT 250 WORDS)

  2. First International Workshop on Human Factors in Modeling (HuFaMo 2015)

    DEFF Research Database (Denmark)

    Störrle, Harald; Chaudron, Michel R. V.; Amaral, Vasco

    2015-01-01

    human factors in modeling. Our goal is to improve the state of the science and professionalism in empirical research in the Model Based Engineering community. Typical examples of research questions might consider the usability of a certain approach, such as a method or language, or the emotional states......Modeling is a human-intensive enterprise. As such, many research questions related to modeling can only be answered by empirical studies employing human factors. The International Workshop Series on Human Factors in Modeling (HuFaMo) is dedicated to the discussion of empirical research involving...... or personal judgements of modelers. While concerned with foundations and framework support for modeling, the community has been somehow neglecting the issue of human factors in this context. There is a growing need from the community concerned with quality factors to understand the best practices...

  3. La voz y la letra en "Un huésped", de Yoko Tawada

    Directory of Open Access Journals (Sweden)

    María Lucía Correa

    2009-05-01

    Full Text Available Los textos de Yoko Tawada, escritorajaponesa residente en Alemania,hacen presente el desgarramientode quien vive fuera de la lenguamaterna. Es una obra que se balanceasobre el límite entre loscódigos, donde nada hay evidente,donde la palabra parece tener vidapropia. Entre los textos que tomanesta extrañeza del lenguaje comosustrato, se encuentra el relato"Un huésped", cuya particular referenciaa la voz y a la letra comodos registros que se entrelazan yse repelen alternativamente, loconvierte en una valiosa fuente dereflexiones sobre lo oral, la voz, laletra, la lectura y la escritura.Palabras clave: Yoko Tawada, literaturajaponesa contemporánea, voz,letra, escritura.

  4. Spectroscopy of bright Algol-type semi-detached close binary system HU Tauri (HR 1471)

    Science.gov (United States)

    Parthasarathy, M.

    2018-01-01

    Radial velocities of the primary component (B8V) of HU Tauri derived from the photographic spectra obtained during January 1974 to December 1974 and spectroscopic orbital elements from the analysis of the radial velocity curve of the B8V primary are given. The H line of the late type secondary component is clearly detected on the photographic spectra taken around the quadratures and radial velocities of the secondary component are derived. The radial velocity semi amplitudes of the primary (K) and secondary (K) are found to be 60 km/sec and 234 km/sec respectively. The mass ratio M/M = K/K is found to be 0.2564. The detection of the H line of the secondary is confirmed from the high resolution spectra that I obtained during 1981 and 1983 at quadratures using the 2.1-m McDonald observatory Otto Struve reflector telescope and high resolution coude Reticon spectrograph.

  5. The complete chloroplast genome sequence of the relict woody plant Metasequoia glyptostroboides Hu et Cheng

    Directory of Open Access Journals (Sweden)

    Jinhui eChen

    2015-06-01

    Full Text Available Metasequoia glyptostroboides Hu et Cheng is the only species in the genus Metasequoia Miki ex Hu et Cheng, which belongs to the Cupressaceae family. There were around ten species in the Metasequoia genus, which were widely spread across the Northern Hemisphere during the Cretaceous of the Mesozoic and in the Cenozoic. M. glyptostroboides is the only remaining representative of this genus. Here, we report the complete chloroplast (cp genome sequence and the cp genomic features of M. glyptostroboides. The M. glyptostroboides cp genome is 131,887 bp in length, with a total of 117 genes comprised of 82 protein-coding genes, 31 tRNA genes and four rRNA genes. In this genome, 11 forward repeats, nine palindromic repeats and 15 tandem repeats were detected. A total of 188 perfect microsatellites were detected through simple sequence repeat (SSR analysis and these were distributed unevenly within the cp genome. Comparison of the cp genome structure and gene order to those of several other land plants indicated that a copy of the inverted repeat (IR region, which was found to be IR region A (IRA, was lost in the M. glyptostroboides cp ge-nome. The five most divergent and five most conserved genes were determined and further phylogenetic analysis was performed among plant species, especially for relat-ed species in conifers. Finally, phylogenetic analysis demonstrated that M. glyptostro-boides is a sister species to Cryptomeria japonica (L. F. D. Don and to Taiwania cryptomerioides Hayata. The complete cp genome sequence information of M. glyp-tostroboides will be great helpful for further investigations of this endemic relict woody plant and for in-depth understanding of the evolutionary history of the conif-erous cp genomes, especially for the position of M. glyptostroboides in plant systemat-ics and evolution.

  6. The complete chloroplast genome sequence of the relict woody plant Metasequoia glyptostroboides Hu et Cheng.

    Science.gov (United States)

    Chen, Jinhui; Hao, Zhaodong; Xu, Haibin; Yang, Liming; Liu, Guangxin; Sheng, Yu; Zheng, Chen; Zheng, Weiwei; Cheng, Tielong; Shi, Jisen

    2015-01-01

    Metasequoia glyptostroboides Hu et Cheng is the only species in the genus Metasequoia Miki ex Hu et Cheng, which belongs to the Cupressaceae family. There were around 10 species in the Metasequoia genus, which were widely spread across the Northern Hemisphere during the Cretaceous of the Mesozoic and in the Cenozoic. M. glyptostroboides is the only remaining representative of this genus. Here, we report the complete chloroplast (cp) genome sequence and the cp genomic features of M. glyptostroboides. The M. glyptostroboides cp genome is 131,887 bp in length, with a total of 117 genes comprised of 82 protein-coding genes, 31 tRNA genes and four rRNA genes. In this genome, 11 forward repeats, nine palindromic repeats, and 15 tandem repeats were detected. A total of 188 perfect microsatellites were detected through simple sequence repeat (SSR) analysis and these were distributed unevenly within the cp genome. Comparison of the cp genome structure and gene order to those of several other land plants indicated that a copy of the inverted repeat (IR) region, which was found to be IR region A (IRA), was lost in the M. glyptostroboides cp genome. The five most divergent and five most conserved genes were determined and further phylogenetic analysis was performed among plant species, especially for related species in conifers. Finally, phylogenetic analysis demonstrated that M. glyptostroboides is a sister species to Cryptomeria japonica (L. F.) D. Don and to Taiwania cryptomerioides Hayata. The complete cp genome sequence information of M. glyptostroboides will be great helpful for further investigations of this endemic relict woody plant and for in-depth understanding of the evolutionary history of the coniferous cp genomes, especially for the position of M. glyptostroboides in plant systematics and evolution.

  7. New contributions to the knowledge of Chinese flea beetle fauna (III): Revision of Meishania Chen & Wang with description of five new species (Coleoptera: Chrysomelidae: Galerucinae)

    Science.gov (United States)

    The flea beetle genus Meishania Chen & Wang is revised and five new species - M. cangshanensis sp. nov., M. flavipennis sp. nov., M. fulvotigera sp. nov., and M. sichuanica sp. nov. from China and M. bhutanensis sp. nov. from Bhutan - are described. All species of Meishania are illustrated and a key...

  8. H.E. Professor Wang Liheng, Minister of Aviation of the People's Republic of China, President, China Aerospace Science & Technology Corporation

    CERN Multimedia

    Patrice Loïez

    2001-01-01

    H. E. Professor Wang Liheng, Minister of Aviation, and President, China Aerospace Science & Technology Corporation, People's Republic of China (2nd from left) with (from left to right) Professor Hans Hofer, Professor Roger Cashmore, Research Director for Collider Programmes, Professor Samuel C. C. Ting, CERN and Professor Lei Gang, Secretary to the Minister, September 2001.

  9. Answer to Wang and Luo, "Polyploidization increases meiotic recombination frequency in Arabidopsis: a close look at statistical modelling and data analysis"

    Directory of Open Access Journals (Sweden)

    Pecinka Ales

    2012-04-01

    Full Text Available Abstract This article is a response to Wang and Luo. See correspondence article http://www.biomedcentral.com/1741-7007/10/30/ [WEBCITE] and the original research article http://www.biomedcentral.com/1741-7007/9/24 [WEBCITE].

  10. Anti-Inflammatory and Osteoprotective Effects of Cannabinoid-2 Receptor Agonist HU-308 in a Rat Model of Lipopolysaccharide-Induced Periodontitis.

    Science.gov (United States)

    Ossola, Cesar A; Surkin, Pablo N; Mohn, Claudia E; Elverdin, Juan C; Fernández-Solari, Javier

    2016-06-01

    Anti-inflammatory and immunologic properties of cannabinoids have been reported in several tissues. Expression of cannabinoid receptor Type 2 was reported in osteoblasts and osteoclasts, suggesting a key role in bone metabolism. The aim of this study is to assess the effect of treatment with cannabinoid-2 receptor agonist HU-308 in the oral health of rats subjected to lipopolysaccharide (LPS)-induced periodontitis. Twenty-four rats were distributed in four groups (six rats per group): 1) control rats; 2) sham rats; 3) rats submitted to experimental periodontitis (LPS); and 4) rats submitted to experimental periodontitis and treated with HU-308 (LPS+HU). In groups LPS and LPS+HU, periodontitis was induced by LPS (1 mg/mL) injected into the gingival tissue (GT) of maxillary and mandibular first molars and into the interdental space between the first and second molars, 3 days per week for 6 weeks. In group LPS+HU, HU-308 (500 ng/mL) was applied topically to the GT daily. Alveolar bone loss resulting from LPS-induced periodontitis was significantly attenuated with HU-308 treatment (LPS+HU), measured by macroscopic and histologic examination. Treatment also reduced gingival production of inflammatory mediators augmented in LPS-injected rats, such as: 1) inducible nitric oxide (iNOS) activity (LPS: 90.18 ± 36.51 pmol/minute/mg protein versus LPS+HU: 16.37 ± 4.73 pmol/minute/mg protein; P periodontitis on the salivary secretory response to pilocarpine. Moreover, iNOS activity and PGE2 content, which were increased by LPS-induced periodontitis in the submandibular gland, returned to control values after HU-308 treatment. This study demonstrates anti-inflammatory, osteoprotective, and prohomeostatic effects of HU-308 in oral tissues of rats with LPS-induced periodontitis.

  11. Isolation and characterization of a catalase gene "HuCAT3" from pitaya (Hylocereus undatus) and its expression under abiotic stress.

    Science.gov (United States)

    Nie, Qiong; Gao, Guo-Li; Fan, Qing-jie; Qiao, Guang; Wen, Xiao-Peng; Liu, Tao; Peng, Zhi-Jun; Cai, Yong-Qiang

    2015-05-25

    Abiotic stresses usually cause H2O2 accumulation, with harmful effects, in plants. Catalase may play a key protective role in plant cells by detoxifying this excess H2O2. Pitaya (Hylocereus undatus) shows broad ecological adaptation due to its high tolerance to abiotic stresses, e.g. drought, heat and poor soil. However, involvement of the pitaya catalase gene (HuCAT) in tolerance to abiotic stresses is unknown. In the present study, a full-length HuCAT3 cDNA (1870 bp) was isolated from pitaya based on our previous microarray data and RACE method. The cDNA sequence and deduced amino acid sequence shared 73-77% and 75-80% identity with other plant catalases, respectively. HuCAT3 contains conserved catalase family domain and catalytic sites. Pairwise comparison and phylogenetic analysis indicated that HuCAT3 is most similar to Eriobotrya japonica CAT, followed by Dimocarpus longan CAT and Nicotiana tabacum CAT1. Expression profile analysis demonstrated that HuCAT3 is mainly expressed in green cotyledons and mature stems, and was regulated by H2O2, drought, cold and salt stress, whereas, its expression patterns and maximum expression levels varied with stress types. HuCAT activity increased as exposure to the tested stresses, and the fluctuation of HuCAT activity was consistent with HuCAT3 mRNA abundance (except for 0.5 days upon drought stress). HuCAT3 mRNA elevations and HuCAT activities changes under cold stress were also in conformity with the cold tolerances among the four genotypes. The obtained results confirmed a major role of HuCAT3 in abiotic stress response of pitaya. This may prove useful in understanding pitaya's high tolerance to abiotic stresses at molecular level. Copyright © 2015 Elsevier B.V. All rights reserved.

  12. The histone-like protein HU has a role in gene expression during the acid adaptation response in Helicobacter pylori.

    Science.gov (United States)

    Álvarez, Alhejandra; Toledo, Héctor

    2017-08-01

    Gastritis, ulcers, and gastric malignancy have been linked to human gastric epithelial colonization by Helicobacter pylori. Characterization of the mechanisms by which H. pylori adapts to the human stomach environment is of crucial importance to understand H. pylori pathogenesis. In an effort to extend our knowledge of these mechanisms, we used proteomic analysis and qRT-PCR to characterize the role of the histone-like protein HU in the response of H. pylori to low pH. Proteomic analysis revealed that genes involved in chemotaxis, oxidative stress, or metabolism are under control of the HU protein. Also, expression of the virulence factors Ggt and NapA is affected by the null mutation of hup gene both at neutral and acid pH, as evidenced by qRT-PCR analysis. Those results showed that H. pylori gene expression is altered by shift to low pH, thus confirming that acid exposure leads to profound changes in genomic expression, and suggest that the HU protein is a regulator that may help the bacterium adapt to the acid stress. In accordance with previous reports, we found that the HU protein participates in gene expression regulation when the microorganism is exposed to acid stress. Such transcriptional regulation underlies protein accumulation in the H. pylori cell. © 2017 John Wiley & Sons Ltd.

  13. Preliminary crystallographic analysis of the RNA-binding domain of HuR and its poly(U)-binding properties

    International Nuclear Information System (INIS)

    Wang, Hong; Li, Heng; Shi, Hui; Liu, Yang; Liu, Huihui; Zhao, Hui; Niu, Liwen; Teng, Maikun; Li, Xu

    2011-01-01

    Here, the recombinant ARE-binding region of HuR (residues 18–186) was crystallized in space group P2 1 2 1 2, with unit-cell parameters a = 41.2, b = 133.1, c = 31.4 Å. Human antigen R (HuR), a ubiquitously expressed member of the Hu protein family, is an important post-transcriptional regulator which has three RNA-recognition motif (RRM) domains. The two tandem N-terminal RRM domains can selectively bind to the AU-rich element (ARE), while the third one interacts with the poly(A) tail and other proteins. Here, the recombinant ARE-binding region of HuR (residues 18–186) was crystallized in space group P2 1 2 1 2, with unit-cell parameters a = 41.2, b = 133.1, c = 31.4 Å. X-ray diffraction data were collected to a resolution of 2.8 Å. Mutagenesis analysis and SPR assays revealed its poly(U)-binding properties

  14. All-atom simulation study of protein PTH(1-34) by using the Wang-Landau sampling method

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Seung-Yeon [Korea National University of Transportation, Chungju (Korea, Republic of); Kwak, Woo-Seop [Chosun University, Gwangju (Korea, Republic of)

    2014-12-15

    We perform simulations of the N-terminal 34-residue protein fragment PTH(1-34), consisting of 581 atoms, of the 84-residue human parathyroid hormone by using the all-atom ECEPP/3 force field and the Wang-Landau sampling method. Through a massive high-performance computation, the density of states and the partition function Z(T), as a continuous function of T, are obtained for PTH(1-34). From the continuous partition function Z(T), the partition function zeros of PTH(1-34) are evaluated for the first time. From both the specific heat and the partition function zeros, two characteristic transition temperatures are obtained for the all-atom protein PTH(1-34). The higher transition temperature T{sub 1} and the lower transition temperature T{sub 2} of PTH(1-34) can be interpreted as the collapse temperature T{sub θ} and the folding temperature T{sub f} , respectively.

  15. Risky choice with heuristics: reply to Birnbaum (2008), Johnson, Schulte-Mecklenbeck, and Willemsen (2008), and Rieger and Wang (2008).

    Science.gov (United States)

    Brandstätter, Eduard; Gigerenzer, Gerd; Hertwig, Ralph

    2008-01-01

    E. Brandstätter, G. Gigerenzer, and R. Hertwig (2006) showed that the priority heuristic matches or outperforms modifications of expected utility theory in predicting choice in 4 diverse problem sets. M. H. Birnbaum (2008) argued that sets exist in which the opposite is true. The authors agree--but stress that all choice strategies have regions of good and bad performance. The accuracy of various strategies systematically depends on choice difficulty, which the authors consider a triggering variable underlying strategy selection. Agreeing with E. J. Johnson, M. Schulte-Mecklenbeck, and M. C. Willemsen (2008) that process (not "as-if") models need to be formulated, the authors show how quantitative predictions can be derived and test them. Finally, they demonstrate that many of Birnbaum's and M. O. Rieger and M. Wang's (2008) case studies championing their preferred models involved biased tests in which the priority heuristic predicted data, whereas the parameterized models were fitted to the same data. The authors propose an adaptive toolbox approach of risky choice, according to which people first seek a no-conflict solution before resorting to conflict-resolving strategies such as the priority heuristic. (c) 2008 APA, all rights reserved

  16. Peripheral blood progenitor cell transplantation mobilised by r-metHuG-CSF (filgrastim); a less costly alternative to autologous bone marrow transplantation

    NARCIS (Netherlands)

    C.A. Uyl-de Groot (Carin); D.J. Richel (Dirk); F.F.H. Rutten (Frans)

    1994-01-01

    textabstractIn a retrospective study, we calculated the treatment costs of 63 patients who received either autologous bone marrow transplantation (ABMT) with recombinant human granulocyte colony-stimulating factor (r-metHuG-CSF) (filgrastim) (n=13) or without r-metHuG-CSF (n=22) or altenatively,

  17. Comparison of HuRAM+ and HERA for Development of Data Worksheet for Simulator based HERA Databank

    International Nuclear Information System (INIS)

    Choi, Sunyoung; Jung, Wondea

    2013-01-01

    We also compared the existing HERA methods and HERA database to select essential data fields. We performed a preliminary study to see the possibility to induce the operator's emergency operating procedure (EOP) noncompliance behaviors under a simulated emergency. The purpose of this paper is to compare the HuRAM + and HERA to obtain an insight into the construction of a data worksheet for a qualitative HERA. In this paper, we performed a case study for applying simulator training data to HuRAM + and HERA. With this insight, as well as the results of the researches mentioned above, we have a plan to develop a systematic and qualitative HERA and a data worksheet for the work. In this paper, we compared HuRAM + and HERA to obtain an insight into the construction of a data worksheet for a qualitative HERA and performed a case study. HERA requires a burden to analyze and input an event data due to too many data fields even though it is well designed to estimate Heaps. It is somewhat more convenient to input data into the HuRAM + ; however, it is difficult to analyze the organization and safety culture factors. We are now trying to develop the framework of a data worksheet for a qualitative HERA based on simulator training data. The purpose of our data worksheet is to provide key information for HEP estimation and to enhance the understanding of an operators' behavior under an off-normal plant status. We aim less encumbered means of obtaining the needed data for HERA by changing the existing data worksheet framework of HuRAM + and HERA and by reducing data fields that require reading the between the lines

  18. The RNA binding protein HuR does not interact directly with HIV-1 reverse transcriptase and does not affect reverse transcription in vitro

    Directory of Open Access Journals (Sweden)

    Gronenborn Angela M

    2010-05-01

    Full Text Available Abstract Background Lemay et al recently reported that the RNA binding protein HuR directly interacts with the ribonuclease H (RNase H domain of HIV-1 reverse transcriptase (RT and influences the efficiency of viral reverse transcription (Lemay et al., 2008, Retrovirology 5:47. HuR is a member of the embryonic lethal abnormal vision protein family and contains 3 RNA recognition motifs (RRMs that bind AU-rich elements (AREs. To define the structural determinants of the HuR-RT interaction and to elucidate the mechanism(s by which HuR influences HIV-1 reverse transcription activity in vitro, we cloned and purified full-length HuR as well as three additional protein constructs that contained the N-terminal and internal RRMs, the internal and C-terminal RRMs, or the C-terminal RRM only. Results All four HuR proteins were purified and characterized by biophysical methods. They are well structured and exist as monomers in solution. No direct protein-protein interaction between HuR and HIV-1 RT was detected using NMR titrations with 15N labeled HuR variants or the 15N labeled RNase H domain of HIV-1 RT. Furthermore, HuR did not significantly affect the kinetics of HIV-1 reverse transcription in vitro, even on RNA templates that contain AREs. Conclusions Our results suggest that HuR does not impact HIV-1 replication through a direct protein-protein interaction with the viral RT.

  19. 89Zr-huJ591 immuno-PET imaging in patients with advanced metastatic prostate cancer

    International Nuclear Information System (INIS)

    Pandit-Taskar, Neeta; Solomon, Stephen B.; Durack, Jeremy C.; Carrasquillo, Jorge A.; Lefkowitz, Robert A.; Osborne, Joseph R.; O'Donoghue, Joseph A.; Beylergil, Volkan; Ruan, Shutian; Cheal, Sarah M.; Lyashchenko, Serge; Gonen, Mithat; Lewis, Jason S.; Holland, Jason P.; Reuter, Victor E.; Loda, Massimo F.; Smith-Jones, Peter M.; Weber, Wolfgang A.; Larson, Steven M.; Bander, Neil H.; Scher, Howard I.; Morris, Michael J.

    2014-01-01

    Given the bone tropism of prostate cancer, conventional imaging modalities poorly identify or quantify metastatic disease. 89 Zr-huJ591 positron emission tomography (PET) imaging was performed in patients with metastatic prostate cancer to analyze and validate this as an imaging biomarker for metastatic disease. The purpose of this initial study was to assess safety, biodistribution, normal organ dosimetry, and optimal imaging time post-injection for lesion detection. Ten patients with metastatic prostate cancer received 5 mCi of 89 Zr-huJ591. Four whole-body scans with multiple whole-body count rate measurements and serum activity concentration measurements were obtained in all patients. Biodistribution, clearance, and lesion uptake by 89 Zr-huJ591 immuno-PET imaging was analyzed and dosimetry was estimated using MIRD techniques. Initial assessment of lesion targeting of 89 Zr-huJ591 was done. Optimal time for imaging post-injection was determined. The dose was well tolerated with mild chills and rigors seen in two patients. The clearance of 89 Zr-huJ591 from serum was bi-exponential with biological half-lives of 7 ± 4.5 h (range 1.1-14 h) and 62 ± 13 h (range 51-89 h) for initial rapid and later slow phase. Whole-body biological clearance was 219 ± 48 h (range 153-317 h). The mean whole-body and liver residence time was 78.7 and 25.6 h, respectively. Dosimetric estimates to critical organs included liver 7.7 ± 1.5 cGy/mCi, renal cortex 3.5 ± 0.4 cGy/mCi, and bone marrow 1.2 ± 0.2 cGy/mCi. Optimal time for patient imaging after injection was 7 ± 1 days. Lesion targeting of bone or soft tissue was seen in all patients. Biopsies were performed in 8 patients for a total 12 lesions, all of which were histologically confirmed as metastatic prostate cancer. One biopsy-proven lesion was not positive on 89 Zr-huJ591, while the remaining 11 lesions were 89 Zr-huJ591 positive. Two biopsy-positive nodal lesions were noted only on 89 Zr-huJ591 study, while the

  20. {sup 89}Zr-huJ591 immuno-PET imaging in patients with advanced metastatic prostate cancer

    Energy Technology Data Exchange (ETDEWEB)

    Pandit-Taskar, Neeta; Solomon, Stephen B.; Durack, Jeremy C.; Carrasquillo, Jorge A.; Lefkowitz, Robert A.; Osborne, Joseph R. [Memorial Sloan Kettering Cancer Center, Department of Radiology, New York, NY (United States); Weill Cornell Medical College, Department of Radiology, New York, NY (United States); O' Donoghue, Joseph A. [Memorial Sloan Kettering Cancer Center, Department of Medical Physics, New York, NY (United States); Beylergil, Volkan; Ruan, Shutian; Cheal, Sarah M. [Memorial Sloan Kettering Cancer Center, Department of Radiology, New York, NY (United States); Lyashchenko, Serge [Memorial Sloan Kettering Cancer Center, Department of Radiochemistry and Molecular Imaging Probes Core, New York, NY (United States); Gonen, Mithat [Memorial Sloan Kettering Cancer Center, Department of Epidemiology and Biostatistics, New York, NY (United States); Lewis, Jason S. [Memorial Sloan Kettering Cancer Center, Department of Radiology, New York, NY (United States); Memorial Sloan Kettering Cancer Center, Department of Radiochemistry and Molecular Imaging Probes Core, New York, NY (United States); Memorial Sloan Kettering Cancer Center, Program in Molecular Pharmacology and Chemistry, New York, NY (United States); Weill Cornell Medical College, Department of Radiology, New York, NY (United States); Holland, Jason P. [Memorial Sloan Kettering Cancer Center, Department of Radiology, New York, NY (United States); Harvard Medical School, Department of Radiology of Massachusetts General Hospital, Boston, MA (United States); Reuter, Victor E. [Memorial Sloan Kettering Cancer Center, Department of Pathology, New York, NY (United States); Weill Cornell Medical College, Department of Pathology, New York, NY (United States); Loda, Massimo F. [Dana-Farber Cancer Institute, Boston, MA (United States); Broad Institute of Harvard and MIT, Cambridge, MA (United States); Smith-Jones, Peter M. [Memorial Sloan Kettering Cancer Center, Department of Radiology, New York, NY (United States); Department of Psychiatry and Behavioral Science of Stony Brook University, Stony Brook, NY (United States); Weber, Wolfgang A.; Larson, Steven M. [Memorial Sloan Kettering Cancer Center, Department of Radiology, New York, NY (United States); Memorial Sloan Kettering Cancer Center, Program in Molecular Pharmacology and Chemistry, New York, NY (United States); Weill Cornell Medical College, Department of Radiology, New York, NY (United States); Bander, Neil H. [Memorial Sloan Kettering Cancer Center, Department of Surgery, New York, NY (United States); Weill Cornell Medical College, Department of Urology, New York, NY (United States); Scher, Howard I.; Morris, Michael J. [Memorial Sloan Kettering Cancer Center, Department of Medicine, New York, NY (United States); Weill Cornell Medical College, Department of Medicine, New York, NY (United States)

    2014-11-15

    Given the bone tropism of prostate cancer, conventional imaging modalities poorly identify or quantify metastatic disease. {sup 89}Zr-huJ591 positron emission tomography (PET) imaging was performed in patients with metastatic prostate cancer to analyze and validate this as an imaging biomarker for metastatic disease. The purpose of this initial study was to assess safety, biodistribution, normal organ dosimetry, and optimal imaging time post-injection for lesion detection. Ten patients with metastatic prostate cancer received 5 mCi of {sup 89}Zr-huJ591. Four whole-body scans with multiple whole-body count rate measurements and serum activity concentration measurements were obtained in all patients. Biodistribution, clearance, and lesion uptake by {sup 89}Zr-huJ591 immuno-PET imaging was analyzed and dosimetry was estimated using MIRD techniques. Initial assessment of lesion targeting of {sup 89}Zr-huJ591 was done. Optimal time for imaging post-injection was determined. The dose was well tolerated with mild chills and rigors seen in two patients. The clearance of {sup 89}Zr-huJ591 from serum was bi-exponential with biological half-lives of 7 ± 4.5 h (range 1.1-14 h) and 62 ± 13 h (range 51-89 h) for initial rapid and later slow phase. Whole-body biological clearance was 219 ± 48 h (range 153-317 h). The mean whole-body and liver residence time was 78.7 and 25.6 h, respectively. Dosimetric estimates to critical organs included liver 7.7 ± 1.5 cGy/mCi, renal cortex 3.5 ± 0.4 cGy/mCi, and bone marrow 1.2 ± 0.2 cGy/mCi. Optimal time for patient imaging after injection was 7 ± 1 days. Lesion targeting of bone or soft tissue was seen in all patients. Biopsies were performed in 8 patients for a total 12 lesions, all of which were histologically confirmed as metastatic prostate cancer. One biopsy-proven lesion was not positive on {sup 89}Zr-huJ591, while the remaining 11 lesions were {sup 89}Zr-huJ591 positive. Two biopsy-positive nodal lesions were noted only on

  1. Characterization of a novel xylanase gene from rumen content of Hu sheep.

    Science.gov (United States)

    Wang, Qian; Luo, Yang; He, Bo; Jiang, Lin-Shu; Liu, Jian-Xin; Wang, Jia-Kun

    2015-12-01

    A novel xylanase gene, xyn-lxy, was cloned from a metagenomic fosmid library, which was previously constructed from the rumen contents of Hu sheep and was functionally characterized in Escherichia coli. The open reading frame was composed of 1923 bp and encoded for 640 amino acids, including a catalytic domain of glycosyl hydrolase family 10 and carbohydrate-binding module 9. The gene showed 97 % identity with uncultured bacterium Contig1552 but low similarity with xylanases from known cellulolytic-degrading microorganisms in the rumen. The recombinant XYN-LXY showed a specific activity of 664.7 U mg(-1). The optimal temperature and pH of the enzyme were 50 °C and 6.0, respectively. Specifically, XYN-LXY was exclusively activated by Mn(2+) among all of the cations and reducing agents tested in this study. An enzymatic hydrolysis assay revealed that XYN-LXY degraded birchwood xylan into xylooligosaccharide with a low degree of polymerization. After incubation for 4 h, the concentration of the dominant product, xylobiose, was 2.297 ± 0.175 mg ml(-1) (74.07 % of total product) followed by xylose with a concentration of 0.656 ± 0.010 mg ml(-1) (21.14 % of total product). The XYN-LXY exhibited deep degradation effects on the xylan substrate, which were rarely observed with endo-xylanase, making it a promising candidate for industrial application, especially in biofuel production.

  2. Feasibility of CBCT-based dose calculation: Comparative analysis of HU adjustment techniques

    International Nuclear Information System (INIS)

    Fotina, Irina; Hopfgartner, Johannes; Stock, Markus; Steininger, Thomas; Lütgendorf-Caucig, Carola; Georg, Dietmar

    2012-01-01

    Background and purpose: The aim of this work was to compare the accuracy of different HU adjustments for CBCT-based dose calculation. Methods and materials: Dose calculation was performed on CBCT images of 30 patients. In the first two approaches phantom-based (Pha-CC) and population-based (Pop-CC) conversion curves were used. The third method (WAB) represents override of the structures with standard densities for water, air and bone. In ROI mapping approach all structures were overridden with average HUs from planning CT. All techniques were benchmarked to the Pop-CC and CT-based plans by DVH comparison and γ-index analysis. Results: For prostate plans, WAB and ROI mapping compared to Pop-CC showed differences in PTV D median below 2%. The WAB and Pha-CC methods underestimated the bladder dose in IMRT plans. In lung cases PTV coverage was underestimated by Pha-CC method by 2.3% and slightly overestimated by the WAB and ROI techniques. The use of the Pha-CC method for head–neck IMRT plans resulted in difference in PTV coverage up to 5%. Dose calculation with WAB and ROI techniques showed better agreement with pCT than conversion curve-based approaches. Conclusions: Density override techniques provide an accurate alternative to the conversion curve-based methods for dose calculation on CBCT images.

  3. Antioxidant and antidermatophytic activities of essential oil and extracts of Metasequoia glyptostroboides Miki ex Hu.

    Science.gov (United States)

    Bajpai, Vivek K; Yoon, Jung In; Chul Kang, Sun

    2009-06-01

    This study was undertaken to assess the antioxidant and antidermatophytic potential of the essential oil and extracts (hexane, chloroform, ethyl acetate and methanol) of Metasequoia glyptostroboides Miki ex Hu. Antioxidant activity was evaluated by using 1,1-diphenyl-2-picrylhydrazyl (DPPH) assay. The free radical scavenging activities of the oil and ethyl acetate extract were found to be superior (IC(50)=9.1 and 14.24 microg/ml, respectively) as compared to butylatedhydroxyanisole (BHA), (IC(50)=18.27 microg/ml). Also the ethyl acetate extract revealed the highest phenolic contents (93.26 mg/g of dry wt) as compared to the other extracts. Further, oil (1250 microg/disc) and extracts (1750 microg/disc) revealed 35.33-67.66 and 18.0-53.3% antidermatophytic effect, respectively, along with their respective MIC values (62.5-500 and 250-4000 microg/ml) against Trichophyton rubrum KCTC 6345, T. rubrum KCTC 6375, T. rubrum KCTC 6352, T. mentagrophytes KCTC 6085, T. mentagrophytes KCTC 6077, T. mentagrophytes KCTC 6316, Microsporum canis KCTC 6591, M. canis KCTC 6348 and M. canis KCTC 6349. The oil also had a strong detrimental effect on spore germination as well as concentration and time-dependent kinetic inhibition of M. canis KCTC 6591.

  4. La huída en la obra de Mario Vargas Llosa

    Directory of Open Access Journals (Sweden)

    German Arce Ross

    Full Text Available Se trata de poner en perspectiva la mayor parte de novelas de Mario Vargas Llosa en función del tema de la huída, partiendo del hecho que é1 solicitó la nacionalidad Española inmediatamente después de haber perdido las elecciones para la Presidencia del Perú y de haber escrito El pez en el agua. Nuestro análisis intenta demostrar la importancia de la figura paterna – principalmente en el sentido de su ausencia y de sus bruscas reapariciones – en la cristalización sintomática del tema de la fuga. Es por eso que una analogía con la posición fóbica, en relación al padre o a sus substitutos, nos ha parecido pertinente. Teniendo como pivot el análisis de la forma, del contexto y del contenido de su libro de memorias, este trabajo definiría así las bases de una contribución literaria de la obra de Vargas Llosa a la clinica de la fobia.

  5. Systematics of a kleptoplastidal dinoflagellate, Gymnodinium eucyaneum Hu (Dinophyceae), and its cryptomonad endosymbiont.

    Science.gov (United States)

    Xia, Shuang; Zhang, Qi; Zhu, Huan; Cheng, Yingyin; Liu, Guoxiang; Hu, Zhengyu

    2013-01-01

    New specimens of the kleptoplastidal dinoflagellate Gymnodinium eucyaneum Hu were collected in China. We investigated the systematics of the dinoflagellate and the origin of its endosymbiont based on light morphology and phylogenetic analyses using multiple DNA sequences. Cells were dorsoventrally flattened with a sharply acute hypocone and a hemispherical epicone. The confusion between G. eucyaneum and G. acidotum Nygaard still needs to be resolved. We found that the hypocone was conspicuously larger than the epicone in most G. eucyaneum cells, which differed from G. acidotum, but there were a few cells whose hypocone and epicone were of nearly the same size. In addition, there was only one site difference in the partial nuclear LSU rDNA sequences of a sample from Japan given the name G. acidotum and G. eucyaneum in the present study, which suggest that G. eucyaneum may be a synonym of G. acidotum. Spectroscopic analyses and phylogenetic analyses based on nucleomorph SSU rDNA sequences and chloroplast 23 s rDNA sequences suggested that the endosymbiont of G. eucyaneum was derived from Chroomonas (Cryptophyta), and that it was most closely related to C. coerulea Skuja. Moreover, the newly reported kleptoplastidal dinoflagellates G. myriopyrenoides and G. eucyaneum in our study were very similar, and the taxonomy of kleptoplastidal dinoflagellates was discussed.

  6. Systematics of a kleptoplastidal dinoflagellate, Gymnodinium eucyaneum Hu (Dinophyceae, and its cryptomonad endosymbiont.

    Directory of Open Access Journals (Sweden)

    Shuang Xia

    Full Text Available New specimens of the kleptoplastidal dinoflagellate Gymnodinium eucyaneum Hu were collected in China. We investigated the systematics of the dinoflagellate and the origin of its endosymbiont based on light morphology and phylogenetic analyses using multiple DNA sequences. Cells were dorsoventrally flattened with a sharply acute hypocone and a hemispherical epicone. The confusion between G. eucyaneum and G. acidotum Nygaard still needs to be resolved. We found that the hypocone was conspicuously larger than the epicone in most G. eucyaneum cells, which differed from G. acidotum, but there were a few cells whose hypocone and epicone were of nearly the same size. In addition, there was only one site difference in the partial nuclear LSU rDNA sequences of a sample from Japan given the name G. acidotum and G. eucyaneum in the present study, which suggest that G. eucyaneum may be a synonym of G. acidotum. Spectroscopic analyses and phylogenetic analyses based on nucleomorph SSU rDNA sequences and chloroplast 23 s rDNA sequences suggested that the endosymbiont of G. eucyaneum was derived from Chroomonas (Cryptophyta, and that it was most closely related to C. coerulea Skuja. Moreover, the newly reported kleptoplastidal dinoflagellates G. myriopyrenoides and G. eucyaneum in our study were very similar, and the taxonomy of kleptoplastidal dinoflagellates was discussed.

  7. Pathological brain detection based on wavelet entropy and Hu moment invariants.

    Science.gov (United States)

    Zhang, Yudong; Wang, Shuihua; Sun, Ping; Phillips, Preetha

    2015-01-01

    With the aim of developing an accurate pathological brain detection system, we proposed a novel automatic computer-aided diagnosis (CAD) to detect pathological brains from normal brains obtained by magnetic resonance imaging (MRI) scanning. The problem still remained a challenge for technicians and clinicians, since MR imaging generated an exceptionally large information dataset. A new two-step approach was proposed in this study. We used wavelet entropy (WE) and Hu moment invariants (HMI) for feature extraction, and the generalized eigenvalue proximal support vector machine (GEPSVM) for classification. To further enhance classification accuracy, the popular radial basis function (RBF) kernel was employed. The 10 runs of k-fold stratified cross validation result showed that the proposed "WE + HMI + GEPSVM + RBF" method was superior to existing methods w.r.t. classification accuracy. It obtained the average classification accuracies of 100%, 100%, and 99.45% over Dataset-66, Dataset-160, and Dataset-255, respectively. The proposed method is effective and can be applied to realistic use.

  8. Managing Stability in the Taiwan Strait: Non-Military Policy towards Taiwan under Hu Jintao

    Directory of Open Access Journals (Sweden)

    Wu-ueh Chang

    2009-10-01

    Full Text Available China’s Taiwan policy has been one of coupling intimidation (the “stick” approach with coercion (the “carrot” approach, a policy mix which, in the near term, is not likely to change, as is evidenced by the passage of the “Anti-Secession Law” in March, 2005. However, under Hu Jintao, the focus has been on pragmatism. The warm atmosphere that presently reigns in the Taiwan Strait area is unprecedented. Further talks are expected before the two cross-Strait leaders are slated to step down, simultaneously, in 2012. An era of reconciliation and negotiations has dawned. For the first time there is consensus regarding norms of interaction between the two sides. Cross-Strait relations have stabilized after years of tumult. More open, stable and predictable cross-Strait relations are in the interests of both sides. Difficulties surely lie ahead, but they will be dealt with in a different manner than what has been witnessed in the past.

  9. Public health impact of disease-behavior dynamics. Comment on "Coupled disease-behavior dynamics on complex networks: A review" by Z. Wang et al.

    Science.gov (United States)

    Wells, Chad R.; Galvani, Alison P.

    2015-12-01

    In a loop of dynamic feedback, behavior such as the decision to vaccinate, hand washing, or avoidance influences the progression of the epidemic, yet behavior is driven by the individual's and population's perceived risk of infection during an outbreak. In what we believe will become a seminal paper that stimulates future research as well as an informative teaching aid, Wang et. al. comprehensively review methodological advances that have been used to incorporate human behavior into epidemiological models on the effects of coupling disease transmission and behavior on complex social networks [1]. As illustrated by the recent outbreaks of measles and Middle Eastern Respiratory Syndrome (MERS), here we highlight the importance of coupling behavior and disease transmission that Wang et al. address.

  10. Supplier evaluation system of the wood processing enterprise in the region of the CZ, SK, HU and AT

    OpenAIRE

    Muselíková, Vladislava

    2015-01-01

    The Bachelor thesis Supplier evaluation system of the wood processing enterprise in the region of the CR, the SK, HU and AT deals with the analysis of the current supplier evaluation system in IKEA Industry company in Malacky. The theoretical part is based on literature review and contains a description of the purchasing process and methodology for selection and evaluation of suppliers. The practical part is devoted to the analysis of the Supplier Classification in IKEA. The main output of th...

  11. HTLV-1 Infection and Neuropathogenesis in the Context of Rag1-/-γc-/- (RAG1-Hu) and BLT Mice.

    Science.gov (United States)

    Ginwala, Rashida; Caruso, Breanna; Khan, Zafar K; Pattekar, Ajinkya; Chew, Glen M; Corley, Michael J; Loonawat, Ronak; Jacobson, Steven; Sreedhar, Sreesha; Ndhlovu, Lishomwa C; Jain, Pooja

    2017-09-01

    To date, the lack of a suitable small animal model has hindered our understanding of Human T-cell lymphotropic virus (HTLV)-1 chronic infection and associated neuropathogenesis defined as HTLV-1-associated myelopathy/tropical spastic paraparesis (HAM/TSP). The host immune response plays a critical role in the outcome of HTLV-1 infection, which could be better tested in the context of humanized (hu) mice. Thus, we employ here the Balb/c-Rag1 -/- γc -/- or Rag1 as well as Bone marrow-Liver-Thymic (BLT) mouse models for engraftment of human CD34 + hematopoietic stem cells. Flow cytometry and histological analyses confirmed reconstitution of Rag1 and BLT mice with human immune cells. Following HTLV-1 infection, proviral load (PVL) was detected in the blood of Rag-1 and BLT hu-mice as early as 2 weeks post-infection (wpi) with sustained elevation in the subsequent weeks followed by Tax expression. Additionally, infection was compared between adult and neonatal Rag1 mice with both PVL and Tax expression considerably higher in the adult Rag1 mice as compared to the neonates. Establishment of peripheral infection led to lymphocytic infiltration with concomitant Tax expression and resulting myelin disruption within the central nervous system of infected mice. In addition, up-regulation in the expression of several immune checkpoint mediators such as programmed cell death-1 (PD-1), T-cell Ig and ITIM domain (TIGIT), and T cell Ig and mucin domain-3 protein (Tim-3) were observed on CD8 + T cells in various organs including the CNS of infected hu-mice. Collectively, these studies represent the first attempt to establish HTLV-1 neuropathogenesis in the context of Rag-1 and BLT hu-mice as potential novel tools for understanding HTLV-1 neuropathogenesis and testing of novel therapies such as immune checkpoint blockade in the amelioration of chronic HTLV-1 infection.

  12. Tra stabilità sociale e pornografia: giochi di parole sovversivi e armonizzazione su Internet nell’era Hu Jintao

    Directory of Open Access Journals (Sweden)

    Nazarena Fazzari

    2017-07-01

    Full Text Available The purpose of this paper is to analyze the policies adopted by the government of Hu Jintao (2002-2012 about the Internet. Such laws have been partially translated into Italian. Their aim alternates between the fight against pornography and the protection of social stability. The ‘digital resistance’ attempts to evade censorship through homophony, e.g. through the Baidu ten mythical creatures, the most famous being Caonima.

  13. HuD and the Survival Motor Neuron Protein Interact in Motoneurons and Are Essential for Motoneuron Development, Function, and mRNA Regulation.

    Science.gov (United States)

    Hao le, Thi; Duy, Phan Q; An, Min; Talbot, Jared; Iyer, Chitra C; Wolman, Marc; Beattie, Christine E

    2017-11-29

    Motoneurons establish a critical link between the CNS and muscles. If motoneurons do not develop correctly, they cannot form the required connections, resulting in movement defects or paralysis. Compromised development can also lead to degeneration because the motoneuron is not set up to function properly. Little is known, however, regarding the mechanisms that control vertebrate motoneuron development, particularly the later stages of axon branch and dendrite formation. The motoneuron disease spinal muscular atrophy (SMA) is caused by low levels of the survival motor neuron (SMN) protein leading to defects in vertebrate motoneuron development and synapse formation. Here we show using zebrafish as a model system that SMN interacts with the RNA binding protein (RBP) HuD in motoneurons in vivo during formation of axonal branches and dendrites. To determine the function of HuD in motoneurons, we generated zebrafish HuD mutants and found that they exhibited decreased motor axon branches, dramatically fewer dendrites, and movement defects. These same phenotypes are present in animals expressing low levels of SMN, indicating that both proteins function in motoneuron development. HuD binds and transports mRNAs and one of its target mRNAs, Gap43 , is involved in axonal outgrowth. We found that Gap43 was decreased in both HuD and SMN mutants. Importantly, transgenic expression of HuD in motoneurons of SMN mutants rescued the motoneuron defects, the movement defects, and Gap43 mRNA levels. These data support that the interaction between SMN and HuD is critical for motoneuron development and point to a role for RBPs in SMA. SIGNIFICANCE STATEMENT In zebrafish models of the motoneuron disease spinal muscular atrophy (SMA), motor axons fail to form the normal extent of axonal branches and dendrites leading to decreased motor function. SMA is caused by low levels of the survival motor neuron (SMN) protein. We show in motoneurons in vivo that SMN interacts with the RNA binding

  14. A Conjugated Aptamer-Gold Nanoparticle Fluorescent Probe for Highly Sensitive Detection of rHuEPO-α

    Directory of Open Access Journals (Sweden)

    Zhaoyang Zhang

    2011-11-01

    Full Text Available We present here a novel conjugated aptamer-gold nanoparticle (Apt-AuNPs fluorescent probe and its application for specific detection of recombinant human erythropoietin-α (rHuEPO-α. In this nanobiosensor, 12 nm AuNPs function as both a nano-scaffold and a nano-quencher (fluorescent energy acceptor, on the surface of which the complementary sequences are linked (as cODN-AuNPs and pre-hybridized with carboxymethylfluorescein (FAM-labeled anti-rHuEPO-α aptamers. Upon target protein binding, the aptamers can be released from the AuNP surface and the fluorescence signal is restored. Key variables such as the length of linker, the hybridization site and length have been designed and optimized. Full performance evaluation including sensitivity, linear range and interference substances are also described. This nanobiosensor provides a promising approach for a simple and direct quantification of rHuEPO-α concentrations as low as 0.92 nM within a few hours.

  15. Comment on "Tropospheric temperature response to stratospheric ozone recovery in the 21st century" by Hu et al. (2011

    Directory of Open Access Journals (Sweden)

    C. McLandress

    2012-03-01

    Full Text Available In a recent paper Hu et al. (2011 suggest that the recovery of stratospheric ozone during the first half of this century will significantly enhance free tropospheric and surface warming caused by the anthropogenic increase of greenhouse gases, with the effects being most pronounced in Northern Hemisphere middle and high latitudes. These surprising results are based on a multi-model analysis of CMIP3 model simulations with and without prescribed stratospheric ozone recovery. Hu et al. suggest that in order to properly quantify the tropospheric and surface temperature response to stratospheric ozone recovery, it is necessary to run coupled atmosphere-ocean climate models with stratospheric ozone chemistry. The results of such an experiment are presented here, using a state-of-the-art chemistry-climate model coupled to a three-dimensional ocean model. In contrast to Hu et al., we find a much smaller Northern Hemisphere tropospheric temperature response to ozone recovery, which is of opposite sign. We suggest that their result is an artifact of the incomplete removal of the large effect of greenhouse gas warming between the two different sets of models.

  16. HuR and GRSF1 modulate the nuclear export and mitochondrial localization of the lncRNA RMRP

    Science.gov (United States)

    Noh, Ji Heon; Kim, Kyoung Mi; Abdelmohsen, Kotb; Yoon, Je-Hyun; Panda, Amaresh C.; Munk, Rachel; Kim, Jiyoung; Curtis, Jessica; Moad, Christopher A.; Wohler, Christina M.; Indig, Fred E.; de Paula, Wilson; Dudekula, Dawood B.; De, Supriyo; Piao, Yulan; Yang, Xiaoling; Martindale, Jennifer L.; de Cabo, Rafael; Gorospe, Myriam

    2016-01-01

    Some mitochondrial long noncoding RNAs (lncRNAs) are encoded by nuclear DNA, but the mechanisms that mediate their transport to mitochondria are poorly characterized. Using affinity RNA pull-down followed by mass spectrometry analysis, we found two RNA-binding proteins (RBPs), HuR (human antigen R) and GRSF1 (G-rich RNA sequence-binding factor 1), that associated with the nuclear DNA-encoded lncRNA RMRP and mobilized it to mitochondria. In cultured human cells, HuR bound RMRP in the nucleus and mediated its CRM1 (chromosome region maintenance 1)-dependent export to the cytosol. After RMRP was imported into mitochondria, GRSF1 bound RMRP and increased its abundance in the matrix. Loss of GRSF1 lowered the mitochondrial levels of RMRP, in turn suppressing oxygen consumption rates and modestly reducing mitochondrial DNA replication priming. Our findings indicate that RBPs HuR and GRSF1 govern the cytoplasmic and mitochondrial localization of the lncRNA RMRP, which is encoded by nuclear DNA but has key functions in mitochondria. PMID:27198227

  17. Publicidad y consumo de alimentos en estudiantes de Huánuco (Perú

    Directory of Open Access Journals (Sweden)

    María Luisa Sevillano García

    2012-10-01

    Full Text Available Las importantes carencias nutritivas apreciadas en estudiantes del distrito de Huánuco (Perú, junto con la publicidad televisiva de productos de dudosa calidad nutricional observada, nos llevó a plantear y desarrollar una investigación con el objeto de analizar la relación entre ambos fenómenos titulada: Influencia de los anuncios televisivos en el consumo de alimentos publicitados durante el 2010, cuyo resumen se presenta en este artículo. En la investigación planteamos un estudio correlacional con una muestra de 120 escolares de diversas instituciones educativas, a quienes se aplicaron satisfactoriamente encuestas, entrevistas y guía de evaluación física; también se analizó la publicidad emitida por los canales de televisión sobre alimentos y su contenido nutricional. El análisis inferencial aplicado fue Ji cuadrado (?2. Con esta investigación se ha demostrado que el estado de salud de los escolares está afectado, siendo muy agudo respecto a la caries dental, problema que se atribuye al consumo de ciertos alimentos. Se constata que existe relación positiva, con alta significancia estadística, entre la adherencia a los anuncios televisivos y el consumo de alimentos publicitados de alto contenido en sodio, calcio, azúcar y de calorías por los escolares estudiados; así mismo, se prueba la interdependencia entre la exposición a los anuncios televisivos y el consumo de alimentos con productos de alto contenido en grasa que merecen ser vigilados y controlados por los responsables.

  18. ZASTOSOWANIE FUNKCJONAŁU HU-WASHIZU W PLASTYCZNEJ ANALIZIE MES PŁYT GRUBYCH

    Directory of Open Access Journals (Sweden)

    Jakub LEWANDOWSKI

    2016-07-01

    Full Text Available W pracy sformułowano oryginalny, autorski funkcjonał dla zagadnień teorii plastyczności. Podstawą był funkcjonał Hu-Washizu z teorii sprężystości. Przyrostowa postać funkcjonału pozwala w prosty sposób budować algorytmy MES. Zastosowanie funkcjonału przedstawiono na przykładzie płyty grubej. Zastosowano model warstwowy aby uwzględnić częściowe uplastycznienie przekroju płyty. Algorytm MES dla płyty grubej zbudowano w oparciu o trójkątny trzy węzłowy element skończony z liniowymi funkcjami kształtu dla wszystkich przemieszczeń uogólnionych. Naprężenia i odkształcenia w tego typu elemencie przyjmuje się jako stałe. Przedstawiony algorytm nie wymaga żadnych dodatkowych równań teorii plastyczności i jest równoważny stowarzyszonemu prawu płynięcia plastycznego. Algorytm prowadzi do nieliniowego, przyrostowego układu równań algebraicznych, który rozwiązuje się metodą Newtona. Kilka prostych przykładów pozytywnie weryfikuje przyjęte założenia i stosowane algorytmy.

  19. Effects of Bai-Hu decoction on fever induced by lipopolysaccharide

    Directory of Open Access Journals (Sweden)

    Li-Long Jia

    2013-03-01

    Full Text Available This study was designed to investigate the antifebrile effect and mechanisms of Bai-Hu decoction (BHD, a traditional Chinese medical (TCM prescription. The rabbits used in this study received an intravenous injection of lipopolysaccharide (LPS after being orally administered with BHD, ibuprofen, or saline, and their rectal temperatures were monitored by a copper–constantan thermocouple. Concentrations of interleukin-1 beta (IL-1β and tumor necrosis factor alpha (TNF-α in serum and hypothalamus were assayed using the commercially available rabbit IL-1β and TNF-α enzyme-linked immunosorbent assay kits following the manufacturer’s instructions. The BHD treatment group exhibited a significant fall in body temperature in both peaks compared with the LPS group (p<0.05. BHD reduced the concentrations of IL-1β and TNF-α in serum, and of TNF-α in hypothalamus to control the febrile responses at 1 hour. Besides the levels of IL-1β in hypothalamus and serum, the concentration of TNF-α in hypothalamus was decreased remarkably in the BHD group than in the LPS group at 3 hours. The main findings, the partial mechanisms of BHD in reducing biphasic fever elicited by LPS, were that treatments with the crude extract of BHD could remarkably reduce the increased concentrations of IL-1β and TNF-α, not only in serum but also in hypothalamus. The results indicated that BHD would be a valuable candidate for further investigation as a traditional antifebrile and anti-inflammatory natural drug.

  20. Critical experiments on low-enriched uranium oxide system with H/U=1.25

    International Nuclear Information System (INIS)

    Oh, I.; Rothe, R.E.; Tuck, G.

    1982-01-01

    Fifteen (15) critical experiments were performed on a horizontal split table machine using 4.48%-enriched sup(235)U uranium oxide(U 3 O 8 ). The oxide was compacted to a density of 4.68g/cm 3 and placed in 152 mm cubical aluminum cans. Water was added to achive an H/U of 1.25. Various arrays of oxide cans were distributed on each half of the split table, and the separation between halves reduced until criticality occurred. The critical table separation varied from 3.59 mm to 18.40 mm. Twelve (12) experiments required the addition of a high-enriched(-93 %sup(235)U) metal or solution driver to achieve criticality. These experiments were performed in a plastic, concrete, or thin steel reflector. Three additional experiments in the plastic reflector contained either 9.3-mm- or 24.3-mm-thick plastic moderator material between the oxide cans and did not require a driver to achieve criticality. Critical uranium driver masses ranged from 9.999 kg to 14.000 kg (solution driver), and from 25.378 kg to 29.278 kg (metal driver) for 5X5X5 arrays of uranium oxide cans. Always, one or four of these 125 cans had to be removed to make room for the drivers. Therefore, the uranium oxide masses used were 1823.8 kg and 1863.5 kg. For the moderated experiments, the uranium oxide mass ranged between 574.4 kg and 1210.0 kg. (Author)

  1. HuMiTar: A sequence-based method for prediction of human microRNA targets

    Directory of Open Access Journals (Sweden)

    Chen Ke

    2008-12-01

    Full Text Available Abstract Background MicroRNAs (miRs are small noncoding RNAs that bind to complementary/partially complementary sites in the 3' untranslated regions of target genes to regulate protein production of the target transcript and to induce mRNA degradation or mRNA cleavage. The ability to perform accurate, high-throughput identification of physiologically active miR targets would enable functional characterization of individual miRs. Current target prediction methods include traditional approaches that are based on specific base-pairing rules in the miR's seed region and implementation of cross-species conservation of the target site, and machine learning (ML methods that explore patterns that contrast true and false miR-mRNA duplexes. However, in the case of the traditional methods research shows that some seed region matches that are conserved are false positives and that some of the experimentally validated target sites are not conserved. Results We present HuMiTar, a computational method for identifying common targets of miRs, which is based on a scoring function that considers base-pairing for both seed and non-seed positions for human miR-mRNA duplexes. Our design shows that certain non-seed miR nucleotides, such as 14, 18, 13, 11, and 17, are characterized by a strong bias towards formation of Watson-Crick pairing. We contrasted HuMiTar with several representative competing methods on two sets of human miR targets and a set of ten glioblastoma oncogenes. Comparison with the two best performing traditional methods, PicTar and TargetScanS, and a representative ML method that considers the non-seed positions, NBmiRTar, shows that HuMiTar predictions include majority of the predictions of the other three methods. At the same time, the proposed method is also capable of finding more true positive targets as a trade-off for an increased number of predictions. Genome-wide predictions show that the proposed method is characterized by 1.99 signal

  2. DNA clasping by mycobacterial HU: the C-terminal region of HupB mediates increased specificity of DNA binding.

    Directory of Open Access Journals (Sweden)

    Sandeep Kumar

    Full Text Available BACKGROUND: HU a small, basic, histone like protein is a major component of the bacterial nucleoid. E. coli has two subunits of HU coded by hupA and hupB genes whereas Mycobacterium tuberculosis (Mtb has only one subunit of HU coded by ORF Rv2986c (hupB gene. One noticeable feature regarding Mtb HupB, based on sequence alignment of HU orthologs from different bacteria, was that HupB(Mtb bears at its C-terminal end, a highly basic extension and this prompted an examination of its role in Mtb HupB function. METHODOLOGY/PRINCIPAL FINDINGS: With this objective two clones of Mtb HupB were generated; one expressing full length HupB protein (HupB(Mtb and another which expresses only the N terminal region (first 95 amino acid of hupB (HupB(MtbN. Gel retardation assays revealed that HupB(MtbN is almost like E. coli HU (heat stable nucleoid protein in terms of its DNA binding, with a binding constant (K(d for linear dsDNA greater than 1000 nM, a value comparable to that obtained for the HUalphaalpha and HUalphabeta forms. However CTR (C-terminal Region of HupB(Mtb imparts greater specificity in DNA binding. HupB(Mtb protein binds more strongly to supercoiled plasmid DNA than to linear DNA, also this binding is very stable as it provides DNase I protection even up to 5 minutes. Similar results were obtained when the abilities of both proteins to mediate protection against DNA strand cleavage by hydroxyl radicals generated by the Fenton's reaction, were compared. It was also observed that both the proteins have DNA binding preference for A:T rich DNA which may occur at the regulatory regions of ORFs and the oriC region of Mtb. CONCLUSIONS/SIGNIFICANCE: These data thus point that HupB(Mtb may participate in chromosome organization in-vivo, it may also play a passive, possibly an architectural role.

  3. miR-29b, miR-205 and miR-221 enhance chemosensitivity to gemcitabine in HuH28 human cholangiocarcinoma cells.

    Directory of Open Access Journals (Sweden)

    Kinya Okamoto

    Full Text Available BACKGROUND AND AIMS: Cholangiocarcinoma (CCA is highly resistant to chemotherapy, including gemcitabine (Gem treatment. MicroRNAs (miRNAs are endogenous, non-coding, short RNAs that can regulate multiple genes expression. Some miRNAs play important roles in the chemosensitivity of tumors. Here, we examined the relationship between miRNA expression and the sensitivity of CCA cells to Gem. METHODS: Microarray analysis was used to determine the miRNA expression profiles of two CCA cell lines, HuH28 and HuCCT1. To determine the effect of candidate miRNAs on Gem sensitivity, expression of each candidate miRNA was modified via either transfection of a miRNA mimic or transfection of an anti-oligonucleotide. Ontology-based programs were used to identify potential target genes of candidate miRNAs that were confirmed to affect the Gem sensitivity of CCA cells. RESULTS: HuCCT1 cells were more sensitive to Gem than were HuH28 cells, and 18 miRNAs were differentially expressed whose ratios over ± 2log2 between HuH28 and HuCCT1. Among these 18 miRNAs, ectopic overexpression of each of three downregulated miRNAs in HuH28 (miR-29b, miR-205, miR-221 restored Gem sensitivity to HuH28. Suppression of one upregulated miRNA in HuH28, miR-125a-5p, inhibited HuH28 cell proliferation independently to Gem treatment. Selective siRNA-mediated downregulation of either of two software-predicted targets, PIK3R1 (target of miR-29b and miR-221 or MMP-2 (target of miR-29b, also conferred Gem sensitivity to HuH28. CONCLUSIONS: miRNA expression profiling was used to identify key miRNAs that regulate Gem sensitivity in CCA cells, and software that predicts miRNA targets was used to identify promising target genes for anti-tumor therapies.

  4. Effect of the synthetic cannabinoid HU-210 on quorum sensing and on the production of quorum sensing-mediated virulence factors by Vibrio harveyi

    OpenAIRE

    Soni, Divya; Smoum, Reem; Breuer, Aviva; Mechoulam, Raphael; Steinberg, Doron

    2015-01-01

    Background Bacterial populations communicate through the cell density-dependent mechanism of quorum sensing (QS). Vibrio harveyi, one of the best studied model organisms for QS, was used to explore effects of the synthetic cannabinoid HU-210 on QS and different QS-regulated physiological processes in bacteria. Results Analysis of QS-regulated bioluminescence in wild-type and mutant strains of V. harveyi revealed that HU-210 affects the autoinducer-2 (AI-2) pathway, one of three known QS casca...

  5. Comment on "Electron impact excitation of N-like ions from the ICFT R-matrix calculation" by HB Wang, G Jiang, XF Li, and ZC He in At. Data Nucl. Data Tables 120 (2018) 373-429

    Science.gov (United States)

    Aggarwal, Kanti M.

    2018-03-01

    The paper "Electron impact excitation of N-like ions from the ICFT R-matrix calculation" by Wang et al. [1] lacks details of calculations, presents only limited data, and has a few anomalies, as listed below.

  6. Changes in Cellular mRNA Stability, Splicing, and Polyadenylation through HuR Protein Sequestration by a Cytoplasmic RNA Virus

    Directory of Open Access Journals (Sweden)

    Michael D. Barnhart

    2013-11-01

    Full Text Available The impact of RNA viruses on the posttranscriptional regulation of cellular gene expression is unclear. Sindbis virus causes a dramatic relocalization of the cellular HuR protein from the nucleus to the cytoplasm in infected cells. This is to the result of the expression of large amounts of viral RNAs that contain high-affinity HuR binding sites in their 3′ UTRs effectively serving as a sponge for the HuR protein. Sequestration of HuR by Sindbis virus is associated with destabilization of cellular mRNAs that normally bind HuR and rely on it to regulate their expression. Furthermore, significant changes can be observed in nuclear alternative polyadenylation and splicing events on cellular pre-mRNAs as a result of sequestration of HuR protein by the 3′ UTR of transcripts of this cytoplasmic RNA virus. These studies suggest a molecular mechanism of virus-host interaction that probably has a significant impact on virus replication, cytopathology, and pathogenesis.

  7. Reply to Comment on ``Effects of fast and slow solar wind on the correlations between interplanetary medium and geomagnetic activity'' by C. B. Wang and J. K. Chao

    Science.gov (United States)

    Ballatore, Paola

    2003-10-01

    The paper [2002] (the paper commented) shows that the statistical significance of the correlations between the interplanetary parameters and the geomagnetic indices (Kp or Dst) is generally less significant during the fastest solar wind. On the other hand, at these fast solar wind periods, the significance of the Kp versus Dst correlation is equal to or higher than during slower solar wind. These results, together with further observations related to substorm periods and with previously published findings, are interpreted in terms of a difference in the interplanetary-magnetospheric coupling for solar wind faster or slower than a certain threshold (identified between about 500 and 600 km/s). Specifically, it is suggested that a possible linear approximation of the geomagnetic-interplanetary coupling is more appropriate during solar wind speed (Vsw) slower than this threshold, being nonlinear processes more dominant during the fastest speeds. This reply highlights that the correlation coefficients shown by [2003] are in agreement with these findings. In addition, Wang and Chao show that the statistical significance of the difference between the correlation coefficients for Vsw ≥ 550 km/s and those for Vsw Wang and Chao is wrong. Moreover, Wang and Chao recalculate the correlations between the interplanetary parameters and the ΔDst instead of Dst; in fact they note that the time derivative of this index (not the index itself) is driven by the interplanetary medium. Here we note that on the contrary, they show that the correlation coefficients between interplanetary parameters and Dst are larger than those obtained using ΔDst and we suggest a possible interpretation in terms of nonlinearity.

  8. Epigenetic battle of the sexes. Comment on: ;Epigenetic game theory: How to compute the epigenetic control of maternal-to-zygotic transition; by Qian Wang et al.

    Science.gov (United States)

    Wu, Song

    2017-03-01

    Qian Wang et al. present an interesting framework, named epigenetic game theory, for modeling sex-based epigenetic dynamics during embryogenesis from a new viewpoint of evolutionary game theory [1]. That is, epigenomes of sperms and oocytes may coordinate through either cooperation or competition, or both, to affect the fitness of embryos. The work uses a set of ordinary differential equations (ODEs) to describe longitudinal trajectories of DNA methylation levels in both parental and maternal gametes and their dependence on each other. The insights gained from this review, i.e. dynamic methylation profiles and their interaction are potentially important to many fields, such as biomedicine and agriculture.

  9. Innate Immune Activation Can Trigger Experimental Spondyloarthritis in HLA-B27/Huβ2m Transgenic Rats

    Directory of Open Access Journals (Sweden)

    Melissa N. van Tok

    2017-08-01

    Full Text Available Spondyloarthritis (SpA does not display the typical features of auto-immune disease. Despite the strong association with MHC class I, CD8+ T cells are not required for disease induction in the HLA-B27/Huβ2m transgenic rats. We used Lewis HLA-B27/Huβ2m transgenic rats [21-3 × 283-2]F1, HLA-B7/Huβ2m transgenic rats [120-4 × 283-2]F1, and wild-type rats to test our hypothesis that SpA may be primarily driven by the innate immune response. In vitro, splenocytes were stimulated with heat-inactivated Mycobacterium tuberculosis and cytokine expression and production was measured. In vivo, male and female rats were immunized with 30, 60, or 90 µg of heat-inactivated M. tuberculosis and clinically monitored for spondylitis and arthritis development. After validation of the model, we tested whether prophylactic and therapeutic TNF targeting affected spondylitis and arthritis. In vitro stimulation with heat-inactivated M. tuberculosis strongly induced gene expression of pro-inflammatory cytokines such as TNF, IL-6, IL-1α, and IL-1β, in the HLA-B27 transgenic rats compared with controls. In vivo immunization induced an increased spondylitis and arthritis incidence and an accelerated and synchronized onset of spondylitis and arthritis in HLA-B27 transgenic males and females. Moreover, immunization overcame the protective effect of orchiectomy. Prophylactic TNF targeting resulted in delayed spondylitis and arthritis development and reduced arthritis severity, whereas therapeutic TNF blockade did not affect spondylitis and arthritis severity. Collectively, these data indicate that innate immune activation plays a role in the initiation of HLA-B27-associated disease and allowed to establish a useful in vivo model to study the cellular and molecular mechanisms of disease initiation and progression.

  10. HuR and podoplanin expression is associated with a high risk of malignant transformation in patients with oral preneoplastic lesions.

    Science.gov (United States)

    Habiba, Umma; Kitamura, Tetsuya; Yanagawa-Matsuda, Aya; Higashino, Fumihiro; Hida, Kyoko; Totsuka, Yasunori; Shindoh, Masanobu

    2016-11-01

    The risk of malignant transformation in oral preneoplastic lesions (OPLs) is challenging to assess. The objective of the present study was to determine the expression of ELAV like RNA binding protein 1 (HuR) and podoplanin in OPLs, and to evaluate the use of each protein as biomarkers for the risk assessment of malignant transformations. Immunohistochemistry for HuR and podoplanin was performed on the tissues of 51 patients with OPL, including cases of low grade dysplasia (LGD) and high grade dysplasia (HGD). The association between the protein expression patterns and clinicopathological parameters, including oral cancer free survival (OCFS) time, was analyzed during the follow-up period. HuR and podoplanin expression was observed in 28 (55%) and 36 (71%) of 51 patients, respectively. Kaplan-Meier analysis showed that the expression of HuR and podoplanin was associated with the risk of progression to oral cancer (P<0.05). Multivariate analysis revealed that HuR and podoplanin expression was associated with a 2.93-fold (95% confidence interval (CI), 0.98-10.34; P=0.055) and 2.06-fold (95% CI, 0.55-8.01; P=0.283) increase in risk of malignant transformation, respectively. The risk of OPL malignant transformation was considerably increased with the coexpression of HuR and podoplanin compared with the histological grading (95% CI, 1.64-23.59; P=0.005). The results of the present study demonstrated that the expression of HuR and podoplanin associates with malignant transformation and suggests that the proteins may be used as biomarkers to identify OPL patients with an increased risk of cancer development.

  11. HuB (elavl2 mRNA is restricted to the germ cells by post-transcriptional mechanisms including stabilisation of the message by DAZL.

    Directory of Open Access Journals (Sweden)

    Sophie E Wiszniak

    Full Text Available The ability of germ cells to carry out a gene regulatory program distinct from the surrounding somatic tissue, and their capacity to specify an entire new organism has made them a focus of many studies that seek to understand how specific regulatory mechanisms, particularly post-transcriptional mechanisms, contribute to cell fate. In zebrafish, germ cells are specified through the inheritance of cytoplasmic determinants, termed the germ plasm, which contains a number of maternal mRNAs and proteins. Investigation of several of these messages has revealed that the restricted localisation of these mRNAs to the germ plasm and subsequent germ cells is due to cis-acting sequence elements present in their 3'UTRs. Here we show that a member of the Hu family of RNA-binding proteins, HuB, is maternally provided in the zebrafish embryo and exhibits germ cell specific expression during embryogenesis. Restriction of HuB mRNA to the germ cells is dependent on a number of sequence elements in its 3'UTR, which act to degrade the mRNA in the soma and stabilise it in the germ cells. In addition, we show that the germ cell specific RNA-binding protein DAZL is able to promote HuB mRNA stability and translation in germ cells, and further demonstrate that these activities require a 30 nucleotide element in the 3'UTR. Our study suggests that DAZL specifically binds the HuB 3'UTR and protects the message from degradation and/or enhances HuB translation, leading to the germ cell specific expression of HuB protein.

  12. Treatment of depression with Chai Hu Shu Gan San: a systematic review and meta-analysis of 42 randomized controlled trials.

    Science.gov (United States)

    Sun, Yan; Xu, Xia; Zhang, Jinping; Chen, Yuanyuan

    2018-02-17

    Depression is a common mental disorder. Chai Hu Shu Gan San, a traditional Chinese medicine, is used to treat depression empirically. We present a systematic review and meta-analysis of the therapeutic efficacy and safety of Chai Hu Shu Gan San in treating depression. Several databases, including PubMed, China National Knowledge Internet, Wanfang, Chongqing VIP, and the Cochrane library, were systematically searched from their date of foundation to January 1, 2017. In this review, wehave included randomized control trials that compared Chai Hu Shu Gan San (or its combination with a regular Western medicine) with a regular Western medicine alone for the treatment of depression. Two investigators independently extracted and analyzed the data using RevMan 5.2.0 software. Mean difference (with a 95% confidence interval) was used as efficacy indices for outcomes. We included 42 studies involving 3234 patients with depression in 15 different types of diseases. Meta analyses showed better effect of Chai Hu Shu Gan San than fluoxetine for pure depression (MD = - 1.59, from - 2.82 to - 0.37, 4 trials, I 2  = 26%), for post-stroke depression (MD = - 4.20, from - 6.20 to - 2.19, 7 trials, I 2  = 96%), and for postpartum depression (MD = - 4.10, from - 7.48 to - 0.72 7 trials, I 2  = 86%). None of the articles reported severe adverse events of oral administration of Chai Hu Shu Gan San. Furthermore, any adverse effects of using Chai Hu Shu Gan San alone were fewer than those of regular Western medicines. This review found that Chai Hu Shu Gan San has some advantages in treating depression, especially post-stroke depression and post-partum depression. A meticulously designed and conducted randomized control trial is needed for further evaluation.

  13. One of the Two Genes Encoding Nucleoid-Associated HU Proteins in Streptomyces coelicolor Is Developmentally Regulated and Specifically Involved in Spore Maturation▿ †

    Science.gov (United States)

    Salerno, Paola; Larsson, Jessica; Bucca, Giselda; Laing, Emma; Smith, Colin P.; Flärdh, Klas

    2009-01-01

    Streptomyces genomes encode two homologs of the nucleoid-associated HU proteins. One of them, here designated HupA, is of a conventional type similar to E. coli HUα and HUβ, while the other, HupS, is a two-domain protein. In addition to the N-terminal part that is similar to that of HU proteins, it has a C-terminal domain that is similar to the alanine- and lysine-rich C termini of eukaryotic linker histones. Such two-domain HU proteins are found only among Actinobacteria. In this phylum some organisms have only a single HU protein of the type with a C-terminal histone H1-like domain (e.g., Hlp in Mycobacterium smegmatis), while others have only a single conventional HU. Yet others, including the streptomycetes, produce both types of HU proteins. We show here that the two HU genes in Streptomyces coelicolor are differentially regulated and that hupS is specifically expressed during sporulation, while hupA is expressed in vegetative hyphae. The developmental upregulation of hupS occurred in sporogenic aerial hyphal compartments and was dependent on the developmental regulators whiA, whiG, and whiI. HupS was found to be nucleoid associated in spores, and a hupS deletion mutant had an average nucleoid size in spores larger than that in the parent strain. The mutant spores were also defective in heat resistance and spore pigmentation, although they possessed apparently normal spore walls and displayed no increased sensitivity to detergents. Overall, the results show that HupS is specifically involved in sporulation and may affect nucleoid architecture and protection in spores of S. coelicolor. PMID:19717607

  14. pp32 (ANP32A expression inhibits pancreatic cancer cell growth and induces gemcitabine resistance by disrupting HuR binding to mRNAs.

    Directory of Open Access Journals (Sweden)

    Timothy K Williams

    Full Text Available The expression of protein phosphatase 32 (PP32, ANP32A is low in poorly differentiated pancreatic cancers and is linked to the levels of HuR (ELAV1, a predictive marker for gemcitabine response. In pancreatic cancer cells, exogenous overexpression of pp32 inhibited cell growth, supporting its long-recognized role as a tumor suppressor in pancreatic cancer. In chemotherapeutic sensitivity screening assays, cells overexpressing pp32 were selectively resistant to the nucleoside analogs gemcitabine and cytarabine (ARA-C, but were sensitized to 5-fluorouracil; conversely, silencing pp32 in pancreatic cancer cells enhanced gemcitabine sensitivity. The cytoplasmic levels of pp32 increased after cancer cells are treated with certain stressors, including gemcitabine. pp32 overexpression reduced the association of HuR with the mRNA encoding the gemcitabine-metabolizing enzyme deoxycytidine kinase (dCK, causing a significant reduction in dCK protein levels. Similarly, ectopic pp32 expression caused a reduction in HuR binding of mRNAs encoding tumor-promoting proteins (e.g., VEGF and HuR, while silencing pp32 dramatically enhanced the binding of these mRNA targets. Low pp32 nuclear expression correlated with high-grade tumors and the presence of lymph node metastasis, as compared to patients' tumors with high nuclear pp32 expression. Although pp32 expression levels did not enhance the predictive power of cytoplasmic HuR status, nuclear pp32 levels and cytoplasmic HuR levels associated significantly in patient samples. Thus, we provide novel evidence that the tumor suppressor function of pp32 can be attributed to its ability to disrupt HuR binding to target mRNAs encoding key proteins for cancer cell survival and drug efficacy.

  15. Grateloupia tenuis Wang et Luan sp. nov. (Halymeniaceae, Rhodophyta: A New Species from South China Sea Based on Morphological Observation and rbcL Gene Sequences Analysis

    Directory of Open Access Journals (Sweden)

    Ling Yu

    2013-01-01

    Full Text Available Grateloupia tenuis Wang et Luan sp. nov. is a new species described from Lingshui, Hainan Province, South China Sea. Based on the external form and internal structure, combined with rbcL gene sequence analysis, Grateloupia tenuis is distinct from other Grateloupia species as follows: (1 thalli is slippery and cartilaginous in texture; possess fewer branches, relatively slight main axes, and two or three dichotomous branches; (2 cortex is 5-6 layers; medulla is solid when young, but hollow in old branches; reproductive structures are dispersed in main axes of thalli and lower portions of branchlets; exhibits Grateloupia-type auxiliary cell ampullae; (3 the four studied G. tenuis sequences were positioned in a large Grateloupia clade of Halymeniaceae, which included sister group generitype G. filicina with 68 bp differences; G. tenuis was determined to be a sister taxon to the G. catenata, G. ramosissima, G. orientalis, and G. filiformis subclade. The pairwise distances between G. tenuis and these species were 39 to 50 bp. The sequences of G. tenuis differed by 81–108 bp from the sequences of other samples in Grateloupia; there are 114–133 bp changes between G. tenuis and other genera of Halymeniaceae. In final analysis, we considered Grateloupia tenuis Wang et Luan sp. nov. to be a new species of genus Grateloupia.

  16. Grateloupia tenuis Wang et Luan sp. nov. (Halymeniaceae, Rhodophyta): a new species from South China Sea based on morphological observation and rbcL gene sequences analysis.

    Science.gov (United States)

    Yu, Ling; Wang, Hongwei; Luan, Rixiao

    2013-01-01

    Grateloupia tenuis Wang et Luan sp. nov. is a new species described from Lingshui, Hainan Province, South China Sea. Based on the external form and internal structure, combined with rbcL gene sequence analysis, Grateloupia tenuis is distinct from other Grateloupia species as follows: (1) thalli is slippery and cartilaginous in texture; possess fewer branches, relatively slight main axes, and two or three dichotomous branches; (2) cortex is 5-6 layers; medulla is solid when young, but hollow in old branches; reproductive structures are dispersed in main axes of thalli and lower portions of branchlets; exhibits Grateloupia-type auxiliary cell ampullae; (3) the four studied G. tenuis sequences were positioned in a large Grateloupia clade of Halymeniaceae, which included sister group generitype G. filicina with 68 bp differences; G. tenuis was determined to be a sister taxon to the G. catenata, G. ramosissima, G. orientalis, and G. filiformis subclade. The pairwise distances between G. tenuis and these species were 39 to 50 bp. The sequences of G. tenuis differed by 81-108 bp from the sequences of other samples in Grateloupia; there are 114-133 bp changes between G. tenuis and other genera of Halymeniaceae. In final analysis, we considered Grateloupia tenuis Wang et Luan sp. nov. to be a new species of genus Grateloupia.

  17. Grateloupia ramosa Wang & Luan sp. nov. (Halymeniaceae, Rhodophyta), a new species from China based on morphological evidence and comparative rbcL sequences

    Science.gov (United States)

    Cao, Cuicui; Liu, Miao; Guo, Shaoru; Zhao, Dan; Luan, Rixiao; Wang, Hongwei

    2016-03-01

    Grateloupia ramosa Wang & Luan sp. nov. (Halymeniaceae, Rhodophyta) is newly described from Hainan Province, southern China. The organism has the following morphological features: (1) purplish red, cartilaginous and lubricous thalli 5-10 cm in height; (2) compressed percurrent axes bearing abundant branches with opposite arrangement; (3) claw-like apices on top, constricted to 2-4 cm at the base; (4) cortex consisting of 3-6 layers of elliptical or anomalous cells and a medulla covered by compact medullary filaments; (5) reproductive structures distributed throughout the thallus, especially centralized at the bottom of the end portion of the branches; and (6) 4-celled Carpogonial branches and 3-celled auxiliary-cell branches, both of the Grateloupia-type. The morphological diff erences were supported by molecular phylogenetics based on ribulose-1, 5-bisphosphate carboxylase/oxygenase ( rbcL) gene sequence analysis. There was only a 1 bp divergence between specimens collected from Wenchang and Lingshui of Hainan province. The new species was embedded in the large Grateloupia clade of the Halymeniaceae. The pairwise distances between G. ramosa and other species within Grateloupia ranged from 26 to 105 bp, within pairwise distances of 13-111 bp between species of the large genus Grateloupia in Halymeniaceae. Thus, we propose this new species as G. ramosa Wang & Luan sp. nov.

  18. Grateloupia tenuis Wang et Luan sp. nov. (Halymeniaceae, Rhodophyta): A New Species from South China Sea Based on Morphological Observation and rbcL Gene Sequences Analysis

    Science.gov (United States)

    Wang, Hongwei; Luan, Rixiao

    2013-01-01

    Grateloupia tenuis Wang et Luan sp. nov. is a new species described from Lingshui, Hainan Province, South China Sea. Based on the external form and internal structure, combined with rbcL gene sequence analysis, Grateloupia tenuis is distinct from other Grateloupia species as follows: (1) thalli is slippery and cartilaginous in texture; possess fewer branches, relatively slight main axes, and two or three dichotomous branches; (2) cortex is 5-6 layers; medulla is solid when young, but hollow in old branches; reproductive structures are dispersed in main axes of thalli and lower portions of branchlets; exhibits Grateloupia-type auxiliary cell ampullae; (3) the four studied G. tenuis sequences were positioned in a large Grateloupia clade of Halymeniaceae, which included sister group generitype G. filicina with 68 bp differences; G. tenuis was determined to be a sister taxon to the G. catenata, G. ramosissima, G. orientalis, and G. filiformis subclade. The pairwise distances between G. tenuis and these species were 39 to 50 bp. The sequences of G. tenuis differed by 81–108 bp from the sequences of other samples in Grateloupia; there are 114–133 bp changes between G. tenuis and other genera of Halymeniaceae. In final analysis, we considered Grateloupia tenuis Wang et Luan sp. nov. to be a new species of genus Grateloupia. PMID:24455703

  19. Zhuyi: From Absence to Bustle? Some Comments on Wang Jianjiang’s Article “The Bustle and the Absence of Zhuyi”

    Directory of Open Access Journals (Sweden)

    Aleš Erjavec

    2017-09-01

    Full Text Available The article is a response to the article published in Filozofski vestnik in 2016 and written by Prof. Wanf Jianjiang who in recent years devoted much of his efforts to the influence of of Western aesthetics and philosophy on Chinese humanities. Thus a notion introduced by Prof. Wang Jianjiang – Zhuyi – became the center of discussion in the papers that are to be found in this volume of AM Journal. Prof. Jianjiang claims that Zhuyi has a similar meaning as Western -ism and argues that Chinese aestheticians and intellectuals in general must develop their own theories (-isms if they want to gain speech and not remain stuck with voice (cf. Jacques Rancière.   Article received: May 3, 2017; Article accepted: May 8, 2017; Published online: September 15, 2017 Original scholarly paper How to cite this article: Erjavec, Aleš. "Zhuyi: From Absence to Bustle? Some Comments on Wang Jianjiang’s Article 'The Bustle and the Absence of Zhuyi'." AM Journal of Art and Media Studies 13 (2017: 111-121. doi: 10.25038/am.v0i13.189

  20. Efficacy of the Frame and Hu mathematical model for the quantitative analysis of agents influencing growth of chick embryo fibroblasts

    International Nuclear Information System (INIS)

    Korohoda, K.; Czyz, J.

    1994-01-01

    The experiments on the effect of various sera and substratum surface area upon growth of chick embryo fibroblasts-like in secondary cultures are described and discussed on the grounds of a mathematical model for growth of anchorage-dependent cells proposed by Frame and Hu. The model and presented results demonstrate the mutual independence of the effects of agent influencing of rate of cell proliferation (i.e. accelerating or retarding growth) and the agents that modify the limitation of cell proliferation (i.e. maximum cell density at confluence). The model proposed by Frame and Hu due to its relative simplicity offers and easy mode of description and quantitative evaluation of experiments concerning cell growth regulation. It is shown that various sera added at constant concentration significantly modify the rate of cell proliferation with little effect upon the maximum cell density attainable. The cells grew much more slowly in the presence of calf serum than in the presence of chick serum and the addition of iron and zinc complexes to calf serum significantly accelerated cell growth. An increase in the substratum surface area by the addition of glass wool to culture vessels significantly increased cell density per constant volume of medium even when retardation of growth was observed. The results presented point to the need of direct cell counting for estimation of cell growth curves and discussion of effects of agents influencing parameters characterizing cell proliferation. (author). 34 refs, 5 figs, 2 tabs

  1. HuR cytoplasmic expression is associated with increased cyclin A expression and poor outcome with upper urinary tract urothelial carcinoma

    International Nuclear Information System (INIS)

    Liang, Peir-In; Shiue, Yow-Ling; Huang, Hsuan-Ying; Hsu, Han-Ping; Chen, Li-Tzon; Lin, Ching-Yih; Tai, Chein; Lin, Chun-Mao; Li, Chien-Feng; Li, Wei-Ming; Wang, Yu-Hui; Wu, Ting-Feng; Wu, Wen-Ren; Liao, Alex C; Shen, Kun-Hung; Wei, Yu-Ching; Hsing, Chung-Hsi

    2012-01-01

    HuR is an RNA-binding protein that post-transcriptionally modulates the expressions of various target genes implicated in carcinogenesis, such as CCNA2 encoding cyclin A. No prior study attempted to evaluate the significance of HuR expression in a large cohort with upper urinary tract urothelial carcinomas (UTUCs). In total, 340 cases of primary localized UTUC without previous or concordant bladder carcinoma were selected. All of these patients received ureterectomy or radical nephroureterectomy with curative intents. Pathological slides were reviewed, and clinical findings were collected. Immunostaining for HuR and cyclin A was performed and evaluated by using H-score. The results of cytoplasmic HuR and nuclear cyclin A expressions were correlated with disease-specific survival (DSS), metastasis-free survival (MeFS), urinary bladder recurrence-free survival (UBRFS), and various clinicopathological factors. HuR cytoplasmic expression was significantly related to the pT status, lymph node metastasis, a higher histological grade, the pattern of invasion, vascular and perineurial invasion, and cyclin A expression (p = 0.005). Importantly, HuR cytoplasmic expression was strongly associated with a worse DSS (p < 0.0001), MeFS (p < 0.0001), and UBRFS (p = 0.0370) in the univariate analysis, and the first two results remained independently predictive of adverse outcomes (p = 0.038, relative risk [RR] = 1.996 for DSS; p = 0.027, RR = 1.880 for MeFS). Cyclin A nuclear expression was associated with a poor DSS (p = 0.0035) and MeFS (p = 0.0015) in the univariate analysis but was not prognosticatory in the multivariate analyses. High-risk patients (pT3 or pT4 with/without nodal metastasis) with high HuR cytoplasmic expression had better DSS if adjuvant chemotherapy was performed (p = 0.015). HuR cytoplasmic expression was correlated with adverse phenotypes and cyclin A overexpression and also independently predictive of worse DSS and MeFS, suggesting its roles in

  2. The RNA binding protein HuR differentially regulates unique subsets of mRNAs in estrogen receptor negative and estrogen receptor positive breast cancer

    Directory of Open Access Journals (Sweden)

    Chen Jing

    2010-04-01

    Full Text Available Abstract Background The discordance between steady-state levels of mRNAs and protein has been attributed to posttranscriptional control mechanisms affecting mRNA stability and translation. Traditional methods of genome wide microarray analysis, profiling steady-state levels of mRNA, may miss important mRNA targets owing to significant posttranscriptional gene regulation by RNA binding proteins (RBPs. Methods The ribonomic approach, utilizing RNA immunoprecipitation hybridized to microarray (RIP-Chip, provides global identification of putative endogenous mRNA targets of different RBPs. HuR is an RBP that binds to the AU-rich elements (ARE of labile mRNAs, such as proto-oncogenes, facilitating their translation into protein. HuR has been shown to play a role in cancer progression and elevated levels of cytoplasmic HuR directly correlate with increased invasiveness and poor prognosis for many cancers, including those of the breast. HuR has been described to control genes in several of the acquired capabilities of cancer and has been hypothesized to be a tumor-maintenance gene, allowing for cancers to proliferate once they are established. Results We used HuR RIP-Chip as a comprehensive and systematic method to survey breast cancer target genes in both MCF-7 (estrogen receptor positive, ER+ and MDA-MB-231 (estrogen receptor negative, ER- breast cancer cell lines. We identified unique subsets of HuR-associated mRNAs found individually or in both cell types. Two novel HuR targets, CD9 and CALM2 mRNAs, were identified and validated by quantitative RT-PCR and biotin pull-down analysis. Conclusion This is the first report of a side-by-side genome-wide comparison of HuR-associated targets in wild type ER+ and ER- breast cancer. We found distinct, differentially expressed subsets of cancer related genes in ER+ and ER- breast cancer cell lines, and noted that the differential regulation of two cancer-related genes by HuR was contingent upon the cellular

  3. MSA Mimic? Rare Occurrence of Anti-Hu Autonomic Failure and Thymoma in a Patient with Parkinsonism: Case Report and Literature Review

    Directory of Open Access Journals (Sweden)

    Vito A. G. Ricigliano

    2018-01-01

    Full Text Available Thymoma is a tumor originating from thymic gland, frequently manifesting with paraneoplastic neurological disorders. Its association with paraneoplastic dysautonomia is relatively uncommon. Here, we describe the challenging case of a 71 year-old female who developed subacute autonomic failure with digestive pseudo-obstruction, dysphagia, urinary tract dysfunction and orthostatic hypotension complicating an underlying extrapyramidal syndrome that had started 3 months before hospital admission. Autonomic symptoms had 2-month course and acutely worsened just before and during hospitalization. Combination of severe dysautonomia and parkinsonism mimicked rapidly progressing multiple system atrophy. However, diagnostic exams showed thymic tumor with positive anti-Hu antibodies on both serum and cerebrospinal fluid. Complete response of dysautonomia to immunoglobulins followed by thymectomy confirmed the diagnosis of anti-Hu-related paraneoplastic neurological syndrome. With regards to extrapyramidal symptoms, despite previous descriptions of paraneoplastic parkinsonism caused by other antineuronal antibodies, in our case no relation between anti-Hu and parkinsonism could be identified. A literature review of published reports describing anti-Hu positivity in thymic neoplasms highlighted that a definite autonomic disease due to anti-Hu antibodies is extremely rare in patients with thymoma but without myasthenia gravis, with only one case published so far.

  4. Comparison between two treatment protocols with recombinant Human Erythropoietin (rHuEpo in the treatment of late anemia in neonates with Rh-Isoimmunization

    Directory of Open Access Journals (Sweden)

    A.A. Zuppa

    2012-08-01

    Full Text Available Objectve. The Rh-hemolytic disease can lead to a late anemia by hemolytic and hyporigenerative mechanism. We compared the effectiveness of rHuEPO in two care protocols that differ for doses of rHuEPO administrated and for timing of administration. Methods. A cohort of 14 neonates was investigated. The neonates were treated with two different protocols. Protocol A: a dose of 200 U/kg/day of rHuEpo administered subcutaneously starting from the end of the second week of life; Protocol B: a dose of 400 U/kg/day of rHuEpo administered subcutaneously starting from the end of the first week of life. Results. The hematocrit values in the protocol A group decreased during treatment (32,5% vs 25,2%, whereas the hematocrit value in protocol B group remained almost stable (38,7% vs 42,8%. The mean numbers of platelets remained stable in both groups while neutrophils increased in protocol A group and decreased in protocol B (p<0,05. Reticulocyte count increased during treatment in both groups, although only in protocol B group it was statistically significative (p<0,05. Conclusions. Our results suggest a similar efficacy between the two treatment protocols. Increasing doses of rHuEPO do not seem enhancing their effectiveness and the incidence of side effects.

  5. Effect of the synthetic cannabinoid HU-210 on quorum sensing and on the production of quorum sensing-mediated virulence factors by Vibrio harveyi.

    Science.gov (United States)

    Soni, Divya; Smoum, Reem; Breuer, Aviva; Mechoulam, Raphael; Steinberg, Doron

    2015-08-12

    Bacterial populations communicate through the cell density-dependent mechanism of quorum sensing (QS). Vibrio harveyi, one of the best studied model organisms for QS, was used to explore effects of the synthetic cannabinoid HU-210 on QS and different QS-regulated physiological processes in bacteria. Analysis of QS-regulated bioluminescence in wild-type and mutant strains of V. harveyi revealed that HU-210 affects the autoinducer-2 (AI-2) pathway, one of three known QS cascades of V. harveyi. Furthermore, QS-mediated biofilm formation and swimming motility in the mutant strain BB152 (AI-1(-), AI-2(+)) were significantly reduced in the presence of HU-210. HU-210 inhibited QS-mediated virulence factor production without any inhibitory effect on bacterial growth. It also alters the expression of several genes, which are regulated by QS, specifically downregulating the genes of the AI-2 QS cascade. First evidence is being provided for interference of bacterial signal-transduction systems by a synthetic cannabinoid. The effect of HU-210 was specific to the AI-2 cascade in V. harveyi. AI-2 is known as a "universal autoinducer" and interference with its activity opens a broad spectrum of applications for synthetic cannabinoids in future research as a potential anti-QS agent.

  6. Development and Characterization of a Humanized Anti-HER2 Antibody HuA21 with Potent Anti-Tumor Properties in Breast Cancer Cells

    Directory of Open Access Journals (Sweden)

    Ruilin Li

    2016-04-01

    Full Text Available Human epidermal growth factor receptor 2 (HER2 is one of the most studied tumor-associated antigens for cancer immunotherapy. An engineered anti-HER-2 chimeric A21 antibody (chA21 is a chimeric antibody targeted to subdomain I of the HER2 extracellular domain. Here, we report the anti-tumor activity of the novel engineered monoclonal antibody humanized chA21 (HuA21 that targets HER2 on the basis of chA21, and we describe the underlying mechanisms. Our results reveal that HuA21 markedly inhibits the proliferation and migration of HER2-overexpressing breast cancer cells and causes enhanced antibody-dependent cell-mediated cytotoxicity potency against HER2-overexpressing tumor cells. In particular, HuA21, but not trastuzumab (Tra, markedly suppresses growth and enhances the internalization of the antibody in Tra-resistant BT-474 breast cancer cells. These characteristics are highly associated with the intrinsic ability of HuA21 to down-regulate HER2 activation and inhibit the extracellular signal-regulated kinase 1/2 (ERK1/2 and protein kinase B (Akt signaling pathways. Furthermore, the combination of HuA21 with Tra synergistically enhances the anti-tumor effects in vitro and in vivo and inhibits HER2 activation and the ERK1/2 and Akt signaling pathways. Altogether, our results suggest that HuA21 may represent a unique anti-HER2 antibody with potential as a therapeutic candidate alone or in combination with other anti-HER2 reagents in cancer therapy.

  7. 王弼《老子注》的詮釋辨證/ Interpretative Dialectics of Wang Bi’s Exegesis of Lao-Tzu

    Directory of Open Access Journals (Sweden)

    Jung-Tao TSAI

    2012-09-01

    Wang Bi, the most prominent scholar of metaphysics of the Wei and Jin Dynasties, was an unprecedented genius throughout the history of Chinese philosophy. In this article, the author examines the brilliant contributions made by Lin Li Zhen, Yu Dun Kang and Rudolf G. Wagner, who are noticed for their research of Exegesis of Lao-Tzu. It is a synthesis of the directions of investigation, approaches, and significant findings they have come up with. Among the three interpretations, Lin focuses on the explanation of Wang’s metaphysic thinking while Yu emphasizes Wang’s secular concerns by proposing the “philosophy of thoroughness” and political holism. As for Wagner, he approaches this work with the views of linguistic philosophy and suggests refined stylistics as interpretative strategy, which functions to enrich the textual contents.

  8. Simple deterministic models and applications. Comment on "Coupled disease-behavior dynamics on complex networks: A review" by Z. Wang et al.

    Science.gov (United States)

    Yang, Hyun Mo

    2015-12-01

    Currently, discrete modellings are largely accepted due to the access to computers with huge storage capacity and high performance processors and easy implementation of algorithms, allowing to develop and simulate increasingly sophisticated models. Wang et al. [7] present a review of dynamics in complex networks, focusing on the interaction between disease dynamics and human behavioral and social dynamics. By doing an extensive review regarding to the human behavior responding to disease dynamics, the authors briefly describe the complex dynamics found in the literature: well-mixed populations networks, where spatial structure can be neglected, and other networks considering heterogeneity on spatially distributed populations. As controlling mechanisms are implemented, such as social distancing due 'social contagion', quarantine, non-pharmaceutical interventions and vaccination, adaptive behavior can occur in human population, which can be easily taken into account in the dynamics formulated by networked populations.

  9. A new concept: Epigenetic game theory. Comment on: ;Epigenetic game theory: How to compute the epigenetic control of maternal-to-zygotic transition; by Qian Wang et al.

    Science.gov (United States)

    Zheng, Xiu-Deng; Tao, Yi

    2017-03-01

    The evolutionary significance of the interaction between paternal and maternal genomes in fertilized zygotes is a very interesting and challenging question. Wang et al. developed the concept of epigenetic game theory, and they try to use this concept to explain the interaction between paternal and maternal genomes in fertilized zygotes [1]. They emphasize that the embryogenesis can be considered as an ecological system in which two highly distinct and specialized gametes coordinate through either cooperation or competition, or both, to maximize the fitness of embryos under Darwinian selection. More specifically, they integrate game theory to model the pattern of coordination of paternal genome and maternal genomes mediated by DNA methylation dynamics, and they called this epigenetic game theory.

  10. De Hemingway au chinois classique : le travail de la langue de l’écrivain taïwanais Wang Wen-hsing

    Directory of Open Access Journals (Sweden)

    Sandrine Marchand

    2014-04-01

    Full Text Available Dans les années 1970, l’« occidentalisation » de Wang Wen-hsing lui attire les foudres de la critique. On lui reproche, entre autres choses, de mal écrire, d’être incompréhensible et d’écrire dans une langue occidentalisée. Lui-même semble prendre pour modèle son professeur de français, dont le niveau de chinois classique était très élevé. Entre chinois classique, moderne, dialecte de sa région natale (très proche du dialecte de Taïwan, anglais, et français idéalisé, Wang Wen-hsing invente sa propre langue. Dans les manuscrits de son premier roman, il recourt au syllabaire que les enfants utilisent en cours d’apprentissage de la langue chinoise pour remplacer les caractères d’écriture, syllabaire qui disparaît ensuite à la publication. Que nous apprend l’utilisation de ce syllabaire sur le travail créatif de l’auteur ?Wang Wen-hsing est un auteur qui, entre extrême précision et violence, consacre sa vie et toute son énergie au travail de la langue. Quelle langue tente-t-il d’approcher : le chinois normatif des temps anciens, la langue américaine de Hemingway, ou un mélange des deux ?Multilingue à l’intérieur de la langue chinoise moderne, elle-même langue encore proche du chinois classique, abandonné seulement au début du xxe siècle, l’écriture romanesque de Wang Wen-hsing, qui a pour critère de valeur le « tong-shun » (clarté et aisance, est le fruit de l’oralité et d’une langue expérimentale. Ce rapport à la langue vient-il de sa situation d’émigration, de son isolement des milieux politiques et intellectuels, comme cela lui a été reproché lorsque justement on l’accusait d’écrire dans une langue incompréhensible pour le lecteur ? Pourquoi ces romans sont-ils jugés incompréhensibles ? En raison du niveau du lecteur moyen ? Pour des raisons géopolitiques, car il est un émigré en position dominante dans l’île ? Parce que la langue chinoise est dans

  11. TH-CD-207B-11: Multi-Vendor Phantom Study of CT Lung Density Metrics: Is a Reproducibility of Less Than 1 HU Achievable?

    Energy Technology Data Exchange (ETDEWEB)

    Chen-Mayer, H [National Institute of Standards & Technology, Gaithersburg, MD (United States); Judy, P [Brigham & Women’s Hospital, Boston, MA (United States); Fain, S [University of Wisconsin, Madison, WI (United States); Hoppel, B [Toshiba Medical Research Institute USA, Inc, Vernon Hills, IL (United States); Lynch, D [Nation Jewish Health, Denver, CO (United States); Fuld, M [Siemens Medical Solutions USA, Inc., Baltimore, MD (United States)

    2016-06-15

    Purpose: To standardize the calibration procedures of CT lung density measurements using low-density reference foams in a phantom, and to demonstrate a reproducibility of less than 1 HU for lung equivalent foam densities measured across CT vendor platforms and protocols. Methods: A phantom study was conducted on CT scanner models from 4 vendors at 100, 120, and 135/140 kVp and 1.5, 3, and 6 mGy dose settings, using a lung density phantom containing air, water, and 3 reference foams (indirectly calibrated) with discrete densities simulating a 5-cm slice of the human chest. Customized segmentation software was used to analyze the images and generate a mean HU and variance for each of the density for the 22 vendor/protocols. A 3-step calibration process was devised to remove a scanner-dependent parameter using linear regression of the HU value vs the relative electron density. The results were mapped to a single energy (80 keV) for final comparison. Results: The heterogeneity across vendor platforms for each density assessed by a random effects model was reduced by 50% after re-calibration, while the standard deviation of the mean HU values also improved by about the same amount. The 95% CI of the final HU value was within +/−1 HU for all 3 reference foam densities. For the backing lung foam in the phantom (served as an “unknown”), this CI is +/− 1.6 HU. The kVp and dose settings did not appear to have significant contributions to the variability. Conclusion: With the proposed calibration procedures, the inter-scanner reproducibility of better than 1 HU is demonstrated in the current phantom study for the reference foam densities, but not yet achieved for a test density. The sources of error are being investigated in the next round of scanning with a certified Standard Reference Material for direct calibration. Fain: research funding from GE Healthcare to develop pulmonary MRI techniques. Hoppel: employee of Toshiba Medical Research Institute USA

  12. Nivel de pobreza y estado nutricional asociados a parasitosis intestinal en estudiantes, Huánuco, Perú, 2010

    Directory of Open Access Journals (Sweden)

    César Gabriel Berto Moreano

    2013-10-01

    Full Text Available Introducción: Se ha encontrado una prevalencia alta de parasitosis en escolares de la amazonía; pese a ello, no hay estudios realizados que revisen su asociación con el nivel socioeconómico y estado nutricional. Objetivos: Determinar la relación entre nivel de pobreza y estado nutricional con la presencia de parásitos intestinales en estudiantes escolares del caserío Venenillo, Huánuco. Diseño: Estudio transversal-analítico. Lugar: Caserío de Venenillo, Huánuco. Participantes: Estudiantes escolares de la única institución educativa del centro poblado. Intervenciones: A 42 estudiantes se les realizó examen coproparasitológico mediante observación directa con lugol y técnica de sedimentación rápida de Lumbreras. El nivel de pobreza fue determinado mediante el índice de necesidades básicas insatisfechas (NBI; y el grado de desnutrición, por medio del índice de Waterlow. El análisis estadístico fue realizado mediante el coeficiente gamma de Goodman y Kruskal. Principales medidas de resultados: Relación de parasitosis intestinal con pobreza y estado nutricional. Resultados: Los parásitos intestinales estuvieron presentes en 97,6%. Se encontró asociación significativa entre el nivel de parasitismo y el nivel de pobreza (p=0,02; gamma=0,82. No se encontró asociación significativa entre nivel de desnutrición y parasitismo (p=0,77. Conclusiones: La parasitosis intestinal se asoció al nivel de pobreza, no así con el nivel de desnutrición en la población de estudio.

  13. Dieta de roedores sigmodontinos (Cricetidae en los bosques montanos tropicales de Huánuco, Perú

    Directory of Open Access Journals (Sweden)

    Maggie C. Noblecilla

    2013-06-01

    Full Text Available Se analizó el contenido estomacal de cinco especies de roedores sigmodontinos: Akodon orophilus, Microry-zomys altissimus, M. minutus, Thomasomys notatus yT. kalinowskii, procedentes de los bosques montanos de Huánuco, Perú (2564 - 3850 m de altitud. Concluimos que A. orophiluses insectívora por haber presentado un alto volumen de artrópodos (adultos y larvas en el contenido estomacal (90,1%; mientras que T. notatusy T. kalinowskiison principalmente herbívoras por el alto volumen de materia vegetal, 89% y 67,75% respectiva-mente; y que M. altissimusy M. minutusson omnívoras por presentar volúmenes similares tanto para vegetales como para artrópodos. Thomasomys kalinowskiies considerada generalista por la mayor amplitud de nicho (4,61, mientras A. orophiluses considerada especialista por el menor valor (1,70. Akodon orophilusmostró una preferencia por el consumo de artrópodos adultos al tener un bajo coeficiente de variación (CV= 20% y también un significativo aumento en el consumo de larvas de artrópodos en la época húmeda, siendo la única especie con variación estacional en la dieta. Por otro lado, la sobreposición de nicho fue menor a 0,75 en el 80% de los pares de especies comparados, indicando una baja similitud en la dieta. La mayor similitud en la dieta se observó entre M. altissimus- T. notatus(0,822 y M. minutus - T. kalinowskii(0,816. Se concluye que estos roedores sigmodontinos, simpátricos en los bosques montanos de Huánuco, exhiben dietas disímiles, probablemente como una estrategia para evitar o aminorar la competencia interespecífica.

  14. Short communication. Employment of molecular markers to develop tetraploid “supermale” asparagus from andromonoecious plants of the landrace ‘Morado de Huétor’

    Directory of Open Access Journals (Sweden)

    Jose J. Regalado

    2014-10-01

    Full Text Available The aim of this work was the development of new “supermale” genotypes retaining the highest genetic diversity possible of the tetraploid asparagus landrace ‘Morado de Huétor’. The elite andromonoecious male HT664 of the ‘Morado de Huétor’ asparagus landrace and the andromonoecious hybrid male HC027, obtained by crossing between this landrace and a commercial cultivar of Asparagus officinalis, were selected for self-pollination to produce possible “supermales” with genes of ‘Morado de Huétor’ (SMHT. To confirm the hybrid nature of HC027, we characterized this genotype with EST-SSR (Expressed Sequence Tag-derived Simple Sequence Repeats markers. We also adopted the sex-linked marker Asp1-T7 for sex determination in ‘Morado de Huétor’ and the resulting hybrids between this landrace and other commercial cultivars. Asp1-T7 marker was used for the selection and genotyping of SMHT. “All-male” cultivars with a different genetic background can be generated by crossing females with these new “supermale” genotypes, and the agronomical traits of these new cultivars would be very different from the “all-male” cultivars currently available in the market, making them extremely interesting for asparagus breeding programs.

  15. Proteínas del huésped incorporadas en el Virus de la Inmunodeficiencia Humana tipo 1 (VIH-1

    Directory of Open Access Journals (Sweden)

    Dayane Canedo de León

    2008-01-01

    Full Text Available El Virus de la Inmunodeficiencia Humana (VIH, como la mayoría de los virus envueltos, toma esta estructura cuando abandona la célula infectada. El virus adquiere durante este proceso, junto con fragmentos de la membrana de la célula huésped, proteínas derivadas de la membrana celular como parte integral de la envoltura madura. Estos componentes de la envoltura viral derivados del huésped pueden ejercer algunos efectos en el ciclo de vida del virus, en la interacción virus-célula, especialmente en la respuesta del huésped a sus propias proteínas incorporadas por el virus y, finalmente, en la patogénesis de la enfermedad inducida por el virus. El rol de estas proteínas ha recibido cada día más atención, específicamente en la importancia que puedan tener en el proceso infeccioso viral y en le desarrollo del Síndrome de la Inmunodeficiencia Adquirida (SIDA. El objetivo de este artículo es hacer una revisión de las proteínas del huésped que son incorporadas por el VIH, haciendo énfasis en el rol potencial de estas proteínas en la patogénesis del SIDA.

  16. Proposed Methodology for Application of Human-like gradual Multi-Agent Q-Learning (HuMAQ) for Multi-robot Exploration

    International Nuclear Information System (INIS)

    Ray, Dip Narayan; Majumder, Somajyoti

    2014-01-01

    Several attempts have been made by the researchers around the world to develop a number of autonomous exploration techniques for robots. But it has been always an important issue for developing the algorithm for unstructured and unknown environments. Human-like gradual Multi-agent Q-leaming (HuMAQ) is a technique developed for autonomous robotic exploration in unknown (and even unimaginable) environments. It has been successfully implemented in multi-agent single robotic system. HuMAQ uses the concept of Subsumption architecture, a well-known Behaviour-based architecture for prioritizing the agents of the multi-agent system and executes only the most common action out of all the different actions recommended by different agents. Instead of using new state-action table (Q-table) each time, HuMAQ uses the immediate past table for efficient and faster exploration. The proof of learning has also been established both theoretically and practically. HuMAQ has the potential to be used in different and difficult situations as well as applications. The same architecture has been modified to use for multi-robot exploration in an environment. Apart from all other existing agents used in the single robotic system, agents for inter-robot communication and coordination/ co-operation with the other similar robots have been introduced in the present research. Current work uses a series of indigenously developed identical autonomous robotic systems, communicating with each other through ZigBee protocol

  17. The monomeric form of Neisseria DNA mimic protein DMP19 prevents DNA from binding to the histone-like HU protein

    Science.gov (United States)

    Ko, Tzu-Ping; Liao, Yi-Ting; Hsu, Kai-Cheng

    2017-01-01

    DNA mimicry is a direct and effective strategy by which the mimic competes with DNA for the DNA binding sites on other proteins. Until now, only about a dozen proteins have been shown to function via this strategy, including the DNA mimic protein DMP19 from Neisseria meningitides. We have shown previously that DMP19 dimer prevents the operator DNA from binding to the transcription factor NHTF. Here, we provide new evidence that DMP19 monomer can also interact with the Neisseria nucleoid-associated protein HU. Using BS3 crosslinking, gel filtration and isothermal titration calorimetry assays, we found that DMP19 uses its monomeric form to interact with the Neisseria HU dimer. Crosslinking conjugated mass spectrometry was used to investigate the binding mode of DMP19 monomer and HU dimer. Finally, an electrophoretic mobility shift assay (EMSA) confirmed that the DNA binding affinity of HU is affected by DMP19. These results showed that DMP19 is bifunctional in the gene regulation of Neisseria through its variable oligomeric forms. PMID:29220372

  18. Investigation of the HU-density conversion method and comparison of dose distribution for dose calculation on MV cone beam CT images

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Min Joo; Lee, Seu Ran; Suh, Tae Suk [Dept. of Biomedical Engineering, The Catholic University of Korea, Bucheon (Korea, Republic of)

    2011-11-15

    Modern radiation therapy techniques, such as Image-guided radiation therapy (IGRT), Adaptive radiation therapy (ART) has become a routine clinical practice on linear accelerators for the increase the tumor dose conformity and improvement of normal tissue sparing at the same time. For these highly developed techniques, megavoltage cone beam computed tomography (MVCBCT) system produce volumetric images at just one rotation of the x-ray beam source and detector on the bottom of conventional linear accelerator for real-time application of patient condition into treatment planning. MV CBCT image scan be directly registered to a reference CT data set which is usually kilo-voltage fan-beam computed tomography (kVFBCT) on treatment planning system and the registered image scan be used to adjust patient set-up error. However, to use MV CBCT images in radiotherapy, reliable electron density (ED) distribution are required. Patients scattering, beam hardening and softening effect caused by different energy application between kVCT, MV CBCT can cause cupping artifacts in MV CBCT images and distortion of Houns field Unit (HU) to ED conversion. The goal of this study, for reliable application of MV CBCT images into dose calculation, MV CBCT images was modified to correct distortion of HU to ED using the relationship of HU and ED from kV FBCT and MV CBCT images. The HU-density conversion was performed on MV CBCT image set using Dose difference map was showing in Figure 1. Finally, percentage differences above 3% were reduced depending on applying density calibration method. As a result, total error co uld be reduced to under 3%. The present study demonstrates that dose calculation accuracy using MV CBCT image set can be improved my applying HU-density conversion method. The dose calculation and comparison of dose distribution from MV CBCT image set with/without HU-density conversion method was performed. An advantage of this study compared to other approaches is that HU

  19. Proteomics reveal energy metabolism and mitogen-activated protein kinase signal transduction perturbation in human Borna disease virus Hu-H1-infected oligodendroglial cells.

    Science.gov (United States)

    Liu, X; Yang, Y; Zhao, M; Bode, L; Zhang, L; Pan, J; Lv, L; Zhan, Y; Liu, S; Zhang, L; Wang, X; Huang, R; Zhou, J; Xie, P

    2014-05-30

    Borna disease virus (BDV) is a neurotropic, non-cytolytic RNA virus which replicates in the cell nucleus targeting mainly hippocampal neurons, but also astroglial and oligodendroglial cells in the brain. BDV is associated with a large spectrum of neuropsychiatric pathologies in animals. Its relationship to human neuropsychiatric illness still remains controversial. We could recently demonstrate that human BDV strain Hu-H1 promoted apoptosis and inhibited cell proliferation in a human oligodendroglial cell line (OL cells) whereas laboratory BDV strain V acted contrariwise. Here, differential protein expression between BDV Hu-H1-infected OL cells and non-infected OL cells was assessed through a proteomics approach, using two-dimensional electrophoresis followed by matrix-assisted laser desorption ionization-time of flight tandem mass spectrometry. A total of 63 differential host proteins were identified in BDV Hu-H1-infected OL cells compared to non-infected OL cells. We found that most changes referred to alterations related to the pentose phosphate pathway, glyoxylate and dicarboxylate metabolism, the tricarboxylic acid (TCA) cycle, and glycolysis /gluconeogenesis. By manual querying, two differential proteins were found to be associated with mitogen-activated protein kinase (MAPK) signal transduction. Five key signaling proteins of this pathway (i.e., p-Raf, p-MEK, p-ERK1/2, p-RSK, and p-MSK) were selected for Western blotting validation. p-ERK1/2 and p-RSK were found to be significantly up-regulated, and p-MSK was found to be significantly down-regulated in BDV Hu-H1-infected OL cells compared to non-infected OL cell. Although BDV Hu-H1 constitutively activated the ERK-RSK pathway, host cell proliferation and nuclear translocation of activated pERK in BDV Hu-H1-infected OL cells were impaired. These findings indicate that BDV Hu-H1 infection of human oligodendroglial cells significantly perturbs host energy metabolism, activates the downstream ERK-RSK complex of

  20. Infección por Gnathostoma (Spirurida: Gnathostomatidae en Hoplias microlepis: prevalencia, correlación con la talla del pez, huéspedes e implicaciones para salud pública en Ecuador

    Directory of Open Access Journals (Sweden)

    Juan José Alava

    2009-12-01

    Conclusiones. La gnathostomiasis sigue siendo prevalente en la zona costera de Ecuador y el agente patógeno es aún encontrado en el huésped intermediario. Diversos mamíferos neotropicales estarían actuando como huésped reservorio definitivo en el ciclo biológico de Gnathostoma en Ecuador.

  1. Detrimental ELAVL-1/HuR-dependent GSK3β mRNA stabilization impairs resolution in acute respiratory distress syndrome.

    Directory of Open Access Journals (Sweden)

    Olivia Hoffman

    Full Text Available A hallmark of acute respiratory distress syndrome (ARDS is accumulation of protein-rich edema in the distal airspaces and its removal is critical for patient survival. Previous studies have shown a detrimental role of Glycogen Synthase Kinase (GSK 3β during ARDS via inhibition of alveolar epithelial protein transport. We hypothesized that post-transcriptional regulation of GSK3β could play a functional role in ARDS resolution. To address this hypothesis, we performed an in silico analysis to identify regulatory genes whose expression correlation to GSK3β messenger RNA utilizing two lung cancer cell line array datasets. Among potential regulatory partners of GSK3β, these studies identified the RNA-binding protein ELAVL-1/HuR (Embryonic Lethal, Abnormal Vision, Drosophila-Like as a central component in a likely GSK3β signaling network. ELAVL-1/HuR is a RNA-binding protein that selectively binds to AU-rich elements of mRNA and enhances its stability thereby increasing target gene expression. Subsequent studies with siRNA suppression of ELAVL-1/HuR demonstrated deceased GSK3β mRNA and protein expression and improved clearance of FITC-albumin in A549 cells. Conversely, stabilization of ELAVL-1/HuR with the proteasome inhibitor MG-132 resulted in induction of GSK3β at mRNA and protein level and attenuated FITC-albumin clearance. Utilizing ventilator-induced lung injury or intra-tracheal installation of hydrochloric acid to induce ARDS in mice, we observed increased mRNA and protein expression of ELAVL-1/HuR and GSK3β. Together, our findings indicate a previously unknown interaction between GSK3β and ELAV-1 during ARDS, and suggest the inhibition of the ELAV-1- GSK3β pathways as a novel ARDS treatment approach.

  2. A single nucleotide polymorphism in the zona pellucida 3 gene is associated with the first parity litter size in Hu sheep.

    Science.gov (United States)

    Chong, Yuqing; Huang, Huarong; Liu, Guiqiong; Jiang, Xunping; Rong, Weiheng

    2018-03-31

    Zona pellucida 3 (ZP3) is a primary sperm receptor and acrosome reaction inducer. As a candidate gene, the ZP3 gene has been widely studied since it has great influence on reproductive traits in farm animals. However, little is known about the association between polymorphisms of the coding region of the ZP3 gene and the first parity litter size in Hu sheep. Therefore, the objective of this study was to identify single nucleotide polymorphisms (SNPs) of the ZP3 gene associated with the first parity litter size in Hu sheep. A total of 462 female Hu sheep were sampled to detect SNPs in the coding region of the ZP3 gene. Six SNPs were identified and the reliability of all estimated allele frequencies reached 0.9545 except for one locus (g.2293C > T). SNP (rs401271989) was identified as that involved in amino acid change (Ile → Leu). This amino acid was located at the beginning of a β-strand and outside of the ZP3 protein membrane, and it was most likely to be a ligand-binding site (the possibility was 0.917). At this locus, individuals with AC genotype had a larger litter size than those with CC genotype in the first parity (2.050 vs 1.727, p size in Hu sheep, and it may affect the function of ZP3 protein by impacting the secondary and tertiary protein structures. The present study demonstrates that SNP (rs401271989) could be used in marker-assisted selection of the first parity litter size in Hu sheep. Copyright © 2018 Elsevier B.V. All rights reserved.

  3. Modelo de gestión cultural: Una experiencia con el Qhapaq Ñan en Huánuco

    Directory of Open Access Journals (Sweden)

    Denesy Palacios Jiménez

    2014-06-01

    Full Text Available Objetivos: Plantear el aprovechamiento del patrimonio cultural arqueológico del Qhapaq Ñan en Huánuco en condición de parque cultural, mediante un modelo eficiente de gestión cultural basada en la investigación, protección, conservación y uso social, para convertir a este lugar en un destino turístico y así contribuir con un proyecto no solo para salvaguardarlo sino también para incrementar los ingresos económicos y reducir los niveles de pobreza en la zona. Métodos: Se trata de un estudio que describe y recoge experiencias de gestión cultural respecto a cómo se aprovecha en otros sitios el legado o patrimonio cultural arqueológico, tanto en el ámbito mundial como nacional. La investigación fue cuantitativa y cualitativa, con un alcance correlacional. Se usó el diseño descriptivo, comparativo, analítico, histórico, deductivo. Resultados: El estudio plantea la necesidad de optimizar los recursos para el aprovechamiento del Qhapaq Ñan como parque cultural a través de una adecuada gestión cultural, y que dicho parque comprenderá 68,34 km, desde el tambo de Tambococha o Tunsucancha hasta el tambo de Taparako, por ser uno de los tramos mejor conservados e involucra importantes zonas de patrimonio cultural material e inmaterial. Conclusiones: El Camino Inca en Huánuco es uno de los patrimonios más importantes del país, y es posible ser impulsado como un parque cultural mediante un modelo de gestión cultural, si tenemos en cuenta las diversas experiencias de gestión en el país y en mundo, cuyos aportes deben servir de apoyo para un modelo de gestión en este campo.

  4. Game theory in epigenetic reprogramming. Comment on: ;Epigenetic game theory: How to compute the epigenetic control of maternal-to-zygotic transition; by Qian Wang et al.

    Science.gov (United States)

    Hsu, Fei-Man; Chen, Pao-Yang

    2017-03-01

    Von Neumann and Morgenstern published the Theory of Games and Economic Behavior in 1944, describing game theory as a model in which intelligent rational decision-makers manage to find their best strategies in conflict, cooperative or other mutualistic relationships to acquire the greatest benefit [1]. This model was subsequently incorporated in ecology to simulate the ;fitness; of a species during natural selection, designated evolutionary game theory (EGT) [2]. Wang et al. proposed ;epiGame;, taking paternal and maternal genomes as ;intelligent; players that compete, cooperate or both during embryogenesis to maximize the fitness of the embryo [3]. They further extended game theory to an individual or single cell environment. During early zygote development, DNA methylation is reprogrammed such that the paternal genome is demethylated before the maternal genome. After the reset, the blastocyst is re-methylated during embryogenesis. At that time, the paternal and maternal genomes have a conflict of interest related to the expression of their own genes. The proposed epiGame models such interactive regulation between the parental genomes to reach a balance for embryo development (equation (2)).

  5. Scaling behavior can be tricky: Comment on "Universal scaling for the dilemma strength in evolutionary games" by Z. Wang et al.

    Science.gov (United States)

    Hui, Pak Ming; Xu, Chen

    2015-09-01

    Evolutionary game theory is a powerful tool for studying the emergence of cooperation among competing individuals [1]. Popularly studied games include the prisoner's dilemma [2], snowdrift game [3] and stag hunt game [4]. They have been extensively studied for the extent of cooperative behavior under different dilemma strengths. Generally, the games can be defined by a 2 × 2 matrix and thus four payoff elements, T, R, P, and S, for the possible payoffs to players when they use pure strategies against each other. Detailed definitions of the four payoffs are given in the review by Wang et al. [5]. For simplicity, it is often the case that fewer parameters are invoked, e.g. a single parameter [3] and more generally two parameters [6]. Generally speaking, reducing the number of parameters has the effect of restricting the system to a certain subspace of the unreduced case. In addition, the spatial structures, such as a well-mixed population or a population forming a complex network, that govern the competing relationship and environment of the agents, and the evolutionary rules, that govern how agents update their strategies, are vital in determining how cooperation evolves, as well documented in the references of [5].

  6. Comments on the paper 'Sorption of radionickel to goethite: effect of water quality parameters and temperature' by Hu et al

    International Nuclear Information System (INIS)

    Yuh-Shan Ho

    2011-01-01

    Recently, Hu et al. [1]. published a paper with the above title. In section 'Effect of contact time', the authors stated, 'In order to study the sorption rate constant of Ni(II) to goethite, the pseudo-second-order rate equation was used to fit the kinetic sorption of Ni(II) to goethite' and referred to two self-citations published in 2008 and 2010 respectively [2, 3]. In fact, this kinetic model has already been published first in 1996 [4], and a modified model was presented in the following years to correct a mistake in the 1996 paper [5-7]. However the mistake in the model was duplicated by other researchers [8, 9]. In order to stop the proliferation of the mistake a comment has been made [10]. This type of error could be avoided if authors have had paid more attentions to details about the model from the original paper [11]. Accuracy in citing references is very important for the transmission of scientific knowledge. Citation errors reflect poorly on authors who republish original ideas that were already published. Hopefully, the identification of this type of problems will lead to improved accuracy in referencing [12]. Authors should make serious efforts to check the accuracy of references cited in their manuscripts as well as to read the original article before quoting it rather than citing from abstracts or cross-references [13]. It is recommended that more attention should be paid in preparing bibliographies and in checking quoted references [14]. (author)

  7. Karyotypes of Akodon orophilus Osgood 1913 and Thomasomys sp. (Rodentia: Sigmodontinae from Huánuco, Peru

    Directory of Open Access Journals (Sweden)

    Víctor Pacheco

    2012-10-01

    Full Text Available Conventional chromosomal preparations were made of three native mice from Huánuco, Peru: a male and a female of Thomasomys sp., and a male of Akodon orophilus. Thomasomys sp. had a karyotype of 2n = 42, XY (n = 21, meanwhile A. orophilus presented 2n = 22, XY (n = 11. Comparisons between chromosomal pairs from the existent literature indicate that both are new karyotypes. Thomasomys sp. has a distinct sexual Y chromosome, the only metacentric (m reported for the genus. The chromosomes X and Y of A. orophilus are acrocentrics (a; and the length of chromosome Y (2/3 of the length of X distinguishes A. orophilus from other congeneric. Because the structural differences between the sexual chromosomes usually generates mechanism of reproductive isolation at intraspecific level and are bigger still in interspecific crosses, we concluded that the karyotypes reported here support the validity of the species A. orophilus and suggest that Thomasomys sp. represents a new species to science.

  8. Renal Protective Effect of Xiao-Chai-Hu-Tang on Diabetic Nephropathy of Type 1-Diabetic Mice

    Directory of Open Access Journals (Sweden)

    Chun-Ching Lin

    2012-01-01

    Full Text Available Xiao-Chai-Hu-Tang (XCHT, a traditional Chinese medicine formula consisting of seven medicinal plants, is used in the treatment of various diseases. We show here that XCHT could protect type-1 diabetic mice against diabetic nephropathy, using streptozotocin (STZ-induced diabetic mice and high-glucose (HG-exposed rat mesangial cell (RMC as models. Following 4 weeks of oral administration with XCHT, renal functions and renal hypertrophy significantly improved in the STZ-diabetic mice, while serum glucose was only moderately reduced compared to vehicle treatment. Treatment with XCHT in the STZ-diabetic mice and HG-exposed RMC resulted in a decrease in expression levels of TGF-β1, fibronectin, and collagen IV, with concomitant increase in BMP-7 expression. Data from DPPH assay, DHE stain, and CM-H2DCFDA analysis indicated that XCHT could scavenge free radicals and inhibit high-glucose-induced ROS in RMCs. Taken together, these results suggest that treatment with XCHT can improve renal functions in STZ-diabetic mice, an effect that is potentially mediated through decreasing oxidative stress and production of TGF-β1, fibronectin, and collagen IV in the kidney during development of diabetic nephropathy. XCHT, therefore merits further investigation for application to improve renal functions in diabetic disorders.

  9. Synergistic Anticancer Effects of Vorinostat and Epigallocatechin-3-Gallate against HuCC-T1 Human Cholangiocarcinoma Cells

    Directory of Open Access Journals (Sweden)

    Tae Won Kwak

    2013-01-01

    Full Text Available The aim of this study was to investigate the effect of the combination of vorinostat and epigallocatechin-3-gallate against HuCC-T1 human cholangiocarcinoma cells. A novel chemotherapy strategy is required as cholangiocarcinomas rarely respond to conventional chemotherapeutic agents. Both vorinostat and EGCG induce apoptosis and suppress invasion, migration, and angiogenesis of tumor cells. The combination of vorinostat and EGCG showed synergistic growth inhibitory effects and induced apoptosis in tumor cells. The Bax/Bcl-2 expression ratio and caspase-3 and -7 activity increased, but poly (ADP-ribose polymerase expression decreased when compared to treatment with each agent alone. Furthermore, invasion, matrix metalloproteinase (MMP expression, and migration of tumor cells decreased following treatment with the vorinostat and EGCG combination compared to those of vorinostat or EGCG alone. Tube length and junction number of human umbilical vein endothelial cells (HUVECs decreased as well as vascular endothelial growth factor expression following vorinostat and EGCG combined treatment. These results indicate that the combination of vorinostat and EGCG had a synergistic effect on inhibiting tumor cell angiogenesis potential. We suggest that the combination of vorinostat and EGCG is a novel option for cholangiocarcinoma chemotherapy.

  10. Avaliação dos óbitos ocorridos no Hospital Universitário da Universidade Federal de Santa Catarina (HU/UFSC Evaluation of deaths occurred at the University Hospital (HU/UFSC

    Directory of Open Access Journals (Sweden)

    Rachel Duarte Moritz

    2008-10-01

    Full Text Available OBJETIVO: Avaliar os óbitos ocorridos no HU/UFSC. Comparar o perfil dos pacientes que morreram nas enfermarias com o daqueles que morreram na UTI. Verificar se os óbitos foram considerados esperados (E e não evitáveis (NE. Constatar se houve recusa/suspensão de terapêutica (RST precedendo a morte. MÉTODOS: Obtivemos dados por meio de ficha elaborada pela Comissão de Óbito Hospitalar (COH, na qual constavam os aspectos demográficos, clínicos e terapêuticos dos pacientes e a avaliação da COH sobre a expectativa/evitabilidade dos óbitos. RESULTADOS: Analisamos os dados dos 326 pacientes com mais de 14 anos, que morreram entre julho/2004 e dezembro/2005. Desses, 128 morreram na UTI (G1 e 198 nas enfermarias (G2. A RST precedeu 38,2% dos óbitos no G1 e 2% no G2 (pOBJECTIVE: To evaluate the deaths which occurred at the HU/UFSC. To compare the profile of patients who died in the wards with that of patients who died in the ICU. To classify deaths which were expected or not, and avoidable or not. To verify how often withholding or withdrawing (WW therapy preceded death. METHODS: Archives of the Hospital Death Commission (HDC were analyzed. The clinical and demographic records were retrieved from the HDC data bank. Deaths were classified by the HDC as expected or not and avoidable or not. RESULTS: Data from 326 dead persons over 14 years of age were analyzed. One hundred and twenty eight deaths occurred in the ICU (G1 and 198 in the wards (G2. WW therapy preceded 38.2% of deaths in G1 and 2% in G2 (p<0.001. The main WW therapies were vasoactive drugs and antibiotics. Almost 20% of deaths were unexpected/avoidable in G1. In G2 6.5% were considered unexpected and 5% avoidable (p<0.005. Patients in G1 were younger and mostly male (p<0.005. Do-not-resuscitate orders were registered in 48.4% of patients' medical charts in G2 and 6.3% in G1 (p<0.001. Cardiopulmonary resuscitation was performed in 23.4% of patients in G1 and in 5.5% in G2 (p<0

  11. Aryl hydrocarbon receptor-dependent retention of nuclear HuR suppresses cigarette smoke-induced cyclooxygenase-2 expression independent of DNA-binding.

    Science.gov (United States)

    Zago, Michela; Sheridan, Jared A; Nair, Parameswaran; Rico de Souza, Angela; Gallouzi, Imed-Eddine; Rousseau, Simon; Di Marco, Sergio; Hamid, Qutayba; Eidelman, David H; Baglole, Carolyn J

    2013-01-01

    The aryl hydrocarbon receptor (AhR), a ligand-activated transcription factor that responds to man-made environmental toxicants, has emerged as an endogenous regulator of cyclooxygenase-2 (Cox-2) by a mechanism that is poorly understood. In this study, we first used AhR-deficient (AhR(-/-) ) primary pulmonary cells, together with pharmacological tools to inhibit new RNA synthesis, to show that the AhR is a prominent factor in the destabilization of Cox-2 mRNA. The destabilization of Cox-2 mRNA and subsequent suppression of cigarette smoke-induced COX-2 protein expression by the AhR was independent of its ability to bind the dioxin response element (DRE), thereby differentiating the DRE-driven toxicological AhR pathway from its anti-inflammatory abilities. We further describe that the AhR destabilizes Cox-2 mRNA by sequestering HuR within the nucleus. The role of HuR in AhR stabilization of Cox-2 mRNA was confirmed by knockdown of HuR, which resulted in rapid Cox-2 mRNA degradation. Finally, in the lungs of AhR(-/-) mice exposed to cigarette smoke, there was little Cox-2 mRNA despite robust COX-2 protein expression, a finding that correlates with almost exclusive cytoplasmic HuR within the lungs of AhR(-/-) mice. Therefore, we propose that the AhR plays an important role in suppressing the expression of inflammatory proteins, a function that extends beyond the ability of the AhR to respond to man-made toxicants. These findings open the possibility that a DRE-independent AhR pathway may be exploited therapeutically as an anti-inflammatory target.

  12. A comparative study of oral health attitudes and behavior using the Hiroshima University-Dental Behavioral Inventory (HU-DBI) between dental and civil engineering students in Colombia.

    Science.gov (United States)

    Jaramillo, Jorge A; Jaramillo, Fredy; Kador, Itzjak; Masuoka, David; Tong, Liyue; Ahn, Chul; Komabayashi, Takashi

    2013-03-01

    The aim of this study was to use the Hiroshima University - Dental Behavioral Inventory (HU-DBI) to compare oral health attitudes and behavior of dental and civil engineering students in Colombia. The HU-DBI's survey consisting of twenty dichotomous responses (agree-disagree) regarding tooth brushing, was completed at University Antonio Narino for the dental students and the University of Cauca for the civil engineering students. The Spanish version of the HU-DBI questionnaire was taken by 182 of 247 dental students and 411 of 762 engineering students. The data was-statistically analyzed by the chi-square test and backward logistic regression. Compared to the engineering students, the dental students were more likely to agree with questions such as "I am bothered by the color of my gums"(OR = 2.2, 95% CI: 1.3-3.7),"I think I can clean my teeth well without using toothpaste" (OR = 3.0, 95% CI: 1.5-5.9), "I have used a dye to see how clean my teeth are" (OR = 2.9, 95% CI: 1.9-4.3), and "I have had my dentist tell me that I brush very well" (OR = 2.0, 95% CI: 1.3-3.1). The dental education curriculum in a dental school compared to a civil engineering school in Colombia indicated that a three-phase curriculum in didactics and clinics increased oral health attitudes and behavior from entry to graduation.

  13. HU participates in expression of a specific set of genes required for growth and survival at acidic pH in Escherichia coli.

    Science.gov (United States)

    Bi, Hongkai; Sun, Lianle; Fukamachi, Toshihiko; Saito, Hiromi; Kobayashi, Hiroshi

    2009-05-01

    The major histone-like Escherichia coli protein, HU, is composed of alpha and beta subunits respectively encoded by hupA and hupB in Escherichia coli. A mutant deficient in both hupA and hupB grew at a slightly slower rate than the wild type at pH 7.5. Growth of the mutant diminished with a decrease in pH, and no growth was observed at pH 4.6. Mutants of either hupA or hupB grew at all pH levels tested. The arginine-dependent survival at pH 2.5 was diminished approximately 60-fold by the deletion of both hupA and hupB, whereas the survival was slightly affected by the deletion of either hupA or hupB. The mRNA levels of adiA and adiC, which respectively encode arginine decarboxylase and arginine/agmatine antiporter, were low in the mutant deficient in both hupA and hupB. The deletion of both hupA and hupB had little effect on survival at pH 2.5 in the presence of glutamate or lysine, and expression of the genes for glutamate and lysine decarboxylases was not impaired by the deletion of the HU genes. These results suggest that HU regulates expression of the specific set of genes required for growth and survival in acidic environments.

  14. Autoregulation of transcription of the hupA gene in Escherichia coli: evidence for steric hindrance of the functional promoter domains induced by HU.

    Science.gov (United States)

    Kohno, K; Yasuzawa, K; Hirose, M; Kano, Y; Goshima, N; Tanaka, H; Imamoto, F

    1994-06-01

    The molecular mechanism of autoregulation of expression of the hupA gene in Escherichia coli was examined. The promoter of the gene contains a palindromic sequence with the potential to form a cruciform DNA structure in which the -35 sequence lies at the base of the stem and the -10 sequence forms a single-stranded loop. An artificial promoter lacking the palindrome, which was constructed by replacing a 10 nucleotide repeat for the predicted cruciform arm by a sequence in the opposite orientation, was not subject to HU-repression. DNA relaxation induced by deleting HU proteins and/or inhibiting DNA gyrase in cells results in increased expression from the hupA promoter. We propose that initiation of transcription of the hupA gene is negatively regulated by steric hindrance of the functional promoter domains for formation of the cruciform configuration, which is facilitated at least in part by negative supercoiling of the hupA promoter DNA region. The promoter region of the hupB gene also contains a palindromic sequence that can assume a cruciform configuration. Negative regulation of this gene by HU proteins may occur by a mechanism similar to that operating for the hupA gene.

  15. Adrenaline promotes epithelial-to-mesenchymal transition via HuR-TGFβ regulatory axis in pancreatic cancer cells and the implication in cancer prognosis.

    Science.gov (United States)

    Pu, Jun; Zhang, Xiaorui; Luo, Huiwen; Xu, Lijuan; Lu, Xiaozhao; Lu, Jianguo

    2017-11-25

    Psychological stress has recently been described as a risk factor in the development of pancreatic cancer. Here, we reported that increased neurotransmitter adrenaline was associated with the poor survival in pancreatic cancer patients. Moreover, in the cell model study, we found adrenaline promoted pancreatic cell PANC-1 migration in a dose dependent manner. Block of the β2-adrenoreceptor with ICI118,551, significantly reduced cell migration. Further study found that adrenaline induced a cytoplasmic translocation of RNA binding protein HuR, which in turn activated TGFβ, as shown by the SBE luciferase assay and phosphorylation of Smad2/3. Either HuR knockdown or TGFβ inhibition reduced cell migration induced by adrenaline. Taken together, our study here revealed that adrenaline-HuR-TGFβ regulatory axis at least partially contributes to the psychological stress induced metastasis in PANC-1 cells, shedding light on therapeutic targeting psychological stress in improving the prognosis of pancreatic cancer. Copyright © 2017 Elsevier Inc. All rights reserved.

  16. HuR and Ago2 Bind the Internal Ribosome Entry Site of Enterovirus 71 and Promote Virus Translation and Replication.

    Directory of Open Access Journals (Sweden)

    Jing-Yi Lin

    Full Text Available EV71 (enterovirus 71 RNA contains an internal ribosomal entry site (IRES that directs cap-independent initiation of translation. IRES-dependent translation requires the host's translation initiation factors and IRES-associated trans-acting factors (ITAFs. We reported recently that mRNA decay factor AUF1 is a negative-acting ITAF that binds IRES stem-loop II. We also reported that the small RNA-processing enzyme Dicer produces at least four small RNAs (vsRNAs from the EV71 IRES. One of these, vsRNA1, derived from IRES stem-loop II, reduces IRES activity and virus replication. Since its mechanism of action is unknown, we hypothesized that it might control association of ITAFs with the IRES. Here, we identified the mRNA stability factor HuR and the RISC subunit Argonaute 2 (Ago2 as two ITAFs that bind stem-loop II. In contrast to AUF1, HuR and Ago2 promote EV71 IRES activity and virus replication. In vitro RNA-binding assays revealed that vsRNA1 can alter association of Ago2, HuR, and AUF1 with stem-loop II. This presents a possible mechanism by which vsRNA1 could control viral translation and replication.

  17. Analisis senyawa volatil dari ekstrak tanaman yang berpotensi sebagai atraktan parasitoid telur wereng batang coklat, Anagrus nilaparvatae (Pang et Wang (Hymenoptera: Mymaridae

    Directory of Open Access Journals (Sweden)

    Surjani Wonorahardjo

    2015-09-01

    Full Text Available Plants produce volatiles as communication cues intra- or inter- species. Infested plants by herbivores will produce volatiles as indirect defense mechanism that attracts natural enemies of herbivores. Analysis of volatiles compounds produced by rice plant as result of infested brown plant hopper (BPH, Nilaparvata lugens Stâl, was done to identify compounds in the volatiles that potentially can be used as attractant for egg parasitoids of BPH, Anagrus nilaparvatae (Pang et Wang (Hymenoptera: Mymaridae. This research was an early stage to develop formulation of parasitoid attractant. The research activities include volatiles extraction of infested rice stem by BPH eggs using acetone, n-hexane as the extraction solvents; analyses of volatile compounds with GC-MS; and bioassay of parasitoid orientation behavior to the volatiles using olfactometer methods. Extraction methods applied were maceration and continuous extraction followed by concentration. Bioassay on the parasitoid orientation behavior was done by using Y-tube olfactometer and every lot of bioassay using 30 parasitoid females with 3 replicates. The results showed that the volatile compounds of extract of infested rice stem by BPH eggs comprise of 16 components. The highest proportion of the components extracted with acetone is 2-Pentanone, 4-hydroxy-4-methyl (19,9%, while those with n-hexane is Hexanedioic acid, dioctyl ester (65%. A. nilaparvatae showed positive response to the volatiles extracted from infested rice plant by N. lugens eggs. Therefore, the volatiles can be used as an attractant for the egg A. nilaparvatae to support rice pest management.

  18. Absorption of SO/sub 2/ by pecan (Carya illinoensis (Wang) K. Koch) and alfalfa (Medicago sativa L. ) and its effect on net photosynthesis

    Energy Technology Data Exchange (ETDEWEB)

    Sisson, W.B.; Booth, J.A.; Throneberry, G.O.

    1981-06-01

    Absorption rates of SO/sub 2/ by pecan (Carya illinoensis (Wang) K. Koch) leaflets exposed to 2.6, 5.2, and 7.8 mg SO/sub 2/ m/sup -3/ were measured over a 2 h period. SO/sub 2/ was rapidly absorbed by the leaflets in all treatments during the initial 30-50 min; the rate of uptake decreased to a rather constant level thereafter. Total SO/sub 2/ absorbed during the 2 h period was 15.6, 25.6, and 38.9 nmol cm/sup -2/ for the low, medium, and high SO/sub 2/ concentrations, respectively. Reductions in net photosynthetic rates were proportional to ambient SO/sub 2/ concentrations and total SO/sub 2/ absorbed. Partial photosynthetic recovery occurred in all treatments during a 2 hr post-treatment period and full recovery occurred during a 12 h dark period. Exposure to SO/sub 2/ resulted in slight increases in stomatal and boundary layer resistances to CO/sub 2/ and substantial increases in residual resistances. Absorption rates of SO/sub 2/ by alfalfa (Medicago sativa L.) exposed to 5.2 mg SO/sub 2/ m/sup -3/ for 1 h were approximately double those of pecan exposed to the same ambient SO/sub 2/ concentration. Alfalfa net photosynthetic rates were reduced 74% after 1 h exposure to 5.2 mg SO/sub 2/ m/sup -3/ while a depression of 42% occurred in pecan.

  19. Petrochemistry and zircon U-Pb geochronology of granitic rocks in the Wang Nam Khiao area, Nakhon Ratchasima, Thailand: Implications for petrogenesis and tectonic setting

    Science.gov (United States)

    Fanka, Alongkot; Tsunogae, Toshiaki; Daorerk, Veerote; Tsutsumi, Yukiyasu; Takamura, Yusuke; Sutthirat, Chakkaphan

    2018-05-01

    Carboniferous biotite granite, Late Permian hornblende granite, and Triassic biotite-hornblende granite, all of which belong to the Eastern Granite Belt, expose in the Wang Nam Khiao area, Nakhon Ratchasima, northeastern Thailand. The Carboniferous biotite granite is dominated by quartz, K-feldspar, plagioclase, and biotite. The Late Permian hornblende granite contains dominant assemblages of plagioclase, quartz, K-feldspar, hornblende, and minor amount of biotite, while the Triassic biotite-hornblende granite consists of quartz, plagioclase, K-feldspar with small amounts of biotite, and hornblende. The REE patterns with steep decrease from light to heavy REE together with the LILE (e.g. K, Sr) enrichment and depletion of some particular HFSE (e.g. Nb, Ti) indicate low degree of partial melting. Mineral chemistry of biotite and hornblende in the granites reflects crystallization from hydrous calc-alkaline arc-derived magmas possibly formed by subduction. Amphibole-plagioclase thermometry and Al-in-hornblende barometry indicate that the Late Permian hornblende granite and the Triassic biotite-hornblende granite may have equilibrated at 3.0-5.8 kbar/700-820 °C and 2.0-3.2 kbar/600-750 °C, respectively, in the middle-upper crust (about 10-15 km depth). Zircon U-Pb geochronology of the Carboniferous biotite granite, Late Permian hornblende granite and Triassic biotite-hornblende granite yielded intrusion ages of 314.6-284.9 Ma, 253.4 Ma, and 237.8 Ma, respectively, which implies multiple episodes of arc-magmatism formed by Palaeo-Tethys subduction beneath Indochina Terrane during Late Carboniferous/Early Permian, Late Permian and Middle Triassic.

  20. Combined influence of CT random noise and HU-RSP calibration curve nonlinearities on proton range systematic errors

    Science.gov (United States)

    Brousmiche, S.; Souris, K.; Orban de Xivry, J.; Lee, J. A.; Macq, B.; Seco, J.

    2017-11-01

    Proton range random and systematic uncertainties are the major factors undermining the advantages of proton therapy, namely, a sharp dose falloff and a better dose conformality for lower doses in normal tissues. The influence of CT artifacts such as beam hardening or scatter can easily be understood and estimated due to their large-scale effects on the CT image, like cupping and streaks. In comparison, the effects of weakly-correlated stochastic noise are more insidious and less attention is drawn on them partly due to the common belief that they only contribute to proton range uncertainties and not to systematic errors thanks to some averaging effects. A new source of systematic errors on the range and relative stopping powers (RSP) has been highlighted and proved not to be negligible compared to the 3.5% uncertainty reference value used for safety margin design. Hence, we demonstrate that the angular points in the HU-to-RSP calibration curve are an intrinsic source of proton range systematic error for typical levels of zero-mean stochastic CT noise. Systematic errors on RSP of up to 1% have been computed for these levels. We also show that the range uncertainty does not generally vary linearly with the noise standard deviation. We define a noise-dependent effective calibration curve that better describes, for a given material, the RSP value that is actually used. The statistics of the RSP and the range continuous slowing down approximation (CSDA) have been analytically derived for the general case of a calibration curve obtained by the stoichiometric calibration procedure. These models have been validated against actual CSDA simulations for homogeneous and heterogeneous synthetical objects as well as on actual patient CTs for prostate and head-and-neck treatment planning situations.

  1. Benchmark critical experiments on low-enriched uranium oxide systems with H/U = 0.77

    International Nuclear Information System (INIS)

    Tuck, G.; Oh, I.

    1979-08-01

    Ten benchmark experiments were performed at the Critical Mass Laboratory at Rockwell International's Rocky Flats Plant, Golden, Colorado, for the US Nuclear Regulatory Commission. They provide accurate criticality data for low-enriched damp uranium oxide (U 3 O 8 ) systems. The core studied consisted of 152 mm cubical aluminum cans containing an average of 15,129 g of low-enriched (4.46% 235 U) uranium oxide compacted to a density of 4.68 g/cm 3 and with an H/U atomic ratio of 0.77. One hundred twenty five (125) of these cans were arranged in an approx. 770 mm cubical array. Since the oxide alone cannot be made critical in an array of this size, an enriched (approx. 93% 235 U) metal or solution driver was used to achieve criticality. Measurements are reported for systems having the least practical reflection and for systems reflected by approx. 254-mm-thick concrete or plastic. Under the three reflection conditions, the mass of the uranium metal driver ranged from 29.87 kg to 33.54 kg for an oxide core of 1864.6 kg. For an oxide core of 1824.9 kg, the weight of the high concentration (351.2 kg U/m 3 ) solution driver varied from 14.07 kg to 16.14 kg, and the weight of the low concentration (86.4 kg U/m 3 ) solution driver from 12.4 kg to 14.0 kg

  2. ESR1 Gene Polymorphisms and Prostate Cancer Risk: A HuGE Review and Meta-Analysis.

    Directory of Open Access Journals (Sweden)

    Yu-Mei Wang

    Full Text Available Many published data on the association between single nucleotide polymorphisms (SNPs in the ESR1 gene and prostate cancer susceptibility are inconclusive. The aim of this Human Genome Epidemiology (HuGE review and meta-analysis is to derive a more precise estimation of this relationship.A literature search of PubMed, Embase, Web of Science and Chinese Biomedical (CBM databases was conducted from their inception through July 1st, 2012. Crude odds ratios (ORs with 95% confidence intervals (CIs were calculated to assess the strength of association.Twelve case-control studies were included with a total 2,165 prostate cancer cases and 3,361 healthy controls. When all the eligible studies were pooled into the meta-analysis, ESR1 PvuII (C>T and XbaI (A>G polymorphisms showed no association with the risk of prostate cancer. However, in the stratified analyses based on ethnicity and country, the results indicated that ESR1 PvuII (C>T polymorphism was significantly associated with increased risk of prostate cancer among Asian populations, especially among Indian population; while ESR1 XbaI (A>G polymorphism may significantly increase the risk of prostate cancer among American population. Furthermore, we also performed a pooled analysis for all eligible case-control studies to explore the role of codon 10 (T>C, codon 325 (C>G, codon 594 (G>A and +261G>C polymorphisms in prostate cancer risk. Nevertheless, no significant associations between these polymorphisms and the risk of prostate cancer were observed.Results from the current meta-analysis indicate that ESR1 PvuII (C>T polymorphism may be a risk factor for prostate cancer among Asian populations, especially among Indian population; while ESR1 XbaI (A>G polymorphism may increase the risk of prostate cancer among American population.

  3. A.~()HU

    African Journals Online (AJOL)

    officer training college to improve the professional standards of ..... secret, rifts have arisen over internment policy and the Ulster ... racks life in Germany offers little compensation for this. .... Clausewitzian principle of civil-military balance, has.

  4. Genetic inactivation of the Fanconi anemia gene FANCC identified in the hepatocellular carcinoma cell line HuH-7 confers sensitivity towards DNA-interstrand crosslinking agents

    Directory of Open Access Journals (Sweden)

    Bassermann Florian

    2010-05-01

    Full Text Available Abstract Background Inactivation of the Fanconi anemia (FA pathway through defects in one of 13 FA genes occurs at low frequency in various solid cancer entities among the general population. As FA pathway inactivation confers a distinct hypersensitivity towards DNA interstrand-crosslinking (ICL-agents, FA defects represent rational targets for individualized therapeutic strategies. Except for pancreatic cancer, however, the prevalence of FA defects in gastrointestinal (GI tumors has not yet been systematically explored. Results A panel of GI cancer cell lines was screened for FA pathway inactivation applying FANCD2 monoubiquitination and FANCD2/RAD51 nuclear focus formation and a newly identified FA pathway-deficient cell line was functionally characterized. The hepatocellular carcinoma (HCC line HuH-7 was defective in FANCD2 monoubiquitination and FANCD2 nuclear focus formation but proficient in RAD51 focus formation. Gene complementation studies revealed that this proximal FA pathway inactivation was attributable to defective FANCC function in HuH-7 cells. Accordingly, a homozygous inactivating FANCC nonsense mutation (c.553C > T, p.R185X was identified in HuH-7, resulting in partial transcriptional skipping of exon 6 and leading to the classic cellular FA hypersensitivity phenotype; HuH-7 cells exhibited a strongly reduced proliferation rate and a pronounced G2 cell cycle arrest at distinctly lower concentrations of ICL-agents than a panel of non-isogenic, FA pathway-proficient HCC cell lines. Upon retroviral transduction of HuH-7 cells with FANCC cDNA, FA pathway functions were restored and ICL-hypersensitivity abrogated. Analyses of 18 surgical HCC specimens yielded no further examples for genetic or epigenetic inactivation of FANCC, FANCF, or FANCG in HCC, suggesting a low prevalence of proximal FA pathway inactivation in this tumor type. Conclusions As the majority of HCC are chemoresistant, assessment of FA pathway function in HCC could

  5. Essays on Korean online game communities: A sense of place: Media and motivation in Korea by the Wang-tta effect; Order and chaos in an ethnography of Korean online game communities

    OpenAIRE

    Chee, Florence

    2005-01-01

    Essay 1 : This paper presents an ethnographic analysis of the different ways Korean game players establish community. I look at Korean PC game rooms as "third places,", and peer relations associated with online video gaming activities. A synthesis of the Korean concept "Wang-tta" and application of the TEDA Ethos protocol provides extra insight into the motivations to excel at digital games and one of the strong drivers of such community membership. Essay 2: This paper explores the dichotomy ...

  6. Effectiveness of the HuCare Quality Improvement Strategy on health-related quality of life in patients with cancer: study protocol of a stepped-wedge cluster randomised controlled trial (HuCare2 study).

    Science.gov (United States)

    Caminiti, Caterina; Iezzi, Elisa; Passalacqua, Rodolfo

    2017-10-06

    Our group previously demonstrated the feasibility of the HuCare Quality Improvement Strategy (HQIS), aimed at integrating into practice six psychosocial interventions recommended by international guidelines. This trial will assess whether the introduction of the strategy in oncology wards improves patient's health-related quality of life (HRQoL). Multicentre, incomplete stepped-wedge cluster randomised controlled trial, conducted in three clusters of five centres each, in three equally spaced time epochs. The study also includes an initial epoch when none of the centres are exposed to the intervention, and a final epoch when all centres will have implemented the strategy. The intervention is applied at a cluster level, and assessed at an individual level with cross-sectional model. A total of 720 patients who received a cancer diagnosis in the previous 2 months and about to start medical treatment will be enrolled. The primary aim is to evaluate the effectiveness of the HQIS versus standard care in terms of improvement of at least one of two domains (emotional and social functions) of HRQoL using the EORTC QLQ-C30 (European Organisation for Research and Treatment of Cancer Quality of Life Questionnaire-Core 30 items) questionnaire, at baseline and at 3 months. This outcome was chosen because patients with cancer generally exhibit low HRQoL, particularly at certain stages of care, and because it allows to assess the strategy's impact as perceived by patients themselves. The HQIS comprises three phases: (1) clinician training-to improve communication-relational skills and instruct on the project; (2) centre support-four on-site visits by experts of the project team, aimed to boost motivation, help with context analysis and identification of solutions; (3) implementation of Evidence-Based Medicine (EBM) recommendations at the centre. Ethics committee review approval has been obtained from the Ethics Committee of Parma. Results will be disseminated at conferences, and

  7. A mathematical view for ordinary differential equation models. Comment on ;Epigenetic game theory: How to compute the epigenetic control of maternal-to-zygotic transition; by Qian Wang et al.

    Science.gov (United States)

    Fu, Guifang

    2017-03-01

    Qian Wang et al. have written an interesting article to propose a modeling framework named epiGame in this issue of Physics of Life Reviews [1]. The epiGame framework models how the methylation state of paternal and maternal genomes regulates the embryogenesis as an ecological system in which two highly distinct and specialized gametes coordinate through either cooperation or competition, or both, to maximize the fitness of embryos. Qian Wang et al. also provide solid simulation studies and real data analysis to validate the correctness of their epiGame framework. The importance of embryo development and fertility mechanism cannot be overemphasized, hence, I think that the present review by Qian Wang et al. will stand as a useful modeling guide for practicing biologists or researchers in fertility health to quantify how sperms and oocytes interact through epigenetic process to determine embryo development. In addition, it will serve as a source of many important references to work in the reproductive biology field.

  8. Response to Commentary on Cheng, Broome, Feng, and Hu (2017) Leadership behaviours play a significant role in implementing evidence-based practice. Journal of Clinical Nursing, 2018;27:e1684-e1685.

    Science.gov (United States)

    Cheng, Lei; Feng, Sheng; Hu, Yan; Broome, Marion E

    2018-06-12

    Thank you for the opportunity to respond to Hu and Gifford's comments(Hu & Gifford, 2018). We appreciated their acknowledgement of our findings about the factors influencing the successful implementation of evidence-based practice (EBP). The authors described leadership behaviors as having a significant role in implementing evidence-based practice. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.

  9. Phase I trial of anti-GD2 monoclonal antibody hu3F8 plus GM-CSF: Impact of body weight, immunogenicity and anti-GD2 response on pharmacokinetics and survival.

    Science.gov (United States)

    Cheung, Irene Y; Kushner, Brian H; Modak, Shakeel; Basu, Ellen M; Roberts, Stephen S; Cheung, Nai-Kong V

    2017-01-01

    Fifty-seven stage 4 patients with refractory/relapsed neuroblastoma were enrolled in a phase I trial (Clinicaltrials.gov NCT01757626) using humanized anti-GD2 monoclonal antibody hu3F8 in combination with granulocyte-macrophage colony-stimulating factor. The influence of body weight and human anti-human antibody (HAHA) on the pharmacokinetics (PK) of hu3F8, and the effect of de novo anti-GD2 response on patient outcome were explored. Serum samples before hu3F8 infusion, and serially up to day 12 during treatment cycle #1, and at 5 min after each hu3F8 infusion for all subsequent cycles were collected. PK was analyzed using non-compartmental modeling. Immunogenicity was assayed by HAHA response, and vaccination effect by induced host anti-GD2 response measured periodically until disease progression or last followup. Progression-free and overall survival was estimated by the Kaplan-Meier method. Despite dosing being based on body weight, smaller patients had consistently lower area-under-the-curve and faster clearance over the 15 dose levels (0.9 to 9.6 mg/kg per treatment cycle) in this trial. Positive HAHA, defined by the upper limit of normal, when measured within 10 days from the last hu3F8 dose received, was associated with significantly lower serum hu3F8. Despite prior sensitization to other anti-GD2 antibody, e.g. mouse 3F8 or ch14.18, 75% of the patients never developed HAHA response even after getting more treatment cycles. Hu3F8 induced a de novo anti-GD2 response in patients, which was prognostic of progression-free survival. We conclude that hu3F8 had low immunogenicity. During treatment, positive HAHA and low body weight affected PK adversely, whereas induced anti-GD2 response was an outcome predictor.

  10. Visualization of Moderator Circulation with 1/8 scaled HU-KINS for Calandria Tank of CANDU6

    International Nuclear Information System (INIS)

    Cho, Dae Kun; Kim, Nam Seok; Lee, Jae Young; Kim, Man Woong

    2005-01-01

    The moderator cooling capability of Calandria tank is important during the hypothetical incident of CANDU reactor. Even though the loss of ECCS cooling, the heat of the nuclear fuel can be cooled by the heat transfer path through the contacting location between the pressure tube and Calandria tube. The moderator cooling system removes the heat from the fuel so it pays an ultimate heat sink for the nuclear safety. Therefore, the understanding and estimating the thermal hydraulic conditions of the circulating moderator in the Calandria is of importance. However, the three dimensional nature and complexity of the Calandria tubes make it difficult to analyze. Recent progress in the the three dimensional computational fluid dynamics including the model of turbulent flow stimulate the studies on this subject. For the design or safety analysis purpose, the mesh generation and furnishing proper physical models are imperative and the experimental validation should be performed. However, the experimental facilities have been constructed in the scaled way by the Canadian research groups, AECL and COG. Two facilities: SPEL (1/10 scale by Koroyannaski, 1983) and STERN (1/4 scale by Hadaller, 1990) have been producing experimental data such as the local temperatures and velocities. Several papers has been published to report their CFD codes can be available for the CANDU analysis by comparing the calculations with the experimental results of those facilities. However, as noted by Lee et al. the previous experimental facilities were not scaled properly both in the sense of the force balance between buoyancy force and the jet inertia force. Also, the power density of the moderator was not scaled properly. Therefore, it cannot be said that the observations through SPEL and STERN may have a certain discrepancy from the real CANDU-6 plant. Lee et al (2003) developed the scaling laws for the CANDU-6 and design a 1/8 scale experimental facility named as HU-KINS. In the present paper

  11. Studies on the structures of the Tm, Sj, M1, Can, Sext and Hu blood group antigens.

    Science.gov (United States)

    Dahr, W; Knuppertz, G; Beyreuther, K; Moulds, J J; Moulds, M; Wilkinson, S; Capon, C; Fournet, B; Issitt, P D

    1991-08-01

    The Glycophorins (GPs = sialoglycoproteins) in erythrocyte membranes from various Black individuals, some of which exhibit the M1, Can, Sj, Tm, Sext and/or Hu antigens, and several Caucasian donors, including pooled fetal red cells, were studied. Using agglutination inhibition assays with GP fractions, GP fragments and chemically modified GPs as well as trypsin treatment of intact red cells, the antigens defined by anti-M1, anti-M+M1, anti-Can and anti-Tm sera were found to be located on the N-terminal tryptic peptide (T2, residues 1-31) of the major GP (GP A = MN sialoglycoprotein). Evidence was obtained that the N-terminal amino-acid residue, NeuNAc and/or (a) different sugar residue(s) are involved in the antigens. Amino-acid sequence and composition analyses excluded an amino-acid exchange within the N-terminal region (residues 1-31) of GP A. Carbohydrate analyses revealed the attachment of GlcNAc residues (up to about five, dependent on the strength of the above-mentioned antigens) to O-glycosidically linked oligosaccharides within the N-terminal portion (residues 1-31) of GP A. As judged from the carbohydrate compositions of peptides, the alteration of the O-glycosidic oligosaccharides is associated with a slight increase of the Gal and Fuc contents and a slight decrease of the NeuNAc level. Analyses of small, secondary cyanogen bromide and V8 proteinase peptides from the N-terminal region of GP A from Blacks, Caucasians and Caucasian fetal cells suggest that the variable attachment of small quantities of GlcNAc (about 0.03 to about 0.2 residues per peptide molecule) accounts, at least in part, for the polymorphisms detected by anti-Can and the original anti-Tm (serum Sheerin). Remarkably, the GlcNAc-containing O-glycosidic oligosaccharides occur only in small quantities, or not all at, within the positions 32-61 of GP A and the glycosylated domains of GP B and GP C.(ABSTRACT TRUNCATED AT 400 WORDS)

  12. Topological phase transition in the two-dimensional anisotropic Heisenberg model: A study using the Replica Exchange Wang-Landau sampling

    Science.gov (United States)

    Figueiredo, T. P.; Rocha, J. C. S.; Costa, B. V.

    2017-12-01

    Although the topological Berezinskii-Kosterlitz-Thouless transition was for the first time described by 40 years ago, it is still a matter of discussion. It has been used to explain several experiments in the most diverse physical systems. In contrast with the ordinary continuous phase transitions the BKT-transition does not break any symmetry. However, in some contexts it can easily be confused with other continuous transitions, in general due to an insufficient data analysis. The two-dimensional XY (or sometimes called planar rotator) spin model is the fruit fly model describing the BKT transition. As demonstrated by Bramwell and Holdsworth (1993) the finite-size effects are more important in two-dimensions than in others due to the logarithmic system size dependence of the properties of the system. Closely related is the anisotropic two dimensional Heisenberg model (AH). Although they have the same Hamiltonian the spin variable in the former has only two degrees of freedom while the AH has three. Many works treat the AH model as undergoing a transition in the same universality class as the XY model. However, its characterization as being in the BKT class of universality deserve some investigation. This paper has two goals. First, we describe an analytical evidence showing that the AH model is in the BKT class of universality. Second, we make an extensive simulation, using the numerical Replica Exchange Wang-Landau method that corroborate our analytical calculations. From our simulation we obtain the BKT transition temperature as TBKT = 0 . 6980(10) by monitoring the susceptibility, the two point correlation function and the helicity modulus. We discuss the misuse of the fourth order Binder's cumulant to locate the transition temperature. The specific heat is shown to have a non-critical behavior as expected in the BKT transition. An analysis of the two point correlation function at low temperature, C(r) ∝r - η(T), shows that the exponent, η, is consistent

  13. A biblioterapia na humanização da assistência hospitalar do Hospital Universitário da Universidade Federal de Santa Catarina – HU/UFSC/Bibliotherapy for the hospital care humanization in the university hospital of Santa Catarina Federal University – HU/UFSC

    Directory of Open Access Journals (Sweden)

    Eva Seitz

    2008-01-01

    Full Text Available Este artigo tem por finalidade apresentar resultados do estudo realizado com pacientes, acompanhantes e funcionários das Unidades de Internação Cirúrgica do Hospital Universitário da Universidade Federal de Santa Catarina (UIC/HU/UFSC. O foco central foi o de verificar até que ponto a prática biblioterapêutica e as atividades de lazer contribuem no processo de Humanização da Assistência Hospitalar dos pacientes internados nas (UIC/HU/UFSC, na percepção dos pacientes, acompanhantes, funcionários da enfermagem e assistentes sociais da referida unidade de internação. Foram entrevistados 16 pacientes, 11 acompanhantes e 13 funcionários da enfermagem e assistentes sociais. As atividades de lazer analisadas neste estudo foram a prática biblioterapêutica, as atividades do grupo Reaja e a dança. Trata-se de uma pesquisa quantitativa e qualitativa. Quanto ao procedimento técnico, a presente pesquisa é classificada como estudo de caso, no qual, utilizou-se, para a coleta dos dados a entrevista estruturada e, cujos resultados demonstram que as atividades contribuem muito na Humanização da Assistência Hospitalar dos pacientes internados na UIC/HU/UFSC. This article has for purpose to present resulted of the study carried through with patients, companions and employees of the Units of Surgical Internment of the University Hospital of the Federal University of Santa Catarina (UIC/HU/UFSC. The central focus was to verify until point the practical library-therapy and the activities of leisure contribute in the process of Humanization of the Hospital Assistance of the patients interned in (UIC/HU/UFSC, in the perception of the patients, companions, employees of the nursing and social assistants of the related unit of internment. 16 patients, 11 companions and 13 social employees of the nursing and assistants had been interviewed. The analyzed activities of leisure in this study had been the practical library-therapy, the activities of

  14. Biodegradation of Chlorpyrifos and Its Hydrolysis Product 3,5,6-Trichloro-2-Pyridinol by a New Fungal Strain Cladosporium cladosporioides Hu-01

    Science.gov (United States)

    Peng, Chuyan; Liu, Hongmei; Hu, Meiying; Zhong, Guohua

    2012-01-01

    Intensive use of chlorpyrifos has resulted in its ubiquitous presence as a contaminant in surface streams and soils. It is thus critically essential to develop bioremediation methods to degrade and eliminate this pollutant from environments. We present here that a new fungal strain Hu-01 with high chlorpyrifos-degradation activity was isolated and identified as Cladosporium cladosporioides based on the morphology and 5.8S rDNA gene analysis. Strain Hu-01 utilized 50 mg·L−1 of chlorpyrifos as the sole carbon of source, and tolerated high concentration of chlorpyrifos up to 500 mg·L−1. The optimum degradation conditions were determined to be 26.8°C and pH 6.5 based on the response surface methodology (RSM). Under these conditions, strain Hu-01 completely metabolized the supplemented chlorpyrifos (50 mg·L−1) within 5 d. During the biodegradation process, transient accumulation of 3,5,6-trichloro-2-pyridinol (TCP) was observed. However, this intermediate product did not accumulate in the medium and disappeared quickly. No persistent accumulative metabolite was detected by gas chromatopraphy-mass spectrometry (GC-MS) analysis at the end of experiment. Furthermore, degradation kinetics of chlorpyrifos and TCP followed the first-order model. Compared to the non-inoculated controls, the half-lives (t 1/2) of chlorpyrifos and TCP significantly reduced by 688.0 and 986.9 h with the inoculum, respectively. The isolate harbors the metabolic pathway for the complete detoxification of chlorpyrifos and its hydrolysis product TCP, thus suggesting the fungus may be a promising candidate for bioremediation of chlorpyrifos-contaminated water, soil or crop. PMID:23056611

  15. Biodegradation of chlorpyrifos and its hydrolysis product 3,5,6-trichloro-2-pyridinol by a new fungal strain Cladosporium cladosporioides Hu-01.

    Directory of Open Access Journals (Sweden)

    Shaohua Chen

    Full Text Available Intensive use of chlorpyrifos has resulted in its ubiquitous presence as a contaminant in surface streams and soils. It is thus critically essential to develop bioremediation methods to degrade and eliminate this pollutant from environments. We present here that a new fungal strain Hu-01 with high chlorpyrifos-degradation activity was isolated and identified as Cladosporium cladosporioides based on the morphology and 5.8S rDNA gene analysis. Strain Hu-01 utilized 50 mg·L(-1 of chlorpyrifos as the sole carbon of source, and tolerated high concentration of chlorpyrifos up to 500 mg·L(-1. The optimum degradation conditions were determined to be 26.8°C and pH 6.5 based on the response surface methodology (RSM. Under these conditions, strain Hu-01 completely metabolized the supplemented chlorpyrifos (50 mg·L(-1 within 5 d. During the biodegradation process, transient accumulation of 3,5,6-trichloro-2-pyridinol (TCP was observed. However, this intermediate product did not accumulate in the medium and disappeared quickly. No persistent accumulative metabolite was detected by gas chromatopraphy-mass spectrometry (GC-MS analysis at the end of experiment. Furthermore, degradation kinetics of chlorpyrifos and TCP followed the first-order model. Compared to the non-inoculated controls, the half-lives (t(1/2 of chlorpyrifos and TCP significantly reduced by 688.0 and 986.9 h with the inoculum, respectively. The isolate harbors the metabolic pathway for the complete detoxification of chlorpyrifos and its hydrolysis product TCP, thus suggesting the fungus may be a promising candidate for bioremediation of chlorpyrifos-contaminated water, soil or crop.

  16. Estrategia de desarrollo de capacidades y el empoderamiento de mujeres en riesgo de violencia familiar grave. Distrito de Ambo; Huánuco-2017.

    OpenAIRE

    Fernández Picón, Clara

    2017-01-01

    El objetivo del estudio fue demostrar que la estrategia de desarrollo de capacidades tiene efecto en el empoderamiento de las mujeres con riesgo de violencia familiar grave, del distrito de Ambo; Huánuco, en el 2017. El estudio fue de enfoque cuantitativo, de tipo cuasi experimental, longitudinal (pre y pos-test), analítico, prospectivo y con grupo experimental y control; con 48 mujeres seleccionadas aleatoriamente. Al grupo experimental se le aplicó la estrategia de desarrollo de capacidades...

  17. Tafonomia del yacimiento de vertebrados pleistoceno de Huéscar-1 (Granada, españa

    Directory of Open Access Journals (Sweden)

    Alberdi, M. T.

    2003-08-01

    Full Text Available This work analyses the sedimentary and taphonomic processes that induced the selective preservation and spatial distribution of Húescar-1 bone assemblage (early Galerian. The bone fossil remains are associated with an alluvial fan system that flowed into a lacustrine area with calcareous sedimentation. The fossils show numerous scratch and abrasion marks produced during their transportation as channel lag. The remains appear in three sedimentological settings: in paleochannel filling-up sequences, in pockets built at the outlet of the channels in the lacustrine area, and scattered within calcareous silts. Nevertheless, most of them are found in the second instante. The cumulative process was attritional as pointed out by the mortality profiles of Equus altidens and could be explained by selective predation and/or seasonal bone accumulation. The notably small number of artiodactyl species, particularly in the typical foms of bush or forest habitats and the presence of amphibious forms (Hippopotamus are indicative of an open grassland habitat. The aquatic birds represent the autochthonous component of the association. For each bone recovered severa1 variables were measured, the data obtained underwent graphic and statistical treatment that provided useful information for the site taphonomic interpretation.Se estudia el conjunto de procesos sedimentarios y rasgos tafonómicos que condicionaron la preservación selectiva y disposición espacial de los restos de vertebrados que forman el yacimiento de edad Galeriense inferior de Huéscar-l. Los restos óseos están asociados a un sistema de abanicos aluviales que desembocaba en una zona lacustre carbonatada amplia. Es un conjunto transportado donde los restos muestran numerosas señales de abrasión y arrastre. Los restos óseos aparecen en tres situaciones sedimentológicas: carga de fondo en el relleno de los paleocanales, bolsadas formadas en el punto de la desembocadura y dispersos espor

  18. Autophagy Stimulus Promotes Early HuR Protein Activation and p62/SQSTM1 Protein Synthesis in ARPE-19 Cells by Triggering Erk1/2, p38MAPK, and JNK Kinase Pathways

    Directory of Open Access Journals (Sweden)

    Nicoletta Marchesi

    2018-01-01

    Full Text Available RNA-binding protein dysregulation and altered expression of proteins involved in the autophagy/proteasome pathway play a role in many neurodegenerative disease onset/progression, including age-related macular degeneration (AMD. HuR/ELAVL1 is a master regulator of gene expression in human physiopathology. In ARPE-19 cells exposed to the proteasomal inhibitor MG132, HuR positively affects at posttranscriptional level p62 expression, a stress response gene involved in protein aggregate clearance with a role in AMD. Here, we studied the early effects of the proautophagy AICAR + MG132 cotreatment on the HuR-p62 pathway. We treated ARPE-19 cells with Erk1/2, AMPK, p38MAPK, PKC, and JNK kinase inhibitors in the presence of AICAR + MG132 and evaluated HuR localization/phosphorylation and p62 expression. Two-hour AICAR + MG132 induces both HuR cytoplasmic translocation and threonine phosphorylation via the Erk1/2 pathway. In these conditions, p62 mRNA is loaded on polysomes and its translation in de novo protein is favored. Additionally, for the first time, we report that JNK can phosphorylate HuR, however, without modulating its localization. Our study supports HuR’s role as an upstream regulator of p62 expression in ARPE-19 cells, helps to understand better the early events in response to a proautophagy stimulus, and suggests that modulation of the autophagy-regulating kinases as potential therapeutic targets for AMD may be relevant.

  19. A phase 1b study of humanized KS-interleukin-2 (huKS-IL2) immunocytokine with cyclophosphamide in patients with EpCAM-positive advanced solid tumors

    International Nuclear Information System (INIS)

    Connor, Joseph P; Henslee-Downey, Jean; Kramer, Daniel; Neugebauer, Roland; Stupp, Roger; Cristea, Mihaela C; Lewis, Nancy L; Lewis, Lionel D; Komarnitsky, Philip B; Mattiacci, Maria R; Felder, Mildred; Stewart, Sarah; Harter, Josephine

    2013-01-01

    Humanized KS-interleukin-2 (huKS-IL2), an immunocytokine with specificity for epithelial cell adhesion molecule (EpCAM), has demonstrated favorable tolerability and immunologic activity as a single agent. Phase 1b study in patients with EpCAM-positive advanced solid tumors to determine the maximum tolerated dose (MTD) and safety profile of huKS-IL2 in combination with low-dose cyclophosphamide. Treatment consisted of cyclophosphamide (300 mg/m 2 on day 1), and escalating doses of huKS-IL2 (0.5–4.0 mg/m 2 IV continuous infusion over 4 hours) on days 2, 3, and 4 of each 21-day cycle. Safety, pharmacokinetic profile, immunogenicity, anti-tumor and biologic activity were evaluated. Twenty-seven patients were treated for up to 6 cycles; 26 were evaluable for response. The MTD of huKS-IL2 in combination with 300 mg/m 2 cyclophosphamide was 3.0 mg/m 2 . At higher doses, myelosuppression was dose-limiting. Transient lymphopenia was the most common grade 3/4 adverse event (AE). Other significant AEs included hypotension, hypophosphatemia, and increase in serum creatinine. All patients recovered from these AEs. The huKS-IL2 exposure was dose-dependent, but not dose-proportional, accumulation was negligible, and elimination half-life and systemic clearance were independent of dose and time. Most patients had a transient immune response to huKS-IL2. Immunologic activity was observed at all doses. Ten patients (38%) had stable disease as best response, lasting for ≥ 4 cycles in 3 patients. The combination of huKS-IL2 with low-dose cyclophosphamide was well tolerated. Although no objective responses were observed, the combination showed evidence of immunologic activity and 3 patients showed stable disease for ≥ 4 cycles.

  20. Epigenetic information in gametes: Gaming from before fertilization. Comment on ;Epigenetic game theory: How to compute the epigenetic control of maternal-to-zygotic transition; by Qian Wang et al.

    Science.gov (United States)

    Shi, Junchao; Zhang, Xudong; Liu, Ying; Chen, Qi

    2017-03-01

    In their interesting article [1] Wang et al. proposed a mathematical model based on evolutionary game theory [2] to tackle the fundamental question in embryo development, that how sperm and egg interact with each other, through epigenetic processes, to form a zygote and direct successful embryo development. This work is based on the premise that epigenetic reprogramming (referring to the erasure and reconstruction of epigenetic marks, such as DNA methylation and histone modifications) after fertilization might be of paramount importance to maintain the normal development of embryos, a premise we fully agree, given the compelling experimental evidence reported [3]. Wang et al. have specifically chosen to employ the well-studied DNA methylation reprogramming process during mammalian early embryo development, as a basis to develop their mathematical model, namely epigenetic game theory (epiGame). They concluded that the DNA methylation pattern in mammalian early embryo could be formulated and quantified, and their model can be further used to quantify the interactions, such as competition and/or cooperation of expressed genes that maximize the fitness of embryos. The efforts by Wang et al. in quantitatively and systematically analyzing the beginning of life apparently hold value and represent a novel direction for future embryo development research from both theoretical and experimental biologists. On the other hand, we see their theory still at its infancy, because there are plenty more parameters to consider and there are spaces for debates, such as the cases of haploid embryo development [4]. Here, we briefly comment on the dynamic process of epigenetic reprogramming that goes beyond DNA methylation, a dynamic interplay that involves histone modifications, non-coding RNAs, transposable elements et al., as well as the potential input of the various types of 'hereditary' epigenetic information in the gametes - a game that has started before the fertilization.

  1. Protective effects of fermented honeybush (Cyclopia intermedia) extract (HU-018) against skin aging: a randomized, double-blinded, placebo-controlled study.

    Science.gov (United States)

    Choi, Sun Young; Hong, Ji Yeon; Ko, Eun Jung; Kim, Beom Joon; Hong, Sung-Woon; Lim, Mi Hyoung; Yeon, Sung Hum; Son, Rak Ho

    2018-02-01

    Oxidative stress and photodamage resulting from ultraviolet radiation exposure play key roles in skin aging. Fermented Cyclopia intermedia, which is used to brew honeybush tea, exerts antioxidant and anti-wrinkle effects by inhibiting reactive oxygen species production and downregulating matrix metalloproteinase activity. This randomized, double-blinded, placebo-controlled study aimed to evaluate the efficacy and safety of fermented honeybush (Cyclopia intermedia) extract (HU-018) for skin rejuvenation. 120 Korean subjects with crow's feet wrinkles were randomized to receive either low-dose extract (400 mg/day), high-dose extract (800 mg/day), or placebo (negative control, only dextran) for 12 weeks. Wrinkles were evaluated using JANUS ® and PRIMO pico ® . Skin elasticity, hydration and transepidermal water loss were measured. Global skin wrinkle grade was significantly improved in both low-dose and high-dose groups compared to placebo group, as well as for skin hydration and elasticity. Both the low- and high-dose groups showed significantly decreased TEWL compared to the placebo group. There were no adverse effects during the entire study period. Our data indicate that HU-018 is effective for improving skin wrinkles, elasticity, and hydration. Therefore, daily supplementation with fermented honeybush could be helpful for protecting against skin aging.

  2. Using game theory to investigate the epigenetic control mechanisms of embryo development: Comment on: "Epigenetic game theory: How to compute the epigenetic control of maternal-to-zygotic transition" by Qian Wang et al.

    Science.gov (United States)

    Zhang, Le; Zhang, Shaoxiang

    2017-03-01

    A body of research [1-7] has already shown that epigenetic reprogramming plays a critical role in maintaining the normal development of embryos. However, the mechanistic quantitation of the epigenetic interactions between sperms and oocytes and the related impact on embryo development are still not clear [6,7]. In this study, Wang et al., [8] develop a modeling framework that addresses this question by integrating game theory and the latest discoveries of the epigenetic control of embryo development. Copyright © 2017 Elsevier B.V. All rights reserved.

  3. From the Ethnic History of Asia – the Dōnghú, Wūhuán and Xiānbēi Proto-Mongolian Tribes

    Directory of Open Access Journals (Sweden)

    Nenad Vidaković

    2012-04-01

    Full Text Available The aim of this paper is to present the history of the Dōnghú, Wūhuán and Xiānbēi Proto-Mongolian tribes in the period from the 4th century B.C. to the end of the 3rd century A.D. The history of the ancient nomadic peoples who lived north of China is written in Chinese dynasty chronicles. Proto-Mongolian tribes from the 1st century B.C. are called Dōnghú in Chinese sources. The earliest news on them originates from the Warring States Period (4th – 3rd century B.C., and tells of a conflict with the northern Chinese states. Other types of sources on the history of the Proto-Mongolian tribes are archaeological findings, which associate Mongolian ethnogenesis with slab grave cultures and the Lower Xiàjiādiàn. Linguists find the materials for the research on Mongolian ethnogenesis in the Altaic linguistic family, which the Mongolian language belongs to as well. Based on the mentioned sources, the change in the political situation in the steppes at the end of the 3rd century B.C., when the people of Xiōngnú created a powerful state and conquered the Dōnghúes, is described in the paper. The remains of the shattered Dōnghúes, who had mostly migrated to the north, have been recorded in Chinese chronicles under new topoethnonyms: Xiānbēi and Wūhuán. The weakening and fall of the Xiōngnúes’ state enabled the Proto-Mongolian tribes to re-enter the historical scene. At the end of the 1st century B.C. the Chinese Hàn Empire firstly established relations with the Wūhuán tribes and in the middle of the 1st century A.D. with the Xiānbēi tribes, too. In the beginning both tribal alliances acknowledged the supreme authority of China and carried out frontier service. Under the guidance of tribal chiefs the tribes started to run an independent policy and attack China’s border areas during the 2nd century A.D. In the conclusion, the author describes the period when the Wūhuán and Xiānbēi tribes were at the peak of their power

  4. Tai An's Famous and Aristocratic Official Families in Korean---New Research on Wang Yiwen Family Adherent to the End of Ming Dynasty%流寓韩国的泰安名臣世家--明末遗民王以文族系新考

    Institute of Scientific and Technical Information of China (English)

    周郢

    2016-01-01

    韩国历史上著名之“九义士”,乃指明清之际随同朝鲜质子入境的九位明朝士人。其中之王以文,传系明臣王楫孙。王楫为明泰安州人,故里即今岱岳区范镇大王庄。范镇王氏所藏道光钞本《王氏族谱》中,不少内容堪与韩国史料相印证。两者在王楫及其先世的记述基本一致,而王楫之后则存在较大差异。入朝王氏系出于泰安范镇王氏家族洵无疑义,但王以文是否为王楫之孙,仍有进一步查证之余地。%The famous "nine righteous men" in Korean history was the nine scholars who had been ac-companying Korean hostage back to Korean at the end of Ming Dynasty. Wang Yiwen, the grandson of Wang Ji, the Ming minister who was from Da Wang Village of Fan County in Tai An. The book Wangs Pedigree of a Clan formed in Dao Guang of Qing Dynasty contained the same contents with Korean historical materials. Wang Ji and his ancestors' documents are generally the same, and his offspring's are different. So it is con-firmed that Wangs in Korea are from Tai An, but Wang Yiwen's origin should give further investigation.

  5. Nivel de aceptabilidad del vino de tumbo serrano (passiflora mollisima), elaborado con los parámetros tecnológicos óptimos, en la ciudad de Huánuco 2015

    OpenAIRE

    Ríos García, Geaninne

    2017-01-01

    La investigación se desarrolló en la ciudad de Huánuco que por su ubicación geográfica, produce una gran variedad de frutas, entre ellas el tumbo serrano, esta fruta no es aprovechada por los pobladores. El objetivo del presente estudio es determinar el nivel de aceptabilidad en la ciudad de Huánuco, Amarilis y Pillco Marca del vino de tumbo serrano (Passiflora mollissima L.), elaborado con los parámetros tecnológicos óptimos. La investigación se desarrolló en tres etapas la primera con...

  6. Priming with r-metHuSCF and filgrastim or chemotherapy and filgrastim in patients with malignant lymphomas: a randomized phase II pilot study of mobilization and engraftment

    DEFF Research Database (Denmark)

    Johnsen, Hanne; Geisler, C; Juvonen, E

    2011-01-01

    methionyl human G-CSF (filgrastim, r-metHuG-CSF) (experimental arm A) or routine chemotherapy plus filgrastim (conventional arm B). The primary objective was to evaluate the side effects and toxicity during priming and mobilization. The secondary objectives were efficacy by the level of blood......-circulating PBPCs, the number of harvest days and the time to three-lineage engraftment after autografting. First, during priming 5 patients had 8 serious events, 4 in each arm. A summary of all adverse events revealed 30 (94%) patients suffering from 132 events of all grading. Second, neutropenia...... and thrombocytopenia was documented in arm B. Third, 9/14 (64%) patients in arm A reached the target of 5 million CD34(+) cells/kg body weight (bw) compared with 13/15 (87%) in arm B. The results represent the first randomized trial of growth factor plus chemotherapy priming and indicate that a formal phase III trial...

  7. A dual model HU conversion from MRI intensity values within and outside of bone segment for MRI-based radiotherapy treatment planning of prostate cancer

    Energy Technology Data Exchange (ETDEWEB)

    Korhonen, Juha, E-mail: juha.p.korhonen@hus.fi [Clinical Research Institute Helsinki University Central Hospital Ltd., POB-700, 00029 HUS, Finland and Department of Oncology, Helsinki University Central Hospital, POB-180, 00029 HUS (Finland); Kapanen, Mika [Clinical Research Institute Helsinki University Central Hospital Ltd., POB-700, 00029 HUS (Finland); Department of Oncology, Helsinki University Central Hospital, POB-180, 00029 HUS (Finland); Department of Medical Physics, Tampere University Hospital, POB-2000, 33521 Tampere (Finland); Keyriläinen, Jani; Seppälä, Tiina; Tenhunen, Mikko [Department of Oncology, Helsinki University Central Hospital, POB-180, 00029 HUS (Finland)

    2014-01-15

    Purpose: The lack of electron density information in magnetic resonance images (MRI) poses a major challenge for MRI-based radiotherapy treatment planning (RTP). In this study the authors convert MRI intensity values into Hounsfield units (HUs) in the male pelvis and thus enable accurate MRI-based RTP for prostate cancer patients with varying tissue anatomy and body fat contents. Methods: T{sub 1}/T{sub 2}*-weighted MRI intensity values and standard computed tomography (CT) image HUs in the male pelvis were analyzed using image data of 10 prostate cancer patients. The collected data were utilized to generate a dual model HU conversion technique from MRI intensity values of the single image set separately within and outside of contoured pelvic bones. Within the bone segment local MRI intensity values were converted to HUs by applying a second-order polynomial model. This model was tuned for each patient by two patient-specific adjustments: MR signal normalization to correct shifts in absolute intensity level and application of a cutoff value to accurately represent low density bony tissue HUs. For soft tissues, such as fat and muscle, located outside of the bone contours, a threshold-based segmentation method without requirements for any patient-specific adjustments was introduced to convert MRI intensity values into HUs. The dual model HU conversion technique was implemented by constructing pseudo-CT images for 10 other prostate cancer patients. The feasibility of these images for RTP was evaluated by comparing HUs in the generated pseudo-CT images with those in standard CT images, and by determining deviations in MRI-based dose distributions compared to those in CT images with 7-field intensity modulated radiation therapy (IMRT) with the anisotropic analytical algorithm and 360° volumetric-modulated arc therapy (VMAT) with the Voxel Monte Carlo algorithm. Results: The average HU differences between the constructed pseudo-CT images and standard CT images of each

  8. Effect of Age on Energy Requirement for Maintenance and Growth of Dorper and Hu Crossbred F1 Ewes Weighing 20 to 50 kg

    Science.gov (United States)

    Nie, H. T.; Wan, Y. J.; You, J. H.; Wang, Z. Y.; Lan, S.; Fan, Y. X.; Wang, F.

    2015-01-01

    This research aimed to define the energy requirement of Dorper and Hu Hybrid F1 ewes 20 to 50 kg of body weight, furthermore to study energy requirement changes with age and evaluate the effect of age on energy requirement parameters. In comparative slaughter trial, thirty animals were divided into three dry matter intake treatments (ad libitum, n = 18; low restricted, n = 6; high restricted, n = 6), and were all slaughtered as baseline, intermediate, and final slaughter groups, to calculate body chemical components and energy retained. In digestibility trial, twelve ewes were housed in individual metabolic cages and randomly assigned to three feeding treatments in accordance with the design of a comparative slaughter trial, to evaluate dietary energetic values at different feed intake levels. The combined data indicated that, with increasing age, the net energy requirement for maintenance (NEm) decreased from 260.62±13.21 to 250.61±11.79 kJ/kg0.75 of shrunk body weight (SBW)/d, and metabolizable energy requirement for maintenance (MEm) decreased from 401.99±20.31 to 371.23±17.47 kJ/kg0.75 of SBW/d. Partial efficiency of ME utilization for maintenance (km, 0.65 vs 0.68) and growth (kg, 0.42 vs 0.41) did not differ (p>0.05) due to age; At the similar condition of average daily gain, net energy requirements for growth (NEg) and metabolizable energy requirements for growth (MEg) for ewes during late fattening period were 23% and 25% greater than corresponding values of ewes during early fattening period. In conclusion, the effect of age upon energy requirement parameters in the present study were similar in tendency with previous recommendations, values of energy requirement for growth (NEg and MEg) for Dorper and Hu crossbred female lambs ranged between the NRC (2007) recommendation for early and later maturating growing sheep. PMID:26104522

  9. Analysis of the kinetic of expression of tristetraprolin and HuR by rheumatoid arthritis patients pheripheral blood mononuclear cells stimulated with lipopolysaccharide

    Directory of Open Access Journals (Sweden)

    G. Ferraccioli

    2011-09-01

    Full Text Available Objective. Given the role of TNF-α in Rheumatoid Arthritis (RA we decided to define the characteristics of the TNF- α synthesis by peripheral blood mononuclear cells (PBMNCs obtained from active-aggressive RA patients giving a particular attention to the modulation of the expression of two fundamental proteins in TNF-α mRNA stability regulation, Tristetraprolin (TTP and HuR. Methods. 11 RA patients with active disease were enrolled in the study before their entry in 2 double blind protocols: Infliximab versus MTX and Etanercept versus MTX. 9 healthy blood donors were taken as controls. PBMNCs obtained by Ficoll centrifugation and plastic adherence were stimulated with lipopolysaccharide (LPS and TNF-α was measured in the supernatant during 8 hours by ELISA. At each time point the cells were harvested and analysed for TNF- α, TTP and HuR mRNA expression by semi-quantitative PCR. Results. MNCs TNF-α secretion after LPS stimulation did not differ significantly between RA and control subjects, even if a tendency towards a more prompt response was observed in the patients. More importantly only the DMARDs responsive patients (DAS <3.7 at the 6th month, with a minimal reduction of 1.2 points disclosed precociously (at the first month a significant change in the profile of TNF-α secretion and maintained it until the 6th month. The “normalization” of the synthetic behaviour was accompanied by the resetting in the regulation of the expression of the TTP, that appeared significantly different in the patients before and after therapy. Conclusions. Independently from the type of therapy, responsive patients demonstrate a rapid change in the cellular biology at the systemic level that might drive the resolution of the phlogistic process at the synovial level.

  10. SU-F-J-193: Efficient Dose Extinction Method for Water Equivalent Path Length (WEPL) of Real Tissue Samples for Validation of CT HU to Stopping Power Conversion

    International Nuclear Information System (INIS)

    Zhang, R; Baer, E; Jee, K; Sharp, G; Flanz, J; Lu, H

    2016-01-01

    Purpose: For proton therapy, an accurate model of CT HU to relative stopping power (RSP) conversion is essential. In current practice, validation of these models relies solely on measurements of tissue substitutes with standard compositions. Validation based on real tissue samples would be much more direct and can address variations between patients. This study intends to develop an efficient and accurate system based on the concept of dose extinction to measure WEPL and retrieve RSP in biological tissue in large number of types. Methods: A broad AP proton beam delivering a spread out Bragg peak (SOBP) is used to irradiate the samples with a Matrixx detector positioned immediately below. A water tank was placed on top of the samples, with the water level controllable in sub-millimeter by a remotely controlled dosing pump. While gradually lowering the water level with beam on, the transmission dose was recorded at 1 frame/sec. The WEPL were determined as the difference between the known beam range of the delivered SOBP (80%) and the water level corresponding to 80% of measured dose profiles in time. A Gammex 467 phantom was used to test the system and various types of biological tissue was measured. Results: RSP for all Gammex inserts, expect the one made with lung-450 material (<2% error), were determined within ±0.5% error. Depends on the WEPL of investigated phantom, a measurement takes around 10 min, which can be accelerated by a faster pump. Conclusion: Based on the concept of dose extinction, a system was explored to measure WEPL efficiently and accurately for a large number of samples. This allows the validation of CT HU to stopping power conversions based on large number of samples and real tissues. It also allows the assessment of beam uncertainties due to variations over patients, which issue has never been sufficiently studied before.

  11. SU-F-J-193: Efficient Dose Extinction Method for Water Equivalent Path Length (WEPL) of Real Tissue Samples for Validation of CT HU to Stopping Power Conversion

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, R; Baer, E; Jee, K; Sharp, G; Flanz, J; Lu, H [Massachusetts General Hospital and Harvard Medical School, Boston, MA (United States)

    2016-06-15

    Purpose: For proton therapy, an accurate model of CT HU to relative stopping power (RSP) conversion is essential. In current practice, validation of these models relies solely on measurements of tissue substitutes with standard compositions. Validation based on real tissue samples would be much more direct and can address variations between patients. This study intends to develop an efficient and accurate system based on the concept of dose extinction to measure WEPL and retrieve RSP in biological tissue in large number of types. Methods: A broad AP proton beam delivering a spread out Bragg peak (SOBP) is used to irradiate the samples with a Matrixx detector positioned immediately below. A water tank was placed on top of the samples, with the water level controllable in sub-millimeter by a remotely controlled dosing pump. While gradually lowering the water level with beam on, the transmission dose was recorded at 1 frame/sec. The WEPL were determined as the difference between the known beam range of the delivered SOBP (80%) and the water level corresponding to 80% of measured dose profiles in time. A Gammex 467 phantom was used to test the system and various types of biological tissue was measured. Results: RSP for all Gammex inserts, expect the one made with lung-450 material (<2% error), were determined within ±0.5% error. Depends on the WEPL of investigated phantom, a measurement takes around 10 min, which can be accelerated by a faster pump. Conclusion: Based on the concept of dose extinction, a system was explored to measure WEPL efficiently and accurately for a large number of samples. This allows the validation of CT HU to stopping power conversions based on large number of samples and real tissues. It also allows the assessment of beam uncertainties due to variations over patients, which issue has never been sufficiently studied before.

  12. The stress-induced heat shock protein 70.3 expression is regulated by a dual-component mechanism involving alternative polyadenylation and HuR.

    Science.gov (United States)

    Kraynik, Stephen M; Gabanic, Andrew; Anthony, Sarah R; Kelley, Melissa; Paulding, Waltke R; Roessler, Anne; McGuinness, Michael; Tranter, Michael

    2015-06-01

    Heat shock protein 70.3 (Hsp70.3) expression increases in response to cellular stress and plays a cytoprotective role. We have previously shown that Hsp70.3 expression is controlled through coordinated post-transcriptional regulation by miRNAs and alternative polyadenylation (APA), and APA-mediated shortening of the Hsp70.3 3'-UTR facilitates increased protein expression. A stress-induced increase in Hsp70.3 mRNA and protein expression is accompanied by alternative polyadenylation (APA)-mediated truncation of the 3'UTR of the Hsp70.3 mRNA transcript. However, the role that APA plays in stress-induced expression of Hsp70.3 remains unclear. Our results show that APA-mediated truncation of the Hsp70.3 3'UTR increases protein expression through enhanced polyribosome loading. Additionally, we demonstrate that the RNA binding protein HuR, which has been previously shown to play a role in mediating APA, is necessary for heat shock mediated increase in Hsp70.3 mRNA and protein. However, it is somewhat surprising to note that HuR does not play a role in APA of the Hsp70.3 mRNA, and these two regulatory events appear to be mutually exclusive regulators of Hsp70.3 expression. These results not only provide important insight to the regulation of stress response genes following heat shock, but also contribute an enhanced understanding of how alternative polyadenylation contributes to gene regulation. Copyright © 2015 Elsevier B.V. All rights reserved.

  13. 古今文献中与“尪痹”相关的病证名研究%A Study on the Disorders Relevant with“ Wang Bi”in the Ancient and Modern Literatures

    Institute of Scientific and Technical Information of China (English)

    孟小燕; 王育林

    2016-01-01

    Differentiation of disease and differentiation of syndrome are equally important in the di-agnosis and treatment of TCM. Disease is the entire process of some abnormal life state and syndrome is a cer-tain stage in the abnormal process in the life. The terms of disease and syndrome are related with each other. In the study of the ancient and modern literatures on the term Wang Bi(尪痹),it was found that the term for syndrome was also involved. Wang Bi(尪痹)is the new term of a disease proposed by TCM master,Jiao Shude. By investigating the name and origin of the disease,Wan Bi was identified as the term of syndrome. The connection of Wang Bi(尪痹)and Wan Bi was attempted to build so as to contribute to the correct un-derstanding of the disease and construction of medical history in TCM.%中医诊治强调辨病与辨证并重,中医学探讨某病时兼及“病”“证”。疾病指人体某种异常生命状态的全过程,而证候是这个全部生命异常过程中的某个阶段。病证名即与病、证发生发展相关的称谓。在考察古今文献中与“尪痹”相关称谓时,发现还有证名的存在,因此为客观全面,该文使用了“病证名”而非“病名”的概念。“尪痹”是已故中医学家焦树德提出的新病名,考察古今文献中与“尪痹”相关的称谓,可以发现还有证名的存在。对这些病证的名实与源流进行考察,考证“尪痹”之源,辨析病证名“顽痹”。力图呈现与“尪痹”相关病证名的大致面貌,以利于准确把握这一疾病,俾于中医疾病史的建构。

  14. MiR-146b-5p overexpression attenuates stemness and radioresistance of glioma stem cells by targeting HuR/lincRNA-p21/β-catenin pathway

    Science.gov (United States)

    Yang, Wei; Yu, Hongquan; Shen, Yueming; Liu, Yingying; Yang, Zhanshan; Sun, Ting

    2016-01-01

    A stem-like subpopulation existed in GBM cells, called glioma stem cells (GSCs), might contribute to cancer invasion, angiogenesis, immune evasion, and therapeutic resistance, providing a rationale to eliminate GSCs population and their supporting niche for successful GBM treatment. LincRNA-p21, a novel regulator of cell proliferation, apoptosis and DNA damage response, is found to be downregulated in several types of tumor. However, little is known about the role of lincRNA-p21 in stemness and radioresistance of GSCs and its regulating mechanisms. In this study, we found that lincRNA-p21 negatively regulated the expression and activity of β-catenin in GSCs. Downregulation of lincRNA-p21 in GSCs was resulted from upregulation of Hu antigen R (HuR) expression caused by miR-146b-5p downregulation. MiR-146b-5p overexpression increased apoptosis and radiosensitivity, decreased cell viability, neurosphere formation capacity and stem cell marker expression, and induced differentiation in GSCs. Moreover, knock-down lincRNA-p21 or HuR and β-catenin overexpression could rescue the phenotypic changes resulted from miR-146b-5p overexpression in GSCs. These findings suggest that targeting the miR-146b-5p/HuR/lincRNA-p21/β-catenin signaling pathway may be valuable therapeutic strategies against glioma. PMID:27166258

  15. Changes in the sense of agency during hypnosis: The Hungarian version of the Sense of Agency Rating Scale (SOARS-HU) and its relationship with phenomenological aspects of consciousness.

    Science.gov (United States)

    Költő, András; Polito, Vince

    2017-03-01

    Changes in the sense of agency are defining feature of hypnosis. The Sense of Agency Rating Scale (SOARS) is a 10-item questionnaire, administered after a hypnosis session to assess alteration in the sense of agency. In the present study, a Hungarian version of the measure (SOARS-HU) is presented. The SOARS-HU and the Phenomenology of Consciousness Inventory (PCI) were administered to 197 subjects following hypnotizability screening with the Harvard Group Scale of Hypnotic Susceptibility Scale, Form A (HGSHS:A). Confirmatory factor analysis and correlations with hypnotizability demonstrate the reliability and validity of the SOARS-HU. Changes in the Involuntariness and Effortlessness subscales of the SOARS-HU were associated with alterations in subjective conscious experience, as measured by the PCI. These changes in subjective experience remained significant after controlling for HGSHS:A scores. These results indicate that changes in the sense of agency during hypnosis are associated with alterations of consciousness that are independent of hypnotizability. Copyright © 2017 Elsevier Inc. All rights reserved.

  16. Phase I/II clinical and pharmacokinetic study evaluating a fully human monoclonal antibody against EGFr (HuMax-EGFr) in patients with advanced squamous cell carcinoma of the head and neck

    DEFF Research Database (Denmark)

    Bastholt, Lars; Specht, Lena; Jensen, Kenneth

    2007-01-01

    PURPOSE: To assess safety, tolerability, pharmacokinetics and clinical activity of HuMax-EGFr in patients with SCCHN. PATIENTS AND METHODS: Twenty-eight patients with SCCHN were enrolled. The study comprised a single-dose escalation part for assessment of safety issues followed by a repeat dose e...

  17. Yan Sun, Corruption and Market in Contemporary China, Ithaca (N.Y.), Cornell University Press, 2004 et Ning Wang, Making a Market Economy. The Institutional Transformation of a Freshwater Fishery in a Chinese Community, Londres et New York, Routledge, 200

    OpenAIRE

    Guiheux, Gilles

    2008-01-01

    Ces deux ouvrages éclairent les conditions dans lesquelles, au cours des 25 dernières années, l’économie de commande a été démantelée et remplacée progressivement par un système de marché. Yan Sun, professeur de sciences politiques, s’intéresse à la corruption dans une double perspective macro et micro. Ning Wang, économiste néo-institutionnaliste, se demande comment, à la faveur des réformes, une région (Jingzhou, au sud du Hubei) s’est convertie à la pisciculture. La corruption est une ques...

  18. Research Upregulation of CD23 (FcεRII Expression in Human Airway Smooth Muscle Cells (huASMC in Response to IL-4, GM-CSF, and IL-4/GM-CSF

    Directory of Open Access Journals (Sweden)

    Lew D Betty

    2005-05-01

    Full Text Available Abstract Background Airway smooth muscle cells play a key role in remodeling that contributes to airway hyperreactivity. Airway smooth muscle remodeling includes hypertrophy and hyperplasia. It has been previously shown that the expression of CD23 on ASMC in rabbits can be induced by the IgE component of the atopic serum. We examined if other components of atopic serum are capable of inducing CD23 expression independent of IgE. Methods Serum starved huASMC were stimulated with either IL-4, GM-CSF, IL-13, IL-5, PGD2, LTD4, tryptase or a combination of IL-4, IL-5, IL-13 each with GM-CSF for a period of 24 h. CD23 expression was analyzed by flow cytometry, western blot, and indirect immunofluorescence. Results The CD23 protein expression was upregulated in huASMC in response to IL-4, GM-CSF, and IL-4/GM-CSF. The percentage of cells with increased fluorescence intensity above the control was 25.1 ± 4.2% (IL-4, 15.6 ± 2.7% (GM-CSF and 32.9 ± 13.9% (IL-4/GMCSF combination(n = 3. The protein content of IL-4/GMCSF stimulated cells was significantly elevated. Expression of CD23 in response to IL-4, GM-CSF, IL-4/GM-CSF was accompanied by changes in cell morphology including depolymerization of isoactin fibers, cell spreading, and membrane ruffling. Western blot revealed abundant expression of the IL-4Rα and a low level expression of IL-2Rγc in huASMC. Stimulation with IL-4 resulted in the phosphorylation of STAT-6 and an increase in the expression of the IL-2Rγc. Conclusion CD23 on huASMC is upregulated by IL-4, GM-CSF, and IL-4/GM-CSF. The expression of CD23 is accompanied by an increase in cell volume and an increase in protein content per cell, suggesting hypertrophy. Upregulation of CD23 by IL-4/GM-CSF results in phenotypic changes in huASMC that could play a role in cell migration or a change in the synthetic function of the cells. Upregulation of CD23 in huASMC by IL-4 and GM-CSF can contribute to changes in huASMC and may provide an avenue

  19. The influence of royal jelly and human interferon-alpha (HuIFN-αN3) on proliferation, glutathione level and lipid peroxidation in human colorectal adenocarcinoma cells in vitro.

    Science.gov (United States)

    Filipič, Bratko; Gradišnik, Lidija; Rihar, Klemen; Šooš, Eugen; Pereyra, Adriana; Potokar, Jana

    2015-12-01

    Among royal jelly's (RJ) various biological activities, its possible antitumour activity deserves particular attention. The purpose of this study was to investigate the influence of RJ, its bioactive component 10-hydroxy-2-decenoic acid (10- HDA), and human interferon-alpha (HuIFN-αN3) on the proliferation of human colorectal adenocarcinoma cells (CaCo- 2), and ascertain their effect on intracellular glutathione (GSH) level and lipid peroxidation. We studied the antiproliferative (AP) activity of RJ [(0.1 g/10 mL phosphate buffer saline (PBS)], HuIFN-αN3 (1000 I.U. mL⁻¹), 10-HDA at 100.0 μmol L⁻¹, and their different combinations, in the ratio 1:1, 1:2, and 2:1 on CaCo-2 cells. The GSH level was measured by glutathione assay. The lipid peroxidation was measured by malondialdehyde (MDA) assay. Single RJ had a low AP activity: 2.0 (0.5 mg mL⁻¹). HuIFN-αN3 had an AP activity of 2.5 (208.33 I.U. mL⁻¹), while 10-HDA had an AP activity of 1.5 (37.5 μmol mL⁻¹). The highest AP activity of 3.8 was obtained when RJ and HuIFN-αN3 were applied at the ratio 2:1. In that combination the level of GSH was 24.9±2.4 nmol g⁻³ of proteins (vs. 70.2±3.2 nmol g⁻³ in the control) and the level of MDA was 72.3±3.1 nmol g⁻³ (vs. 23.6±9.1 nmol g⁻³ in the control). It is generally assumed that 10-HDA, an important constituent of RJ, together with HuIFN-αN3, is responsible for the inhibition of CaCo-2 cells proliferation in vitro. In our study, however, RJ and HuIFN-αN3 applied at 2:1 decreased the level of GSH the most and significantly increased lipid peroxidation via MDA in CaCo-2 cells. Future studies should show whether these GSH- and MDA-related activities of RJ, HuIFN-αN3, 10-HDA, and their combinations may decrease the tumorigenicity index and tumorigenic potential of various tumour cells in vitro.

  20. Glycosylphosphatidylinositol-Anchored Anti-HIV scFv Efficiently Protects CD4 T Cells from HIV-1 Infection and Deletion in hu-PBL Mice

    Science.gov (United States)

    Ye, Chaobaihui; Wang, Weiming; Cheng, Liang; Li, Guangming; Wen, Michael; Wang, Qi; Zhang, Qing; Li, Dan

    2016-01-01

    ABSTRACT Despite success in viral inhibition and CD4 T cell recovery by highly active antiretroviral treatment (HAART), HIV-1 is still not curable due to the persistence of the HIV-1 reservoir during treatment. One patient with acute myeloid leukemia who received allogeneic hematopoietic stem cell transplantation from a homozygous CCR5 Δ32 donor has had no detectable viremia for 9 years after HAART cessation. This case has inspired a field of HIV-1 cure research focusing on engineering HIV-1 resistance in permissive cells. Here, we employed a glycosylphosphatidylinositol (GPI)-scFv X5 approach to confer resistance of human primary CD4 T cells to HIV-1. We showed that primary CD4 T cells expressing GPI-scFv X5 were resistant to CCR5 (R5)-, CXCR4 (X4)-, and dual-tropic HIV-1 and had a survival advantage compared to control cells ex vivo. In a hu-PBL mouse study, GPI-scFv X5-transduced CD4 T cells were selected in peripheral blood and lymphoid tissues upon HIV-1 infection. Finally, GPI-scFv X5-transduced CD4 T cells, after being cotransfused with HIV-infected cells, showed significantly reduced viral loads and viral RNA copy numbers relative to CD4 cells in hu-PBL mice compared to mice with GPI-scFv AB65-transduced CD4 T cells. We conclude that GPI-scFv X5-modified CD4 T cells could potentially be used as a genetic intervention against both R5- and X4-tropic HIV-1 infections. IMPORTANCE Blocking of HIV-1 entry is one of most promising approaches for therapy. Genetic disruption of the HIV-1 coreceptor CCR5 by nucleases in T cells is under 2 clinical trials and leads to reduced viremia in patients. However, the emergence of viruses using the CXCR4 coreceptor is a concern for therapies applying single-coreceptor disruption. Here, we report that HIV-1-permissive CD4 T cells engineered with GPI-scFv X5 are resistant to R5-, X4-, or dual-tropic virus infection ex vivo. In a preclinical study using hu-PBL mice, we show that CD4 T cells were protected and that GPI-scFv X5

  1. Los orígenes del Colegio Menor de la Concepción de Huérfanos de Salamanca

    Directory of Open Access Journals (Sweden)

    Miguel A. MARTÍN SÁNCHEZ

    2009-12-01

    Full Text Available RESUMEN: El Colegio Menor de la Concepción de Huérfanos de la Universidad de Salamanca es uno más de la gran cantidad de colegios que se fundaron al amparo del estudio salmantino en el siglo XVI. Fundado por Francisco de Solís, obispo de Bagnorea y secretario de Paulo III, durante tres siglos facilitó y proporcionó amparo y educación a multitud de estudiantes pobres que no tenían recursos para ello. Fundado en la primera mitad del siglo XVI, durante esta centuria se asentó y comenzó su andadura, que terminaría en el siglo XIX. Este trabajo realiza un análisis sobre los primeros años de vida del Colegio, analizando cuestiones tan importantes como su fundación, las bulas fundacionales, el fundador, las primeras constituciones o la matrícula durante el siglo XVI, entre otras. Fue el siglo XVI el siglo de su nacimiento y consolidación, realizando durante esta centuria un gran esfuerzo institucional, como demuestra el hecho de la elaboración de las primeras constituciones, la construcción del edificio, o la incorporación a la Universidad de Salamanca, por ejemplo. A lo largo de estas páginas realizaremos un recorrido por los orígenes del primer colegio universitario que se crea para el amparo de niños pobres y huérfanos, permitiéndoles estudiar desde la gramática hasta graduarse en la ciencia que mejor les pareciere. La obra social y educativa del Colegio permitió la progresión y ascenso social de multitud de estudiantes pobres y huérfanos con talento, que de otra forma nunca hubieran podido realizar estudios en la Universidad, puesto que carecían de recursos para ello.ABSTRACT: The Conception of Orphans Minor College of the University of Salamanca is one more of the great quantity of colleges that were founded under protection of Salamancan Study in the 16th century. It was founded by Francisco de Solís, bishop of Bagnorea and secretary of Paulo III, provided protection and education to many poor students without

  2. Internação domiciliar: o perfil dos pacientes assistidos pelo Programa HU em Casa Home care: profile of patients attended by a home care program

    Directory of Open Access Journals (Sweden)

    Daniella Reis Barbosa Martelli

    2011-01-01

    Full Text Available Internação domiciliar é uma modalidade de atendimento à saúde que está se transformando em uma alternativa importante para minimizar alguns dos principais problemas inerentes aos sistemas de saúde vigentes, especialmente os da rede pública. O objetivo do estudo foi descrever o perfil sociodemográfico e clínico da população assistida pelo Programa de Internação Domiciliar (PID HU em Casa do Hospital Universitário Clemente de Faria da Universidade Estadual de Montes Claros. O estudo foi descritivo e retrospectivo por meio da análise de prontuários, realizada de maio de 2005 a maio de 2008. Foram analisados 137 pacientes, sendo 75 do gênero feminino (54,7% e 62 do masculino (45,3%. O grupo de 61 a 80 anos foi mais prevalente (37,2% e 73% dos pacientes residiam em bairros periféricos do município de Montes Claros-MG. Dos agravos mais comuns na primeira internação, a pneumonia foi prevalente, 22 casos (16,1%. A maioria dos pacientes foi encaminhada ao PID pela clinica médica (84,7%, com intervalo de maior prevalência de duas a três internações (42,4%. Do total de pacientes, 120 (87,6% permaneceram internados por 16 a 30 dias e 51,8% não necessitaram passar novamente pelo PID para uma segunda internação. Com relação à resolutividade clínica, 130 (94,9% tiveram alta clínica, no PID, na primeira internação. O PID mostrou-se ser um programa de alta resolutividade, atendendo mais ao público idoso feminino, de baixa renda e com períodos de internação relativamente curtos.The home care is a modality of health care which is becoming an important alternative to minimize some of mainly relevant problems of world health, especially the public health network. This paper aimed to describe the socio-demographic and clinical population assisted by the Home Care Program HU em Casa, of the University Hospital Clemente de Faria, Universidade Estadual de Montes Claros. It is a descriptive and retrospective study analyzing

  3. La masacre de Ambo: Histoire d'une revolte paysanne, département de Huánuco, Pérou, 1962-1963

    Directory of Open Access Journals (Sweden)

    2004-01-01

    Full Text Available À travers l’histoire de la révolte de la communauté de Huaylla y Aclacancha (vallée d’Ambo, département de Huánuco il est possible de comprendre comment s’organisent les paysans comuneros pour défendre leurs terres communautaires. L’analyse des requêtes paysannes envoyées aux autorités gouvernementales dévoile l’importance pour la communauté de faire valoir la légitimité de ses droits de propriété, en s’appuyant à la fois sur des actions légales et sur des occupations de terre. Cependant l’utilisation simultanée de ces moyens de revendication n’explique pas en soi le dérapage vers la violence, connu dans la presse comme la masacre de Ambo (la tuerie d’Ambo. Seule une étude des contextes dans lesquels interagissent tous les acteurs concernés (comuneros, syndicalistes, autorités politiques, policiers et hacendados peut permettre de saisir pourquoi les réclamations de cette communauté ont débouché sur la mort de comuneros. A través la historia de la lucha de la comunidad de Huaylla y Aclacancha (provincia de Ambo, departamento de Huánuco se puede comprender cómo se organizan los comuneros para defender sus tierras comunales. El análisis de las solicitudes enviadas por los comuneros a las autoridades gubernamentales nos muestra la importancia, para la comunidad, de hacer valer tanto la legitimidad de sus derechos de propiedad como, al mismo tiempo, apoyarse sobre acciones legales y ocupaciones de tierras. La utilización simultánea de esos medios de reivindicación no explica en sí el deslizamiento violento, conocido en la prensa como la masacre de Ambo. Pero sí, el análisis de los contextos en los cuales interactuan todos los actores de ese drama (comuneros, sindicalistas, autoridades políticas, gardias civiles y hacendados nos permite comprender por qué las reclamaciones de esta comunidad desembocan en la muerte de comuneros. Through a history of the community’s rebellion (Huaylla y Aclacancha, in

  4. La estrategia diplomática-militar de España reflejada en la correspondencia extraoficial del Duque de Huéscar entre 1747 y 1748

    Directory of Open Access Journals (Sweden)

    Naiara Pavía Dopazo

    2014-02-01

    Full Text Available En este artículo se pretende contribuir al conocimiento de los sucesos bélicos acaecidos en Génovadurante la primavera de 1747, a través del intercambio de correspondencia inédita entre algunos delos principales aliados españoles de esta república, capitaneados por Carvajal y Ensenada que encontraronen don Fernando de Silva, duque de Huéscar (luego de Alba, el mejor enlace para la conformaciónde una red social que permitiera un conocimiento extraoficial que mejorara la capacidad deactuación a favor de los intereses de España en dicha república. Un análisis interpersonal de un hechohistórico que pone de manifiesto la «tensa relación» diplomática entre Francia y España, unidas porel Pacto de Familia de 1743 y que determinó las estrategias diplomáticas llevadas por ambos durantelas negociaciones de la paz de Aquisgrán, que puso fin a la Guerra de Sucesión Austriaca.With this article we’re trying to contribute to the knowledge of the warlike events occurred in Genoaduring the spring of 1747, through the exchange of unknown correspondence among some of theprincipal Spanish allies of this republic, led by Carvajal and Ensenada who found in don Fernando ofSilva, Duke of Huéscar (later Duke of Alba, the best link for the conformation of a social network thatallowed an unofficial knowledge in order to improve the capacity of action in favour of the interestsof Spain in the above mentioned republic. An interpersonal analysis of a historical fact that revealsthe diplomatic «tense relationship” between France and Spain, joined by the Family agreement of 1743and that was decisive for the diplomatic strategies accomplished by both of them during thenegotiations of the Peace of Aachen (Aix-la-Chapelle, which came to an end with the War of theAustrian Succession.

  5. Factores asociados a la infección por Ehrlichia canis en perros infestados con garrapatas en la ciudad de Huánuco, Perú

    Directory of Open Access Journals (Sweden)

    Edward Huerto-Medina

    Full Text Available El objetivo del estudio fue determinar la frecuencia y factores asociados a la infección por Ehrlichia canis en perros. Se recolectaron muestras de sangre de 150 perros infestados con garrapatas en 10 consultorios veterinarios de la ciudad de Huánuco en Perú, los perros fueron seleccionados al azar sin distinción de raza, edad ni sexo. Se detectó anticuerpos contra Ehrlichia canis mediante inmunoensayo cromatográfico. El 51,3% de perros estuvieron infectados por Ehrlichia canis. En el análisis multivariado se encontraron asociados a la presencia Ehrlichia canis, el mal estado de salud del perro (p=0,049, un promedio mayor de infestación por garrapatas (p=0,018, perros de edad adulta (p=0,038. La frecuencia de Ehrlichia canis en perros de esta ciudad es alta. Se recomienda el control de la garrapata marrón del perro (Rhipicephalus sanguineus vector de la Ehrlichia canis

  6. Serum metabonomics study of anti-depressive effect of Xiao-Chai-Hu-Tang on rat model of chronic unpredictable mild stress.

    Science.gov (United States)

    Xiong, Zhili; Yang, Jie; Huang, Yue; Zhang, Kuo; Bo, Yunhai; Lu, Xiumei; Su, Guangyue; Ma, Jie; Yang, Jingyu; Zhao, Longshan; Wu, Chunfu

    2016-09-01

    Xiao-Chai-Hu-Tang (XCHT) has been proven to be effective for the clinical treatment of depression. However, the mechanisms of definite antidepressant-like effects and detailed metabolic biomarkers were still unclear in this prior study. Here, we have investigated the metabolic profiles and potential biomarkers in a chronic unpredictable mild stress model after treatment with XCHT. Metabonomics based on ultra-high performance liquid chromatography coupled with mass spectrometry was used to profile the metabolic fingerprints of serum obtained from a rat model with chronic unpredictable mild stress with and without XCHT treatment. The model rats showed a significant decrease in sucrose preference and food consumption, and these depression-like symptoms were significantly improved by XCHT. Through principal component analysis (PCA), nine potential biomarkers of tryptophan, uric acid, phenylalanine, cholic acid and lysophosphatidylcholine (C18:0 LPC, C16:0 LPC, C16:1 LPC, C18:1 LPC, C20:4 LPC) were characterized as potential biomarkers involved the pathogenesis of depression. The therapeutic effect of XCHT on depression may involve in amino acid metabolism, lipid metabolism, oxidative stress and inflammation response. The present investigation highlights that metabonomics is a valuable tool for studying the essence of depression as well as evaluating the efficacy of the corresponding drug treatment. Copyright © 2016 Elsevier B.V. All rights reserved.

  7. Contents of the heavy metals nickel and lead in leaves of Paulownia elongata S.Y. Hu and Paulownia fortunei Hems. in Serbia

    Directory of Open Access Journals (Sweden)

    Stanković Dragica

    2009-01-01

    Full Text Available A comparative study was carried out on the capabilities of the two species Paulownia elongata S. Y. Hu and Paulownia fortunei Hems. as biomonitors of atmospheric (and soil heavy-metal pollution. Research on content of the heavy metals nickel (Ni and lead (Pb in leaves of the species Paulownia elongata growing under urban and suburban conditions with the comparison to the concentration of these elements in leaves of the species Paulownia elongata and Paulownia fortunei on an experimental plot in Bela Crkva showed average nickel concentrations of 2.7 μg/g on the experimental plot in Bela Crkva, Serbia, twice as low as the concentrations measured under extreme urban conditions (6.62 μg/g, or 4.54 μg/g in the immediate vicinity of suburban traffic lines. Inasmuch as Paulownia elongata endures urban conditions well, it can be recommended for cultivation in parks, tree alleys, and wind-protection zones along urban and regional traffic lines.

  8. Assessment of in vitro cyto/genotoxicity of sequentially treated electroplating effluent on the human hepatocarcinoma HuH-7 cell line.

    Science.gov (United States)

    Naik, Umesh Chandra; Das, Mihir Tanay; Sauran, Swati; Thakur, Indu Shekhar

    2014-03-01

    The present study compares in vitro toxicity of electroplating effluent after the batch treatment process with that obtained after the sequential treatment process. Activated charcoal prepared from sugarcane bagasse through chemical carbonization, and tolerant indigenous bacteria, Bacillus sp. strain IST105, were used individually and sequentially for the treatment of electroplating effluent. The sequential treatment involving activated charcoal followed by bacterial treatment removed 99% of Cr(VI) compared with the batch processes, which removed 40% (charcoal) and 75% (bacteria), respectively. Post-treatment in vitro cyto/genotoxicity was evaluated by the MTT test and the comet assay in human HuH-7 hepatocarcinoma cells. The sequentially treated sample showed an increase in LC50 value with a 6-fold decrease in comet-assay DNA migration compared with that of untreated samples. A significant decrease in DNA migration and an increase in LC50 value of treated effluent proved the higher effectiveness of the sequential treatment process over the individual batch processes. Copyright © 2014 Elsevier B.V. All rights reserved.

  9. SupT1 Cell Infusion as a Possible Cell-Based Therapy for HIV: Results from a Pilot Study in Hu-PBMC BRGS Mice

    Directory of Open Access Journals (Sweden)

    Jonathan Fior

    2016-04-01

    Full Text Available In a previous in vitro study, the SupT1 cell line was explored as a decoy target for HIV-1, proposing SupT1 cell infusion as a possible cell-based therapy for HIV. In the present work, the previous in vitro model was translated into an in vivo setting. Specifically, Hu-PBMC BRGS mice were infected with a high input of HIV-1 LAI (100,000 TCID50, and 40 million 30 Gy-irradiated SupT1 cells were infused weekly for 4 weeks as a therapy. Blood samples were taken to monitor CD4+ T cell count and viral load, and mice were monitored daily for signs of illness. At the earliest time point analyzed (Week 1, there was a significantly lower plasma viral load (~10-fold in all animals treated with SupT1 cell infusion, associated with a higher CD4+ T cell count. At later time points, infection proceeded with robust viral replication and evident CD4+ T cell depletion, except in one mouse that showed complete suppression of viral replication and preservation of CD4+ T cell count. No morbidity or mortality was associated with SupT1 cell infusion. The interesting tendencies observed in the generated data suggest that this approach should be further investigated as a possible cell-based HIV therapy.

  10. Hu-Lu-Ba-Wan Attenuates Diabetic Nephropathy in Type 2 Diabetic Rats through PKC-α/NADPH Oxidase Signaling Pathway

    Directory of Open Access Journals (Sweden)

    Lishan Zhou

    2013-01-01

    Full Text Available Hu-Lu-Ba-Wan (HLBW is a Chinese herbal prescription used to treat kidney deficiency. The aim of this study was to explore the effect and mechanism of HLBW on diabetic nephropathy (DN in type 2 diabetic rats. The rat model of DN was established by being fed a high-fat diet and intravenous injection of streptozotocin. Then, HLBW decoction was administered for 16 weeks. Blood glucose level, lipid profile, renal function, 24-hour total urinary protein, and albumin content were examined. Renal morphology and superoxide anion levels were evaluated. The activity of nicotinamide-adenine dinucleotide phosphate (NADPH and protein kinase C-alpha (PKC-α related genes expression in renal tissue were also determined. Our data demonstrated that HLBW significantly improved hyperglycemia, hyperlipidemia, and proteinuria in diabetic rats compared with those of control group. HLBW also alleviated glomerular expansion and fibrosis, extracellular matrix accumulation and effacement of the foot processes. Additionally, HLBW reduced superoxide anion level, NADPH oxidase activity, the protein and mRNA expressions of p47phox, and the protein expression of phosphorylated PKC-α in renal tissue. These results suggest that HLBW is effective in the treatment of DN in rats. The underlying mechanism may be related to the attenuation of renal oxidative stress via PKC-α/NADPH oxidase signaling pathway.

  11. A Pilot Trial of Humanized Anti-GD2 Monoclonal Antibody (hu14.18K322A) with Chemotherapy and Natural Killer Cells in Children with Recurrent/Refractory Neuroblastoma.

    Science.gov (United States)

    Federico, Sara M; McCarville, M Beth; Shulkin, Barry L; Sondel, Paul M; Hank, Jacquelyn A; Hutson, Paul; Meagher, Michael; Shafer, Aaron; Ng, Catherine Y; Leung, Wing; Janssen, William E; Wu, Jianrong; Mao, Shenghua; Brennan, Rachel C; Santana, Victor M; Pappo, Alberto S; Furman, Wayne L

    2017-11-01

    Purpose: Anti-GD2 mAbs, acting via antibody-dependent cell-mediated cytotoxicity, may enhance the effects of chemotherapy. This pilot trial investigated a fixed dose of a unique anti-GD2 mAb, hu14.18K322A, combined with chemotherapy, cytokines, and haploidentical natural killer (NK) cells. Experimental Design: Children with recurrent/refractory neuroblastoma received up to six courses of hu14.18K322A (40 mg/m 2 /dose, days 2-5), GM-CSF, and IL2 with chemotherapy: cyclophosphamide/topotecan (courses 1,2), irinotecan/temozolomide (courses 3,4), and ifosfamide/carboplatin/etoposide (courses 5,6). Parentally derived NK cells were administered with courses 2, 4, and 6. Serum for pharmacokinetic studies of hu14.18K322A, soluble IL2 receptor alpha (sIL2Rα) levels, and human antihuman antibodies (HAHA) were obtained. Results: Thirteen heavily pretreated patients (9 with prior anti-GD2 therapy) completed 65 courses. One patient developed an unacceptable toxicity (grade 4 thrombocytopenia >35 days). Four patients discontinued treatment for adverse events (hu14.18K322A allergic reaction, viral infection, surgical death, second malignancy). Common toxicities included grade 3/4 myelosuppression (13/13 patients) and grade 1/2 pain (13/13 patients). Eleven patients received 29 NK-cell infusions. The response rate was 61.5% (4 complete responses, 1 very good partial response, 3 partial responses) and five had stable disease. The median time to progression was 274 days (range, 239-568 days); 10 of 13 patients (77%) survived 1 year. Hu14.18K322A pharmacokinetics was not affected by chemotherapy or HAHA. All patients had increased sIL2Rα levels, indicating immune activation. Conclusions: Chemotherapy plus hu14.18K322A, cytokines, and NK cells is feasible and resulted in clinically meaningful responses in patients with refractory/recurrent neuroblastoma. Further studies of this approach are warranted in patients with relapsed and newly diagnosed neuroblastoma. Clin Cancer Res; 23

  12. Mitilanotherium inexpectatum (Giraffidae, Mammalia from Huélago (Lower Pleistocene; Guadix-Baza basin, Granada, Spain - observations on a peculiar biogegraphic pattern

    Directory of Open Access Journals (Sweden)

    Morales, J.

    2011-12-01

    Full Text Available Giraffid fossils from the lowermost Pleistocene (MN17 locality Huélago (Guadix-Baza Basin, Granada, Spain are described and assigned to Mitilanotherium inexpectatum Samson & Radulesco (1966. The remains are compared to giraffid material from the Pliocene and younger. The known geographic distribution of this giraffid is disjunct; it is found in Spain and in an area stretching from Rumania and Greece to Tadzhikistan, but not in central Europe. The oldest record is from the Upper Pliocene (MN16 of Turkey and the youngest is from the Lower Pleistocene of Greece (with an estimated age of about 1.2 Ma. Shortly after 2.6 Ma it may have dispersed to Spain, where it may have lived as much as half a million years. The dispersal did not leave a fossil record in the area between SE Europe and Spain. The same occured with dispersals of other mammals in the Early, Middle and Late Miocene, Pliocene and Pleistocene. These species that show this pattern are interpreted to be adapted to open or arid environments. Their dispersals across Europe to Spain may have occurred during short periods of atypical environmental conditions and thus did not leave an easily detectable fossil record.Los fósiles de jirafas del Pleistoceno basal (MN 17 de la localidad de Huélago (Cuenca de Guadix- Baza, Granada, Spain son descritos y asignados a Mitilanotherium inexpectatum Samson & Radulesco (1966. Los restos fósiles son comparados con jiráfidos del Plioceno, y formas más recientes. La distribución geográfica conocida muestra que es disyunta; encontrándose en España y en un área que se extiende de Rumania y Grecia a Tadzhikistan, pero no en Europa central. El registro más antiguo procede del Plioceno Superior (MN 16 de Turquía y el más reciente del Pleistoceno inferior de Grecia (con una edad estimada de ca. 1, 2 Ma. Poco después de los 2,6 Ma la especie pudo haberse dispersado a España, donde como mucho pudo haber durado medio millón de años. Esta dispersion

  13. Efecto de una intervención educativa sobre los conocimientos de teniasis/cisticercosis en una comunidad rural de Huánuco, Perú 2005

    Directory of Open Access Journals (Sweden)

    Elsa Palacios-Flores

    2008-07-01

    Full Text Available Objetivo. Evaluar el efecto de una intervención educativa sobre los conocimientos de teniasis/cisticercosis en los pobladores de la localidad de Queropalca, Huánuco. Materiales y métodos. Se realizó un ensayo comunitario, en el cual se aplicó una estrategia educativo comunicacional sobre los factores de riesgo de teniasis/cisticercosis, consistente en metodologías participativas de visitas casa en casa y campañas de promoción en toda la jurisdicción durante seis meses (junio a diciembre del 2005. Se midió el nivel de conocimientos sobre teniasis/cisticercosis en los pobladores de 10 años a más de edad. Resultados. Se evaluaron 142 pobladores, la intervención educativa mejoró el nivel de conocimiento global sobre la teniasis/cisticercosis (p < 0,001 y sobre los factores de riesgo como la eliminación de basura al campo libre (p = 0,027, consumo de alimentos sin lavarse las manos (p = 0,043, crianza de cerdos sin corral (p < 0,001, no uso de letrinas o baños (p < 0,001, consumo de carne de cerdo sin inspección sanitaria (p < 0,001, no se modificó el nivel de conocimiento relacionado al consumo de agua no tratada (p = 0,148. Conclusiones. La aplicación de la metodología educativo comunicacional incrementó los conocimientos relacionados con las medidas higiénicas sanitarias para la prevención y control de la teniasis/cisticercosis en una población altoandina.

  14. The Diversity of REcent and Ancient huMan (DREAM): A New Microarray for Genetic Anthropology and Genealogy, Forensics, and Personalized Medicine.

    Science.gov (United States)

    Elhaik, Eran; Yusuf, Leeban; Anderson, Ainan I J; Pirooznia, Mehdi; Arnellos, Dimitrios; Vilshansky, Gregory; Ercal, Gunes; Lu, Yontao; Webster, Teresa; Baird, Michael L; Esposito, Umberto

    2017-12-01

    The human population displays wide variety in demographic history, ancestry, content of DNA derived from hominins or ancient populations, adaptation, traits, copy number variation, drug response, and more. These polymorphisms are of broad interest to population geneticists, forensics investigators, and medical professionals. Historically, much of that knowledge was gained from population survey projects. Although many commercial arrays exist for genome-wide single-nucleotide polymorphism genotyping, their design specifications are limited and they do not allow a full exploration of biodiversity. We thereby aimed to design the Diversity of REcent and Ancient huMan (DREAM)-an all-inclusive microarray that would allow both identification of known associations and exploration of standing questions in genetic anthropology, forensics, and personalized medicine. DREAM includes probes to interrogate ancestry informative markers obtained from over 450 human populations, over 200 ancient genomes, and 10 archaic hominins. DREAM can identify 94% and 61% of all known Y and mitochondrial haplogroups, respectively, and was vetted to avoid interrogation of clinically relevant markers. To demonstrate its capabilities, we compared its FST distributions with those of the 1000 Genomes Project and commercial arrays. Although all arrays yielded similarly shaped (inverse J) FST distributions, DREAM's autosomal and X-chromosomal distributions had the highest mean FST, attesting to its ability to discern subpopulations. DREAM performances are further illustrated in biogeographical, identical by descent, and copy number variation analyses. In summary, with approximately 800,000 markers spanning nearly 2,000 genes, DREAM is a useful tool for genetic anthropology, forensic, and personalized medicine studies. © The Author(s) 2017. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution.

  15. Humanización de la Sanidad y Salud Laboral: Implicaciones, estado de la cuestión y propuesta del Proyecto HU-CI

    Directory of Open Access Journals (Sweden)

    Macarena Gálvez Herrer

    Full Text Available Resumen La evolución científica y técnica de la atención sanitaria mantienen un desarrollo exponencial que permite cada vez una mejor asistencia a los pacientes, nuevas formas de tratamiento y crecientes índices de supervivencia. Sin embargo, estos importantes avances que enriquecen la atención a la salud, en muchas ocasiones, han ido invadiendo espacio al propio acto humano de la atención a la persona. Potenciar organizaciones más humanizadas implicará establecer acciones dirigidas al ambiente y lugar de trabajo, así como a todos los agentes implicados (pacientes, familiares y profesionales. Con dicha finalidad, las políticas de Humanización y su aplicación al contexto sanitario son una realidad en nuestros días y están concretándose en algunas propuestas específicas en determinadas organizaciones, con el apoyo de algunos organismos oficiales. En el presente trabajo, señalamos la interacción entre los objetivos de dichas políticas de humanización y las metas de la salud laboral en contextos asistenciales. Se exploran áreas comunes de trabajo dirigidas al bienestar del profesional sanitario, posibilidades de gestión integral de ambos conceptos, y se expone un ejemplo concreto como es el Proyecto de Humanización de las Unidades de Cuidados Intensivos (HU-CI.

  16. Estudio clínico epidemiológico de bartonelosis humana en el valle del Monzón, Huamalíes, Huánuco

    Directory of Open Access Journals (Sweden)

    Abelardo Tejada

    2003-12-01

    Full Text Available OBJETIVO: Estudiar los casos de bartonelosis humana en valle del Monzón y determinar las especies de Lutzomyia que podrían jugar papel en la transmisión de la enfermedad en la zona. MATERIAL Y MÉTODOS: Se estudió casos de la enfermedad de Carrión en la selva alta del valle del Monzón, provincia de Huamalíes, Huánuco, donde entre 1997 y 1998 se presentó un brote epidémico. Para el diagnóstico de los casos se realizó frotis y gota gruesa, hemocultivo y serología. Para la captura de flebotominos, se utilizó trampas de luz CDC y trampa Shannon, en ambientes intra y peridomiciliarios. RESULTADOS: A lo largo de 21 localidades, la enfermedad afectó 140 personas, 25 de ellos entre 1 y 4 años de edad, 81 mujeres y 59 hombres; 121 presentaron la fase aguda de la enfermedad, 16 la fase intercalar y 3 la fase eruptiva. La población de la zona se dedica principalmente al cultivo de la coca, café y cacao. CONCLUSIÓN: Se estableció que el valle del Monzón es nueva zona endémica de bartonelosis humana, donde la transmisión ocurre principalmente en ambientes intra y peridomiciliarios, siendo Lutzomyia serrana el vector más probable.

  17. Characterization and determination of antioxidant components in the leaves of Camellia chrysantha (Hu Tuyama based on composition–activity relationship approach

    Directory of Open Access Journals (Sweden)

    Jin-Bin Wei

    2015-03-01

    Full Text Available Camellia chrysantha (Hu Tuyama (CCT, an ornamental plant possessing antioxidant activity, has been infused as tea and drank for its health benefits. The antioxidant components in CCT, however, had not been clearly characterized. To quickly identify the antioxidant constituents of CCT, a composition–activity relationship strategy based on ultra high-pressure liquid chromatography coupled with linear ion trap hybrid orbitrap mass spectrometry and orthogonal partial least-squares method has been applied. As a result, 16 variables were found to make significant contributions to the 1,1-diphenyl-2-picrylhydrazyl radical scavenging activity. Six of them were identified as catechin (1, epicatechin (5, vitexin (8, isovitexin (10, quercetin-7-O-β-D-glucopyranoside (12 and kaempferol (16. The strength of 1,1-diphenyl-2-picrylhydrazyl radical scavenging activity was found to be 12 > 1 > 5 > 16 > 8 > 10 by validation test. Meanwhile, a liquid chromatography-electrospray ionization-mass spectrometry method was established for quantitative determination of six marker compounds in CCT samples from different preparations. The validation of the method, including linearity, sensitivity (limitation of detection and limitation of quantification, repeatability, precision, stability, and recoveries, was carried out and demonstrated to meet the requirements of quantitative analysis. This is the first report on the comprehensive characterization and determination of chemical constituents in CCT by ultra high-pressure liquid chromatography coupled with linear ion trap hybrid orbitrap mass spectrometry. The results indicate that the composition–activity relationship approach may be a useful method for the discovery of active constituents in natural plants and the quality control of medicinal herbs.

  18. Synthesis of (R)-5-(Di[2,3-3H2]propylamino)-5,6-dihydro-4H-imidazo[4,5,1-ij]quinolin-2(1H)-one-([3H]U-86170) and (R)-5-([2,3-3H2]propylamino)-5,6-dihydro-4H-imidazo(4,5,1-ij) quinolin-2(1H)-one ([3H]U-91356)

    International Nuclear Information System (INIS)

    Moon, M.W.; Hsi, R.S.P.

    1992-01-01

    (R)-5-(diallylamino)-5,6-dihydro-4H-imidazo[4,5,1-ij]quinolin-2(1H)-one (12b) was prepared in 9% overall yield from 3-aminoquinoline. Reaction of 12b in ethyl acetate with tritium gas in presence of a 5% platinum on carbon catalyst afforded a mixture of (R)-5-(di[2,3- 3 H 2 ]propylamino)-5,6-dihydro-4H-imidazo[4,5,1-ij]-quinolin-2(1H)-one ([ 3 H]U-86170, 69 Ci/mmol) and (R)-5-([2,3- 3 H 2 ]-propylamino)5,6-dihydro-4H-imidazo-[4,5,1-ij]quinolin-2(1H)-one ( [ 3 H]U-91356, 34 Ci/mmol) which was separated by preparative reverse-phase chromatography. U-86170 and U-91356 are potent dopamine D2 agonists. The labelled compounds are useful for drug disposition studies. [ 3 H]U-86170 is also useful as a dopamine D2 agonist radioligand for receptor binding studies. (author)

  19. Wang Haili, The History of Egypt

    Institute of Scientific and Technical Information of China (English)

    Han Jianwei[1

    2015-01-01

    The History of Egypt is the first monograph on Egyptian history written by a single Chinese author. As a comprehensive study both in Egyptology and in Egyptian history, it represents a new level of Egyptian historical research in Chinese academia.

  20. DONG JIE Zhang, LIANG Wang, ZHON

    Indian Academy of Sciences (India)

    User

    development, hairless nude skin, and short life (Abitbol et al., 2015; Bryson et al., 2013). On the ... Foxn1 maintains TECs to support T-cell development via mcm2 ... were ligated upstream of the firefly luciferase gene in the plasmid pGL3-Basic.

  1. Epigenetic game theory and its application in plants. Comment on: ;Epigenetic game theory: How to compute the epigenetic control of maternal-to-zygotic transition; by Qian Wang et al.

    Science.gov (United States)

    Zhang, Yuan-Ming; Zhang, Yinghao; Guo, Mingyue

    2017-03-01

    Wang's et al. article [1] is the first to integrate game theory (especially evolutionary game theory) with epigenetic modification of zygotic genomes. They described and assessed a modeling framework based on evolutionary game theory to quantify, how sperms and oocytes interact through epigenetic processes, to determine embryo development. They also studied the internal mechanisms for normal embryo development: 1) evolutionary interactions between DNA methylation of the paternal and maternal genomes, and 2) the application of game theory to formulate and quantify how different genes compete or cooperate to regulate embryogenesis through methylation. Although it is not very comprehensive and profound regarding game theory modeling, this article bridges the gap between evolutionary game theory and the epigenetic control of embryo development by powerful ordinary differential equations (ODEs). The epiGame framework includes four aspects: 1) characterizing how epigenetic game theory works by the strategy matrix, in which the pattern and relative magnitude of the methylation effects on embryogenesis, are described by the cooperation and competition mechanisms, 2) quantifying the game that the direction and degree of P-M interactions over embryo development can be explained by the sign and magnitude of interaction parameters in model (2), 3) modeling epigenetic interactions within the morula, especially for two coupled nonlinear ODEs, with explicit functions in model (4), which provide a good fit to the observed data for the two sexes (adjusted R2 = 0.956), and 4) revealing multifactorial interactions in embryogenesis from the coupled ODEs in model (2) to triplet ODEs in model (6). Clearly, this article extends game theory from evolutionary game theory to epigenetic game theory.

  2. Retracted: Addition of a single methyl group to a small molecule sodium channel inhibitor introduces a new mode of gating modulation, by L Wang, SG Zellmer, DM Printzenhoff and NA Castle. British Journal of Pharmacology, volume 172(20): 4905-4918, published in October 2015; DOI 10.1111/bph.13259.

    Science.gov (United States)

    2018-07-01

    The above article, published by the British Journal of Pharmacology in October 2015 (https://bpspubs.onlinelibrary.wiley.com/doi/full/10.1111/bph.13259), has been retracted by agreement between the authors, the journal Editor in Chief and John Wiley & Sons Limited. The retraction has been agreed owing to the discovery of errors in the chemical structure of the synthetic compounds generated. The corrected structure is now available in the article PF-06526290 can both enhance and inhibit conduction through voltage gated sodium channels by L Wang, SG Zellmer, DM Printzenhoff and NA Castle, 2018, https://bpspubs.onlinelibrary.wiley.com/doi/full/10.1111/bph.14338. Reference Wang L, Zellmer SG, Printzenhoff DM, Castle NA (2015). Addition of a single methyl group to a small molecule sodium channel inhibitor introduces a new mode of gating modulation. Br J Pharmacol 172: 4905-4918. https://doi.org/10.1111/bph.13259. © 2018 The British Pharmacological Society.

  3. Mortalidad neonatal, análisis de registros de vigilancia e historias clínicas del año 2011 neonatales en Huánuco y Ucayali, Perú

    Directory of Open Access Journals (Sweden)

    José Enrique Velásquez Hurtado

    Full Text Available Objetivos. Estimar la tasa de mortalidad neonatal y describir las defunciones neonatales ocurridas en el 2011 en hospitales del Ministerio de Salud de las regiones Huánuco y Ucayali, Perú. Materiales y Métodos .Estudio transversal realizado de septiembre a noviembre de 2012 en Huánuco y Ucayali. Se revisaron los registros de las defunciones neonatales ocurridas en el 2011 en municipalidades provinciales, direcciones regionales de salud y cuatro hospitales de referencia. Para el cálculo de las tasas de mortalidad se utilizaron las fuentes de información más confiables por región. La revisión de 185 historias clínicas en los hospitales permitió describir las causas básicas de las muertes neonatales. Resultados. En el 2011 se reportaron en Huánuco 10 886 recién nacidos vivos y 158 muertes neonatales, con una tasa de 14,5 muertes por 1000 nacidos vivos. En Ucayali, se reportaron 11 441 recién nacidos vivos y 138 muertes neonatales, con una tasa de 12,1 muertes por 1000 nacidos vivos. La mayoría de muertes neonatales hospitalarias ocurrieron en los primeros 7 días de vida (87%, en neonatos prematuros (73,9% y con bajo peso al nacimiento (67%. Las causas básicas más frecuentes en las muertes neonatales fueron: infección (31,4%, malformación congénita (22,2% y prematuridad (18,9%. . Conclusiones La tasa de mortalidad neonatal en las regiones estudiadas fue superior a la media nacional. Los resultados sugieren la necesidad de intervenciones efectivas e integrales durante el embarazo, parto y periodo posnatal temprano; siendo este último periodo el de mayor vulnerabilidad en el neonato

  4. Mortalidad neonatal, análisis de registros de vigilancia e historias clínicas del año 2011 en Huánuco y Ucayali, Perú

    Directory of Open Access Journals (Sweden)

    José Enrique Velásquez Hurtado

    Full Text Available Objetivos. Estimar la tasa de mortalidad neonatal y describir las defunciones neonatales ocurridas en el 2011 en hospitales del Ministerio de Salud de las regiones Huánuco y Ucayali, Perú. Materiales y Métodos .Estudio transversal realizado de septiembre a noviembre de 2012 en Huánuco y Ucayali. Se revisaron los registros de las defunciones neonatales ocurridas en el 2011 en municipalidades provinciales, direcciones regionales de salud y cuatro hospitales de referencia. Para el cálculo de las tasas de mortalidad se utilizaron las fuentes de información más confiables por región. La revisión de 185 historias clínicas en los hospitales permitió describir las causas básicas de las muertes neonatales. Resultados. En el 2011 se reportaron en Huánuco 10 886 recién nacidos vivos y 158 muertes neonatales, con una tasa de 14,5 muertes por 1000 nacidos vivos. En Ucayali, se reportaron 11 441 recién nacidos vivos y 138 muertes neonatales, con una tasa de 12,1 muertes por 1000 nacidos vivos. La mayoría de muertes neonatales hospitalarias ocurrieron en los primeros 7 días de vida (87%, en neonatos prematuros (73,9% y con bajo peso al nacimiento (67%. Las causas básicas más frecuentes en las muertes neonatales fueron: infección (31,4%, malformación congénita (22,2% y prematuridad (18,9%. . Conclusiones La tasa de mortalidad neonatal en las regiones estudiadas fue superior a la media nacional. Los resultados sugieren la necesidad de intervenciones efectivas e integrales durante el embarazo, parto y periodo posnatal temprano; siendo este último periodo el de mayor vulnerabilidad en el neonato

  5. Role of transcription factor Sp1 and RNA binding protein HuR in the downregulation of Dr+ Escherichia coli receptor protein decay accelerating factor (DAF or CD55) by nitric oxide.

    Science.gov (United States)

    Banadakoppa, Manu; Liebenthal, Daniel; Nowak, David E; Urvil, Petri; Yallampalli, Uma; Wilson, Gerald M; Kishor, Aparna; Yallampalli, Chandra

    2013-02-01

    We previously reported that nitric oxide (NO) reduces the rate of bacteremia and maternal mortality in pregnant rats with uterine infection by Escherichia coli expressing the Dr Fimbria (Dr(+) ). The epithelial invasion of Dr(+) E. coli is dependent on the expression level of its cellular receptor decay accelerating factor (DAF). NO reduces the rate of bacteremia by downregulating the expression of DAF. In this study, we elucidated the role of transcription factor Sp1 and RNA binding protein HuR in the downregulation of human DAF by NO. We generated a series of deletion mutant constructs of DAF gene 5'-untranslated region and mapped the NO-response region upstream to the core promoter region of the DAF gene. One of the several Sp1 binding sites in the DAF 5'-untranslated region was located within the NO-response region. The binding of Sp1 to this site was inhibited by NO. Furthermore, NO also promoted the degradation of DAF mRNA. The 3'-untranslated region of DAF harbors an AU-rich element and this element destabilized the mRNA transcript. NO promoted the rapid degradation of DAF mRNA by inhibiting the binding of mRNA stabilizing protein HuR to this AU-rich region. The inhibition of binding of HuR to the AU-rich region was due to the S-nitrosylation of one or more cysteine residues by NO. Thus, these data reveal the molecular mediators of transcriptional and post-transcriptional regulation of DAF by NO with implications in pathophysiology related to DAF. © 2012 The Authors Journal compilation © 2012 FEBS.

  6. A 970 Hounsfield units (HU) threshold of kidney stone density on non-contrast computed tomography (NCCT) improves patients' selection for extracorporeal shockwave lithotripsy (ESWL): evidence from a prospective study.

    Science.gov (United States)

    Ouzaid, Idir; Al-qahtani, Said; Dominique, Sébastien; Hupertan, Vincent; Fernandez, Pédro; Hermieu, Jean-François; Delmas, Vincent; Ravery, Vincent

    2012-12-01

    What's known on the subject? and What does the study add? Stone density on non-contrast computed tomography (NCCT) is reported to be a prognosis factor for extracorporeal shockwave lithotripsy (ESWL). In this prospective study, we determined that a 970 HU threshold of stone density is a very specific and sensitive threshold beyond which the likelihood to be rendered stone free is poor. Thus, NCCT evaluation of stone density before ESWL may useful to identify which patients should be offered alternative treatment to optimise their outcome. • To evaluate the usefulness of measuring urinary calculi attenuation values by non-contrast computed tomography (NCCT) for predicting the outcome of treatment by extracorporeal shockwave lithotripsy (ESWL). • We prospectively evaluated 50 patients with urinary calculi of 5-22 mm undergoing ESWL. • All patients had NCCT at 120 kV and 100 mA on a spiral CT scanner. Patient age, sex, body mass index, stone laterality, stone size, stone attenuation values (Hounsfield units [HU]), stone location, and presence of JJ stent were studied as potential predictors. • The outcome was evaluated 4 weeks after the ESWL session by NCCT. • ESWL success was defined as patients being stone-free (SF) or with remaining stone fragments of ESWL treatment. • Stones of patients who became SF or had CIRF had a lower density compared with stones in patients with residual fragments [mean (sd) 715 (260) vs 1196 (171) HU, P ESWL was identified. • The use of NCCT to determine the attenuation values of urinary calculi before ESWL helps to predict treatment outcome, and, consequently, could be helpful in planning alternative treatment for patients with a likelihood of a poor outcome from ESWL. © 2012 THE AUTHORS. BJU INTERNATIONAL © 2012 BJU INTERNATIONAL.

  7. Estrategia de intervención en el empoderamiento de la mujer víctima de violencia de pareja de una zona periurbana de Huánuco; 2017

    OpenAIRE

    Quiñones Flores, Mitzi Marleni

    2017-01-01

    El objetivo del estudio fue demostrar el efecto de la estrategia de intervención en el empoderamiento de la mujer víctima de violencia de pareja de una zona periurbana de Huánuco. El estudio fue de tipo longitudinal, analítico, prospectivo y experimental; con 44 mujeres para el grupo experimental y control, quienes respondieron los instrumentos de valoración previamente fiabilizados y según consideraciones éticas. La comprobación de hipótesis fue mediante la prueba U de Mann-Whitney para un p...

  8. Excepciones a la prueba prohibida para garantizar el derecho al debido proceso penal, en la Corte Superior de Justicia del Distrito Judicial de Huánuco, 2014 - 2015

    OpenAIRE

    Flores León, Vilma Felicitas

    2016-01-01

    La presente investigación ha tenido el objetivo de identificar las excepciones a la prueba prohibida que deben ser admitidas y valoradas para garantizar el derecho al debido proceso penal en la Corte Superior de Justicia del Distrito Judicial de Huánuco, 2014 - 2015, planteándose como una hipótesis que, la investigación de la verdad en el proceso penal, la defensa de los derechos fundamentales de la persona humana y el interés público, son las excepciones a la prueba prohibida que deben ser a...

  9. Prevalencia de hepatitis viral A y B y factores de riesgo asociados a su infección en la población escolar de un distrito de Huánuco - Perú

    Directory of Open Access Journals (Sweden)

    C Heriberto Hidalgo

    2002-01-01

    Full Text Available Objetivo: Determinar la prevalencia de marcadores serológicos para la infección por el virus de la hepatitis A y B en la población escolar del distrito de Huánuco e identificar los factores asociados a dichas infecciones. Materiales y métodos: en este estudio transversal analítico se seleccionó una muestra aleatoria y estratificada de 270 del total de escolares registrados en los diferentes centros educativos del distrito de Huánuco, Departamento de Huánuco-Perú, de abril a diciembre del 2000, en quienes se evaluó la presencia de HBsAg y anticuerpos anti-HAV, anticuerpos totales, anticuerpos IgM anti-HBcAg, anti-HDV y antígeno "e" en sangre (Estos últimos tres sólo a los HBsAg reactivos. La presencia de factores de riesgo para la infección por estos dos virus fue evaluada por una encuesta epidemiológica. Resultados: 257 (95,2% escolares tuvieron Anticuerpos anti-HAV, 8 (3,0% resultaron ser portadores de HBsAg, 62 (23,0% tuvieron anticuerpos anti- HBcAg y ninguno de los 8 portadores de HBsAg tuvieron anticuerpos anti-HDV, anticuerpos IgM anti-HBcAg, ni antígeno "e" (HBeAg. La edad mayor a 11 años estuvo asociada a la presencia de anti-HAV (OR=14,3, p<0,001. El tener vivienda de adobe estuvo asociado a la reactividad al HBsAg (OR=5,1, p=0,045 y el tener relaciones sexuales estuvo asociado a la presencia de anticuerpos anti-HBcAg (OR=6,49, p=0,003. Conclusiones: el distrito de Huánuco tiene una alta endemicidad para HAV y endemicidad intermedia para el HBV. La edad mayor de 11 años estuvo asociada a una mayor infección por HAV y el tener vivienda precaria y relaciones sexuales a una mayor infección por HBV.

  10. Factores de depresión y de autoestima en mujeres víctimas de violencia familiar asistidas en un Centro de Emergencia Mujer de la provincia de Huánuco

    OpenAIRE

    Sobrado Chávez, Félix Dulio

    2017-01-01

    Investigación de tipo descriptiva comparativa correlacional tuvo como objetivo Establecer la relación y/o comparación entre los niveles de depresión y de autoestima que presentan las mujeres víctimas de violencia, asistidas en un centro emergencia mujer de la provincia de Huánuco según el tipo de familia, estado civil, ocupación y la edad. Se aplicaron las escalas de depresión de Beck y la escala de Coopersmith a una muestra de 140 mujeres entre 18 a 47 años de edad. Los datos fueron procesad...

  11. In vitro and in vivo bactericidal activity of Tinospora sagittata (Oliv.) Gagnep. var. craveniana (S.Y.Hu) Lo and its main effective component, palmatine, against porcine Helicobacter pylori

    OpenAIRE

    Rong, Qian; Xu, Min; Dong, Qi; Zhang, Yuli; Li, Yinglun; Ye, Gang; Zhao, Ling

    2016-01-01

    Background Tinospora sagittata (Oliv.) Gagnep. var. craveniana (S.Y.Hu) Lo (TSG) is a traditional Chinese herb that has been used for the treatment of upper respiratory tract infection and has anti-bacterial and anti-ulcer activity. Our study investigated the bactericidal effects of TSG and its major component, palmatine, against a Helicobacter pylori (H. pylori) strain isolated from pig and the standard strain H. pylori SS1 in vitro and in vivo. Methods H. pylori was isolated from pig and na...

  12. Las actividades extracurriculares y su influencia en la comprensión lectora del idioma inglés en los estudiantes del Instituto Superior Pedagógico Público “Marcos Duran Martel” - Huánuco 2013

    OpenAIRE

    Montero Albornoz, Rocio del Pilar

    2016-01-01

    El objetivo principal del trabajo de investigación es de determinar la mejor estrategia para desarrollar las actividades extracurriculares en la comprensión lectora del idioma Inglés en los estudiantes del Institutos Superior Pedagógico Públicos “Marcos Duran Martel” Huánuco. Esta investigación se enmarca en un enfoque investigativo integral y se clasifica como descriptivo explicativa. Todo el trabajo investigativo se realiza bajo el enfoque como método general de la ciencia, al utilizar un s...

  13. 王友仁点穴开合按动法针对踝关节扭伤推拿经验浅析%Discussion on WANG You-ren's Treatment for Sprain of Ankle with Andong Therapy of Pressing Acupoint Combined with Joint Switching

    Institute of Scientific and Technical Information of China (English)

    包庆旭

    2017-01-01

    This article focused on WANG You-ren chief physician's Andong therapy theory system, systematically summarized the treatment ideas and characteristics of acute phase for the sprain of ankle. Combined with typical cases, details of WANG You-ren chief physician's treatment with specific press method, remote press method, holographic press method, and corresponding to the press method for the acupoints principle were introduced. WANG You-ren chief physician also proposed early treatment and active protection when people have sprain of ankle, with a purpose to achieve the good efficacy, such as relieve acute pain, reduce swelling, and few sequelae.%本文重点对王友仁主任医师以按动疗法理论体系为纲要,对踝关节扭伤急性期的治疗思路和特色手法进行系统总结,并结合典型病例,详细介绍王友仁主任医师用特定按动法、远端按动法、全息按动法、对应按动法为取穴原则,以达到点穴镇痛在先、开合按动顺筋归位在后的推拿治疗方法.王友仁主任医师提出踝关节扭伤后应及早治疗、积极防护,达到急者镇痛、消肿,缓者后遗症少的理念,在临床上获得满意疗效.

  14. Factores diagnósticos endoscópicos y pronósticos relacionados con el Helicobacter Pylori en la enfermedad injerto contra huésped tras el trasplante alogénico de células hematopoyéticas

    OpenAIRE

    Velasco Guardado, Antonio

    2016-01-01

    [ES] INTRODUCCIÓN: El trabajo consta de tres artículos originales relacionados por un lado con el diagnóstico endoscópico e histológico en la Enfermedad de Injerto contra Huésped (EICH) tras el trasplante alogénico de células hematopoyéticas (TACH) y por otro sobre el papel que juega la infección por Helicobacter pylori (HP) en dicha enfermedad. El tracto gastrointestinal es la principal diana de la Enfermedad de Injerto contra Huésped. Su diagnóstico se basa en los hallazgos endoscópicos e ...

  15. Adaptación y propiedades psicométricas del inventario de depresión de Beck II en estudiantes de la Universidad Pública de Huánuco

    OpenAIRE

    Rivera Mansilla, Yessica María

    2014-01-01

    El presente estudio tuvo como objetivo adaptar y evaluar las propiedades psicométricas del Inventario de Depresión de Beck II (Beck, Steer y Brown, 1996) en una muestra probabilística estratificada de 869 estudiantes de pregrado de la Universidad Nacional Hermilio Valdizán de Huánuco, matriculados en el semestre 2013-I. Se realizó la adaptación lingüística a partir del análisis de contenido con criterio de jueces; el nuevo Inventario de Depresión de Beck II Adaptación Huanuqueña alcanzó una a...

  16. La variabilité génétique chez l'huître plate Ostrea edulis (L. 1758) : inférence du nombre de géniteurs instantané d'une population

    OpenAIRE

    Da Silva, Sara Maria Mira

    2001-01-01

    Les études de génétique des populations des bivalves marins ont fréquemment mit en évidence une relation hétérozygotie / valeur sélective, et un fort déficit en hétérozygotes. Parmi les hypothèses explicatives de ces deux phénomènes, la création d'individus consanguins dans les populations est particulièrement intéressante à tester. Le but de ce travail était de vérifier s'il pouvait y avoir un nombre faible de géniteurs à la base d'un événement de reproduction donné chez l'huître plate Ostre...

  17. Discussion of "Carbon benefits of wolfberry plantation on secondary saline land in Jingtai oasis, Gansu - A case study on application of the CBP model" by Yaolin Wang, Chuanyan Zhao, Quanlin Ma, Yingke Li, Hujia Jing, Tao Sun, Eleanor Milne, Mark Easter, Keith Paustian, Hoi Wen Au Yong, John McDonagh (2015) [Journal of Environmental Management 157, 303-310].

    Science.gov (United States)

    Azarnivand, Ali

    2015-12-01

    Wang et al. (2015) employed driving force-pressure-state-impact-response (DPSIR) framework to provide a robust decision-making structure for carbon emission reduction by use of wolfberry plantation in the Jingtai oasis, China. DPSIR appropriately identified the causes of problem along with adopting the responses to the barriers associated with wolfberry plantation. However, the discusser argues that, the paper could have prepared more viable outcomes, if the authors had used causal network rather than causal chains through the DPSIR framework. Furthermore, they could have quantified the mutual relationship among the relevant factors to provide a detailed economic assessment. With this knowledge in hand, the current discussion letter suggests eDPSIR and meDPSIR to address drawbacks regarding conventional DPSIR framework. Due to proper performance of eDPSIR and meDPSIR, they are recommended as practical tools in the future environmental studies. Copyright © 2015 Elsevier Ltd. All rights reserved.

  18. Qualitative and quantitative characterization of secondary metabolites and carbohydrates in Bai-Hu-Tang using ultraperformance liquid chromatography coupled with quadrupole time-of-flight mass spectrometry and ultraperformance liquid chromatography coupled with photodiode array detector.

    Science.gov (United States)

    Zhong, Wei-Fang; Tong, Wing-Sum; Zhou, Shan-Shan; Yip, Ka-Man; Li, Song-Lin; Zhao, Zhong-Zhen; Xu, Jun; Chen, Hu-Biao

    2017-10-01

    Bai-Hu-Tang (BHT), a classic traditional Chinese medicine (TCM) formula used for clearing heat and promoting body fluid, consists of four traditional Chinese medicines, i.e., Gypsum Fibrosum (Shigao), Anemarrhenae Rhizoma (Zhimu), Glycyrrhizae Radix et Rhizoma Praeparata cum Melle (Zhigancao), and nonglutinous rice (Jingmi). The chemical composition of BHT still remains largely elusive thus far. To qualitatively and quantitatively characterize secondary metabolites and carbohydrates in BHT, here a combination of analytical approaches using ultraperformance liquid chromatography coupled with quadrupole time-of-flight mass spectrometry and ultraperformance liquid chromatography coupled with photodiode array detector was developed and validated. A total of 42 secondary metabolites in BHT were tentatively or definitely identified, of which 10 major chemicals were quantified by the extracting ion mode of quadrupole time-of-flight mass spectrometry. Meanwhile, polysaccharides, oligosaccharides, and monosaccharides in BHT were also characterized via sample pretreatment followed by sugar composition analysis. The quantitative results indicated that the determined chemicals accounted for 35.76% of the total extract of BHT, which demonstrated that the study could be instrumental in chemical dissection and quality control of BHT. The research deliverables not only laid the root for further chemical and biological evaluation of BHT, but also provided a comprehensive analytical strategy for chemical characterization of secondary metabolites and carbohydrates in traditional Chinese medicine formulas. Copyright © 2017. Published by Elsevier B.V.

  19. Biscuits with No Added Sugar Containing Stevia, Coffee Fibre and Fructooligosaccharides Modifies α-Glucosidase Activity and the Release of GLP-1 from HuTu-80 Cells and Serotonin from Caco-2 Cells after In Vitro Digestion.

    Science.gov (United States)

    Martinez-Saez, Nuria; Hochkogler, Christina Maria; Somoza, Veronika; Del Castillo, Maria Dolores

    2017-07-04

    This study assessed the in vitro effects of the bioaccessible food components released during the simulated human digestion of a coffee fibre-containing biscuit (CFB) on α-glucosidase activity, antioxidant capacity and satiety hormones. Digest of CFB presented a significantly ( p < 0.05) lower amount of sugar (68.6 mg/g) and a higher antioxidant capacity (15.1 mg chlorogenic acid eq./g) than that of a sucrose-containing biscuit (SCB). The CFB significantly reduced ( p < 0.05) α-glucosidase activity (IC50 = 3.3 mg/mL) compared to the SCB (IC50 = 6.2 mg/mL). Serotonin and glucagon-like peptide-1 (GLP-1) release by differentiated Caco-2 and HuTu-80 cells, respectively, was stimulated by the CFB (355% at a concentration of 0.5 mg/mL and 278% at a concentration of 0.05 mg/mL) to the same order of magnitude as those of the SCB. To summarize, the CFB was demonstrated to reduce monosaccharide bioaccessibility, to inhibit a diabetes-related digestive enzyme, and to improve the release of satiety hormones.

  20. Qualitative and quantitative characterization of secondary metabolites and carbohydrates in Bai-Hu-Tang using ultraperformance liquid chromatography coupled with quadrupole time-of-flight mass spectrometry and ultraperformance liquid chromatography coupled with photodiode array detector

    Directory of Open Access Journals (Sweden)

    Wei-Fang Zhong

    2017-10-01

    Full Text Available Bai-Hu-Tang (BHT, a classic traditional Chinese medicine (TCM formula used for clearing heat and promoting body fluid, consists of four traditional Chinese medicines, i.e., Gypsum Fibrosum (Shigao, Anemarrhenae Rhizoma (Zhimu, Glycyrrhizae Radix et Rhizoma Praeparata cum Melle (Zhigancao, and nonglutinous rice (Jingmi. The chemical composition of BHT still remains largely elusive thus far. To qualitatively and quantitatively characterize secondary metabolites and carbohydrates in BHT, here a combination of analytical approaches using ultraperformance liquid chromatography coupled with quadrupole time-of-flight mass spectrometry and ultraperformance liquid chromatography coupled with photodiode array detector was developed and validated. A total of 42 secondary metabolites in BHT were tentatively or definitely identified, of which 10 major chemicals were quantified by the extracting ion mode of quadrupole time-of-flight mass spectrometry. Meanwhile, polysaccharides, oligosaccharides, and monosaccharides in BHT were also characterized via sample pretreatment followed by sugar composition analysis. The quantitative results indicated that the determined chemicals accounted for 35.76% of the total extract of BHT, which demonstrated that the study could be instrumental in chemical dissection and quality control of BHT. The research deliverables not only laid the root for further chemical and biological evaluation of BHT, but also provided a comprehensive analytical strategy for chemical characterization of secondary metabolites and carbohydrates in traditional Chinese medicine formulas.

  1. ‘Quadrilateral’ in Philosophy and Bie-modernism (Comments on Aleš Erjavec’s “Zhuyi: From Absence to Bustle? Some Comments on Wang Jianjiang's Article ‘The Bustle and the Absence of Zhuyi’”

    Directory of Open Access Journals (Sweden)

    Wang Jianjiang

    2017-09-01

    Full Text Available Aleš Erjavec proposed the global philosophical quadrilateral, giving Chinese philosophy, aesthetics, and humanities an expectation. However, the realization of this expectation hinges on the question whether Chinese philosophy as well as aesthetics and the humanities can rid themselves of the staggering level of ‘voice’ and develop their ‘speech’. To make ‘speech’, any nation should have its own idea, theory and Zhuyi. How to overcome the embarrassment that ‘quadrilateral’ expectation implies? Time spatialization and four-phase development theories of the Bie-modern, and great leap forward pause theory have provided an answer. The quadrilateral expectation as shown by Aleš Erjavec, is encountering the antagonism between ‘cosmopolitanism’ and ‘nationalism’. The key to resolving this antagonism is ‘my’ original achievement consisting of ‘Chinese traditional philosophy, Western philosophy, Marxism and I (myself’. Bie-modernism is a Zhuyi of self-regulation, self-renewal and self-transcendence and of their practical implementation.   Article received: May 21, 2017; Article accepted: May 24, 2017; Original scholarly paper How to cite this article: Jianjiang, Wang. "‘Quadrilateral’ in Philosophy and Bie-modernism (Comments on Aleš Erjavec’s “Zhuyi: From Absence to Bustle? Some Comments on Wang Jianjiang's Article ‘The Bustle and the Absence of Zhuyi’”." AM Journal of Art and Media Studies 13 (2017: 123-142. doi: 10.25038/am.v0i13.190

  2. L'amélioration de la qualité des huîtres à échelle professionnelle: intégration de l'eau salée souterraine traitée comme milieu d'élevage

    OpenAIRE

    Haure, Joel; Durin, Olivier; Palvadeau, Hubert; Papin, Mathias; Nourry, Max; Penisson, Christian; Martin, Jean-louis

    2003-01-01

    Les travaux menés au LCPL depuis plusieurs année sur l'engraissement contrôlé de l'huître creuse Crassostrea gigas ont permis, à l'échelle expérimentale de définir les différents paramètres d 'élevage: température : 14°C ration alimentaire : 2.10(9) cell/ind/j de la diatomée Skeletonema costatum - indice AFNOR initial sans incidence - débit d 'eau : 3 l/ind/h - eau de mer ou eau salée souterraine. Dans ces conditions et après 30 jours d 'engraissement, le poids total des huîtres a progressé d...

  3. Propuesta de un modelo de diagnóstico y control para la elaboración de perfiles de proyectos de inversión pública del sector educación del Gobierno Regional de Huánuco, bajo la metodología de la dinámica de sistemas – 2015

    OpenAIRE

    Flores Pinan, Julio Humberto

    2016-01-01

    El presente trabajo de investigación; se realizó con el objetivo de Proponer un Modelo de Diagnóstico y Control para la Elaboración de Perfiles de Proyectos de Inversión Pública del Sector Educación del Gobierno Regional de Huánuco, bajo la Metodología de la Dinámica de Sistemas. Por tal motivo; se investigó acerca de todos los factores intervinientes en la Problemática del Sector de Educación en el Departamento de Huánuco, mediante la Selección y Muestreo de todos los PIPs de Educación el...

  4. Introduction of digital soil mapping techniques for the nationwide regionalization of soil condition in Hungary; the first results of the DOSoReMI.hu (Digital, Optimized, Soil Related Maps and Information in Hungary) project

    Science.gov (United States)

    Pásztor, László; Laborczi, Annamária; Szatmári, Gábor; Takács, Katalin; Bakacsi, Zsófia; Szabó, József; Dobos, Endre

    2014-05-01

    Due to the former soil surveys and mapping activities significant amount of soil information has accumulated in Hungary. Present soil data requirements are mainly fulfilled with these available datasets either by their direct usage or after certain specific and generally fortuitous, thematic and/or spatial inference. Due to the more and more frequently emerging discrepancies between the available and the expected data, there might be notable imperfection as for the accuracy and reliability of the delivered products. With a recently started project (DOSoReMI.hu; Digital, Optimized, Soil Related Maps and Information in Hungary) we would like to significantly extend the potential, how countrywide soil information requirements could be satisfied in Hungary. We started to compile digital soil related maps which fulfil optimally the national and international demands from points of view of thematic, spatial and temporal accuracy. The spatial resolution of the targeted countrywide, digital, thematic maps is at least 1:50.000 (approx. 50-100 meter raster resolution). DOSoReMI.hu results are also planned to contribute to the European part of GSM.net products. In addition to the auxiliary, spatial data themes related to soil forming factors and/or to indicative environmental elements we heavily lean on the various national soil databases. The set of the applied digital soil mapping techniques is gradually broadened incorporating and eventually integrating geostatistical, data mining and GIS tools. In our paper we will present the first results. - Regression kriging (RK) has been used for the spatial inference of certain quantitative data, like particle size distribution components, rootable depth and organic matter content. In the course of RK-based mapping spatially segmented categorical information provided by the SMUs of Digital Kreybig Soil Information System (DKSIS) has been also used in the form of indicator variables. - Classification and regression trees (CART) were

  5. Inventario y evaluación de primates y amenazas para sus poblaciones en bosque montano de la Región Huánuco, Perú

    Directory of Open Access Journals (Sweden)

    Rolando Aquino

    2015-06-01

    Full Text Available El estudio estuvo orientado al inventario y evaluación de primates e identificar las amenazas para sus poblaciones en bosque montano de la Región Huánuco,  un área poco explorado con respecto a la  fauna silvestre. De Junio a Julio y de Setiembre a Octubre del 2014, fueron conducidos censos por transecto en puntos de muestreo correspondientes a las microcuencas de los ríos Chontayacu y Chinchao y cuenca alta del río Huallaga. En 618 km de longitud recorrida fueron registrados 47 grupos pertenecientes a cinco especies, siendo las más comunes Alouatta seniculus (15 grupos y Lagothrix flavicauda  (13 grupos. L. flavicauda fue observada únicamente en la Microcuenca del río Chontayacu,  y Ateles chamek  en la Cuenca alta del río Huallaga. En el área de estudio, los primates viven en parches de bosques primario y residual, excepto en el Chontayacu, donde el bosque primario es todavía denso y extenso. La densidad poblacional fue más alta para L. flavicauda (20,8 indiv./km2 y más baja para Sapajus macrocephalus (2,7 indiv./km2. Entre las actividades observadas, la deforestación para la agricultura y ganadería constituye la principal  amenaza para la supervivencia de primates, en particular en la Microcuenca del río Chinchao y Cuenca alta del río Huallaga.

  6. Eficiencia de polinización de colonias huérfanas del abejorro nativo Bombus atratus (Hymenoptera: Apidae en dos cultivares de fresa (Fragaria x ananassa sembrados bajo cubierta en la sabana de Bogotá

    Directory of Open Access Journals (Sweden)

    Carlos Alberto Poveda Coronel

    2018-01-01

    Full Text Available En Colombia la fresa se ha convertido en un cultivo de interés económico debido a la creciente demanda en el mercado extranjero en la última década. La mayoría de plantaciones son a campo abierto y no usan esquemas de polinización para mejorar la calidad de producción. La polinización con abejorros mejora la calidad de los frutos, aunque estos se producen mediante polinización espontánea. La especie nativa Bombus atratus ha sido reconocida como un polinizador eficiente de cultivos hortofrutícolas colombianos bajo invernadero. El presente estudio evaluó la eficiencia de polinización de dos colonias huérfanas en la calidad de los frutos de las variedades camino real y ventana sembrados bajo invernadero en Cajicá-Colombia. Se embolsaron los botones para obtener los frutos producidos espontáneamente y ser comparados con los frutos provenientes de la visita de obreras de B. atratus. Se encontró que la visita de las obreras mejoró la calidad de los frutos en las variables, calibre (35 % y 31 %, longitud (28 % y 19 %, peso fresco (103 % y 90 %, peso seco (126 % y 145 % y número de semillas (55 % y 81 % para las variedades Camino Real y Ventana respectivamente. A partir de las observaciones realizadas, se determinó que el recurso floral utilizado por las obreras de B. atratus fue el néctar y se hacen recomendaciones sobre su uso en este cultivo.

  7. Heterogeneous catalytic degradation of polyacrylamide solution | Hu ...

    African Journals Online (AJOL)

    Modified with trace metal elements, the catalytic activity of Fe2O3/Al2O3 could be changed greatly. Among various trace metal elements, Fe2O3/Al2O3 catalysts modified with Co and Cu showed great increase on catalytic activity. International Journal of Engineering, Science and Technology, Vol. 2, No. 7, 2010, pp. 110- ...

  8. Main: 1HU9 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available Lox3; Glycine Max Molecule: Lipoxygenase-3; Chain: A; Synonym: L-3; Other_details: Complex With 4-Hydroperox...RSKLDSQVYGDHTSQITKEHLEPNLEGLTVDEAIQNKRLFLLGHHDPIMPYLRRINATSTKAYATRTILFLKNDGTLRPLAIELSLPHPQGDQSGAFSQVFLPADEGV...TFLWGRYSVEMSAVVYKDWVFTDQALPADLIKRGMAIEDPSCPHGIRLVIEDYPYAVDGLEIWDAIKTWVHEYVFLYYKSDDTLREDPELQACWKELVEVGHGDKKNEPWWPKMQTREELVEACAI

  9. EnviroAtlas - HU12_polygon

    Data.gov (United States)

    U.S. Environmental Protection Agency — This data set is a complete digital hydrologic unit boundary layer to the Subwatershed (12-digit) 6th level for the entire United States. This data set consists of...

  10. 论王安石“善恶由习”人性论的理论渊源及其内容%On the Theoretical Origins and Contents of Wang Anshi's Theory of Human Nature on the Good and Evil Emerged from the Habit and Custom

    Institute of Scientific and Technical Information of China (English)

    欧阳辉纯

    2012-01-01

    Traditional ethical thinking theory of human nature provided theoretical basis for Wang Anshi' s. The theory of human nature in traditional ethical thinking history is mainly as follows, that is, the theory advanced by Mencius that human nature is good from birth, the theory put forward by Xunzi that human nature is evil from birth, the theory put forward by Sh- ishuo that human nature is both good and evil from birth, the Sanpin theory advanced by Dong Zhongshu, the theory put for-ward by Yangxiong that human nature is mixed goodness and evilness, and the Sanpin theory of disposition advanced by Hanyu. Wang Anshi's theory of human nature on the good and evil emerged from the habit and custom originates from critical-ly drawing on the results of previous theory of human nature. It is to the traditional theory of human nature to inject new mean-ing, to open up new realm, and thus it has an important position in traditional ethical thinking history in China.%传统人性论是王安石人性论形成的理论来源。传统伦理思想史上的人性论主要有孟子的性善论、告子的性无善无恶论、苟子的性恶论、世硕的性有善有恶论、董仲舒的性三品论、扬雄的性善恶混论和韩愈的性情三品说。王安石批判地吸收了前人的人性论成果,形成了他的“善恶由习”的人性论。他的人性论给传统人性论注入了新的内涵,开拓了新的境界,因而在中国伦理思想史上具有重要的地位。

  11. Identificación de una nueva área de infección por Rickettsias del grupo typhi: estudio de un brote de tifus en Huánuco

    Directory of Open Access Journals (Sweden)

    Rosa Mostorino E

    2003-03-01

    Full Text Available Objetivos: Investigar un brote de síndrome febril en el distrito de Punchao mediante una evaluación clínica, laboratorial y entomológica para conocer los factores asociados a la aparición de dicho brote. Materiales y métodos: Debido al reporte de tres pacientes con cuadro clínico febril asociado a cefalea, mialgias y postración en la semana epidemiológica Nº41 del año 2000, procedentes del distrito de Punchao, Humalíes, Huánuco y ante la información de presentación inusual de pacientes febriles en la última semana en dicho lugar, se decidió investigar la naturaleza y características del brote. Se definió como caso a todo paciente con cuadro febril agudo y uno de estos síntomas: cefalea, mialgias o postración; procediéndose a la búsqueda activa de éstos y a la evaluación de presencia de anticuerpos para rickettsias en suero mediante inmunofluorescencia indirecta (IFI. Se capturaron roedores y se colectaron ectoparásitos en las viviendas (roedores, animales domésticos y humanos, a fin de identificar la presencia de Rickettsias en ellos mediante IFI, aislamiento o PCR. Resultados: No se logró el aislamiento del agente causal. Se evidenció circulación de la Rickettsia sp. (serología positiva tanto en humanos (en casos y en no casos como en roedores. Se evidenció mayor presencia de malos hábitos de aseo y condiciones inadecuadas de saneamiento básico en los casos (respecto a los no casos y una disminución de los casos luego del inicio de las medidas de control. Conclusiones: Las evidencias encontradas permitieron identificar un brote de tifus en Punchao, no pudiéndose determinar la especie involucrada debido a que no se aisló el agente causal.

  12. Intervención comunicacional en la promoción del perfil ambiental del profesorado del Colegio Nacional Integrado Jorge Basadre en Santa María del Valle, Huánuco. Perú-2011

    Directory of Open Access Journals (Sweden)

    Angélica SOTOMAYOR BACA

    2015-05-01

    Full Text Available En la búsqueda de medidas de mitigación y remediación de la crisis ambiental, la preparación de profesores para la Educación Ambiental es, en la actualidad, reconocida como una prioridad. Ello determina la necesidad de una transformación continua del rol docente, constituyéndose en agentes activos en la formación integral de nuevas generaciones, abordando los problemas ambientales con enfoques emergentes.El objetivo de esta investigación es comprobar si a lo largo de la intervención comunicacional se logra mejorar el perfil ambiental del profesorado del Colegio Nacional Integrado Jorge Basadre en Santa María del Valle, del distrito y provincia de Huánuco-Perú. Y, por tanto, optimizar sus capacidades hacia la enseñanzaaprendizaje del cuidado del ambiente, incorporando en el alumno el compromiso con el cuidado del ambiente. El estudio es experimental, prospectivo, longitudinal y analítico, con diseño de un solo grupo antes y después; de treinta y seis participantes voluntarios de la intervención comunicacional, desarrollada en sesiones mensuales, en un periodo de cinco meses. Se aplicaron satisfactoriamente una encuesta y dos escalas validadas y fiabilizadas. Se comprueban las hipótesis mediante el análisis de varianza de un factor de contrastes multivariados y la prueba t para medias de una muestra relacionada; apoyados en el SPWS V19. La influencia de la intervención comunicacional es demostrada mediante las diferencias significativas obtenidas en los momentos posteriores a la intervención respecto al momento basal. Según los hallazgos, se confirman las hipótesis que establecen diferencias en el comportamiento habitual, en la práctica pedagógica y en las percepciones hacia la educación ambiental de los participantes. Sin embargo, la intervención no mejora la práctica de valores y principios ambientales del profesorado, lo que supone la incidencia de futuros estudios que favorezcan tales cambios. De manera general, la

  13. In vitro and in vivo bactericidal activity of Tinospora sagittata (Oliv.) Gagnep. var. craveniana (S.Y.Hu) Lo and its main effective component, palmatine, against porcine Helicobacter pylori.

    Science.gov (United States)

    Rong, Qian; Xu, Min; Dong, Qi; Zhang, Yuli; Li, Yinglun; Ye, Gang; Zhao, Ling

    2016-08-30

    Tinospora sagittata (Oliv.) Gagnep. var. craveniana (S.Y.Hu) Lo (TSG) is a traditional Chinese herb that has been used for the treatment of upper respiratory tract infection and has anti-bacterial and anti-ulcer activity. Our study investigated the bactericidal effects of TSG and its major component, palmatine, against a Helicobacter pylori (H. pylori) strain isolated from pig and the standard strain H. pylori SS1 in vitro and in vivo. H. pylori was isolated from pig and named H. pylori SCYA201401. For in vitro experiments, the inhibitory activity of TSG and palmatine against H. pylori SCYA201401 and H. pylori SS1 were tested by use of the agar cup diffusion technique. The minimal inhibitory concentration (MIC) and minimal bactericidal concentration (MBC) were determined from the absence of H. pylori colonies on agar plates. Time-kill curves were used to evaluate bactericidal activity; the average number of colonies was calculated at 0 to 48 h after liquid incubation, with concentrations of drugs at 0.5, 1, and 2 × MIC. For in vivo experiments, H. pylori SCYA201401-infected mice were randomly divided into TSG, palmatine, triple therapy (omeprazole, clarithromycin, and amoxicillin), blank control, and model groups. The eradication ratios were determined by use of rapid urease tests and bacterial culture. In vitro, the MIC and MBC of TSG against H. pylori SCYA201401 and SS1 were both 6250 μg/mL, whereas palmatine against H. pylori SCYA201401 was 6.25 μg/mL and against H. pylori SS1 was 3.12 μg/mL. The time-kill curves showed a dose-dependent, progressive decline in the numbers of viable bacteria up to 40 h. In vivo, the eradication ratios in the TSG and palmatine groups of mice were 80 and 50 % compared with 70 % in the triple-therapy group. TSG and its major component, palmatine, have bactericidal activity against H. pylori in vitro and in vivo. The possibility that TSG or palmatine can be effective in the treatment of human and animals H. pylori

  14. Retraction RETRACTION of "Methylation of the RASSFIA promoter in breast cancer" by Y. Ji, H.H. Jin, M.D. Wang, W.X. Cao, J.L. Bao - Genet. Mol. Res. 15 (2): gmr.15028261 (2016) - DOI: 10.4238/gmr.15028261.

    Science.gov (United States)

    Ji, Y; Jin, H H; Wang, M D; Cao, W X; Bao, J L

    2016-10-07

    The retracted article is: Ji Y, Jin HH, Wang MD, Cao WX, et al. (2016). Methylation of the RASSFIA promoter in breast cancer. Genet. Mol. Res. 15: gmr.15028261. There are significant parts of this article (particularly, in the discussion section) that are copied from "Methylation of HIN-1, RASSF1A, RIL and CDH13 in breast cancer is associated with clinical characteristics, but only RASSF1A methylation is associated with outcome", by Jia Xu, Priya B Shetty, Weiwei Feng, Carol Chenault, Robert C Bast Jr, Jean-Pierre J Issa, Susan G Hilsenbeck and Yinhua Yu, published in BMC Cancer 2012; 12: 243. DOI: 10.1186/1471-2407-12-243. The first paragraphs of both discussions are identical. This is concerning. The abstract and introduction sections have much of their text plagiarized. Overall, there is high plagiarism detected. The GMR editorial staff was alerted and after a thorough investigation, we have strong reason to believe that the peer review process was failure and, after review and contacting the authors, the editors of Genetics and Molecular Research decided to retract the article in accordance with the recommendations of the Committee on Publication Ethics (COPE). The authors and their institutions were advised of this serious breach of ethics.

  15. Synthesis and characterization of CuO nanoparticles using strong ...

    Indian Academy of Sciences (India)

    classified into three types on the basis of their dimension, i.e., one-, two- and ... dependent on the shape, size, composition and structures of the nanocrystals. ..... [43] Liu J, Jin J, Deng Z, Huang S-Z, Hu Z-Y, Wang L, Wang C,. Chen L-H, Li Y, ...

  16. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. F Wang. Articles written in Bulletin of Materials Science. Volume 34 Issue 5 August 2011 pp 1033-1037. Synthesis of Mn-doped CeO2 nanorods and their application as humidity sensors · C H Hu C H Xia F Wang M Zhou P F Yin X Y Han · More Details Abstract Fulltext PDF.

  17. A rare adverse reaction of sorafenib | Wang | Libyan Journal of ...

    African Journals Online (AJOL)

    2007-10-30

    Sorafenib is a multikinase inhibitor thought to target vascular endothelial growth factor and its receptor. The European Medicines Agency (EAMA) and Food and Drug Administration (FDA) approved the use of sorafenib in late-stage hepatic cellular cancer (HCC) on October 30, 2007, and November 19, 2007, respectively.

  18. Proteomic analysis of human oral verrucous carcinoma | Wang ...

    African Journals Online (AJOL)

    Peptide mass fingerprints (PMFs) obtained by the MALDI-TOF analysis were applied to National Center for Biotechnology Information (NCBI), SWISS-PROT and MSDB databases using Mascot software. Then the 2-DE gel imaging showed that 74, 36 and 31 differential protein spots were found between OVC and OSCC, ...

  19. Origin of the Wang-Sheeley-Arge solar wind model

    Science.gov (United States)

    Sheeley, Neil R., Jr.

    2017-03-01

    A correlation between solar wind speed at Earth and the amount of magnetic field line expansion in the corona was verified in 1989 using 22 years of solar and interplanetary observations. We trace the evolution of this relationship from its birth 15 years earlier in the Skylab era to its current use as a space weather forecasting technique. This paper is the transcript of an invited talk at the joint session of the Historical Astronomy Division and the Solar Physics Division of the American Astronomical Society during its 224th meeting in Boston, MA, on 3 June 2014.

  20. Rice field for the treatment of pond aquaculture effluents | Wang ...

    African Journals Online (AJOL)

    We conducted an experiment to evaluate the efficiency of rice fields in treating pond aquaculture effluent and its responses to different fertilizer treatments. Four treatments was considered in the experiment: no rice planted as the control (CT); rice planted and no fertilizer input (RE); rice planted and a rate of approximately ...

  1. 76 FR 72387 - Order Relating to Xun Wang

    Science.gov (United States)

    2011-11-23

    ... was under construction in Islamabad, Pakistan, and was a subordinate entity under the ownership and... and timely payment of $200,000 as set forth above. Second, that, pursuant to the Debt Collection Act... facilitates the acquisition or attempted acquisition by the Denied Person of the ownership, possession, or...

  2. Anne Le Huérou, Aude Merlin, Amandine Regamey and Silvia Serrano, Tchétchénie: une affaire intérieure? Russes et Tchétchènes dans l’étau de la guerre, Paris: Editions Autrement, 2005

    Directory of Open Access Journals (Sweden)

    Bruno Coppieters

    2005-10-01

    Full Text Available This book on Chechnya has been co-authored by Anne Le Huérou, Aude Merlin, Amandine Regamey and Silvia Serrano. These scholars are associated with either the Ecole des hautes études en sciences sociales - CNRS or with the Institut d'études politiques de Paris. Their book offers an excellent introduction to the two most recent wars with Russia. Its aim is to explain to a wider public their historical and social background, the claims put forward by the various actors, the different currents in...

  3. Efectos musculares y hematológicos del uso de rHuEpo en combinación con el entrenamiento físico. Implicaciones de la demospresina y la hipoxia en el dopaje sanguineo. Estudios in vivo e in vitro.

    OpenAIRE

    Martínez Bello, Vladimir Essau

    2011-01-01

    En la presente Tesis Doctoral hemos querido estudiar, en primer lugar, el efecto que tendría el incremento artificial de la capacidad de transporte de oxígeno, a través del tratamiento con rHuEpo, sobre distintos parámetros musculares así como su implicación en la mejora del rendimiento físico. Son muchos los autores que, tanto en el ámbito clínico (Winearls, Oliver y cols. 1986; Bommer, Muller-Buhl y cols. 1987) como en el ámbito deportivo (Berglund y Ekblom 1991; Lundby, Robach y cols. 2008...

  4. Hu Jintao's Speech on Climate Change (abridged)%Hu Jintao' s Speech on Climate Change (abridged)

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    @@ Mr.Secretary-General, dear colleagues, Global climate change has a profound impact on the survival and development of mankind. It is a major challenge facing all countries.I wish to highlight a few principles that we need to follow in our common endeavor to tackle this issue of climate change.

  5. Vliv běhu naboso na kinetiku běhu

    OpenAIRE

    Bezemek, Denis

    2017-01-01

    Title: The influence of barefoot running on running kinetics. Objectives: The aim of this work is to assess the influence of different footwear (regular running shoes, barefoot footwear and barefoot running) on footstrike (rear-foot strike, mid-foot strike and fore-foot strike) during running and evaluate the action of reaction forces in different types of footstrike. Methods: In this study participated 11 runners (only men), who were divided in three groups based on their preferred footwear....

  6. Mala imagen y estrategias de selección y adaptación para ladiversificación turística: el caso de las casas de huéspedes oGasthof del Altmühlsee (Alemania

    Directory of Open Access Journals (Sweden)

    Maria del Pilar Leal Londoño

    2016-01-01

    Full Text Available El artículo analiza las estrategias de selección y adaptación que conllevan a una diversificación turística por parte de las casas de huéspedes o Gasthof en la región del lago del Altmühlsee (Alemania, una región con una importante actividad turística que se ha visto amenazada resultado de la mala imagen generada por la prensa como consecuencia de la abundante presencia de algas tóxicas en sus lagos. Para lograrlo, se retoman elementos teóricos de la Geografía Económica Evolutiva (GEE en un enfoque Darwinista, con el fin de entender los mecanismos que han permitido la emergencia de diversas estrategias de diversificación turística por parte de las casas de huéspedes (Gasthof de la región que les permiten adaptar su oferta a pesar de las circunstancias.

  7. Reacción de ingerto versus huésped: de la comprensión a la utilización de un fenómeno biológico Graft versus host reation: from comprehension to utilization of a biological phenomenon

    Directory of Open Access Journals (Sweden)

    Jorge Eliécer Ossa Londoño

    1999-01-01

    Full Text Available La enfermedad de injerto versus huésped es una de las complicaciones con mayor mortalidad que se presentan después de un trasplante, usualmente de médula ósea, o después de una transfusión sanguínea.- Los principales órganos blanco son la piel. el hígado, el tracto gastrointestinal y el sistema inmune. Sin embargo. la apreciación de esta enfermedad ha venido cambiando a medida que avanza la comprensión de la inmunología de trasplantes. pues se ha visto que puede tener resultados benéficos como son un efecto antireucémico y un aumento de la tolerancia a los trasplantes. Graft versus host disease is one of the complications with greater lethality after transplantation, usually of bone marrow, or after blood transfusion. Organs involved include skin, liver, gastrointestinal tract and the immune system. However, the conception of graft versus host disease has been changing as comprehension of transplant immunology has advanced, since it has been demonstrated that it can have beneficial results as an antileucemic response and because of an increased tolerance to grafts.

  8. Stage en entreprise des étudiants de la filière du Tourisme : défis et perspective. Le cas du Département de Français de l’École Supérieure de Langues Étrangères (ESLE de Hué

    Directory of Open Access Journals (Sweden)

    CONG HUYEN TON NU Y Nhiem

    2016-12-01

    Full Text Available Le stage en entreprise des étudiants dans le domaine du tourisme constituant une préoccupation du Département de Français de l’École Supérieure de Langues Étrangères de Hué, une enquête réalisée auprès de nos étudiants en 4e année permet d’éclaircir la problématique liée à leur stage qui mériterait plus d’attention afin de procéder aux améliorations. Des limites, difficultés vécues de nos étudiants de français durant leur stage en entreprise alimentent une multitude de réflexions au service de ce sujet. Dans ce sens, la collaboration école-entreprise est mise en valeur au profit de la qualité du stage.

  9. Quantitative trait locus (QTL) mapping for 100-kernel weight of ...

    African Journals Online (AJOL)

    hope&shola

    2010-12-06

    Dec 6, 2010 ... regimes. Xiao-Hong Liu1, Zu-Ping Zheng2*, Zhen-Bo Tan3, Zhong Li2 and Chuan He2 ... al., 2005; Liu et al., 2007; Wang et al., 2007a; Guo et al.,. 2008; Tang .... They could individually account for 12.63, 7.22, 4.47 and 14.47% of .... Liu ZH, Tang JH, Wei XY, Wang EL, Tian GW, Hu YM, Chen WC. (2007).

  10. Distribution of genes associated with yield potential and water ...

    Indian Academy of Sciences (India)

    on the FMs related to yield and water saving in wheat. Till date, six loci ..... Hu Y., Moiwo J. P., Yang Y., Han S. and Yang Y. 2010 Agricul- tural water-saving ... Lyu L., Hu Y., Li Y. and Wang P. 2007 Effect of irrigation treatment on water use ... Zhang Y. J., Fan P. S., Zhang X., Chen C. J. and Zhou M. G. 2009. Quantification of ...

  11. Viral and host factors related with histopathologyc activity in patients with chronic hepatitis B and moderate or intermittently elevated alanine aminotransferase levels Influencia de factores virales y del huésped en la actividad histológica en pacientes con hepatitis crónica por virus de la hepatitis B y elevación moderada o intermitente de alanina aminotransferasa

    Directory of Open Access Journals (Sweden)

    E. Molina Pérez

    2010-09-01

    Full Text Available Objective: viral and host factors are related with progression of pathological lesion in chronic hepatitis B. We analyzed these factors in patients with moderate or intermittently elevated ALT levels, and its threshold that determinate significant histological activity. Patients and methods: retrospective analyses of viral and host parameters in 89 consecutive chronic hepatitis B patients biopsied because of moderate or intermittently elevated ALT levels [1-2 x ULN (ULN = 39 IU/mL] and/or DNA-HBV > 2 x 10³ IU/mL in AntiHBe+ patients. It was analyzed age, gender, ALT levels, HBeAg, viral load and genotype. It was considered advanced histological lesion a Knodell Score (KS > 7 and histological lesion indicating treatment, lobular inflammation ≥ 2 or fibrosis ≥ 2 according to Scheuer Classification. Results: KS > 7 and histological lesion indicating treatment was found in 47.8 and 60.7% respectively. It was observed relationship between age, male gender, ALT levels and viral load with histological damage (p ULN (69.1 vs. 47.1%, p = 0.04. There were not significant upper frequencies of advanced lesion when a cut-off of 40 years or DNA-HBV > 2 x 10³ IU/mL viral load or serological status HBeAg was considerate. Histological activity was lesser in genotype D patients than those infected with others genotypes (p Objetivo: analizar factores virales y del huésped relacionados con actividad histológica en un subgrupo de pacientes con hepatitis crónica B y elevación intermitente o moderada de alanina aminotransferasa (ALT, y el umbral que determine daño histológico indicativo de tratamiento. Pacientes y métodos: análisis retrospectivo de parámetros virales y del huésped en 89 pacientes con hepatitis crónica B biopsiados consecutivamente por elevación intermitente o moderada de ALT [1-2 x USN (USN = 39 UI/mL]. Fueron analizados edad, sexo, ALT, HBeAg, carga viral y genotipo. Se consideró como lesion histologica avanzada un Índice de

  12. Effects of Dietary Neutral Detergent Fiber to Non-Fiber Carbohydrates Ratio on Ruminal Nitrate Reduction of Hu Sheep%饲粮中性洗涤纤维与非纤维性碳水化合物比例对湖羊瘤胃还原硝态氮的影响

    Institute of Scientific and Technical Information of China (English)

    林淼; 张建刚; 陈志远; 赵国琦

    2014-01-01

    本试验采用4×4拉丁方试验设计,研究4种中性洗涤纤维与非纤维性碳水化合物比例(NDF/NFC)的饲粮(0.58、0.71、1.20、1.57)对湖羊瘤胃硝态氮含量动态变化和发酵特性的影响。各组饲粮中均含有1.0%硝酸钾,在喂后0、0.5、1.0、1.5、2.0、4.0、6.0、8.0 h通过瘤胃瘘管采集瘤胃液,测定硝酸盐和亚硝酸盐含量以及瘤胃发酵参数;晨饲后2.0 h通过颈静脉采血,测定高铁血红蛋白含量。结果表明,6.0~8.0 h饲粮NDF/NFC=0.71时瘤胃亚硝酸盐含量最低;且0~1.5 h随着NDF/NFC的增大,氨态氮( NH3-N)含量有逐渐降低的趋势;0、8.0 h总微生物蛋白质含量以NDF/NFC=0.58时最高,且与NDF/NFC=0.71时差异不显著(P>0.05),整个试验期未出现亚硝酸盐中毒。因此,在本试验条件下,湖羊饲粮NDF/NFC=0.71时,最有利于瘤胃硝态氮还原及瘤胃发酵。%A 4 × 4 Latin square design in this study was used to investigate the effects of different dietary neu-tral detergent fiber to non-fiber carbohydrates ratios (NDF/NFC) (0.58, 0.71, 1.20 and 1.57) on dynamic changes of ruminal nitrate nitrogen content and fermentation characteristics of Hu sheep. The diet of each group contained 1.0% potassium nitrate, and rumen fluid was obtained at 0, 0.5, 1.0, 1.5, 2.0, 4.0, 6.0 and 8.0 h after feeding to determine the contents of nitrate and nitrite and ruminal fermentation parameters. Blood sample was collected at 2.0 h after feeding to determine the blood methemoglobin content. The results showed that the nitrite content of sheep fed diet with NDF/NFC=0.71 was lowest at 6.0 to 8.0 h after feeding. With the rising of NDF/NFC, NH3-N content had a trend of decrease at 0 to 1.5 h after feeding. Total microbial protein con-tent of sheep fed diet with NDF/NFC=0.58 was highest at 0 and 8.0 h after feeding, and had no significant difference with sheep fed diet with NDF/NFC=0.71 ( P>0.05) . In addition, the nitrite toxicity was not detec-ted during

  13. Antihepatoma and Liver Protective Potentials of Ganoderma Lucidum (靈芝 Ling Zhi Fermented in a Medium Containing Black Soybean (黑豆 Hēi Dòu and Astragalus Membranaceus (生黃耆 Shēng Huáng Qí

    Directory of Open Access Journals (Sweden)

    Zheng-Yuan Su

    2013-04-01

    Full Text Available The antihepatoma activity and liver protective function of the fermentation products (5 L fermenator of Ganoderma lucidum (GL; 靈芝 Ling Zhi cultivated in a medium containing black soybean (BS; 黑豆 Hēi Dòu and Astragalus membranaceus (AM; 生黃耆 Shēng Huáng Qí at different fermentation temperatures were investigated in this study. Hep 3B cells pretreated with lovastatin were used to study the antihepatoma activity, and possible active components were analyzed by reverse-phase high-performance liquid chromatography. Carbon tetrachloride (CCl4-induced primary rat hepatocyte injury was further used to evaluate the liver protective activity of the fermentation products. While all the GL broth filtrates do not inhibit the growth of Hep 3B cells, the ethanolic extract from GL-2 mycelia (GL-2-mE, cultivated in the medium containing BS (50 g/L and AM (20 g/L at 24 °C for 11 days showed the best antihepatoma activity (IC50 26.6 μg/mL than the other ethanolic extracts from GL mycelia, GL fruiting body, BS, and AM did. The antihepatoma activities were correlated with some unknown active components in these samples. Furthermore, GL-2-mE (100 μg/mL without harmful effect on the growth of normal primary rat hepatocytes significantly maintained cell viability, reduced lactate dehydrogenase leakage, lowered lipid peroxidation, and increased glutathione peroxidase and glutathione S-transferase activities in the CCl4-induced damaged primary rat hepatocytes.

  14. Changes in speed and strength in female volleyball players during and after a plyometric training program Změny rychlostně-silových předpokladů volejbalistek v průběhu a po absolvování plyometrického tréninkového programu

    Directory of Open Access Journals (Sweden)

    Milan Elfmark

    2009-03-01

    Full Text Available The goal of this article was the validation of a plyometric training program and the evaluation of the changes in monitored speed and explosive power predispositions during and after the end of the training program. The program was applied to a group of female youth volleyball players (n = 11 twice a week during an eight week period. Their actual level of explosive power and locomotor speed was evaluated before, during and after the intervention was completed. The levels were determined with the following tests: the standing vertical jump, the vertical jump with an approach and the shuttle run for 6 x 6 m. There were positive changes in the average values of test scores during the period of testing, but the dynamics of the changes in the explosive power and the speed were different. Other increases in all the characteristics were noticeable when the final measurements were made six weeks after the completion of the training program. Examination of the differences in the test scores by the follow up group, before the beginning and six weeks after finishing the intervention, was centred on objectively and statistically important changes in the volleyball players' motor predispositions (p < .05. The results of the program support the opinion that plyometric exercises are effective tools in the development of explosive power and speed in young athletes. Cílem studie bylo ověřit v tréninkové praxi program sestávající z vybraných plyometrických cvičení a zhodnotit změny sledovaných rychlostně-silových předpokladů v průběhu a po jeho absolvování. Program byl aplikován u volejbalistek kadetské kategorie (n = 11 2x týdně po dobu 8 týdnů. Aktuální úroveň výbušné síly a lokomoční rychlosti byla hodnocena před, v průběhu a po skončení intervence testy dosah jednoruč po výskoku z místa, dosah jednoruč výskokem po smečařském rozběhu a rychlostní člunkový běh na 6 x 6 m. V období realizace programu doch

  15. Effects of Different Dietary Sources of Roughage on Performance, Ruminal Fermentation and Serum Biochemical Parameters of Hu Sheep%不同粗饲料来源饲粮对湖羊生长性能、瘤胃发酵及血清生化指标的影响

    Institute of Scientific and Technical Information of China (English)

    吴天佑; 赵睿; 罗阳; 王洪荣

    2016-01-01

    This study was conducted to study the effects of different dietary sources of roughage on performance,ruminal fermentation and serum biochemical parameters of Hu sheep under the same energy and protein conditions.Eighteen healthy Hu sheep with similar body weight were randomly divided into three groups with six sheep per group,and sheep in different groups were fed three diets with peanut vine (PV group),beanstalk (BS group) and sugarcan molasses (SM group) as the only dietary roughage source,respectively,under the same energy and protein levels.The test had a 15-day pre-experiment and a 45-day experiment.The results showed as follows:1) average daily gain of Hu sheep in PV group was significant higher than that of BS and SM groups (P<0.05).2) Acetate,butyrate,total volatile fatty acid contents and the ratio of acetate to propionate in rumen fluid of SM group were significantly lower than those of the other groups (P<0.05 or P<0.01);propionate content of SM group was significantly higher than that of PV group at 9 h (P<0.05 or P<0.01),but there was no significant difference among groups at 24 h (P>0.05).3) Serum urea nitrogen content of SM group was significantly higher than that of PV group (P<0.05),and serum creatinine content was significantly higher than that of BS group (P<0.05).In conclusion,under the same dietary energy and protein levels condition,compared to BS and SM,PV as the only dietary roughage source can improve performance,ruminal fermentation and nitrogen utilization rate,and save the supplementation of concentrate.%本试验在相同能量和蛋白质水平下,研究了不同粗饲料来源的饲粮对湖羊生长性能、瘤胃发酵功能及血清生化指标的影响.选用体况良好、体重相近的湖羊18只,随机分为3组,每组6只.在相同能量和蛋白质水平饲粮条件下,分别饲喂以花生藤(PV组)、豆秸(BS组)和甘蔗渣(SM组)作为单一粗饲料配制3种不同粗饲料来源的饲粮.试验期60 d

  16. ÕhuLoss - ehtides maailma / Pekka Erelt

    Index Scriptorium Estoniae

    Erelt, Pekka, 1965-

    2011-01-01

    Ehtekunstnike rühmitusest õhuLoss (Kadri Mälk, Piret Hirv, Eve Margus-Villems, Tanel Veenre, Kristiina Laurits, Villu Plink, Katrin Sipelgas). Esimest korda astus rühmitus üles 10 aastat tagasi Hollandis Marzee galeriis toimunud näitusel. 2011. aasta augustis-septembris toimus näitus Tallinna Põhjatuletornis

  17. The Role of Retinal Determination Gene Network (RDGN) in Hormone Signaling Transduction and Prostate Tumorigenesis

    Science.gov (United States)

    2013-10-01

    Wu K, Wang L, Jiao X, Ju X, Li Z, Ertel A, Addya S, McCue P, Lisanti MP, Wang C, Davis RJ, Mardon G, Pestell RG. Androgen therapy resistant...Li Z, Hu J, Chen K, Wu J, Pestell RG. DACH1 inhibited prostate cancer cellular proliferation and Interleukon-6 signaling. AACR 103rd Annual Meeting...March 31 – April 4, 2012, Chicago, IL.  Wang J, Cai S, Chen K, Sun Y, Li S, Pestell RG, Wu K. Regulation of AR transcriptional activity and

  18. A simple extension of “An alternative approach to sea surface aerodynamic roughness” by Zhiqiu Gao, Qing Wang, and Shouping Wang

    Science.gov (United States)

    Gao, Zhiqiu; Wang, Linlin; Bi, Xueyan; Song, Qingtao; Gao, Yuchao

    2012-08-01

    Based on the data previously collected during the Humidity Exchange over the Sea Main Experiment (HEXMAX), the methods used to parameterize aerodynamic roughness (z0), friction velocity (u*), and the neutral drag coefficient (CDN) under moderate wind speed conditions originally proposed by Gao et al. (2006) were extended by using the nondimensional significant wave height (gHs/u*2 or gHs/U10N2) instead of wave age (cp/u* or cp/U10N), where g is the acceleration of gravity, Hs is the significant wave height, U10Nis the horizontal wind speed at 10-m height under the neutral atmospheric condition, andcp is the phase velocity of the peak wave spectrum. The results show (1) u* = 0.024U10N(gHs/U10N2)-1/4, (2) z0 = 10 × exp[-4.797(gHs/u*2)1/6] or z0 = 10 × exp[-16.613(gHs/U10N2)1/4], and (3) CDN = 0.007(gHs/u*2)-1/3 or CDN = 5.76 × 10-4(gHs/U10N2)-1/2. The present parameterization schemes were experimentally tested.

  19. Tropical Journal of Pharmaceutical Research - Vol 15, No 3 (2016)

    African Journals Online (AJOL)

    Wan Wu, Wei Chen, Qiong Jin, 447-451 ... Chung-Shih Chen, Mei-Lin Wang, Rosa Huang Liu, Shih-Pin Chen, Tsong-Ming Lu, Wei-Yu Tsai, Chien-Fu Huang, ... Yan-Qiong Li, Rui Hu, Li-Hui Zhong, Qian Sun, You-Ping Yan, 527-533.

  20. Casein kinase 1-Like 3 is required for abscisic acid regulation of ...

    African Journals Online (AJOL)

    Casein kinase 1-Like 3 is required for abscisic acid regulation of seed germination, root growth, and gene expression in Arabidopsis. M Wang, D Yu, X Guo, X Li, J Zhang, L Zhao, H Chang, S Hu, C Zhang, J Shi, X Liu ...

  1. Treating Simple Tibia Fractures with Poly-DL-Lactic Acid Screw as a ...

    African Journals Online (AJOL)

    ) absorbable screw as a ... fractures. Keywords: Simple tibia fracture, Fracture healing time Poly-DL-lactic acid, Poly-DL-Lactic Acid, ..... bilateral cortex of the bone due to the weak anti- ... Hu YL, Yuan WQ, Wang LF, Liu HF, Jin D. A prospective.

  2. UN Peacekeeping

    DEFF Research Database (Denmark)

    of civilians, Denmark’s contribution to the UN mission in Liberia, anti-piracy operations, and the prospective role of special forces in UN operations. The two forewords of the book have been written by Major General Hu Guangzheng from AMS and Rear Admiral Nils Christian Wang from the Royal Danish Defence...

  3. Genetic diversity of bitter taste receptor gene family in Sichuan

    Indian Academy of Sciences (India)

    Genetic diversity of bitter taste receptor gene family in Sichuan domestic and Tibetan chicken populations. YUAN SU DIYAN LI UMA GAUR YAN WANG NAN WU BINLONG CHEN HONGXIAN XU HUADONG YIN YAODONG HU QING ZHU. RESEARCH ARTICLE Volume 95 Issue 3 September 2016 pp 675-681 ...

  4. Influences of protective atmosphere on the characterization and ...

    Indian Academy of Sciences (India)

    tective atmosphere on the characterization and properties of the ceramics were investigated. All the ceramics showed ... Tian-Hang Zhang et al temperature and ..... Soc. 24 3731. 20. Wang Y, Zhang Y C, Hu Z J, Gao X, Guo X F and Jiang Y J.

  5. Rapid growth of nanotubes and nanorods of würtzite ZnO through ...

    Indian Academy of Sciences (India)

    Administrator

    report here on the synthesis of ZnO nanorods and nano- tubes from a ..... Hu Y, Zhou X, Han Q, Cao Q and Huang Y 2003 Mater. Sci. ... Lao J Y, Huang J Y, Wang D Z and Ren Z F 2003 Nano Lett. 3. 235 ... Xing Y J et al 2003 Appl. Phys. Lett.

  6. African Journal of Biotechnology - Vol 10, No 65 (2011)

    African Journals Online (AJOL)

    HQ Lou, Y Hu, L Zhang, YJ Zhang, PG Tu, XT Yu, YJ Jin, L Wang, 14286-14292 ... The effect of osmopriming on germination, seedling growth and phosphatase activities of lettuce under saline ... S Han, TH Zhu, SJ Li, FL Li, 14404-14409.

  7. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. Hsinyu Lee. Articles written in Journal of Biosciences. Volume 37 Issue 1 March 2012 pp 157-165 Review. Autophagy: A double-edged sword in Alzheimer's disease · Ying-Tsen Tung Bo-Jeng Wang Ming-Kuan Hu Wen-Ming Hsu Hsinyu Lee Wei-Pang Huang Yung-Feng Liao.

  8. DMPD: Crosstalk among Jak-STAT, Toll-like receptor, and ITAM-dependent pathways inmacrophage activation. [Dynamic Macrophage Pathway CSML Database

    Lifescience Database Archive (English)

    Full Text Available 17502339 Crosstalk among Jak-STAT, Toll-like receptor, and ITAM-dependent pathways inmacrophage...May 14. (.png) (.svg) (.html) (.csml) Show Crosstalk among Jak-STAT, Toll-like receptor, and ITAM-dependent pathways inmacrophage...T, Toll-like receptor, and ITAM-dependent pathways inmacrophage activation. Authors Hu X, Chen J, Wang L, Iv

  9. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Fei Yu1 2 Chunhua Wang2 Yan Hu2 Jinwen Yin2. School of Computer and Communication Engineering, Changsha University of Science and Technology, Changsha 410004, People's Republic of China; College of Information Science and Engineering, Hunan University, Changsha 410082, People's Republic of China ...

  10. Cloning and homologic analysis of Tpn I gene in silkworm Bombyx ...

    African Journals Online (AJOL)

    Cloning and homologic analysis of Tpn I gene in silkworm Bombyx mori. Y Zhao, Yao Q, X Tang, Q Wang, H Yin, Z Hu, J Lu, K Chen. Abstract. The troponin complex is composed of three subunits, Troponin C (the calcium sensor component) and Troponin T and I (structural proteins). Tpn C is encoded by multiple genes in ...

  11. Ontology Matching Across Domains

    Science.gov (United States)

    2010-05-01

    matching include GMO [1], Anchor-Prompt [2], and Similarity Flooding [3]. GMO is an iterative structural matcher, which uses RDF bipartite graphs to...AFRL under contract# FA8750-09-C-0058. References [1] Hu, W., Jian, N., Qu, Y., Wang, Y., “ GMO : a graph matching for ontologies”, in: Proceedings of

  12. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Properties of ternary NiFeW alloy coating by jet electrodeposition · J K YU J ZHAO M Q YU ... Article ID 43. Effects of static electricity and fabrication parameters on PVDF film properties ..... PING YANG JUN HU YOUCHUN YU BIN WANG ... Studies of thermally assisted interactions of polysulphide polymer with ionic liquids.

  13. Genetic effect of Myf5 gene in rabbit meat quality traits

    Indian Academy of Sciences (India)

    Jie Wang

    2017-09-12

    Sep 12, 2017 ... of muscle specific genes, and it also has an effect on meat deposition capacity and ... long. Jie Wang and Yongsong Hu contributed equally to this work. Polymorphism of Myf5 has .... mal productivity. Except for SNPs 2 and 3 ...

  14. Determination of diferences in runs between boys and girls aged 5.5 Určení rozdílu v běhu mezi chlapci a dívkami ve věku 5,5 roku

    Directory of Open Access Journals (Sweden)

    Damir Karpljuk

    2005-02-01

    Full Text Available The aim of this research is to determine whether there are distinctions in runs among five and a half year old boys and girls. The research is based on studying 80 girls and 64 boys from seven kindergartens in Slovenia. The following five measurement methods have been used in our research: a 10-meter run, a 150-meter run, a 10-meter run with a flying start, 4-times 5-meter run, and a 300-meter run. The results of the t-test indicate a statistically characteristic difference among boys and girls in 300 m run test results only, that is, a method used for measuring aerobic endurance. Other motor skills results have shown that there are no statistically characteristic differences among boys and girls. It is important that sport activities for boys and girls are organized for both groups of children equally. Especially girls must take part in a variety of running exercises in order to increase their aerobic endurance. They should be encouraged to take part in a variety of games which require activating the energy component of movement. Based on the results of this research we can say that physical education (PE of preschool children should be planned regardless of sex and the PE program should be the same for both boys and girls. Cílem tohoto výzkumu je určit, zda existují odlišnosti v běhu chlapců a dívek ve věku 5,5 roku. Výzkum je založen na studii 80 dívek a 64 chlapců v sedmi mateřských školách ve Slovinsku. Bylo použito těchto pěti měřicích metod: běh na 10 metrů, běh na 150 metrů, běh na 10 metrů s letmým startem, běh 4 × 5 metrů, běh na 300 metrů. Výsledky t-testu vykázaly statisticky významný rozdíl mezi chlapci a dívkami jen v běhu na 300 metrů, což je metoda používaná pro měření aerobní vytrvalosti. Výsledky ostatních pohybových aktivit vykazují, že mezi chlapci a dívkami není žádný statisticky významný rozdíl. Je důležité, aby sportovní aktivity byly organizovány rovnom

  15. Autonomic nervous system activity assessment in recreational half marathon runners [Hodnocení aktivity autonomního nervového systému u rekreačních účastníků půlmaratonského běhu

    Directory of Open Access Journals (Sweden)

    David Smékal

    2011-03-01

    competition. It is evident that the causes of soreness or fatigue do not markedly affect ANS activity during a later phase of recovery.[VÝCHODISKA: Spektrální analýza (SA variability srdeční frekvence (VSF je považována za neinvazivní metodu kvantifikace autonomní kardiální regulace sinoatriálního uzlu. Je známo, že autonomní regulace je ovlivňována různými stresory jako například nervozitou nebo tělesnou prací. CÍLE: Cílem předložené studie bylo zhodnotit vliv předstartovního stavu na aktivitu autonomního nervového systému (ANS a dále pak monitorovat časový průběh zotavení ANS paralelně se subjektivně vnímanou únavou v průběhu 24 hodin od ukončení půlmaratonu u amatérských běžců. METODIKA: Autonomní kardiální regulace byla posuzována pomocí metody SA VSF. Aktivita ANS byla hodnocena jeden týden před závodem a v den závodu. Po ukončení závodu proběhla měření aktivity ANS v 1., 12. a 24. hodině. Aktivita ANS byla reprezentována standardními spektrálními parametry a také komplexními indexy SA HRV. K hodnocení velikosti předstartovní nervozity byla využita modifikovaná Likertova 10bodová škála. Subjektivně vnímaná únava byla hodnocena na 6bodové škále. VÝSLEDKY: Vnímání nervozity bylo signifikantně vyšší v den závodu než týden před závody. Signifikantní pokles komplexního indexu sympatovagové balance v den závodu nepřímo svědčil o vzestupu aktivity sympatiku. Ve 12. ani 24. hodině zotavení se již žádný ze sledovaných parametrů VSF signifikantně nelišil od obou vstupních vyšetření. Subjektivně vnímaná únava zůstala zvýšená ještě 24 hodin od ukončení závodu. ZÁVĚRY: Naše práce ukázala, že zvýšená předzávodní nervozita vede k převaze sympatiku v autonomní regulaci zejména během orthostatické stimulace. Dále bylo zjištěno, že aktivita ANS se navrátila na předzátěžovou úroveň během 12. hodiny od ukončení z

  16. First records of three species of Oxycraspedus Kuschel (Coleóptera: Belidae in Argentina and use of a predictive model to compare their potential distribution with the range of their host-plant, Araucaria araucana Primera cita de las tres especies de Oxycraspedus Kuschel (Coleóptera: Belidae en Argentina y uso de un modelo predictivo para comparar su distribución potencial con el rango de su planta huésped, la Araucaria araucana

    Directory of Open Access Journals (Sweden)

    M.S. FERRER

    2007-09-01

    Full Text Available The first records of the three known species of Oxycraspedus Kuschel (Belidae: Oxycoryninae in Argentina are reported, and added to their known distribution in Chile. These weevils are of interest because of their association with the pehuén or monkey puzzle tree, Araucaria araucana, a species of conservation concern. Their distribution data are of value for the protection of biodiversity in natural areas of Patagonia. The potential distribution of Oxycraspedus, as predicted by a model using bioclimatic variables, is coincident as expected, with the geographic range of the araucaria host-plantSe reportan por primera vez en Argentina las tres especies de Oxycraspedus Kuschel (Belidae: Oxycoryninae y se añaden a su distribución en Chile. Estos gorgojos son de interés debido a su asociación con el pehuén Araucaria araucana, una especie de gran interés en temas de conservación. Los datos sobre su distribución son valiosos para proteger la biodiversidad en áreas de la Patagonia. La distribución potencial de Oxycraspedus predicha por un modelo a partir de variables bioclimáticas, es coincidente, como se esperaba, con el rango geográfico de su planta huésped, la araucaria

  17. Wang et al., Afr J Tradit Complement Altern Med. (2016) 13(1):134 ...

    African Journals Online (AJOL)

    PROF ADEWUNMI

    University of Chinese Medicine, Guangzhou 510405, Guangdong Province, China .... (3) Regular diet not addicted to alcohol and tobacco, tea, coffee, etc., normal sleep ... Exclusion criteria: (1) Metal in the body, such as a pacemaker or metal ... (1) Transverse T1-weighted image (T1WI) sequence: 1 min, 51 s, Fast Spin ...

  18. Wang et al., Afr J Tradit Complement Altern Med. (2016) 13(1):134 ...

    African Journals Online (AJOL)

    PROF ADEWUNMI

    ACTIVATION OF DIFFERENT CEREBRAL FUNCTIONAL REGIONS FOLLOWING ACUPUNCTURE AT BOT .... Therefore, on basis of previous studies, in order to explore the brain function ... The location of KI3 and LR3 were identified in .... and face, and perception of space relation; 3) emotion functions, including emotion.

  19. Wang et al., Afr J Tradit Complement Altern Med. (2014) 11(4):89-93 ...

    African Journals Online (AJOL)

    cadewumi

    ... FOR ITS DELIVERY. TO THE KIDNEYS - A REVIEW ... Key words: silencing RNA, kidney disease, targeting proteins, signal pathways. Introduction ... Silencing RNA application in local drug delivery have been effective while system delivery ...

  20. Wang et al., Afr J Tradit Complement Altern Med. (2015) 12(3):183 ...

    African Journals Online (AJOL)

    USER

    Cooney ... There were more than 400,000 deaths caused by breast cancer per year in past few years .... the rates were 24.9±2.9% (P<0.01), 32.8±4.2% (P<0.01) and 44.9±7.7% (P<0.01) at 24 hours' time point. .... triple negative breast cancer.

  1. Wang et al., Afr J Tradit Complement Altern Med. (2015) 12(5):118 ...

    African Journals Online (AJOL)

    Proff.Adewunmi

    Using randomized controlled clinical research method, random number table was generated by statistics software. 30 healthy volunteers ..... Observation on activating effectiveness of acupuncture at acupoints and non-acupoints on different brain ... children with ADHD revealed by resting-state functional MRI. Brain Dev ...

  2. Hiina mõistatus : Wang-Ba ja palju muudki / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2008-01-01

    Artikli autor annab ülevaate Euroopa Välissuhete Nõukogu tegevdirektori Mark Leonardi raamatust "What Does China Think?". Raamatu autori väide on lihtne: selleks, et aru saada maailma poliitikast, tuleb aru saada Hiinas toimuvast

  3. JPRS Report, China, Wang Meng’s ’Hard Thin Gruel’.

    Science.gov (United States)

    1992-03-26

    honey and chocolate, how could our national strength, our science, our technology, our arts, our sports, our housing, our education, our per capita car...bad and diarrhea is not better. If constipation happens, then cure the constipation; if diarrhea happens, then cure the diarrhea. It would be best if...especially Grandfather’s—expression. If Grandfather coughed once, Mother would immedi- ately start muttering, Is there sand in the gruel? Are the pickled

  4. Wang et al., Afr J Tradit Complement Altern Med. (2013) 10(2):251 ...

    African Journals Online (AJOL)

    AJTCAM

    perilla suppressed HCC tumor growth via blocking PI3K/Akt signaling pathway. ... Two hepatoma cell carcinoma-derived cell line-Huh-7 and Hep3B were used as ... system and quantified by Genetools software. β-tubulin was considered as a ...

  5. Understanding Korean experiences of online game hype, identity, and the menace of the "Wang-tta".

    OpenAIRE

    Chee, Florence

    2005-01-01

    THEME: Internationalism: Worlds at Play The context South Korea continues to set the pace in the world of online games. The nation is a world leader in broadband penetration rates and has a very high level of online game playing. This study reports on the intricate relationship between the sociocultural factors at work in Korean game communities and the context of how games are received. The original field research reported here adds to current knowledge of the interplay between science, tech...

  6. Wang et al., Afr J Tradit Complement Altern Med., (2017) 14 (5): 201 ...

    African Journals Online (AJOL)

    implad

    trace elements are maybe other functional compounds for medicinal effects. ... having a variety of biological activities, including anti-aging, immunoregulation, ... Unlike synthetic drugs, herbal medicine is a ... Material (100μg/mL) and were diluted to the corresponding metal solution. .... Isolation, structural characterization,.

  7. Wang and Li Afr J Tradit Complement Altern Med. (2016) 13(1):99 ...

    African Journals Online (AJOL)

    PROF ADEWUNMI

    It possesses antiseptic, anti-inflammatory, analgesic, anti-cancer and antioxidant ... All experiments on animals were conducted in accordance with and after approval by the ... With the content of gallic acid control as horizontal coordinate and the ... The kinetic constants were calculated based on Michaelis-Menten equation ...

  8. Wang et al., Afr J Tradit Complement Altern Med. (2015) 12(4):151 ...

    African Journals Online (AJOL)

    Proff.Adewunmi

    However, antimicrobial treatment increases the risk of antibiotic residues in milk and antimicrobial resistance, ..... Short communication: Antimicrobial efficacy of intramammary treatment with a novel .... factors associated with subclinical mastitis in dairy farms from the high plains of the northern Antioquia, Colombia. J. Dairy ...

  9. How Should English Grammar Be Taught in Middle Schools By Wang Shikun

    Institute of Scientific and Technical Information of China (English)

    王仕坤

    2014-01-01

    This paper mainly deals with the idea that whether grammar teaching should be weakened or not ,the importance of grammar teaching,the present situation of grammar and some suggestions on how to teach grammar ,aiming at the improvement of English teaching and learning.

  10. VizieR Online Data Catalog: BVRI light curves of GR Boo (Wang+, 2017)

    Science.gov (United States)

    Wang, D.; Zhang, L.; Han, X. L.; Lu, H.

    2017-11-01

    We observed the eclipsing binary GR Boo on May 12, 22 and 24 in 2015 using the SARA 90-cm telescope located at Kitt Peak National Observatory, Arizona, USA. This telescope was equipped with an ARC CCD camera with a resolution of 2048x2048pixels but used at 2x2 binning, resulting in 1024x1024pixels. We used the Bessel BVRI filters. (1 data file).

  11. VizieR Online Data Catalog: AQ Boo VRI differential light curves (Wang+, 2016)

    Science.gov (United States)

    Wang, S.; Zhang, L.; Pi, Q.; Han, X. L.; Zhang, X.; Lu, H.; Wang, D.; Li, T.

    2016-11-01

    On March 22 and April 19 in 2014, we observed AQ Boo with the 60cm telescope at Xinglong Station of the National Astronomical Observatories of China (NAOC). The CCD camera on this telescope has a resolution of 1024 x 1024 pixels and its corresponding field of view is 17'x17' (Yang, 2013NewA...25..109Y). The other three days of data were obtained using the 1-m telescope at Yunnan Observatory of Chinese Academy of Sciences, on January 20, 21 and February 28 in 2015. The CCD camera on this telescope has a resolution of 2048x2048 pixels and its corresponding field of view is 7.3'x7.3'. Bessel VRI filters were used. The exposure times are 100-170s, 50-100s and 50-80s in the V, R, I bands, respectively. (1 data file).

  12. Computational Thermodynamics of Materials Zi-Kui Liu and Yi Wang

    Energy Technology Data Exchange (ETDEWEB)

    Devanathan, Ram

    2017-02-01

    This authoritative volume introduces the reader to computational thermodynamics and the use of this approach to the design of material properties by tailoring the chemical composition. The text covers applications of this approach, introduces the relevant computational codes, and offers exercises at the end of each chapter. The book has nine chapters and two appendices that provide background material on computer codes. Chapter 1 covers the first and second laws of thermodynamics, introduces the spinodal as the limit of stability, and presents the Gibbs-Duhem equation. Chapter 2 focuses on the Gibbs energy function. Starting with a homogeneous system with a single phase, the authors proceed to phases with variable compositions, and polymer blends. The discussion includes the contributions of external electric and magnetic fields to the Gibbs energy. Chapter 3 deals with phase equilibria in heterogeneous systems, the Gibbs phase rule, and phase diagrams. Chapter 4 briefly covers experimental measurements of thermodynamic properties used as input for thermodynamic modeling by Calculation of Phase Diagrams (CALPHAD). Chapter 5 discusses the use of density functional theory to obtain thermochemical data and fill gaps where experimental data is missing. The reader is introduced to the Vienna Ab Initio Simulation Package (VASP) for density functional theory and the YPHON code for phonon calculations. Chapter 6 introduces the modeling of Gibbs energy of phases with the CALPHAD method. Chapter 7 deals with chemical reactions and the Ellingham diagram for metal-oxide systems and presents the calculation of the maximum reaction rate from equilibrium thermodynamics. Chapter 8 is devoted to electrochemical reactions and Pourbaix diagrams with application examples. Chapter 9 concludes this volume with the application of a model of multiple microstates to Ce and Fe3Pt. CALPHAD modeling is briefly discussed in the context of genomics of materials. The book introduces basic thermodynamic concepts clearly and directs readers to appropriate references for advanced concepts and details of software implementation. The list of references is quite comprehensive. The authors make liberal use of diagrams to illustrate key concepts. The two Appendices at the end discuss software requirements and the file structure, and present templates for special quasi-random structures. There is also a link to download pre-compiled binary files of the YPHON code for Linux or Microsoft Windows systems. The exercises at the end of the chapters assume that the reader has access to VASP, which is not freeware. Readers without access to this code can work on a limited number of exercises. However, results from other first principles codes can be organized in the YPHON format as explained in the Appendix. This book will serve as an excellent reference on computational thermodynamics and the exercises provided at the end of each chapter make it valuable as a graduate level textbook. Reviewer: Ram Devanathan is Acting Director of Earth Systems Science Division, Pacific Northwest National Laboratory, USA.

  13. Wang et al., Afr J Tradit Complement Altern Med. (2014) 11(6):92-104

    African Journals Online (AJOL)

    cadewumi

    Every year, millions of people suffer the danger of major disability or even death from burns, caused by hot water, flame and boiling oil. People ... Burn Liniment has been used for burn treatment since ancient times in China, and achieved exact curative effect in clinical trials.The objective of ... respectively were taken.

  14. Analysis of Optical Variations of BL Lac Object AO 0235+164 Wang ...

    Indian Academy of Sciences (India)

    obtain statistically meaningful values for the cross-correlation time lags ... deviation, the fifth represents the largest variations, the sixth represents the fractional ..... 6. Conclusions. The multi-band optical data are collected on the object of AO 0235 + 164. The time lags among the B, V, R and I bands have been analysed.

  15. Optical Spectra Evolution of BL Lac Objects XW Bi1,∗ , BZ Wang2

    Indian Academy of Sciences (India)

    low-frequency peaked BL Lac objects (LBLs) is steeper than the high- frequency peaked BL Lac ... vision of BL Lac objects. Many investigators .... We are grateful to the Scientific Research Foundation of the Education Department of Yunnan ...

  16. Unexpected dehydrogenation behaviors of the 2LiBH4-MgH2 composite confined in a mesoporous carbon scaffold

    CSIR Research Space (South Africa)

    Wang, K

    2014-11-01

    Full Text Available Chemistry C Vol. 118(46) Unexpected Dehydrogenation Behaviors of the 2LiBH4−MgH2 Composite Confined in a Mesoporous Carbon Scaffold Kuikui Wang,†,‡ Xiangdong Kang,*,‡ Yujie Zhong,‡ Chaohao Hu,§ Jianwei Ren,⊥ and Ping Wang*,‡ †University... of Science and Technology of China, Hefei 230026, P. R. China ‡Shenyang National Laboratory for Materials Science, Institute of Metal Research, Chinese Academy of Sciences, Shenyang 110016, P. R. China §Guangxi Key Laboratory of Information Materials...

  17. MicroRNA-200c: A Novel Way to Attack Breast Cancer Metastases by Restoring the Epithelial Phenotype

    Science.gov (United States)

    2012-02-01

    other provision of law , no person shall be subject to any penalty for failing to comply with a collection of information if it does not display a...biallelic loss of Dicer1 promotes tumorigenesis in vivo. Cell Death Differ 17 (4):633–641 38. Law JH, Habibi G, Hu K, Masoudi H, Wang MY, Stratford AL...Reinhardt F, Benaich N, Calogrias D, Szasz AM, Wang ZC, et al. A pleiotropically acting microRNA, miR-31, inhibits breast cancer metastasis. Cell

  18. Névtani kérdések a nyest.hu-n. [Onomastic questions on nyest.hu website

    Directory of Open Access Journals (Sweden)

    Haindrich, Helga Anna

    2013-12-01

    Full Text Available Since the 1st of June 2009, members of the general public have been able to visit a Hungarian website focusing on national and international news and events concerning Linguistic Studies. The portal classifies the current news according to their topics; thus, writings on onomastic questions can be found under the heading Proper Names. Most relevant articles deal with place names; other writings – in order of decreasing frequency – discuss personal names, names for institutions, names for animals, names for artefacts, and trade names. The portal not only shares news and knowledge, but also offers services such as a help desk for problems in translation, text ergonomics and Linguistics. The opportunity to comment on articles and launch forums or blogs to initiate a discourse on topical issues is also provided by the webmaster. The website, by presenting interesting news and topics in connection with proper names, plays a vital role in disseminating factual knowledge relating to Onomastics.

  19. Diagnosis of angiomyolipoma using computed tomography-region of interest ≤-10 HU or 4 adjacent pixels ≤-10 HU are recommended as the diagnostic thresholds

    International Nuclear Information System (INIS)

    Simpson, E.; Patel, U.

    2006-01-01

    AIM: To study and compare the diagnostic accuracy of region of interest (ROI) density measurement and pixel mapping [computed tomography (CT) density of individual pixels] for the diagnosis of renal angiomyolipoma (AML) using CT. MATERIALS AND METHODS: A study group of histologically proven AMLs was compared with a control group of histologically proven renal cell cancers, normal renal parenchyma, and simple renal cysts. The mean tissue density (ROI circle) and a pixel density map were recorded. The diagnostic accuracy of various thresholds of ROI and pixel mapping values were compared using receiver operating characteristic curves. RESULTS: Twenty-two AMLs, 16 renal cell carcinomas (RCCs), 30 simple cysts, and 30 sites of renal parenchyma were evaluated. The mean (±1 SD) density of the AMLs was significantly lower [-15.2(20.8) units] than the three control groups [+36.0(8.1) units, +5.4(3.4) units and +22.2(46.5) units for RCC, renal cyst and parenchyma respectively; p<0.001 (analysis of variance)]. The sensitivities and specificities of the ROI diagnostic thresholds of ≤0 units, ≤-10 units and ≤-20 units were 77 and 97%, 73 and 100% and 50 and 100%, respectively. Using pixel mapping [diagnostic thresholds of either a line of 4 pixels ≤-10 units or a square of 4 pixels ≤-10 units] the sensitivity improves to 86% with a specificity of 97%. CONCLUSION: Although a ROI threshold value of ≤-10 units has a very high specificity (100% in the present study) the sensitivity is modest at only 73%. Pixel mapping is more sensitive for recognizing small clusters of fat. In practice, both methods can be recommended for the analysis of suspected AMLs. ROI density measurement is convenient when analysing large areas of suspected fat and ≤-10 units should be used as the diagnostic threshold. When faced with small lucent areas or indeterminate values after ROI analysis, pixel mapping is recommended using a line of 4 pixels ≤-10 units or a square of 4 pixels ≤-10 units as the discriminating thresholds

  20. China Report: Political, Sociological and Military Affairs.

    Science.gov (United States)

    1983-03-18

    Production Brigade of Guangbao Commune in raising chickens and rabbits in a big way. We must mobilize the commune member house- holds to utilize...The state and the commune, production brigades, and production teams operate fish farms, some of which raise fry . Why not go ahead with raising fish...Wei Xinyi, Huang Yu, Yang Jike, Guo Tixiang, Meng Fulin, Hu Tan, Zhu Nong, Fang Shiliang, Wang Zenong, Pan Ezhang, Liu Zhengwen, Chen Tianren, Ma

  1. Protecting Networks Via Automated Defense of Cyber Systems

    Science.gov (United States)

    2016-09-01

    gray-hats/. 61 Hu, Youfan, Yan Zhang, Chen Xu, Long Lin, Robert L. Snyder, and Zhong Lin Wang. “Self-Powered System with Wireless Data Transmission ...wires will almost completely cease to exist, replaced by mobile nanodevices, which are tiny computers measured in nanometers with integrated wireless ... energy companies, was hypothesized to cost $10,000. Raiu went on to opine, “The cost of entry for [advanced persistent threats] is decreasing …. We’re

  2. Toxicity evaluation of biodegradable chitosan nanoparticles using a zebrafish embryo model

    OpenAIRE

    Hu YL; Qi W; Han F; Shao JZ; Gao JQ

    2011-01-01

    Yu-Lan Hu1, Wang Qi1, Feng Han2, Jian-Zhong Shao3, Jian-Qing Gao11Institute of Pharmaceutics, College of Pharmaceutical Sciences, 2Institute of Pharmacology, Toxicology and Biochemical Pharmaceutics, 3College of Life Sciences, Key Laboratory for Cell and Gene Engineering of Zhejiang Province, Zhejiang University, Hangzhou, Zhejiang, People's Republic of ChinaBackground: Although there are a number of reports regarding the toxicity evaluation of inorganic nanoparticles, knowledge on bi...

  3. China Report, Political, Sociological and Military Affairs

    Science.gov (United States)

    1985-07-16

    the dual fermentation method, tech- nology to reclaim sugar residue, technology to make glucose from rice, fructose and dextrose syrup and other...Hu Wenjun [5170 2429 0689], Su Mingkun [5685 2494 0981], Wang Qian [3769 0241] and other conrades to suc- cessfully trial-produce an oral glucose of...company, the comrades praise in unison his high sense of responsibility toward the enterprise and say that old friend Hong is now like a fish in water

  4. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. C H Xia. Articles written in Bulletin of Materials Science. Volume 34 Issue 5 August 2011 pp 1033-1037. Synthesis of Mn-doped CeO2 nanorods and their application as humidity sensors · C H Hu C H Xia F Wang M Zhou P F Yin X Y Han · More Details Abstract Fulltext PDF.

  5. Ühinemise ja iseolemise vastuseis. Ideaalid ja reaalsus / Rein Tootmaa

    Index Scriptorium Estoniae

    Tootmaa, Rein

    2001-01-01

    Mängufilmid "Keiser ja palgamõrtsukas" ("Jing ke ci qin wang") : režissöör Chen Kaige : Jaapan-Hiina-Prantsusmaa 1999 ja "Tiiger ja draakon" ("Wo hu chang long") : režissöör Ang Lee : Hiina-Hongkong-Ameerika Ühendriigid 2000. Lisa : Aare Ermeli koostatud Chen Kaige ja Ang Lee loomingu lühikokkuvõtted. Kokkuvõte inglise keeles lk. 128

  6. Cross-plane Thermoelectric Transport in p-type La0.67Sr0.33MnO3/LaMnO3 Oxide Metal/Semiconductor Superlattices

    Science.gov (United States)

    2013-12-07

    fre- quency of 5 Hz, and temperature maintained at 750 C measured using an infrared pyrometer (STO emissivity of 0.8). The target was mechanically...thermoelectric transport Thermal conductivity of LSMO/LMO superlattices was measured using a photo- acoustic (PA) technique.18,19 The high resistivity...multilayer material,” J. Appl. Phys. 86(7), 3953 (1999). 19X. W. Wang, H. P. Hu, and X. F. Xu, “Photo- acoustic measurement of thermal conductivity of

  7. Criticality of the random-site Ising model: Metropolis, Swendsen-Wang and Wolff Monte Carlo algorithms

    Directory of Open Access Journals (Sweden)

    D.Ivaneyko

    2005-01-01

    Full Text Available We apply numerical simulations to study of the criticality of the 3D Ising model with random site quenched dilution. The emphasis is given to the issues not being discussed in detail before. In particular, we attempt a comparison of different Monte Carlo techniques, discussing regions of their applicability and advantages/disadvantages depending on the aim of a particular simulation set. Moreover, besides evaluation of the critical indices we estimate the universal ratio Γ+/Γ- for the magnetic susceptibility critical amplitudes. Our estimate Γ+/Γ- = 1.67 ± 0.15 is in a good agreement with the recent MC analysis of the random-bond Ising model giving further support that both random-site and random-bond dilutions lead to the same universality class.

  8. [Commentary on "group and organization: a dimension of collaboration of anthropology and epidemiology" by Song LM and Wang N].

    Science.gov (United States)

    Liao, Su-Su; Zhang, Qing-Ning; Hou, Lei

    2012-10-01

    Epidemiology, as the study of occurrence and distribution of diseases or health events in specified populations and the application of the study to control health problems, is not just a method to study determinants of diseases at individual level through analysis of mass data based on individuals. To achieve the aims on the control of health problems in specified populations, Epidemiology should be public health-oriented to reduce incidence, prevalence and mortality, and should include study on determinants at the population level. Interdisplinarity and systems science will facilitate the breakthrough in improving health of the populations.

  9. A new morphological type of operculate microspore, Discinispora sinensis gen. nov., from the Permian petrified Noeggerathialean strobilus Discinites sinensis Wang

    Czech Academy of Sciences Publication Activity Database

    Wang, J.; Zhang, G.; Bek, Jiří; Pfefferkorn, H. W.

    2004-01-01

    Roč. 128, č. 1 (2004), s. 1-17 ISSN 0034-6667 Grant - others:Chinese National Natural Science Foundation(CN) 40102002; NIGPAS(CN) 003102; NIGPAS(CN) 023117 Institutional research plan: CEZ:AV0Z3013912 Keywords : in situ spores * Noeggerathiales * Permian Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.886, year: 2004

  10. Risky Choice with Heuristics: Reply to Birnbaum (2008), Johnson, Schulte-Mecklenbeck, and Willemsen (2008), and Rieger and Wang (2008)

    Science.gov (United States)

    Brandstatter, Eduard; Gigerenzer, Gerd; Hertwig, Ralph

    2008-01-01

    E. Brandstatter, G. Gigerenzer, and R. Hertwig (2006) showed that the priority heuristic matches or outperforms modifications of expected utility theory in predicting choice in 4 diverse problem sets. M. H. Birnbaum (2008) argued that sets exist in which the opposite is true. The authors agree--but stress that all choice strategies have regions of…

  11. Impact Analysis of Peng-Hu Power System Connected with a Photovoltaic System

    DEFF Research Database (Denmark)

    Wang, Li; Nguyen, Ha Thi; Yan, Chih-Hao

    2014-01-01

    With the rapid increase of photovoltaic (PV) systems installed in power systems in the recent years, the negative impacts on power quality of distribution networks due to highpenetration PV systems can be increased. This paper presents the system-impact analyzed results of a 0.6-MW PV system conn...

  12. The Comparison Study of gas source between two hydrate expeditions in ShenHu area, SCS

    Science.gov (United States)

    Cong, X. R.

    2016-12-01

    Two gas hydrate expeditions (GMGS 01&03) were conducted in the Pearl River Mouth Basin, SCS, which were organized by Guangzhou Marine Geological Survey in 2007 and 2015, respectively. Compared with the drilling results of "mixed bio-thermogenic gas and generally dominated by biogenic gas" in 2007, hydrocarbon component measurements revealed a higher content of ethane and propane in 2015 drilling, providing direct evidence that deep thermogenic gas was the source for shallow hydrate formation. According to the geochemical analyses of the results obtained from the industrial boreholes in Baiyun sag, the deep hydrocarbon gas obviously leaked from the reservoir as escape caused by Dongsha movement in the late Miocene, as a result thermogenic gas from Wenchang, Enping and Zhuhai hydrocarbon source rocks migrated to late Miocene shallow strata through faults, diapirs and gas chimney vertically migration. In this paper we report the differences in fluid migration channel types and discuss their effect in fluid vertical migration efficiency in the two Shenhu hydrate drilling areas. For the drilling area in 2007,when the limited deep thermogenic gas experienced long distance migration process from bottom to up along inefficient energy channel, the gas composition might have changed and the carbon isotope fractionation might have happened, which were reflected in the results of higher C1/C2 ratios and lighter carbon isotope in gas hydrate bearing sediments. As a result the gas is with more "biogenic gas" features. It means thermogenic gases in the deep to contributed the formation of shallow gas hydrate indirectly in 2007 Shenhu drill area. On another hand, the gases were transported to the shallow sediment layers efficiently, where gas hydrate formed, through faults and fractures from deep hydrocarbon reservoirs, and as the result they experienced less changes in both components and isotopes in 2015 drilling site.

  13. The SCID-hu mouse and its application to human radiation biology

    International Nuclear Information System (INIS)

    Kyoizumi, Seishi; Akiyama, Mitoshi; McCune, J.M.; Namikawa, Reiko.

    1993-01-01

    The radiobiological study of humans has been hampered by a lack of suitable in vivo experimental models. Of course, acute and chronic radiation effects in humans have been documented in the studies of atomic bomb (A-bomb) survivors and patients irradiated either by therapeutic intent or by accident. However, the information gained from these studies has been limited by the difficulties in estimating precise radiation doses and in obtaining biological samples for directly analyzing the processes of radiation-induced pathogenesis. With these issues in mind, we propose that the severe combined immunodeficient mouse-human chimera can be used as an in vivo experimental model for human radiation biology. We have developed techniques by which normal human bone marrow can be implanted into immunodeficient C.B-17 scid/scid (SCID) mice (S. Kyoizumi et al, Blood 79, 1704, 1992). We have report that this in vivo model can be used for the analysis of radiation damage to human bone marrow. After whole-body irradiation of the engrafted animals, human progenitor cells within the human marrow were destroyed in a dose-dependent manner (D 0 = 0.7-1.0Gy, n = 1.0). Acute hematotoxicity was reduced when the radioprotective agent (WR-2721) was administered prior to irradiation. After low dose irradiation, the recovery of human progenitor activity was accelerated by treatment with human granulocyte-colony stimulating factor (G-CSF). This small animal model may prove amenable for the risk analysis of human radiation exposure as well as for the development of new modalities for the prevention and treatment of radiotoxic damage to the human hematopoietic system. (author)

  14. [Sex pheromone secondary components of Indian meal moth Plodia interpunctella in China. HU wenlil 2, DU].

    Science.gov (United States)

    Hu, Wenli; Du, Jiawei

    2005-09-01

    Indian meal moth Plodia interpunctella Hübner (Lepidoptera: Pyralidae) is considered as an important insect pest infesting stored grains and other products in China. The major sex pheromone component of P. interpunctella, Z9, E12-14: OAc (TDA), has already been identified. Though the efficiency of male capture by using the bait with this component alone is quite good, the pheromone system is far from fully understood. The identification with capillary chromatographic analysis and GC-MS methods showed that there were four main components, i. e., Z9, E12-14: OAc(A), Z9, E12-14: OH (B), Z9, E12-14: Ald(C), and Z9-14: OAc(D), in the sex pheromone gland of female P. interpunctella, and the ratio of these four components was A: B: C:D= 100:22: 12:9. Wind tunnel experimental results suggested that the response of male P. interpunctella to a blend (A: B: C: D = 8:2:1:0.8) was not significantly different from that to female sex pheromone gland extracts.

  15. Page 1 Hu TropJ ObstetGynaecol, 18 (2), October 2001. A Review of ...

    African Journals Online (AJOL)

    This may be partly due to the low antibody screening (and titration) at 4-weekly prevalence of Rhesus (Rh) negative blood ... The women's biodata, parity, previous history of administration of anti-D globulin, the partner's blood ... were nulliparae"with previous history of abortion and. 47 (61.0%) were parous. Of the 44 women ...

  16. Anodic Oxidation of 18 Halogenated and/or Methylated Derivatives of CB(11)Hu(12)(-)

    Czech Academy of Sciences Publication Activity Database

    Wahab, Abdul; Douvris, C.; Klíma, Jiří; Šembera, F.; Ugolotti, J.; Kaleta, J.; Ludvík, Jiří; Michl, J.

    2017-01-01

    Roč. 56, č. 1 (2017), s. 269-276 ISSN 0020-1669 R&D Projects: GA ČR GAP206/11/0727 Institutional support: RVO:61388955 Keywords : WEAKLY COORDINATING ANIONS * DODECAMETHYLCARBA-CLOSO-DODECABORANYL * ICOSAHEDRAL CARBORANE ANIONS Subject RIV: CG - Electrochemistry OBOR OECD: Electrochemistry (dry cells, batteries, fuel cells, corrosion metals, electrolysis) Impact factor: 4.857, year: 2016

  17. Anodic Oxidation of 18 Halogenated and/or Methylated Derivatives of CB(11)Hu(12)(-)

    Czech Academy of Sciences Publication Activity Database

    Wahab, Abdul; Douvris, C.; Klíma, J.; Šembera, Filip; Ugolotti, Juri; Kaleta, Jiří; Ludvík, J.; Michl, Josef

    2017-01-01

    Roč. 56, č. 1 (2017), s. 269-276 ISSN 0020-1669 Institutional support: RVO:61388963 Keywords : weakly coordinating anions * dodecamethylcarba-closo-dodecaboranyl * icosahedral carborane anions Subject RIV: CA - Inorganic Chemistry OBOR OECD: Inorganic and nuclear chemistry Impact factor: 4.857, year: 2016

  18. World Energy Data System (WENDS). Volume VIII. Nuclear facility profiles, CO--HU. [Brief tabulated information

    Energy Technology Data Exchange (ETDEWEB)

    1979-06-01

    In this compendium each profile of a nuclear facility is a capsule summary of pertinent facts regarding that particular installation. The facilities described include the entire fuel cycle in the broadest sense, encompassing resource recovery through waste management. Power plants and all US facilities have been excluded. To facilitate comparison the profiles have been recorded in a standard format. Because of the breadth of the undertaking some data fields do not apply to the establishment under discussion and accordingly are blank. The set of nuclear facility profiles occupies four volumes; the profiles are ordered by country name, and then by facility code. Each nuclear facility profile volume contains two complete indexes to the information. The first index aggregates the facilities alphabetically by country. It is further organized by category of facility, and then by the four-character facility code. It provides a quick summary of the nuclear energy capability or interest in each country and also an identifier, the facility code, which can be used to access the information contained in the profile.

  19. Sledování průběhu malolaktické fermentace

    OpenAIRE

    Štětkářová, Lucie

    2014-01-01

    Malolactic fermentation (MLF), or malolactic fermentation is a process which converts Malic acid to lactic acid. Made with lactic fermentation bacteria. There are different kinds of lactic acid bacteria -- positive (Oenococcus oeni) and negative (Lactobacillus, Pediococcus). Malolactic fermentation on wine by reducing acidity, improves the stability of microbial and sensory properties of wine. Malolactic fermentation we can perform before the alcoholic fermentation, during alcoholic fermentat...

  20. World Energy Data System (WENDS). Volume VIII. Nuclear facility profiles, CO--HU

    International Nuclear Information System (INIS)

    1979-06-01

    In this compendium each profile of a nuclear facility is a capsule summary of pertinent facts regarding that particular installation. The facilities described include the entire fuel cycle in the broadest sense, encompassing resource recovery through waste management. Power plants and all US facilities have been excluded. To facilitate comparison the profiles have been recorded in a standard format. Because of the breadth of the undertaking some data fields do not apply to the establishment under discussion and accordingly are blank. The set of nuclear facility profiles occupies four volumes; the profiles are ordered by country name, and then by facility code. Each nuclear facility profile volume contains two complete indexes to the information. The first index aggregates the facilities alphabetically by country. It is further organized by category of facility, and then by the four-character facility code. It provides a quick summary of the nuclear energy capability or interest in each country and also an identifier, the facility code, which can be used to access the information contained in the profile

  1. Vliv stimulace silových schopností na rovnováhu

    OpenAIRE

    Škoda, Jan

    2013-01-01

    3 ABSTRACT Title of thesis: Impact of stimulation of power abilities on balance Aim of thesis: Verification of effectiveness of power workouts for stable and unstable supporting surfaces and the impact thereof on balance. Methods: An experimental method was used, with two groups of probands completing a three-month power training programme. The programme included power workouts with balance equipment for the first group and similar power workouts on a stable mat for the second group. The whol...

  2. The role of bioactive substances in controlling foodborne pathogens derived from Metasequoia glyptostroboides Miki ex Hu.

    Science.gov (United States)

    Bajpai, Vivek K; Na, Minkyun; Kang, Sun Chul

    2010-07-01

    In an attempt to isolate bioactive substances, ethyl acetate cone extract of Metasequoia glyptostroboides was subjected to a column chromatographic analysis that resulted in isolation of an abietane type diterpenoid, taxoquinone. Its structure was elucidated by spectroscopic means. In further, taxoquinone showed potential antibacterial effect as diameters of zones of inhibition against foodborne pathogenic bacteria such as Listeria monocytogenes ATCC 19166, Salmonella typhimurium KCTC 2515, Salmonella enteritidis KCTC 2021, Escherichia coli ATCC 8739, E. coli O157:H7 ATCC 43888, Enterobacter aerogenes KCTC2190, Staphylococcus aureus ATCC 6538 and S. aureus KCTC 1916, which were found in the range of 10.6-15.8mm. The minimum inhibitory concentration (MIC) and minimum bactericidal concentration (MBC) values of taxoquinone against the employed bacterial pathogens were found in the range of 62.5-250 and 125-500 microg/ml. Also the compound had strong antibacterial effect on the viable counts of the tested bacteria. Further, scanning electron microscopic study demonstrated potential detrimental effect of taxoquinone on the morphology of E. coli ATCC 8739. These findings indicate that bioactive compound taxoquinone present in M. glyptostroboides could be used as a promising antibacterial agent in food industry to inhibit the growth of certain important foodborne pathogens. 2010 Elsevier Ltd. All rights reserved.

  3. Antibacterial abietane-type diterpenoid, taxodone from Metasequoia glyptostroboides Miki ex Hu.

    Science.gov (United States)

    Bajpai, Vivek K; Kang, Sun Chul

    2010-12-01

    In an attempt to isolate bioactive constituents, ethyl acetate cone extract of Metasequoia glyptostroboides was subjected to a column chromatographic analysis that resulted in isolation of an abietane-type diterpenoid, taxodone. Its structure was elucidated by spectroscopic means. Further, taxodone showed potential antibacterial effect as diameters of zones of inhibition against foodborne pathogenic bacteria, such as Listeria monocytogenes ATCC 19166, Salmonella typhimurium KCTC 2515, S. enteritidis KCTC 2021, Escherichia coli ATCC 8739, E. coli O157:H7 ATCC 43888, Enterobacter aerogenes KCTC 2190, Staphylococcus aureus ATCC 6538 and S. aureus KCTC 1916, were found in the range of 9.4 to 14.2 mm. The minimum inhibitory concentration (MIC) and minimum bactericidal concentration (MBC) values of taxodone against the employed bacterial pathogens were found in the range of 250 to 1000 and 250 to less than 2000 microg/ml, respectively. Also the compound had a strong antibacterial effect on the viable counts of the tested bacteria. These findings indicate that the bioactive compound taxodone present in M. glyptostroboides could be used as an antibacterial agent in food industry to inhibit the growth of certain important foodborne pathogens.

  4. Impacts of elevated ozone on growth and photosynthesis of Metasequoia glyptostroboides Hu et Cheng.

    Science.gov (United States)

    Zhang, Weiwei; Feng, Zhaozhong; Wang, Xiaoke; Niu, Junfeng

    2014-09-01

    One-year-old Metasequoia glyptostroboides seedlings were exposed to non-filtered ambient air (NF) and elevated ozone (E-O3, NF+60 ppb) in open-top chambers for two years. E-O3 accelerated leaf senescence, as indicated by significant decreases in photosynthetic pigment contents with the elongation of O3 exposure. E-O3 significantly affected gas exchange and carboxylation, inducing reductions in light-saturated photosynthesis (Asat), the maximum activity of Rubisco (Vc,max) and the maximum electron transport rate (Jmax). Chl a/b, Vc,max/Jmax and stomatal limitation (l) were not affected. Stomatal conductance (gs) was significantly decreased by E-O3 in the first year, but remained unchanged in the second year. It can be inferred that the decrease in Asat by E-O3 was mainly attributed to the changes in non-stomatal factors. After two years' exposure, E-O3 caused significant decreases in canopy photosynthesis and leaf mass per area, and a significant increase in the number of branches, but induced slight, not significant decreases in growth and biomass. Therefore, it can be concluded that the carbon accumulation of the species M. glyptostroboides could be negatively affected after long-term exposure to high O3 concentration. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

  5. Anatomical studies on the development of Metasequoia glyptostroboides Hu et Cheng wood

    Directory of Open Access Journals (Sweden)

    Alina Hejnowicz

    2015-01-01

    Full Text Available Variability of anatomical characters within a 15 year old stem is presented by the method of contour lines, where against a schematic longitudinal section of a stem points corresponding to the same values for a character are joined by lines, similarly as altitudes in cartography. The method permits prediction of future trends in character changes. It was thus established that tracheid dimensions and diameter of bordered pits in early wood tracheids increase with age of tree and do not reach maximal values before the 15th year. The annual ring width and the height of the rays attain maximal values before the 15th year while the dimensions of ray cells and the percentage of late wood reach almost constant values during the first year or two.

  6. Temporal and spatial characteristics of male cone development in Metasequoia glyptostroboides Hu et Cheng.

    Science.gov (United States)

    Jin, Biao; Tang, Liang; Lu, Yan; Wang, Di; Zhang, Min; Ma, Jiuxia

    2012-12-01

    Metasequoia glyptostroboides, a famous relic species of conifer that survived in China, has been successfully planted in large numbers across the world. However, limited information on male cone development in the species is available. In this study, we observed the morphological and anatomical changes that occur during male cone development in M. glyptostroboides using semi-thin sections and scanning electron microscopy. The male cones were borne oppositely on one-year-old twigs that were mainly located around the outer and sunlit parts of crown. Male cones were initiated from early September and shed pollen in the following February. Each cone consisted of spirally arranged microsporophylls subtended by decussate sterile scales, and each microsporophyll commonly consisted of three microsporangia and a phylloclade. The microsporangial wall was composed of an epidermis, endothecium, and tapetum. In mid-February, the endothecium and tapetum layers disintegrated, and in the epidermal layer the cell walls were thickened with inner protrusions. Subsequently, dehiscence of the microsporangia occurred through rupturing of the microsporangial wall along the dehiscence line. These results suggest that the structure, morphology, architecture and arrangement of male cones of M. glyptostroboides are mainly associated with the production, protection and dispersal of pollen for optimization of wind pollination.

  7. Reporting of Human Genome Epidemiology (HuGE association studies: An empirical assessment

    Directory of Open Access Journals (Sweden)

    Gwinn Marta

    2008-05-01

    Full Text Available Abstract Background Several thousand human genome epidemiology association studies are published every year investigating the relationship between common genetic variants and diverse phenotypes. Transparent reporting of study methods and results allows readers to better assess the validity of study findings. Here, we document reporting practices of human genome epidemiology studies. Methods Articles were randomly selected from a continuously updated database of human genome epidemiology association studies to be representative of genetic epidemiology literature. The main analysis evaluated 315 articles published in 2001–2003. For a comparative update, we evaluated 28 more recent articles published in 2006, focusing on issues that were poorly reported in 2001–2003. Results During both time periods, most studies comprised relatively small study populations and examined one or more genetic variants within a single gene. Articles were inconsistent in reporting the data needed to assess selection bias and the methods used to minimize misclassification (of the genotype, outcome, and environmental exposure or to identify population stratification. Statistical power, the use of unrelated study participants, and the use of replicate samples were reported more often in articles published during 2006 when compared with the earlier sample. Conclusion We conclude that many items needed to assess error and bias in human genome epidemiology association studies are not consistently reported. Although some improvements were seen over time, reporting guidelines and online supplemental material may help enhance the transparency of this literature.

  8. Genetic factors affecting statin concentrations and subsequent myopathy: a HuGENet systematic review

    Science.gov (United States)

    Canestaro, William J.; Austin, Melissa A.; Thummel, Kenneth E.

    2015-01-01

    Statins, 3-hydroxy-3-methyl-glutaryl-coenzyme A reductase inhibitors, have proven efficacy in both lowering low-density-lipoprotein levels and preventing major coronary events, making them one of the most commonly prescribed drugs in the United States. Statins exhibit a class-wide side effect of muscle toxicity and weakness, which has led regulators to impose both dosage limitations and a recall. This review focuses on the best-characterized genetic factors associated with increased statin muscle concentrations, including the genes encoding cytochrome P450 enzymes (CYP2D6, CYP3A4, and CYP3A5), a mitochondrial enzyme (GATM), an influx transporter (SLCO1B1), and efflux transporters (ABCB1 and ABCG2). A systematic literature review was conducted to identify relevant research evaluating the significance of genetic variants predictive of altered statin concentrations and subsequent statin-related myopathy. Studies eligible for inclusion must have incorporated genotype information and must have associated it with some measure of myopathy, either creatine kinase levels or self-reported muscle aches and pains. After an initial review, focus was placed on seven genes that were adequately characterized to provide a substantive review: CYP2D6, CYP3A4, CYP3A5, GATM, SLCO1B1, ABCB1, and ABCG2. All statins were included in this review. Among the genetic factors evaluated, statin-related myopathy appears to be most strongly associated with variants in SLCO1B1. PMID:24810685

  9. Paraneoplastic neurological syndromes with anti-hu antibodies : Pathogenesis and treatment

    NARCIS (Netherlands)

    A.H.C. de Jongste (Arjen)

    2015-01-01

    markdownabstract__Abstract__ Paraneoplastic neurological syndromes (PNS) are remote effects of cancer that are neither caused by invasion of the tumor or its metastasis, nor by infection, ischemia, metabolic and nutritional deficits, surgery or other forms of tumor treatment.1 PNS cause severe

  10. HuRECA: Human Reliability Evaluator for Computer-based Control Room Actions

    International Nuclear Information System (INIS)

    Kim, Jae Whan; Lee, Seung Jun; Jang, Seung Cheol

    2011-01-01

    As computer-based design features such as computer-based procedures (CBP), soft controls (SCs), and integrated information systems are being adopted in main control rooms (MCR) of nuclear power plants, a human reliability analysis (HRA) method capable of dealing with the effects of these design features on human reliability is needed. From the observations of human factors engineering verification and validation experiments, we have drawn some major important characteristics on operator behaviors and design-related influencing factors (DIFs) from the perspective of human reliability. Firstly, there are new DIFs that should be considered in developing an HRA method for computer-based control rooms including especially CBP and SCs. In the case of the computer-based procedure rather than the paper-based procedure, the structural and managerial elements should be considered as important PSFs in addition to the procedural contents. In the case of the soft controllers, the so-called interface management tasks (or secondary tasks) should be reflected in the assessment of human error probability. Secondly, computer-based control rooms can provide more effective error recovery features than conventional control rooms. Major error recovery features for computer-based control rooms include the automatic logic checking function of the computer-based procedure and the information sharing feature of the general computer-based designs

  11. Assessing the People’s Liberation Army in the Hu Jintao Era

    Science.gov (United States)

    2014-04-01

    before China’s transportation and communications infrastructure was modernized. However, with cell phones, computers, the Internet, and...physical stamina , and political indoctrination.80 But there is a limit to the military effectiveness of political mobiliza- tion. Political...air missiles (SAM) imbedded in eight re- volver-type six- cell vertical launching systems (VLS) as with 052C, the Type 052D has two canister-type 32

  12. Hu Hong’ (bad thing): parental perceptions of teenagers’ sexuality in urban Vietnam

    OpenAIRE

    Lan Anh Thi Do; Pimpawun Boonmongkon; Seung Chun Paek; Thomas E. Guadamuz

    2017-01-01

    Abstract Background Teenagers under 18 years old in Vietnam are considered as minors who usually lack the autonomy to make decisions. They are also sometimes viewed as contributors to social evils including crime, violence and substance use. Moreover, most Vietnamese teenagers have unsafe sex before marriage. The objective of this study is to explore the parental perceptions relating to their teenagers’ sexuality, particularly the social and cultural forces, that may hinder access to sexualit...

  13. vénérolo ogie du CH HU Ibn

    African Journals Online (AJOL)

    raoul

    Le service de Dermatologie de l'Hôpital Ibn Sina a été créé en 1969. ... infections virales (n: 13) avec 8 nouveaux cas de SIDA, infections fongiques (n: 10) y compris 8 cas ... L'histoire et la renommée de l'hôpital Ibn Sina font de cet établissement, à côté des ... Les maladies de système sont dominées par le lupus qui est.

  14. Final technical report. 1998 HU CFRT summer fusion high school workshop

    International Nuclear Information System (INIS)

    Ali, Halima; Punjabi, Alkesh

    1999-01-01

    The center conducted its third High School Summer Fusion Science Workshop in Summer 1998. The center had only three faculty mentors available only for a part of Summer 1998, The center accepted four scholars in this workshop, Prof. Halima Ali coordinated this workshop. Each student was assigned to a research mentor according to the student's interest in a specific research area and problem. In the workshop in the center, the students received instructions and training in the basics of energy, plasma and fusion sciences. They also received one-on-one instructions and training by their mentors to further their understanding of the subject and to introduce to relevant concepts such as magnetic confinement fusion, tokamaks, diverters and area-preserving maps

  15. HuMiChip: Development of a Functional Gene Array for the Study of Human Microbiomes

    Energy Technology Data Exchange (ETDEWEB)

    Tu, Q.; Deng, Ye; Lin, Lu; Hemme, Chris L.; He, Zhili; Zhou, Jizhong

    2010-05-17

    Microbiomes play very important roles in terms of nutrition, health and disease by interacting with their hosts. Based on sequence data currently available in public domains, we have developed a functional gene array to monitor both organismal and functional gene profiles of normal microbiota in human and mouse hosts, and such an array is called human and mouse microbiota array, HMM-Chip. First, seed sequences were identified from KEGG databases, and used to construct a seed database (seedDB) containing 136 gene families in 19 metabolic pathways closely related to human and mouse microbiomes. Second, a mother database (motherDB) was constructed with 81 genomes of bacterial strains with 54 from gut and 27 from oral environments, and 16 metagenomes, and used for selection of genes and probe design. Gene prediction was performed by Glimmer3 for bacterial genomes, and by the Metagene program for metagenomes. In total, 228,240 and 801,599 genes were identified for bacterial genomes and metagenomes, respectively. Then the motherDB was searched against the seedDB using the HMMer program, and gene sequences in the motherDB that were highly homologous with seed sequences in the seedDB were used for probe design by the CommOligo software. Different degrees of specific probes, including gene-specific, inclusive and exclusive group-specific probes were selected. All candidate probes were checked against the motherDB and NCBI databases for specificity. Finally, 7,763 probes covering 91.2percent (12,601 out of 13,814) HMMer confirmed sequences from 75 bacterial genomes and 16 metagenomes were selected. This developed HMM-Chip is able to detect the diversity and abundance of functional genes, the gene expression of microbial communities, and potentially, the interactions of microorganisms and their hosts.

  16. HuRoME: entorno de modelado para el software de un robot humanoide

    OpenAIRE

    Inglés Romero, Juan Francisco

    2010-01-01

    Actualmente, el Desarrollo de Software Dirigido por Modelos (DSDM) representa uno de los paradigmas de desarrollo software más en boga en el ámbito de la Ingeniería del Software. Las tecnologías en torno a este nuevo enfoque ofrecen una aproximación prometedora para superar las limitaciones expresivas de los lenguajes de programación de tercera generación, permitiendo a los diseñadores describir sistemas cada vez más complejos de manera más simple, gracias a la utilización de conceptos propi...

  17. Hüseyin Nail Kubali and Durkheim’s Professional ethics and civic morals

    Directory of Open Access Journals (Sweden)

    Ivan Strenski

    2006-01-01

    Full Text Available A swirl of puzzles surrounds a work of Émile Durkheim’s that Jonathan Z. Smith claims is the ‘single most provocative treatment of’ the idea of the sacred in the Durkheimian corpus – Professional Ethics and Civic Morals. Why, one asks, was Durkheim’s work first published in Turkey, especially when the lectures that gave rise to this volume had been delivered in France in the early years of the twentieth century? Of what particular importance was Durkheim for modern Turkish thinkers, and what kinds of thinkers might they be? And, what of this particular work of Durkheim’s? What special purpose, moreover, might have been served by publishing it in Turkey when it was – in 1950? Why was the volume edited by (and who was? Hüseyin Nail Kubali? What were his motives – both of a scientific kind or of a wider social or political sort? These are the questions that are addressed in this article. As readers will discover, in answering them, a nest of hidden themes is uncovered – a nest that few readers – even those who know the Durkheim corpus – will have anticipated. Not only are Durkheimian interpretations of religion at issue, but also the particular bearing of Durkheimianism on modern Turkey. This link with modern Turkey, in turn, brings to the surface many of the controversial questions now vexing the European Union as it ponders the possibility of Turkish membership of the EU – questions of human rights, civil society, the rule of law, the relation of religion and state, to name just the most relevant to the content of this article.

  18. Further considerations on the phonetics and morphologizations of Hi and Hu̯ in Indoeuropean

    Directory of Open Access Journals (Sweden)

    Francisco R. Adrados

    1981-12-01

    Full Text Available The author puts up to date his ideas on Indo-European Laryngeals, which have been published from 1956 onwards. He takes into account new materials as well as new proposals about the most difficult points. He starts exposing some General Phonetics facts which favor his theory and then he offers some new evidence from Anatolian languages which enlarge our knowledge of Indo-European Laryngeals. Then he explains minutely the different treatments of Laryngeals in Post-Anatolian Indo-European, arriving frequently to more economical and simple solutions. The paper ends with a synopsis of the treatments of the six Laryngeals (three with a palatal appendix and three with a labial one in Indo-European.

  19. Interface engineering in inorganic hybrid structures towards improved photocatalysis (Conference Presentation)

    Science.gov (United States)

    Xiong, Yujie

    2016-10-01

    Designing new photocatalytic materials for improving photoconversion efficiency is a promising route to alleviate the steadily worsening environmental issues and energy crisis. Despite the invention of a large number of catalytic materials with well-defined structures, their overall efficiency in photocatalysis is still quite limited as the three key steps - light harvesting, charge generation and separation, and charge transfer to surface for redox reactions - have not been substantially improved. To improve each step in the complex process, there is a major trend to develop materials based on inorganic hybrid structures. In this case, interface engineering holds the promise for boosting the overall efficiency, given the key roles of interface structures in charge and energy transfer. In this talk, I will demonstrate several different approaches to designing inorganic hybrid structures with improved photocatalytic performance via interface engineering. The typical demonstrations include semiconductor-plasmonics systems for broad-spectrum light harvesting, metal-semiconductor interfaces for improved charge separation, semiconductor-MOF (metal-organic framework) configurations for activated surface reactions. It is anticipated that this series of works open a new window to rationally designing inorganic hybrid materials for photo-induced applications. References: (1) Bai, S.; Yang, L.; Wang, C.; Lin, Y.; Lu, J.; Jiang, J. and Xiong, Y.*, Angew. Chem. Int. Ed. 54, 14810-14814 (2015). (2) Bai, S.; Jiang, J.; Zhang, Q. and Xiong, Y.*, Chem. Soc. Rev. 44, 2893-2939 (2015). (3) Bai, S.; Li, X.; Kong, Q.; Long, R.; Wang, C.; Jiang, J. and Xiong, Y.*, Adv. Mater. 27, 3444-3452 (2015). (4) Bai, S.; Ge, J.; Wang, L.; Gong, M.; Deng, M.; Kong, Q.; Song, L.; Jiang, J.;* Zhang, Q.;* Luo, Y.; Xie, Y. and Xiong, Y.*, Adv. Mater. 26, 5689-5695 (2014). (5) Li, R.; Hu, J.; Deng, M.; Wang, H.; Wang, X.; Hu, Y.; Jiang, H. L.; Jiang, J.;* Zhang, Q.;* Xie, Y. and Xiong, Y.*, Adv. Mater

  20. Breaking a chaos-based secure communication scheme designed by an improved modulation method

    International Nuclear Information System (INIS)

    Li Shujun; Alvarez, Gonzalo; Chen Guanrong

    2005-01-01

    Recently Bu and Wang [Bu S, Wang B-H. Chaos, Solitons and Fractals 2004;19(4):919-24] proposed a simple modulation method aiming to improve the security of chaos-based secure communications against return-map-based attacks. Soon this modulation method was independently cryptanalyzed by Chee et al. [Chee CY, Xu D, Bishop SR. Chaos, Solitons and Fractals 2004;21(5):1129-34], Wu et al. [Wu X, Hu H, Zhang B. Chaos, Solitons and Fractals 2004;22(2):367-73], and Alvarez et al. [Alvarez G, Montoya F, Romera M, Pastor G. Chaos, Solitons and Fractals, in press, arXiv:nlin/0406065] via different attacks. As an enhancement to the Bu-Wang method, an improving scheme was suggested by Wu et al. by removing the relationship between the modulating function and the zero-points. The present paper points out that the improved scheme proposed by Wu et al. is still insecure against a new attack. Compared with the existing attacks, the proposed attack is more powerful and can also break the original Bu-Wang scheme. Furthermore, it is pointed out that the security of the modulation-based schemes proposed by Wu et al. is not so satisfactory from a pure cryptographical point of view. The synchronization performance of this class of modulation-based schemes is also discussed

  1. Breaking a chaos-based secure communication scheme designed by an improved modulation method

    Energy Technology Data Exchange (ETDEWEB)

    Li Shujun [Department of Electronic Engineering, City University of Hong Kong, Kowloon, Hong Kong (China)]. E-mail: hooklee@mail.com; Alvarez, Gonzalo [Instituto de Fisica Aplicada, Consejo Superior de Investigaciones Cientificas, Serrano 144-28006 Madrid (Spain); Chen Guanrong [Department of Electronic Engineering, City University of Hong Kong, Kowloon, Hong Kong (China)

    2005-07-01

    Recently Bu and Wang [Bu S, Wang B-H. Chaos, Solitons and Fractals 2004;19(4):919-24] proposed a simple modulation method aiming to improve the security of chaos-based secure communications against return-map-based attacks. Soon this modulation method was independently cryptanalyzed by Chee et al. [Chee CY, Xu D, Bishop SR. Chaos, Solitons and Fractals 2004;21(5):1129-34], Wu et al. [Wu X, Hu H, Zhang B. Chaos, Solitons and Fractals 2004;22(2):367-73], and Alvarez et al. [Alvarez G, Montoya F, Romera M, Pastor G. Chaos, Solitons and Fractals, in press, arXiv:nlin/0406065] via different attacks. As an enhancement to the Bu-Wang method, an improving scheme was suggested by Wu et al. by removing the relationship between the modulating function and the zero-points. The present paper points out that the improved scheme proposed by Wu et al. is still insecure against a new attack. Compared with the existing attacks, the proposed attack is more powerful and can also break the original Bu-Wang scheme. Furthermore, it is pointed out that the security of the modulation-based schemes proposed by Wu et al. is not so satisfactory from a pure cryptographical point of view. The synchronization performance of this class of modulation-based schemes is also discussed.

  2. Speaker-dependent Multipitch Tracking Using Deep Neural Networks

    Science.gov (United States)

    2015-01-01

    sentences spoken by each of 34 speakers (18 male, 16 female). Two male and two female speakers (No. 1, 2, 18, 20, same as [30]), denoted as MA1, MA2 ...Engineering Technical Report #12, 2015 Speaker Pairs MA1- MA2 MA1-FE1 MA1-FE2 MA2 -FE1 MA2 -FE2 FE1-FE2 E T ot al 0 10 20 30 40 50 60 70 80 Jin and Wang Hu and...Pitch 1 Estimated Pitch 2 (d) Figure 6: Multipitch tracking results on a test mixture (pbbv6n and priv3n) for the MA1- MA2 speaker pair. (a) Groundtruth

  3. The 19th Party Congress

    DEFF Research Database (Denmark)

    Brødsgaard, Kjeld Erik; Høyrup Christensen, Nis

    2017-01-01

    veteran leaders such as Wang Qishan (69) continue to serve on the committee? Would Xi Jinping pack the Politburo and the PSC with his own close allies, or would he try to achieve a factional balance observing the interests of former leaders such as Jiang Zemin and Hu Jintao? There was also much....... Such a report is usually a long document setting out the Party's priorities and policy objectives for the next five-year period. Would Xi Jinping's report signal new policy initiatives, and would it outline strategic guidelines reaching beyond 2022? This article examines these questions and assesses the future...

  4. Near-inertial currents off the east coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Mukherjee, A.; Shankar, D.; Aparna, S.G.; Amol, P.; Fernando, V.; Fernandes, R.; Khalap, S.T.; Satlekar, N.P.; Agarvadekar, Y.; Gaonkar, M.G.; Tari, A.P.; Kankonkar, A.; Vernekar, S.

    .8◦N for the M2 tide (Haren, 2005; Alford et al., 2007) and 14.52◦N and 13.44◦N for the K1 andO1 tides, respectively (Xie et al, 2009; sun et al., 2011; Xie et al, 2011). The critical latitude for the semi-diurnal tide is north of the basin boundary... the southwest monsoon. Continental Shelf Research 11, 1397–1408. Sindhu, M. 2012. Numerical Modeling of Tides and Storm Surges in the Bay of Bengal. Ph.D. Thesis. Goa University, India. Sun, Lu., Maas., Zheng, Quanan., Wang, Dongxiao., Hu, Jianyu., Tai, Chang...

  5. Ground-state properties of third-row elements with nonlocal density functionals

    International Nuclear Information System (INIS)

    Bagno, P.; Jepsen, O.; Gunnarsson, O.

    1989-01-01

    The cohesive energy, the lattice parameter, and the bulk modulus of third-row elements are calculated using the Langreth-Mehl-Hu (LMH), the Perdew-Wang (PW), and the gradient expansion functionals. The PW functional is found to give somewhat better results than the LMH functional and both are found to typically remove half the errors in the local-spin-density (LSD) approximation, while the gradient expansion gives worse results than the local-density approximation. For Fe both the LMH and PW functionals correctly predict a ferromagnetic bcc ground state, while the LSD approximation and the gradient expansion predict a nonmagnetic fcc ground state

  6. Molecular Signatures and Diagnostic Biomarkers of Cumulative, Blast-Graded Mild TBI

    Science.gov (United States)

    2013-10-01

    ischemic stroke. Neurol. Res. 30, 783–793. 35. Wang, H.C., Lin, W.C., Lin, Y.J., Rau, C.S., Lee, T.H., Chang, W.N., Tsai, N.W., Cheng, B.C., Kung , C.T., and...J.K., Shen, C.A., Yin, H.N., Zhou, X.F., Lu, W., Hu, Q.G., Chi, Y.F., Ma, L., 22  Deng, H.P., Zhang, X.B., Sun, T.J., and Han , Y.F. (2010). [Early

  7. A comment on the calculation of the total-factor energy efficiency (TFEE) index

    International Nuclear Information System (INIS)

    Chang, Ming-Chung

    2013-01-01

    This study provides a no-output growth model to conveniently calculate the total-factor energy efficiency (TFEE) index originally proposed by Hu and Wang (2006). The TFEE index serves as a very well-known and popular means of estimating overall energy efficiency. While many previous studies have used the indicator of energy inefficiency, including the indicator of energy intensity (i.e., Energy input/Gross Domestic Product (GDP)) to measure energy efficiency, Hu and Kao (2007) point out that the indicator of energy intensity is not only a partial-factor energy efficiency indicator, but that this partial-factor ratio is also quite inappropriate for analyzing the impact of changing energy use over time. The TFEE index overcomes the disadvantage of the indicator of energy intensity as mentioned above, but five steps are needed to calculate the TFEE score. In this study, we provide a no-output growth model to conveniently calculate the TFEE score. Furthermore, we extend this no-output growth model to an output growth model. This study concludes that the output growth model not only makes it easier to calculate the TFEE index than the model proposed by Hu and Wang (2006) and Hu and Kao (2007), but that it can also obtain better TFEE scores. - Highlights: ► The comment is on the total-factor energy efficiency (TFEE) index. ► Two extension models are no-output growth model and output growth model. ► The model in this study makes it easier to calculate the TFEE index.

  8. Quality control for the equipment of Nuclear medicine: experience of the H.U. de la Princesa; Control de calidad del equipamiento en Medicina Nuclear. Experiencia enel H.U. de la Princesa

    Energy Technology Data Exchange (ETDEWEB)

    Espana, M.L.; Gracia, A.; Prieto, C.; Lopez F, P. [Servicio de ProteccionRadiologica. Hospital Universitario de la Princesa C/ Diego de Leon 62, 28006Madrid (Spain)

    1998-12-31

    The quality control of the equipment used in a nuclear medicine service is a fundamental aspect in the Quality Assurance Program that in the present time is starting in our hospital. the objective of this work is to present the internal protocol used, its problematic associated with its starting, and the results obtained in the quality control as of the gamma camera as of the activimeter. In addition to the equipment own to the nuclear medicine service it has been used a Cs-137 source and puppets for several purposes. The results obtained demonstrated the stability of the controlled parameters which has led us to a restating of the established periodicities in our internal protocol, over all for some constancy tests. (Author)

  9. Oxidation of M252 but not M428 in hu-IgG1 is responsible for decreased binding to and activation of hu-FcγRIIa (His131).

    Science.gov (United States)

    Cymer, Florian; Thomann, Marco; Wegele, Harald; Avenal, Cecile; Schlothauer, Tilman; Gygax, Daniel; Beck, Hermann

    2017-11-01

    Oxidation of monoclonal therapeutic antibodies (mAbs) can affect binding to Fc-receptors and potentially influence pharmacokinetics or effector functions like e.g. antibody dependent cellular phagocytosis (ADCP). Recently, it has been demonstrated that binding to FcγRIIa (H131) is affected by methionine oxidation of the Fc-portion but it is currently unknown which methionine is responsible for decreased binding. We separated an oxidized IgG1 monoclonal antibody based on the oxidation state of methionine 252 and analyzed fractionated material in receptor binding experiments as well as in functional (cell-based) assays. Although the unfractionated mixture demonstrated weaker interaction/activation of the receptor, differently oxidized isolated subspecies can lead both to stronger as well as weaker binding and activation of the histidine variant of FcγRIIa. Copyright © 2017 The Authors. Published by Elsevier Ltd.. All rights reserved.

  10. Los nuevos centros comerciales y su impacto económico y social en Huánuco - 2015

    OpenAIRE

    Meza Segura, Dieter Anibal

    2015-01-01

    El recurso natural más valioso y más escaso es el tiempo, porque no es renovable, es irreparable e irrecuperable: una vez que usted desperdicia desde un segundo hasta un año, un lustro o una década, jamás podrá recuperarlos, sólo lamentarse sobre lo que usted pudo haber hecho con ellos, sin que consiga alivio a su sentido de pérdida, error y desperdicio. Eso es lo principal que proporciona un centro comercial: maximiza el uso productivo del tiempo: le proporciona a las personas—desde un ni...

  11. Quality control for the equipment of Nuclear medicine: experience of the H.U. de la Princesa

    International Nuclear Information System (INIS)

    Espana, M.L.; Gracia, A.; Prieto, C.; Lopez F, P.

    1998-01-01

    The quality control of the equipment used in a nuclear medicine service is a fundamental aspect in the Quality Assurance Program that in the present time is starting in our hospital. the objective of this work is to present the internal protocol used, its problematic associated with its starting, and the results obtained in the quality control as of the gamma camera as of the activimeter. In addition to the equipment own to the nuclear medicine service it has been used a Cs-137 source and puppets for several purposes. The results obtained demonstrated the stability of the controlled parameters which has led us to a restating of the established periodicities in our internal protocol, over all for some constancy tests. (Author)

  12. Study of effect of different CT scanning protocols on HU variation and their impact on TPS calculations

    International Nuclear Information System (INIS)

    Mahur, Mamta; Sharma, Richa; Sasindaran, M.; Singh, Anshu; Gedam, Varsha; Negi, P.S.; Grover, R.K.

    2016-01-01

    Computer tomographic (CT) scans are used to correct for tissue inhomogeneties in radiotherapy treatment planning. In order to guarantee a precise treatment, it is important to obtain the relationship between CT Hounsfield units and relative electron densities, which is the basic input for radiotherapy planning systems which consider tissue heterogeneities. The purpose of this study is to investigate the influence of different CT scan parameters (kVp, mAs) on uniformity of CT numbers versus relative electron density (HURED) curves and their different dosimetric impact

  13. Convergent syntheses of HuPrP106-126 (difficult sequence) using native chemical ligation and desulfurization/deselenization

    Czech Academy of Sciences Publication Activity Database

    Šebestík, Jaroslav; Šafařík, Martin; Zawada, Zbigniew; Hlaváček, Jan

    2010-01-01

    Roč. 16, S1 (2010), s. 86-86 ISSN 1075-2617. [European Peptide Symposium /31./. 05.09.2010-09.09.2010, Copenhagen] R&D Projects: GA ČR GA203/07/1517 Institutional research plan: CEZ:AV0Z40550506 Keywords : prion * ligation * convergent synthesis Subject RIV: CC - Organic Chemistry

  14. Laudatio for E. C. G. SUDARSHAN On his 75th Birth Day. Jaca (HU), Spain, September 18, 2006

    International Nuclear Information System (INIS)

    Boya, L J

    2007-01-01

    The scientific career of E. C. G. Sudarshan is reported, with some biographical notes to frame the results. His research and teaching achievements span more than fifty years, and he has been Professor of Physics at the University of Texas at Austin since 1969, where he is still quite active and taking up students. Symmetry, in its multiple aspects, is perhaps the feature more persistent in his whole work; also the complex relations between classical and quantum realities permeates most of his mature-period papers

  15. Mammal Hunting in the Special Use Zone and Buffer Tingo Maria National Park, Huánuco, Peru

    Directory of Open Access Journals (Sweden)

    Fiorella Nasha Gonzales Guillén

    2014-12-01

    Full Text Available Between the months of August to November 2011 were conducted 42 semi-structured interviews to assess the hunting of mammals in areas of special purpose (ZUE and buffer (ZA National Park Tingo María surveys. The results indicate that 43% of the population practiced hunting as a secondary activity, the main smallholder agriculture. The methodology used for hunting are the "tramperas" while the hunting is often 2-3 times a month. Hunting is more common after the wet season, it is selective and responds to the taste of meat that an economic need. Among the most hunted mammals include agouti Dasyprocta sp. and picuro Cuniculus paca, while animals higher biomass as the peccary Pecari tajacu are rare in the area, so it is recommended to increase the control of hunting of vulnerable species in the villages which are inside and in the vicinity of the Park.

  16. Phase II study of Gleevec® plus hydroxyurea (HU) in adults with progressive or recurrent meningioma

    OpenAIRE

    Reardon, David A.; Norden, Andrew D.; Desjardins, Annick; Vredenburgh, James J.; Herndon, James E.; Coan, April; Sampson, John H.; Gururangan, Sridharan; Peters, Katherine B.; McLendon, Roger E.; Norfleet, Julie A.; Lipp, Eric S.; Drappatz, Jan; Wen, Patrick Y.; Friedman, Henry S.

    2011-01-01

    We prospectively evaluated the efficacy and safety of imatinib plus hydroxyurea in patients with progressive/recurrent meningioma. A total of 21 patients with progressive/recurrent meningioma were enrolled in this dual center, single-arm, phase II trial. All patients received 500 mg of hydroxyurea twice a day. Imatinib was administered at 400 mg/day for patients not on CYP3A enzyme inducing anti-epileptic drugs (EIAEDs) and at 500 mg twice a day for patients on EIAEDs. The primary endpoint wa...

  17. Phase II study of Gleevec® plus hydroxyurea (HU) in adults with progressive or recurrent meningioma.

    Science.gov (United States)

    Reardon, David A; Norden, Andrew D; Desjardins, Annick; Vredenburgh, James J; Herndon, James E; Coan, April; Sampson, John H; Gururangan, Sridharan; Peters, Katherine B; McLendon, Roger E; Norfleet, Julie A; Lipp, Eric S; Drappatz, Jan; Wen, Patrick Y; Friedman, Henry S

    2012-01-01

    We prospectively evaluated the efficacy and safety of imatinib plus hydroxyurea in patients with progressive/recurrent meningioma. A total of 21 patients with progressive/recurrent meningioma were enrolled in this dual center, single-arm, phase II trial. All patients received 500 mg of hydroxyurea twice a day. Imatinib was administered at 400 mg/day for patients not on CYP3A enzyme inducing anti-epileptic drugs (EIAEDs) and at 500 mg twice a day for patients on EIAEDs. The primary endpoint was progression-free survival at 6 months (PFS-6) and secondary endpoints were safety, radiographic response rate, and overall survival (OS). Best radiographic response was stable disease and was observed in 14 patients (67%). PFS-6 for all patients, those with grade I tumors (n = 8) and those with grade II or III tumors (n = 13) was 61.9, 87.5 and 46.2%, respectively. Patients with grade II or III tumors had poorer PFS and OS than those with grade I tumors, (P = 0.025 and P = 0.018) respectively. The only grade 3 or greater adverse event occurring in ≥ 10% of patients was anemia (10%). Imatinib plus hydroxyurea is well tolerated among patients with meningioma but has modest anti-tumor activity for this indication.

  18. Introduction to Computational Chemistry: Teaching Hu¨ckel Molecular Orbital Theory Using an Excel Workbook for Matrix Diagonalization

    Science.gov (United States)

    Litofsky, Joshua; Viswanathan, Rama

    2015-01-01

    Matrix diagonalization, the key technique at the heart of modern computational chemistry for the numerical solution of the Schrödinger equation, can be easily introduced in the physical chemistry curriculum in a pedagogical context using simple Hückel molecular orbital theory for p bonding in molecules. We present details and results of…

  19. Konsep Ketuhanan (T’ien dan Relevansinya dengan Pembentukan Etos Kerja dalam Ajaran Kong Hu Cu (Konfusius

    Directory of Open Access Journals (Sweden)

    Nazwar Nazwar

    2016-12-01

    Full Text Available Artikel ini membahas konsep Ketuhanan Konfusius yang berkaitan dengan etika kerja para penganutnya. Konsep ketuhanan yang dianalisa berdasar pada perspektif Filsafat, kemudian ditarik kepada realita tindakan sosial penganut ajaran Konfusius, dengan menggunakan data yang diperoleh berupa semangat kerja dan pemenuhan kebutuhan hidup para penganut pandangan hidup ini. Berdasarkan hasil penelitian, ditemukan bahwa konsep ketuhanan yang terdapat dalam ajaran Konfusius adalah paradigma fungsional. Dalam keyakinan tersebut, relasi antara Tuhan dan manusia didasarkan pada nilai fungsi. Tuhan diyakini berdasar pada peranannya terhadap kehidupan manusia. Begitupun sebaliknya, manusia diyakini berperan dalam pemenuhan keinginan Tuhan. Sehingga dalam ibadahnya yang paling menonjol adalah ritual korban. Semakin banyak korban yang dipersembahkan, maka kehidupanpun akan semakin subur dan makmur. Berdasarkan paradigma demikian, para penganut Konfusius kemudian mempunyai semangat kerja tinggi. Dengan tujuan selain  pemenuhan kebutuhan hidup, juga merupakan usaha pemenuhan kebutuhan spiritual dalam rangka ibadah kepada T’ien (Tuhan. This article discusses the concept of God Confucius relating to the work ethic of its adherents. The concept of God that is analyzed based on the perspective of philosophy, then pulled to the reality of social action adherents of Confucianism, using the data obtained in the form of morale and subsistence adherents of this view of life. Based on this research, it was found that the concept of God contained in the teachings of Confucius is the functional paradigm. In that belief, the relationship between God and man is based on the value of the function. God is believed, based on its role in human life. Vice versa, humans are believed to play a role in the fulfillment of God's will. Thus, in the worship of the most prominent is the ritual sacrifice. The more sacrifices be offered, the more fertile and prosperous life will be. Based on such a paradigm, the Confucians then have a high morale. For purposes other than the needs of life, is also a spiritual business needs in order to the worship to T'ien (God.

  20. Synergistic effect of nisin and cone essential oil of Metasequoia glyptostroboides Miki ex Hu against Listeria monocytogenes in milk samples.

    Science.gov (United States)

    Yoon, Jung In; Bajpai, Vivek K; Kang, Sun Chul

    2011-01-01

    This study was undertaken to evaluate the effect of nisin and cone essential oil of Metasequoia glyptostroboides against Listeria monocytogenes ATCC 19116 inoculated in whole (8%), low (1%) and skim (no fat content) milks. Essential oil at the concentrations of 2% and 5% revealed strong antilisterial effect against L. monocytogenes ATCC 19116 in all categories of milks. Nisin at the concentrations of 250 and 500 IU/ml displayed a remarkable antilisterial effect as compared to the control group. Also, the synergistic combinations of cone essential oil (1% and 2%) and nisin (62.5, 125, 250 and 500 IU/ml) had a remarkable antilisterial activity in all categories of whole, low and skim milks after 14 days. Results of this study indicate that the cone essential oil of M. glyptostroboides might be a useful candidate for using in food industry to control the growth of pathogenic microorganisms. Copyright © 2010 Elsevier Ltd. All rights reserved.

  1. Profile of Patients of the Auditory Health of the State of Santa Catarina Served at HU-UFSC

    Directory of Open Access Journals (Sweden)

    Dimatos, Oscar Cardoso

    2011-01-01

    Full Text Available Introduction: Hearing is one of the essential functions for the development of language and its deficiency may lead to several consequences. Objective: To describe the profile of patients of the Hearing Health Program of the State of Santa Catarina attended at the College Hospital of the Federal University of Santa Catarina. Method:We performed a retrospective study with the patients with hearing aid indication attended in the years 2007 and 2008. They were divided into 2 groups: children ( 18 years. We assessed the following: age, sex, loss type and degree, duration, co-morbidity and probable etiology. Results: 304 reports were reviewed, 10.2% of the children group and 80.8% of the adult group. In the children group, the mean age was of 7.7±5,4 years, with 58.06% boys and 41.94% girls, and in the adult group the mean age was of 61±16 years, with 52.38% women and 47.62% men. The neurosensorial hearing loss was found more frequently in both groups. In the children group, the severe degree loss was more frequent, and in the adult group, the moderate and moderate to severe degrees were more frequent. The main etiologies were genetic/unknown causes in the children group and presbycusis in the adults group. Conclusion:In the children group, most was formed by boys with neurosensorial loss of light and severe degrees, duration > 1 year and without co-morbidities. In the adult group, most was formed by women with neurosensorial loss of moderate and moderate-severe degrees, duration > 5 year and with co-morbidities.

  2. Význam vytrvalostního běhu v evoluci člověka

    OpenAIRE

    Hola, Tomáš

    2016-01-01

    Human evolution and the evolution of our appearance in time is a research subject for a long time. This work summarizes existing studies, opinions and knowledge about possible importance of endurance running in the human evolution. This work analyzes possible benefits of the orientation on the endurance running and adaptations that are pointing on a possibility of the orientation on the endurance running by early Homo. In the first part of my work I will focus on the possible use of endurance...

  3. Vliv intenzivní fyzioterapie na nadváhu a obezitu u osob 40-50 let

    OpenAIRE

    ILLOVÁ, Lenka

    2014-01-01

    The topic of my bachelor thesis is Effect of intensive physiotherapy on overweight and obesity in people from 40 to 50 years. Obesity is severe illness quickly becoming a heavy problem in the society. In spite of this, a little emphasis is put on monitoring and solving the increasing number of overweight and obese people. In my opinion it is a hot issue considering the incidence of obesity is increasing, and occurring in countries which have not been affected so far. The theoretical part deal...

  4. Les phénoloxydases chez l’huître creuse Crassostrea gigas : biomarqueurs potentiels de stress environnemental

    OpenAIRE

    Luna Acosta , Andrea

    2010-01-01

    The Pacific oyster Crassostrea gigas is the leading aquaculture product at the worldwide level. However, massive summer mortalities affect dramatically cultivated and natural oyster populations, especially at young life stages. These events could be linked to an unbalance between the different actors of the triad host – pathogen agent – environment, which could favour a weakening of defence mechanisms in the host, and consequently, the emergence and/or increase of diseases. Among environmenta...

  5. La escritura huérfana: Miguel Romero Esteo o la sublimidad del grotesco en la última vanguardia

    Directory of Open Access Journals (Sweden)

    Cornago Bernal, Óscar

    2002-06-01

    Full Text Available This paper analyzes Romero Esteo's work from a cultural and aesthetic background rarely founded in the peninsular hispanic studies, in spite of being the appropiate one regarding his times. This complex theoretical frame, which has been related afterwards to diverse currents as Posestructuralism, the «New Left» and «Postmodernity», began to be developed in Europe during the sixties. Among the main names of these tendencies, who are the basis for my present approach, Michel Foucault, Roland Barthes, Jacques Derrida, Jean-François Lyotard, Gille Deleuze y Felix Guattari, Jean Baudrillard, Umberto Eco o Eugenio Trías are included. Starting from this wide corpus of aesthetic philosophy, which is going to be given an unitary interpretation through a consideration of the barroque condition of contemporary culture —reconsidering the theory of alegory by Benjamin—, this study intends to understand the specifity of an aesthetic project of great originality as well as the cultural background where it has risen.Este estudio analiza la obra de Miguel Romero Esteo desde un contexto cultural y estético escasamente transitado en el hispanismo peninsular, pero que es, sin embargo, el que le corresponde por generación histórica. Este complejo marco teórico, que ha sido relacionado posteriormente con corrientes diversas como el Posestructuralismo, la «nueva izquierda » o la Posmodernidad, comenzó a desarrollarse en Europa a medida que avanzaban los años sesenta. Entre los nombres que lo han protagonizado, y que son la base de este trabajo, se incluyen Michel Foucault, Roland Barthes, Jacques Derrida, Jean-François Lyotard, Gille Deleuze y Felix Guattari, Jean Baudrillard, Umberto Eco o Eugenio Trías. A partir de este amplio corpus de filosofia estética, al que se le dará una lectura unitaria mediante la condición barroca de la cultura actual —recuperando la teoría de la alegoría de Benjamin—, se trata de entender la especificidad que caracteriza tanto un proyecto estético de gran originalidad como del medio cultural que lo vio nacer.

  6. Vliv obuvi na způsob běhu a zranění

    OpenAIRE

    Kolovecká, Michaela

    2016-01-01

    In recent years running has become a very popular sport. Therefore it is nowadays often discussed whether it is shod running or barefoot running that is better. The aim of this thesis is to provide a summary of scientific pieces of knowledge on the effect of footwear on running style and related injuries. The introduction chapter describes the basics of running techniques and progressive development of running styles in relation to the development of running footwear. The following chapters d...

  7. Strengthening institutions or institutionalising weaknesses? : interactions between aid and institutions in Huíla Province, Angola

    NARCIS (Netherlands)

    Serrano, M.M.

    2012-01-01

    This research analyses the interaction between aid interventions and local institutions through which people address needs during crisis. These include state and non- state institutions involved in social assistance and in the delivery of basic services such as healthcare. The study focuses on the

  8. Trinidad y Pascua en la teología de H-U. von Balthasar y J. Moltmann

    Directory of Open Access Journals (Sweden)

    Eloy Bueno de la Fuente

    2015-06-01

    Full Text Available The rediscovery of the Trinity and the Easter constitutes one of the most important phenomena of the last century theology, especially when it emphasises the intimate connection between both of them. Magnificent examples of this are von Balthasar and Moltmann’s theological projects. However, in these writers, the primacy that is attributed to the cross does not permit to perceive clearly the role and the sense of the resurrection of Jesus.

  9. Bullying y el rendimiento escolar en centros educativos estatales de nivel secundaria del Distrito de Huánuco 2012

    OpenAIRE

    Jerí Guerra, Antonia Esmila

    2016-01-01

    Nuestro problema de investigación se basó en determinar si existe relación entre el fenómeno bullying y el rendimiento escolar de los participantes, considerándose su nivel de participación en dicho fenómeno. El método fue descriptivo correlacional prospectivo (relación entre variables Bullying y Rendimiento Académico), y el diseño fue no experimental correlacional, transaccional de dos grupos independientes, que consiste en observar situaciones ya existentes, como se dan en su contexto na...

  10. Interactive effects of antioxidant genes and air pollution on respiratory function and airway disease: a HuGE review.

    Science.gov (United States)

    Minelli, Cosetta; Wei, Igor; Sagoo, Gurdeep; Jarvis, Debbie; Shaheen, Seif; Burney, Peter

    2011-03-15

    Susceptibility to the respiratory effects of air pollution varies between individuals. Although some evidence suggests higher susceptibility for subjects carrying variants of antioxidant genes, findings from gene-pollution interaction studies conflict in terms of the presence and direction of interactions. The authors conducted a systematic review on antioxidant gene-pollution interactions which included 15 studies, with 12 supporting the presence of interactions. For the glutathione S-transferase M1 gene (GSTM1) (n=10 studies), only 1 study found interaction with the null genotype alone, although 5 observed interactions when GSTM1 was evaluated jointly with other genes (mainly NAD(P)H dehydrogenase [quinone] 1 (NQO1)). All studies on the glutathione S-transferase P1 (GSTP1) Ile105Val polymorphism (n=11) provided some evidence of interaction, but findings conflicted in terms of risk allele. Results were negative for glutathione S-transferase T1 (GSTT1) (n=3) and positive for heme oxygenase 1 (HMOX-1) (n=2). Meta-analysis could not be performed because there were insufficient data available for any specific gene-pollutant-outcome combination. Overall the evidence supports the presence of gene-pollution interactions, although which pollutant interacts with which gene is unclear. However, issues regarding multiple testing, selective reporting, and publication bias raise the possibility of false-positive findings. Larger studies with greater accuracy of pollution assessment and improved quality of conduct and reporting are required. © The Author 2011. Published by Oxford University Press on behalf of the Johns Hopkins Bloomberg School of Public Health. All rights reserved.

  11. Timing of metamorphism of the Lansang gneiss and implications for left-lateral motion along the Mae Ping (Wang Chao) strike-slip fault, Thailand

    Science.gov (United States)

    Palin, R. M.; Searle, M. P.; Morley, C. K.; Charusiri, P.; Horstwood, M. S. A.; Roberts, N. M. W.

    2013-10-01

    The Mae Ping fault (MPF), western Thailand, exhibits dominantly left-lateral strike-slip motion and stretches for >600 km, reportedly branching off the right-lateral Sagaing fault in Myanmar and extending southeast towards Cambodia. Previous studies have suggested that the fault assisted the large-scale extrusion of Sundaland that occurred during the Late Eocene-Early Oligocene, with a geological offset of ˜120-150 km estimated from displaced high-grade gneisses and granites of the Chiang Mai-Lincang belt. Exposures of high-grade orthogneiss in the Lansang National Park, part of this belt, locally contain strong mylonitic textures and are bounded by strike-slip ductile shear zones and brittle faults. Geochronological analysis of monazite from a sample of sheared biotite-K-feldspar orthogneiss suggests two episodes of crystallization, with core regions documenting Th-Pb ages between c. 123 and c. 114 Ma and rim regions documenting a significantly younger age range between c. 45-37 Ma. These data are interpreted to represent possible magmatic protolith emplacement for the Lansang orthogneiss during the Early Cretaceous, with a later episode of metamorphism occurring during the Eocene. Textural relationships provided by in situ analysis suggest that ductile shearing along the MPF occurred during the latter stages of, or after, this metamorphic event. In addition, monazite analyzed from an undeformed garnet-two-mica granite dyke intruding metamorphic units at Bhumipol Lake outside of the Mae Ping shear zone produced a Th-Pb age of 66.2 ± 1.6 Ma. This age is interpreted to date the timing of dyke emplacement, implying that the MPF cuts through earlier formed magmatic and high-grade metamorphic rocks. These new data, when combined with regional mapping and earlier geochronological work, show that neither metamorphism, nor regional cooling, was directly related to strike-slip motion.

  12. Apuntes sobre las nuevas dinámicas de la Oralidad: Escuchando a "Wang-Fo" en el lenguaje hiper-vincular

    Directory of Open Access Journals (Sweden)

    Alexander Díaz

    2008-01-01

    Full Text Available El presente escrito es una reflexión-narración de cómo la oralidad puede hallarse en estado implícito en las comunidades inmersas en la sociedad mediática de consumo. En este mestizaje semiótico de la tradición, la "Cuenteria" alcanza un valor excepcional en Colombia. Existe la evidencia que en las últimas dos décadas, hombres y mujeres de diversos estratos socioeconómicos y niveles de formación académica diferentes, se reúnen a participar de la cultura oral renovada, un paso delante de los medios masivos; tal portento es una alternativa real y viable para la Oralidad.

  13. Towards unified characterization of cooperation mechanisms. Comment on "Universal scaling for the dilemma strength in evolutionary games" by Z. Wang et al.

    Science.gov (United States)

    Han, The Anh

    2015-09-01

    "I will jump into the river to save two brothers or eight cousins": This famous quote by J.B.S. Haldane accurately anticipates the conditions under which cooperation is the favorable choice in an interaction between genetic relatives. The general condition can later be formulated as a surprisingly simple mathematical expression, known as the Hamilton's rule, stating that natural selection favors cooperation if the genetic relatedness (r) between the donor and the recipient of a cooperative act is greater than its cost (c) to benefit (b) ratio [1]: r > c / b. Motivated by Hamilton's elegant early studies, researchers have attempted to find simple and concise rules that characterize the conditions for cooperation to be selected under various social viscosity [2,3]. For example, the seminal work by M. Nowak [3] in 2006 shows that similarly simple rules can be derived that govern each of the other four popular mechanisms of cooperation-direct reciprocity, indirect reciprocity, group selection and network reciprocity-, which can be expressed via the cost-to-benefit ratio being smaller than some critical value associated with the mechanism at work (as seen, for kin interactions, the critical value is relatedness). However, these rules are restricted to the donor and recipient (D&R) paradigm. The question is thus whether it is possible to obtain simple rules even for the general case? The answer is not trivial as a general two-player game is described by four independent parameters, not just two as in the D&R game.

  14. Connecting human behavior and infectious disease spreading. Comment on "Coupled disease-behavior dynamics on complex networks: A review" by Wang et al.

    Science.gov (United States)

    Holme, Petter

    2015-12-01

    Vaccination against measles is one of the great success stories of 20th century medicine. In the USA, before the introduction of the vaccine in 1963, three to four million adolescents were infected annually, around 500 died, around 5000 got serious complications (primarily encephalitis, swelling of the brain), and around 50,000 were hospitalized [7]. With the vaccine, measles virtually vanished and by 2000 it was declared extinct from the USA. This was, however, not the end of the story. There is still a small fraction of parents who do not let their children be vaccinated. The reasons vary-fear of side effects, an aversion of exposing children to something ;unnatural;, and a large number of other ideas. (For a non-academic account of the psychology of vaccination, we recommend Eula Biss's On Immunity[3].) The last few decades, anti-vaccination ideas have been spreading in social media and united people opposing vaccination into something of a movement [4]. In December 2014 there was a first larger outbreak (over 500 cases) of the century, centered around Disneyland (Anaheim, California) [10], and the anti-vaccination movement got much of the blame [4]. This example illustrates how ideas and opinions-that just like diseases are spreading over networks of people-can facilitate outbreaks. The reverse is, thankfully, more common-people, aware of an emerging outbreak, try to lower the chance of contagion by improving hygiene etc., which impedes the outbreak.

  15. 圖書館事業與交流/What Cloud Computing Means to Libraries and Information Services/Xiaocan (Lucy Wang, Jie Huang

    Directory of Open Access Journals (Sweden)

    Xiaocan (Lucy Wang, Jie Huang Xiaocan (Lucy Wang, Jie Huang

    2011-10-01

    Full Text Available Cloud computing, as an emerging style of computing that involves various technologies and provides virtual and scalable IT-related services over the Internet, has become a popular topic in the past few years. Much has been written about this concept and its applications in the IT and business fields, but little has been done in the library setting. This paper first introduces cloud computing with respect to its concepts, types, and general applications. The focus is then shifted to what cloud computing might mean to libraries and information services. The impact of cloud computing on the storage of libraries’ digital assets, integrated library systems, libraries’ IT infrastructures, as well as library services and internal work, has been investigated. The paper also explores the potential benefits of incorporating cloud computing in the library environment and points out some concerns and challenges libraries may have. 雲端計算作為一種新興的、利用多元技術來提供基於網路的IT 服務計算模式,在近幾年來已成為熱門話題。許多文章論述了有關雲端計算的概念及其在IT 和商業中的應用模式,但卻少見對其在圖書館領域中運用的闡述。本文首先介紹有關雲端計算的概念、類型,以及一些基本的應用模式。隨後,本文著眼於雲端計算對圖書館和資訊服務的意義,探討雲端計算在圖書館數位資源儲存、整合圖書館系統、圖書館資訊科技的設施建設、圖書館服務和內部作業等方面產生的影響以及圖書館運用雲端計算的潛在效益。本文剖析圖書館採用雲端計算的益處之時,也同時探討可能面臨的一些問題和挑戰。 頁次:166-174

  16. The importance of accurately modelling human interactions. Comment on "Coupled disease-behavior dynamics on complex networks: A review" by Z. Wang et al.

    Science.gov (United States)

    Rosati, Dora P.; Molina, Chai; Earn, David J. D.

    2015-12-01

    Human behaviour and disease dynamics can greatly influence each other. In particular, people often engage in self-protective behaviours that affect epidemic patterns (e.g., vaccination, use of barrier precautions, isolation, etc.). Self-protective measures usually have a mitigating effect on an epidemic [16], but can in principle have negative impacts at the population level [12,15,18]. The structure of underlying social and biological contact networks can significantly influence the specific ways in which population-level effects are manifested. Using a different contact network in a disease dynamics model-keeping all else equal-can yield very different epidemic patterns. For example, it has been shown that when individuals imitate their neighbours' vaccination decisions with some probability, this can lead to herd immunity in some networks [9], yet for other networks it can preserve clusters of susceptible individuals that can drive further outbreaks of infectious disease [12].

  17. Scaling up complexity in host-pathogens interaction models. Comment on "Coupled disease-behavior dynamics on complex networks: A review" by Z. Wang et al.

    Science.gov (United States)

    Aguiar, Maíra

    2015-12-01

    Caused by micro-organisms that are pathogenic to the host, infectious diseases have caused debilitation and premature death to large portions of the human population, leading to serious social-economic concerns. The persistence and increase in the occurrence of infectious diseases as well the emergence or resurgence of vector-borne diseases are closely related with demographic factors such as the uncontrolled urbanization and remarkable population growth, political, social and economical changes, deforestation, development of resistance to insecticides and drugs and increased human travel. In recent years, mathematical modeling became an important tool for the understanding of infectious disease epidemiology and dynamics, addressing ideas about the components of host-pathogen interactions. Acting as a possible tool to understand, predict the spread of infectious diseases these models are also used to evaluate the introduction of intervention strategies like vector control and vaccination. Many scientific papers have been published recently on these topics, and most of the models developed try to incorporate factors focusing on several different aspects of the disease (and eventually biological aspects of the vector), which can imply rich dynamic behavior even in the most basic dynamical models. As one example to be cited, there is a minimalistic dengue model that has shown rich dynamic structures, with bifurcations (Hopf, pitchfork, torus and tangent bifurcations) up to chaotic attractors in unexpected parameter regions [1,2], which was able to describe the large fluctuations observed in empirical outbreak data [3,4].

  18. Unifying perspectives on cooperation under social viscosity. Comment on "Universal scaling for the dilemma strength in evolutionary games" by Z. Wang et al.

    Science.gov (United States)

    Bauch, Chris T.

    2015-09-01

    How cooperation evolved in populations of self-interested agents puzzled Charles Darwin, who portrayed the paradox in The Descent of Man as such: "He who was ready to sacrifice his life, as many a savage has been, rather than betray his comrades, would often leave no offspring to inherit his noble nature" [1]. Darwin invoked group selection to explain cooperation: if groups of cooperating individuals could work together to outcompete groups of selfish individuals, cooperation could thrive. Fundamentally, this mechanism works by allowing cooperators to interact preferentially with one another: cooperators tend to interact with other co-operators whereas selfish "defectors" tend to interact with other defectors. Since cooperators cooperate and defectors defect, groups of cooperators should do better, on average.

  19. A 1H-NMR-Based Metabonomic Study on the Anti-Depressive Effect of the Total Alkaloid of Corydalis Rhizoma

    Directory of Open Access Journals (Sweden)

    Hongwei Wu

    2015-05-01

    Full Text Available Corydalis Rhizoma, named YuanHu in China, is the dried tuber of Corydalis yanhusuo W.T. Wang which is used in Traditional Chinese Medicine for pain relief and blood activation. Previous pharmacological studies showed that apart from analgesics, the alkaloids from YuanHu may be useful in the therapy of depression by acting on the GABA, dopamine and benzodiazepine receptors. In this study, the antidepressive effect of the total alkaloid of YuanHu (YHTA was investigated in a chronic unpredictable mild stress (CUMS rat model using 1H-NMR-based metabonomics. Plasma metabolic profiles were analyzed and multivariate data analysis was applied to discover the metabolic biomarkers in CUMS rats. Thirteen biomarkers of CUMS-introduced depression were identified, which are myo-inositol, glycerol, glycine, creatine, glutamine, glutamate, β-glucose, α-glucose, acetoacetate, 3-hydroxybutyrate, leucine and unsaturated lipids (L7, L9. Moreover, a metabolic network of the potential biomarkers in plasma perturbed by CUMS was detected. After YHTA treatment, clear separation between the model group and YHTA-treated group was achieved. The levels of all the abnormal metabolites mentioned above showed a tendency of restoration to normal levels. The results demonstrated the therapeutic efficacy of YHTA against depression and suggested that NMR-based metabolomics can provide a simple and easy tool for the evaluation of herbal therapeutics.

  20. An analytical model and parametric study of electrical contact resistance in proton exchange membrane fuel cells

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Zhiliang; Wang, Shuxin; Zhang, Lianhong [School of Mechanical Engineering, Tianjin University, Tianjin 300072 (China); Hu, S. Jack [Department of Mechanical Engineering, The University of Michigan, Ann Arbor, MI 48109-2125 (United States)

    2009-04-15

    This paper presents an analytical model of the electrical contact resistance between the carbon paper gas diffusion layers (GDLs) and the graphite bipolar plates (BPPs) in a proton exchange membrane (PEM) fuel cell. The model is developed based on the classical statistical contact theory for a PEM fuel cell, using the same probability distributions of the GDL structure and BPP surface profile as previously described in Wu et al. [Z. Wu, Y. Zhou, G. Lin, S. Wang, S.J. Hu, J. Power Sources 182 (2008) 265-269] and Zhou et al. [Y. Zhou, G. Lin, A.J. Shih, S.J. Hu, J. Power Sources 163 (2007) 777-783]. Results show that estimates of the contact resistance compare favorably with experimental data by Zhou et al. [Y. Zhou, G. Lin, A.J. Shih, S.J. Hu, J. Power Sources 163 (2007) 777-783]. Factors affecting the contact behavior are systematically studied using the analytical model, including the material properties of the two contact bodies and factors arising from the manufacturing processes. The transverse Young's modulus of chopped carbon fibers in the GDL and the surface profile of the BPP are found to be significant to the contact resistance. The factor study also sheds light on the manufacturing requirements of carbon fiber GDLs for a better contact performance in PEM fuel cells. (author)

  1. Data on isoaspartylation of neuronal ELAVL proteins

    Directory of Open Access Journals (Sweden)

    Mario A. Pulido

    2016-12-01

    Full Text Available This article contains experimental data examining the propensity of neuronal ELAVL proteins to become isoaspartylated. The data are related to the article “Isoaspartylation appears to trigger small cell lung cancer-associated autoimmunity against neuronal protein ELAVL4” (M.A. Pulido, M.K. DerHartunian, Z. Qin, E.M. Chung, D.S. Kang, A.W. Woodham, J.A. Tsou, R. Klooster, O. Akbari, L. Wang, W.M. Kast, S.V. Liu, J.J.G.M. Verschuuren, D.W. Aswad, I.A. Laird-Offringa, 2016 [1], in which it was reported that the N-terminal region of recombinant human ELAVL4 protein, incubated under physiological conditions, acquires a type of highly immunogenic protein damage. Here, we present Western blot analysis data generated by using an affinity-purified polyclonal rabbit antibody (raised against an N-terminal ELAVL4 isoaspartyl-converted peptide to probe recombinant protein fragments of the other three members of the ELAVL family: the highly homologous neuronal ELAVL2 (HuB and ELAVL3 (HuC, and the much less homologous ubiquitously expressed ELAVL1 (HuR.

  2. The 2nd International Conference on Agricultural and Biological Sciences (ABS 2016

    Directory of Open Access Journals (Sweden)

    Lei Pei

    2016-10-01

    Full Text Available Table of contents 01 The influence of soil salt content on the photosynthetic characteristics of spring wheat with trickle irrigation Lei Pei, Zhenhua Wang, Jinzhu Zhang, Wenhao Li 02 Comparing growth of fast-growing and slow-growing endophytes in plants via ergosterol quantification Adeline SY Ting, Yiing Y Chow, Sadequr Rahman 03 Transcriptome and digital gene expression analysis identifies putative triterpene saponin-biosynthetic genes of Panax notoginseng Rongchang Wei 04 Chitosan-assisted isolation and antioxidant evaluation of flavonoids from Sophora japonica L. Zhang Hu, Sidong Li, Chuyan Li, Zijuan Li 05 Two kinds of new characteristics of the ektexine ornamentation of ginkgo pollen Guoxia Wang, Yuzhen Yang, Gang Chen, Qing Luo 06 Analysis of nutrient and medicinal ingredients of Ginkgo pollen in different regions Guoxia Wang, Ruixia Liu, Yuzhen Yang, Lipei Chen 07 Photosynthetic performance of greening seedlings of seven species to drought stress Zhiyang Lie, Tongtong Zhou, Weilong Huang, Li Xue 08 Changes of fluorescence parameters of greening seedlings of seven species under drought stress Jie Li, Zhuomin Wang, Li Xue 09 Mammalian sex hormone affects regeneration capacity and enzymes activity of Triticale L in vitro culture Ismail Bezirganoglu, Pınar Uysal 10 Fractional Fourier entropy increases the recognition rate of fruit type detection Shuihua Wang, Zhihai Lu, Jiquan Yang, Yudong Zhang, John Liu, Ling Wei, Shufang Chen, Preetha Phillips, Zhengchao Dong 11 Banana-peanut intercropping reduces Fusarium wilt disease in banana from enhancing soil bacterial microorganisms and leaf nutrition Hong Li, Xutong Wang, Fengliang Zhao, Guisheng Yang 12 Manganese stress impairs stem ureide nitrogen fixation in yardlong-bean plants in the acidic environment Hong Li 13 A new pest control method for Rhytidodera bowringii Larvae Haijie Huang, Li Zhao, Weijian Huang, Jinhui Wang, Zhongrun Zhang 14 Research on the seed-like Fruits of Subg. Sclarea of

  3. New directions in the history of modern science in China: global science and comparative history.

    Science.gov (United States)

    Elman, Benjamin A

    2007-09-01

    These essays collectively present new perspectives on the history of modem science in China since 1900. Fa-ti Fan describes how science under the Republic of China after 1911 exhibited a complex local and international character that straddled both imperialism and colonialism. Danian Hu focuses on the fate of relativity in the physics community in China after 1917. Zuoyue Wang hopes that a less nationalist political atmosphere in China will stimulate more transnational studies of modern science, which will in turn reveal the underlying commonalities in different national contexts. Sigrid Schmalzer compares the socialist and the capitalist contexts for science in China and reopens the sensitive question of the "mass line" during the Cultural Revolution. Grace Shen describes the tensions early Chinese scientists felt when choosing between foreign models for modem geology and their own professional identities in China. Taken together, these accounts present us with a comparative history of modern science in China that is both globally and locally informed.

  4. Making metals transparency for white light by surface plasmons

    Science.gov (United States)

    Peng, Ru-Wen; Huang, Xian-Rong; Fan, Ren-Hao; Li, Jia; Hu, Qing; Wang, Mu

    2012-02-01

    We demonstrate both experimentally and theoretically that metallic gratings consisting of narrow slits become transparent for extremely broad bandwidths under oblique incidence. This phenomenon can be explained by a concrete picture in which the incident wave drives free electrons on the conducting surfaces and part of the slit walls to form surface plasmons (SPs). The SPs then propagate on the slit walls but are abruptly discontinued by the bottom edges to form oscillating charges that emit the transmitted wave. This picture explicitly demonstrates the conversion between light and SPs and indicates clear guidelines for enhancing SP excitation and propagation. Making structured metals transparent may lead to a variety of applications. References: Xian-Rong Huang, Ru-Wen Peng, and Ren-Hao Fan, Phys. Rev. Lett. (2010)105, 243901; and Ren-Hao Fan, Ru-Wen Peng, Xian-Rong Huang, Jia Li, Qing Hu, and Mu Wang, manuscript prepared(2011).

  5. sl3-web bases, intermediate crystal bases and categorification

    DEFF Research Database (Denmark)

    Tubbenhauer, Daniel

    2014-01-01

    We give an explicit graded cellular basis of the sl3-web algebra K_S. In order to do this, we identify Kuperberg's basis for the sl3-web space W_S with a version of Leclerc-Toffin's intermediate crystal basis and we identify Brundan, Kleshchev and Wang's degree of tableaux with the weight of flows...... on webs and the q-degree of foams. We use this to give a “foamy” version of Hu and Mathas graded cellular basis of the cyclotomic Hecke algebra which turns out to be a graded cellular basis of the sl3-web algebra K_S. We restrict ourselves to the sl3 case here, but our approach should, up...... to the combinatorics of sln-webs, work for all n>1....

  6. Two-Round Password-Only Authenticated Key Exchange in the Three-Party Setting

    Directory of Open Access Journals (Sweden)

    Junghyun Nam

    2015-01-01

    Full Text Available We present the first provably-secure three-party password-only authenticated key exchange (PAKE protocol that can run in only two communication rounds. Our protocol is generic in the sense that it can be constructed from any two-party PAKE protocol. The protocol is proven secure in a variant of the widely-accepted model of Bellare, Pointcheval and Rogaway (2000 without any idealized assumptions on the cryptographic primitives used. We also investigate the security of the two-round, three-party PAKE protocol of Wang, Hu and Li (2010 and demonstrate that this protocol cannot achieve implicit key authentication in the presence of an active adversary.

  7. Assessing Protection Against OP Pesticides and Nerve Agents Provided by Wild-Type HuPON1 Purified from Trichoplusia ni Larvae or Induced via Adenoviral Infection

    Science.gov (United States)

    2013-01-01

    by tracking the production of p-nitrophenol (at A412) from paraoxon (9 mM in 50 mM Tris, 10 mM CaCl2, pH 7.4), as previously described [24]. To...poisoning ( salivation and convulsive chewing) that resolved within 1 h of OP exposure, while the remaining animal died between 8 and 16 h after

  8. Efectividad del programa de protección intrafamiliar frente al problema de la violencia sexual. Huánuco 2014

    OpenAIRE

    Boza Quilca, Marleny

    2015-01-01

    Los delitos contra la libertad sexual son frecuentes en América Latina. El Perú es uno de los países con más altas tasas de denuncias en la modalidad de violación sexual de la región y en donde la violencia sexual es un fenómeno extendido en todos los sectores económicos, grupos de edad y espacios urbanos y rurales. Si bien es cierto, los operadores de justicia cumplen una labor punitiva, no están exentos de establecer procesos de prevención ante esta creciente problemática que tiene carac...

  9. Změna hodnoty firmy v průběhu hospodářského cyklu

    OpenAIRE

    Táborská, Veronika

    2010-01-01

    The diploma thesis is focused on influence of the economic environment to the business value. The goal of the thesis is a corporate valuation of the entity to 31.12.2009 in recent time of unstable market and financial crisic and how is the business value changeable depenging on business cycle. At the beginning summary of theoretical data concerning business cycle theories is introduced, followed by a description of business cycle and GDP of the Czech Republic from 1996 to 2010. Key part of th...

  10. Algoritmus detekující změny průběhu experimentálních dat

    Czech Academy of Sciences Publication Activity Database

    Zezulka, Petr

    2001-01-01

    Roč. 72, č. 279 (2001), s. 97-100 ISSN 1429-6055. [Międzynarodowe Sympozjum - Metody oceny struktury oraz własnosci materiałow i wyroboów /16./. Komorní Lhotka, 11.12.2001-13.12.2001] Institutional research plan: CEZ:AV0Z2041904 Keywords : algorithm Subject RIV: BA - General Mathematics

  11. Sociální práce jako součást resocializace v průběhu výkonu trestu

    OpenAIRE

    Mouleová, Žaneta

    2017-01-01

    This diploma thesis focuses on tackling the issue of in-prison rehabilitation and some related factors. The diploma thesis focuses particularly on the specific problems with social rehabilitation during imprisonment and the related programmes. The thesis gives an overview of social rehabilitation and social work. Close attention is paid to social rehabilitation, treatment programmes and social work. Theoretical knowledge is applied in practical use - a questionnaire survey from Plzeň Prison. ...

  12. TH-C-BRD-05: Reducing Proton Beam Range Uncertainty with Patient-Specific CT HU to RSP Calibrations Based On Single-Detector Proton Radiography

    Energy Technology Data Exchange (ETDEWEB)

    Doolan, P [University College London, London (United Kingdom); Massachusetts General Hospital, Boston, MA (United States); Sharp, G; Testa, M; Lu, H-M [Massachusetts General Hospital, Boston, MA (United States); Bentefour, E [Ion Beam Applications (IBA), Louvain la Neuve (Belgium); Royle, G [University College London, London (United Kingdom)

    2014-06-15

    Purpose: Beam range uncertainty in proton treatment comes primarily from converting the patient's X-ray CT (xCT) dataset to relative stopping power (RSP). Current practices use a single curve for this conversion, produced by a stoichiometric calibration based on tissue composition data for average, healthy, adult humans, but not for the individual in question. Proton radiographs produce water-equivalent path length (WEPL) maps, dependent on the RSP of tissues within the specific patient. This work investigates the use of such WEPL maps to optimize patient-specific calibration curves for reducing beam range uncertainty. Methods: The optimization procedure works on the principle of minimizing the difference between the known WEPL map, obtained from a proton radiograph, and a digitally-reconstructed WEPL map (DRWM) through an RSP dataset, by altering the calibration curve that is used to convert the xCT into an RSP dataset. DRWMs were produced with Plastimatch, an in-house developed software, and an optimization procedure was implemented in Matlab. Tests were made on a range of systems including simulated datasets with computed WEPL maps and phantoms (anthropomorphic and real biological tissue) with WEPL maps measured by single detector proton radiography. Results: For the simulated datasets, the optimizer showed excellent results. It was able to either completely eradicate or significantly reduce the root-mean-square-error (RMSE) in the WEPL for the homogeneous phantoms (to zero for individual materials or from 1.5% to 0.2% for the simultaneous optimization of multiple materials). For the heterogeneous phantom the RMSE was reduced from 1.9% to 0.3%. Conclusion: An optimization procedure has been designed to produce patient-specific calibration curves. Test results on a range of systems with different complexities and sizes have been promising for accurate beam range control in patients. This project was funded equally by the Engineering and Physical Sciences Research Council (UK) and Ion Beam Applications (Louvain-La-Neuve, Belgium)

  13. Recovery of coral cover in records spanning 44 yr for reefs in Kāne`ohe Bay, Oa`hu, Hawai`i

    Science.gov (United States)

    Stimson, John

    2018-03-01

    Published and unpublished long-term studies are assembled to examine trends in coral cover and the dependence of change in coral cover on the initial coral cover in Kāne`ohe Bay over the last 44 yr. Each study showed there had been periods of increase in coral cover in the bay and showed that the rate of change in cover has been inversely dependent on the initial cover at a site. When coral cover is high on upper reef slopes, the fragile structure of reefs in this sheltered bay often collapses, resulting in a decrease in coral cover. The rate of change in coral cover was also inversely dependent on cover in one of the two studies that included analysis of reef-flat corals; the cause of decrease in cover in this habitat is thought to be attributable to particularly low sea levels in Hawai`i in the late 1990s and 2009-2010. The inverse relationship between initial coral cover and change in cover, and the intersections of the regression lines of these variables with the x-axis at intermediate values of coral cover, is indicative of resilience in this ecosystem over the last 44 yr. In the 1970s, the invasive macroscopic green alga Dictyosphaeria cavernosa covered a high percentage of coral habitat and commonly displaced corals from the reef slope and outer reef flats; the change was cited as an example of a phase shift on a reef. This alga has virtually disappeared from the bay, thus increasing the space available to corals; its disappearance is coincident with the increase in coral cover. Other species of macroalgae, including alien species, have not replaced D. cavernosa as major space competitors. The increase in coral cover and virtual disappearance of D. cavernosa constitute an example of a phase-shift reversal.

  14. Tipos y producciones en las cerámicas de paredes finas procedentes del "municipium Augusta Bilbilis" (Huérmeda-Calatayud, Zaragoza)

    OpenAIRE

    Mínguez Morales, José Antonio

    2002-01-01

    El presente trabajo supone una aproximación a las cerámicas de "paredes finas" procedentes del municipium Auguata Bilbilis encontradas durante las excavaciones desarrolladas por el equipo de la Universidad de Zaragoza, dirigido por el Dr. Martín-Bueno, entre los años 1972 y 1996. Dicho conjunto aporta un arco cronológico que va desde el periodo tardorrepublicano, o comienzos del principado de Augusto, al siglo 1 d.C. Sus áreas de procedencia pueden agruparse en dos grandes bloques: la penínsu...

  15. The precision of proton range calculations in proton radiotherapy treatment planning: experimental verification of the relation between CT-HU and proton stopping power

    International Nuclear Information System (INIS)

    Schaffner, B.; Pedroni, E.

    1998-01-01

    The precision in proton radiotherapy treatment planning depends on the accuracy of the information used to calculate the stopping power properties of the tissues in the patient's body. This information is obtained from computed tomography (CT) images using a calibration curve to convert CT Hounsfield units into relative proton stopping power values. The validity of a stoichiometric method to create the calibration curve has been verified by measuring pairs of Hounsfield units and stopping power values for animal tissue samples. It was found that the agreement between measurement and calibration curve is better than 1% if beam hardening effects in the acquisition of the CT images can be neglected. The influence of beam hardening effects on the quantitative reading of the CT measurements is discussed and an estimation for the overall range precision of proton beams is given. It is expected that the range of protons in the human body can be controlled to better than ±1.1% of the water equivalent range in soft tissue and ±1.8% in bone, which translates into a range precision of about 1-3 mm in typical treatment situations. (author)

  16. Influencia de la calidad de servicio en la satisfacción de los clientes en el Scotiabank - agencia Huánuco período 2013

    OpenAIRE

    Martínez Espinoza, Evangelina

    2015-01-01

    Uno de los desafíos más inmediatos para las entidades financieras es considerar a la calidad del servicio financiero como el precio que hay que pagar para poder entrar a competir en el mercado. Es decir, no sólo es un factor diferenciador frente a la competencia, sino un elemento imprescindible para sobrevivir. Así, las entidades financieras que sean capaces de definir, medir y alcanzar la calidad exigida por sus clientes podrán obtener y mantener una fuerte ventaja competitiva frente al rest...

  17. Podávání vitamínových přípravků v průběhu gravidity

    OpenAIRE

    Matoušková, Karolína

    2017-01-01

    This thesis discusses problems of pregnancy and increased nutrient requirements with a focus on vitamins and minerals. It is divided into two parts - theoretical and practical. The aim is to identify those vitamins and minerals that may be deficient during pregnancy and thus their intake should be increased. The theoretical part describes the importance of particular elements for the specifics of pregnancy and possible symptoms of deficiency or excess, with the pregnancy orientation. The prac...

  18. [Effects of a lipid-based nutrient supplement on hemoglobin levels and anthropometric indicators in children from five districts in Huánuco Peru].

    Science.gov (United States)

    Vargas-Vásquez, Alejandro; Bado, Ricardo; Alcázar, Lorena; Aquino, Oscar; Rodríguez, Amelia; Novalbos, José Pedro

    2015-01-01

    Objectives . To determine the effect of consumption of a lipid-based nutrient supplement (LNS) on hemoglobin levels, anemia and anthropometric indicators in children aged six to eleven months old in five districts in the province of Ambo in the region of Huanuco, Peru. A pre-experimental, pre-post study was performed. The study population included children aged six to eleven months old in 19 health facilities in five districts with very high vulnerability to chronic malnutrition in the province of Ambo, Huanuco. Data from 147 children who received the lipid-based nutrient supplement (LNS) from six to eleven months old were obtained. The mean hemoglobin significantly increased by 0.67 g/dL (panemia dropped by 27 percentage points (panemia in children under twelve months, which might constitute an effective alternative to prevent and control childhood anemia.

  19. Estructura y legitimación del delito de colusión e impunidad en el distrito judicial de Huánuco

    OpenAIRE

    Vásquez Solís, Leoncio

    2015-01-01

    El delito de colusión es un tipo penal especial, que exige para la determinación correcta de imputación el conocimiento de normas extrapenales para configurar el ilícito, sin embargo, debido a la complejidad de las normas previas a la tipificación del delito de colusión, y la necesidad de punibilidad este tipo de delitos que afecta gravemente el normal desarrollo del sistema financiero público del Estado, el legislador ha tenido de recurrir a un conjunto de modificatorias...

  20. Visit of the chinese Vice-President of the people's republic of China, Hu Jintao, at the Bugey nuclear power plant

    International Nuclear Information System (INIS)

    2001-11-01

    During the visit of the Vice-President of the people's republic of China at the Bugey nuclear power plant, EDF showed its will of cooperation with China in the energy domain. This document presents the main aspects of this cooperation: the chinese electric power system panorama, the EDF investments in China and the future development. (A.L.B.)