WorldWideScience

Sample records for hsi fy05 pilot-technology

  1. Step 1: Human System Integration (HSI) FY05 Pilot-Technology Interface Requirements for Contingency Management

    Science.gov (United States)

    2005-01-01

    This document involves definition of technology interface requirements for Contingency Management. This was performed through a review of Contingency Management-related, HSI requirements documents, standards, and recommended practices. Technology concepts in use by the Contingency Management Work Package were considered. Beginning with HSI high-level functional requirements for Contingency Management, and Contingency Management technology elements, HSI requirements for the interface to the pilot were identified. Results of the analysis describe (1) the information required by the pilot to have knowledge of system failures and associated contingency procedures, and (2) the control capability needed by the pilot to obtain system status and procedure information. Fundamentally, these requirements provide the candidate Contingency Management technology concepts with the necessary human-related elements to make them compatible with human capabilities and limitations. The results of the analysis describe how Contingency Management operations and functions should interface with the pilot to provide the necessary Contingency Management functionality to the UA-pilot system. Requirements and guidelines for Contingency Management are partitioned into four categories: (1) Health and Status and (2) Contingency Management. Each requirement is stated and is supported with a rationale and associated reference(s).

  2. Step 1: Human System Integration (HSI) FY05 Pilot-Technology Interface Requirements for Command, Control, and Communications (C3)

    Science.gov (United States)

    2005-01-01

    The document provides the Human System Integration(HSI) high-level functional C3 HSI requirements for the interface to the pilot. Description includes (1) the information required by the pilot to have knowledge C3 system status, and (2) the control capability needed by the pilot to obtain C3 information. Fundamentally, these requirements provide the candidate C3 technology concepts with the necessary human-related elements to make them compatible with human capabilities and limitations. The results of the analysis describe how C3 operations and functions should interface with the pilot to provide the necessary C3 functionality to the UA-pilot system. Requirements and guidelines for C3 are partitioned into three categories: (1) Pilot-Air Traffic Control (ATC) Voice Communications (2) Pilot-ATC Data Communications, and (3) command and control of the unmanned aircraft (UA). Each requirement is stated and is supported with a rationale and associated reference(s).

  3. FY05 FM Dial Summary Report

    Energy Technology Data Exchange (ETDEWEB)

    Harper, Warren W.; Strasburg, Jana D.; Golovich, Elizabeth C.; Thompson, Jason S.; Stewart, Timothy L.; Batdorf, Michael T.

    2005-12-01

    Pacific Northwest National Laboratory's Infrared Sensors team is focused on developing methods for standoff detection of nuclear proliferation. In FY05, PNNL continued the development of the FM DIAL (frequency-modulated differential absorption LIDAR) experiment. Additional improvements to the FM DIAL trailer provided greater stability during field campaigns which made it easier to explore new locations for field campaigns. In addition to the Hanford Townsite, successful experiments were conducted at the Marine Science Laboratory in Sequim, WA and the Nevada Test Site located outside Las Vegas, NV. The range of chemicals that can be detected by FM DIAL has also increased. Prior to FY05, distributed feedback quantum cascade lasers (DFB-QCL) were used in the FM DIAL experiments. With these lasers, only simple chemicals with narrow (1-2 cm-1) absorption spectra, such as CO2 and N2O, could be detected. Fabry-Perot (FP) QC lasers have much broader spectra (20-40 cm-1) which allows for the detection of larger chemicals and a wider array of chemicals that can be detected. A FP-QCL has been characterized and used during initial studies detecting DMMP (dimethyl methylphosphonate).

  4. FY05 Targeted Technology Transfer to US Independents

    Energy Technology Data Exchange (ETDEWEB)

    Donald F. Duttlinger; E. Lance Cole

    2005-11-01

    , the PTTC from the start has captured and reported data that document the myriad ways its programs impact industry. Of 119 workshops in FY05 where repeat attendance was reported, 59 percent of attendees on average had attended a PTTC event previously, indicating that a majority felt they were receiving enough value to come back. It also is encouraging that, after 11 years, PTTC events continue to attract new people. The form used at workshops to get participants feedback asks for a ''yes'' or ''no'' response to the question: ''Have you used any new technologies based on knowledge gained through PTTC?'' With data now available from 611 workshops, 41 percent of respondents said, ''yes'', confirming that people are applying the information they receive at PTTC workshops. PTTC in FY04 asked RLO directors, oilfield service companies and producers in 11 areas with significant technological barriers to adding new reserves to estimate the ''PTTC Impact Factor''--that is, the percentage of the total reserves added in their areas that logically could be attributed to PTTC's efforts. Of the estimated 1,266 million barrels of oil equivalent (BOE) added in the 11 areas, participants estimated that roughly 88 million BOE had been added as a result of PTTC's techtransfer efforts. PTTC's 10 regions are the primary delivery mechanism for technology transfer. Attendance at PTTC regional activities set a record in FY05, with 8,900 individuals attending 154 workshops, lunch-and-learn events, or student training and internships. When appropriate, regional workshops incorporate R&D findings from DOE-funded projects. This year HQ began a ''Microhole Technology Integration'' Initiative with DOE to more clearly present their microhole program to producers. Often events are held cooperatively with other national organizations, regional producer associations and

  5. Gas-Cooled Fast Reactor (GFR) FY05 Annual Report

    Energy Technology Data Exchange (ETDEWEB)

    K. D. Weaver; T. Marshall; T. Totemeier; J. Gan; E.E. Feldman; E.A Hoffman; R.F. Kulak; I.U. Therios; C. P. Tzanos; T.Y.C. Wei; L-Y. Cheng; H. Ludewig; J. Jo; R. Nanstad; W. Corwin; V. G. Krishnardula; W. F. Gale; J. W. Fergus; P. Sabharwall; T. Allen

    2005-09-01

    participating in research related to the development of the GFR. These are Euratom (European Commission), France, Japan, South Africa, South Korea, Switzerland, and the United Kingdom. Of these, Euratom (including the United Kingdom and Switzerland), France, and Japan have active research activities with respect to the GFR. The research includes GFR design and safety, and fuels/in-core materials/fuel cycle projects. This report outlines the current design status of the GFR, and includes work done in the areas mentioned above for this fiscal year. In addition, this report fulfills the Level 2 milestones, ''Complete annual status report on GFR reactor design'', and ''Complete annual status report on pre-conceptual GFR reactor designs'' in work package GI0401K01. GFR funding for FY05 included FY04 carryover funds, and was comprised of multiple tasks. These tasks involved a consortium of national laboratories and universities, including the Idaho National Laboratory (INL), Argonne National Laboratory (ANL), Brookhaven National Laboratory (BNL), Oak Ridge National Laboratory (ORNL), Auburn University (AU), Idaho State University (ISU), and the University of Wisconsin-Madison (UW-M). The total funding for FY05 was $1000K, with FY04 carryover of $174K. The cost breakdown can be seen in Table 1.

  6. Analyses in Support of Z-IFE LLNL Progress Report for FY-05

    International Nuclear Information System (INIS)

    Moir, R W; Abbott, R P; Callahan, D A; Latkowski, J F; Meier, W R; Reyes, S

    2005-01-01

    The FY04 LLNL study of Z-IFE [1] proposed and evaluated a design that deviated from SNL's previous baseline design. The FY04 study included analyses of shock mitigation, stress in the first wall, neutronics and systems studies. In FY05, the subject of this report, we build on our work and the theme of last year. Our emphasis continues to be on alternatives that hold promise of considerable improvements in design and economics compared to the base-line design. Our key results are summarized here

  7. HSI in NASA: From Research to Implementation

    Science.gov (United States)

    Whitmore, Mihriban; Plaga, John A.

    2016-01-01

    As NASA plans to send human explorers beyond low Earth orbit, onward to Mars and other destinations in the solar system, there will be new challenges to address in terms of HSI. These exploration missions will be quite different from the current and past missions such as Apollo, Shuttle, and International Space Station. The exploration crew will be more autonomous from ground mission control with delayed, and at times, no communication. They will have limited to no resupply for much longer mission durations. Systems to deliver and support extended human habitation at these destinations are extremely complex and unique, presenting new opportunities to employ HSI practices. In order to have an effective and affordable HSI implementation, both research and programmatic efforts are required. Currently, the HSI-related research at NASA is primarily in the area of space human factors and habitability. The purpose is to provide human health and performance countermeasures, knowledge, technologies, and tools to enable safe, reliable, and productive human space exploration beyond low Earth orbit, and update standards, requirements, and processes to verify and validate these requirements. In addition, HSI teams are actively engaged in technology development and demonstration efforts to influence the mission architecture and next-generation vehicle design. Finally, appropriate HSI references have been added to NASA' s systems engineering documentation, and an HSI Practitioner's Guide has been published to help design engineers consider HSI early and continuously in the acquisition process. These current and planned HSI-related activities at NASA will be discussed in this panel.

  8. Human Systems Integration (HSI) Practitioner's Guide

    Science.gov (United States)

    Zumbado, Jennifer Rochlis

    2015-01-01

    The NASA/SP-2015-3709, Human Systems Integration (HSI) Practitioner's Guide, also known as the "HSIPG," provides a tool for implementing HSI activities within the NASA systems engineering framework. The HSIPG is written to aid the HSI practitioner engaged in a program or project (P/P), and serves as a knowledge base to allow the practitioner to step into an HSI lead or team member role for NASA missions. Additionally, this HSIPG is written to address the role of HSI in the P/P management and systems engineering communities and aid their understanding of the value added by incorporating good HSI practices into their programs and projects. Through helping to build a community of knowledgeable HSI practitioners, this document also hopes to build advocacy across the Agency for establishing strong, consistent HSI policies and practices. Human Systems Integration (HSI) has been successfully adopted (and adapted) by several federal agencies-most notably the U.S. Department of Defense (DoD) and the Nuclear Regulatory Commission (NRC)-as a methodology for reducing system life cycle costs (LCCs). These cost savings manifest themselves due to reductions in required numbers of personnel, the practice of human-centered design, decreased reliance on specialized skills for operations, shortened training time, efficient logistics and maintenance, and fewer safety-related risks and mishaps due to unintended human/system interactions. The HSI process for NASA establishes how cost savings and mission success can be realized through systems engineering. Every program or project has unique attributes. This HSIPG is not intended to provide one-size-fits-all recommendations for HSI implementation. Rather, HSI processes should be tailored to the size, scope, and goals of individual situations. The instructions and processes identified here are best used as a starting point for implementing human-centered system concepts and designs across programs and projects of varying types, including

  9. Human-Systems Integration (HSI) Methodology Development for NASA

    Data.gov (United States)

    National Aeronautics and Space Administration — Human-Systems Integration (HSI) refers to design activities associated with ensuring that manpower, personnel, training, human factors engineering, safety, health...

  10. NASA Langley Low Speed Aeroacoustic Wind Tunnel: Background Noise and Flow Survey Results Prior to FY05 Construction of Facilities Modifications

    Science.gov (United States)

    Booth, Earl R., Jr.; Henderson, Brenda S.

    2005-01-01

    The NASA Langley Research Center Low Speed Aeroacoustic Wind Tunnel is a premier facility for model-scale testing of jet noise reduction concepts at realistic flow conditions. However, flow inside the open jet test section is less than optimum. A Construction of Facilities project, scheduled for FY 05, will replace the flow collector with a new design intended to reduce recirculation in the open jet test section. The reduction of recirculation will reduce background noise levels measured by a microphone array impinged by the recirculation flow and will improve flow characteristics in the open jet tunnel flow. In order to assess the degree to which this modification is successful, background noise levels and tunnel flow are documented, in order to establish a baseline, in this report.

  11. Toward an Improved Method of HSI Evaluation in Defense Acquisition

    National Research Council Canada - National Science Library

    Simpson, Matthew

    2006-01-01

    Each of the domains of HSI is of itself a discipline with vast amounts of research, analytic techniques, educational programs, and methods for evaluating the effectiveness of the system with respect...

  12. A DBN based anomaly targets detector for HSI

    Science.gov (United States)

    Ma, Ning; Wang, Shaojun; Yu, Jinxiang; Peng, Yu

    2017-10-01

    Due to the assumption that Hyperspectral image (HSI) should conform to Gaussian distribution, traditional Mahalanobis distance-based anomaly targets detectors perform poor because the assumption may not always hold. In order to solve those problems, a deep learning based detector, Deep Belief Network(DBN) anomaly detector(DBN-AD), was proposed to fit the unknown distribution of HSI by energy modeling, the reconstruction errors of this encode-decode processing are used for discriminating the anomaly targets. Experiments are implemented on real and synthesized HSI dataset which collection by Airborne Visible Infra-Red Imaging Spectrometer (AVIRIS). Comparing to classic anomaly detector, the proposed method shows better performance, it performs about 0.17 higher in Area Under ROC Curve (AUC) than that of Reed-Xiaoli detector(RXD) and Kernel-RXD (K-RXD).

  13. Toward an Improved Method of HSI Evaluation in Defense Acquisition

    Science.gov (United States)

    2006-12-01

    Edit Parameter’ (A) and ‘Edit Interaction’ (B). . 38 Figure 13. HSI slider tool concept (From http://Kn.gd- ais.com/ASPs/ eLearning /HSI_Sliders...DoD5002/Figure1.asp) The costs associated with any system are not restricted to the amount of money spent to buy the item. In order to better...used in the decision-maker’s interface 39 described later. The information for each parameter is saved by selecting the ‘ Save ’ button at the

  14. Conflict Management Styles in an HBCU HSI Community College Setting

    Science.gov (United States)

    Schmittou, Natasha P.

    2012-01-01

    The purpose of this quantitative study is to investigate the conflict management styles in an HBCU and HSI community college and how gender, power position, age, educational level, and ethnicity influence conflict management. A convenience sample of 80 administrators and 220 subordinates completed an electronic demographic survey and the…

  15. A mathematical model of calcium dynamics in HSY cells.

    Directory of Open Access Journals (Sweden)

    Jung Min Han

    2017-02-01

    Full Text Available Saliva is an essential part of activities such as speaking, masticating and swallowing. Enzymes in salivary fluid protect teeth and gums from infectious diseases, and also initiate the digestion process. Intracellular calcium (Ca2+ plays a critical role in saliva secretion and regulation. Experimental measurements of Ca2+ and inositol trisphosphate (IP3 concentrations in HSY cells, a human salivary duct cell line, show that when the cells are stimulated with adenosine triphosphate (ATP or carbachol (CCh, they exhibit coupled oscillations with Ca2+ spike peaks preceding IP3 spike peaks. Based on these data, we construct a mathematical model of coupled Ca2+ and IP3 oscillations in HSY cells and perform model simulations of three different experimental settings to forecast Ca2+ responses. The model predicts that when Ca2+ influx from the extracellular space is removed, oscillations gradually slow down until they stop. The model simulation of applying a pulse of IP3 predicts that photolysis of caged IP3 causes a transient increase in the frequency of the Ca2+ oscillations. Lastly, when Ca2+-dependent activation of PLC is inhibited, we see an increase in the oscillation frequency and a decrease in the amplitude. These model predictions are confirmed by experimental data. We conclude that, although concentrations of Ca2+ and IP3 oscillate, Ca2+ oscillations in HSY cells are the result of modulation of the IP3 receptor by intracellular Ca2+, and that the period is modulated by the accompanying IP3 oscillations.

  16. Exploring College Students' Identification with an Organizational Identity for Serving Latinx Students at a Hispanic Serving Institution (HSI) and an Emerging HSI

    Science.gov (United States)

    Garcia, Gina A.; Dwyer, Brighid

    2018-01-01

    Hispanic Serving Institutions (HSIs; postsecondary institutions that enroll 25% or more Latinx students) are increasing in significance. But to what extent do students attending an HSI, or an emerging HSI (enrolls 15-24% Latinx students), identify with an organizational identity for serving Latinx students? There is a need to understand how…

  17. Image Enhancement In HSI Space Using Wavelet Transform

    Science.gov (United States)

    Bansal, Sonia; Malhotra, Deepti

    2010-11-01

    Image processing modifies images to improve them (enhancement, restoration), extract information (analysis, recognition), and change their structure (composition, image editing). Image Enhancement is simple and most appealing area among all the digital image processing techniques. The main purpose of image enhancement is to bring out detail that is hidden in an image or to increase contrast in a low contrast image [1]. The color restoration functions of some real color image enhancement algorithms are greatly at random and not proved , and the real color images enhanced which are based on illumination-reflectance model have the loss of details and the `halos', we proposed a new algorithm to overcome these disadvantages. Firstly, we transform the real color image from RGB space to HSI space which is approximately orthonormal system. Secondly, the illumination and the reflectance of value are separated by homomorphic filtering based on illumination-reflectance model. We have discovered that the high dynamic range of image including high bright lights is mainly caused by the reflectance. Thirdly, the details of reflectance are preserved by wavelet transform. Fourthly, the dynamic range of reflectance is compressed by Butterworth filtering. Lastly, the energy of the saturation of real color image in HSI space is attenuated according to the spectral sensitivity of most human vision.

  18. Comparing the Heat Stress Index of HSI and WBGT in BakeryWorkplaces in Hamadan

    Directory of Open Access Journals (Sweden)

    S. Mahdavi

    2006-10-01

    Full Text Available Background and aims   Thermal stress is one of the important issues of physical stress in workplaces. Bakery workers that are one of widely population that under occupation heat stress. In this study, heat stress indexes consist of HSI and WBGT in worker positions in total of 88  bakeries in Hamadan city was assessed.   Methods   In this study 88 bakery workplace was considered. Measuring of air variables to obtain  of HSI and WBGTheat stress indices was performed by axial fan anemometer, WBGTmeter and  hygrometer made in CASELLA CompanyIn this study 88 bakery workplace was considered.   Measuring of air variables to obtain of HSI and WBGTheat stress indices was performed by axial fan anemometer, WBGTmeter and hygrometer made in CASELLACompany.   Results   Results showed that the average HSI index (214.2 ± 43.7 % and the average work experience were (28.57±1.97 C. Analyzing of results showed that Pearson's correlation of coefficient between HSI and WBGT was equal to 0.509. Depending of HSI to air velocity was considerable (r = -0.811 that was not expected.   Conclusion   Values of HSI index had a wide scatter in variances in study fields comparing of  WBGTindex that had a minimal scatter, whereas those are measuring of variables and computing of indexes were same workplaces. Finally, although both heat indexes showed exceeded values form criteria, but calibration between HSI and WBGT in this study, showed that, the HSI index  had any weakness.    

  19. One method for HJ-1-A HSI and CCD data fusion

    International Nuclear Information System (INIS)

    Xiong, Wencheng; Shao, Yun; Shen, Wenming; Xiao, Rulin; Fu, Zhuo; Shi, Yuanli

    2014-01-01

    HJ-1-A satellite, developed by China independently, was equipped with two sensors of Hyper Spectral Imager (HSI) and multispectral sensor (CCD). In this paper, we examine the benefits of combining data from CCD data (high-spatial-resolution, low-spectral-resolution image) with HSI data (low -spatial-resolution, high -spectral-resolution image). Due to the same imaging time and similar spectral regime, the CCD and HSI data can be registered with each other well, and the difference between CCD and HSI data mainly is systematic bias. The approach we have been investigating compares the spectral information present in the multispectral image to the spectral content in the hyperspectral image, and derives a set of equations to approximately acquire the systematic bias between the two sensors. The systematic bias is then applied to the interpolated high-spectral CCD image to produce a fused product. This fused image has the spectral resolution of the hyperspectral image (HSI) and the spatial resolution of the multispectral image (CCD). It is capable of full exploitation as a hyperspectral image. We evaluate this technique using the data of Honghe wetland and show both good spectral and visual fidelity. An analysis of SAM classification test case shows good result when compared to original image. All in all, the approach we developed here provides a means for fusing data from HJ-1-A satellite to produce a spatial-resolution-enhanced hyperspectral data cube that can be further analyzed by spectral classification and detection algorithms

  20. The Ringhals HSI and control room modernisation programme - the practical application of a contemporary user and HF based HSI design process

    International Nuclear Information System (INIS)

    Forsberg, Martin

    2004-01-01

    The existing Ringhals 2 main control room and constituent HSI has now been in operation over approximately 30 years. It has been estimated that the plant's life expectancy can be extended a further 25 years, assuming that a comprehensive modernisation of the present R2 I and C systems is implemented. This paper is intended to provide the readers with a general overview of the modernisation programme initiated during 1999 and expected to be completed with the new MCR and HSI to be in operation during 2006. There are a number of aspects to the modernisation programme that may make it somewhat unique. Naturally the lessons learned during this programme may be of interest for other organisations discussing future plant modernisation Although we can naturally cite the conventional reasons for plant modernisation, one should not neglect other factors that at first glance may not be all that obvious. Such factors include the changing demographic trends in knowledge and training represented in the national educational processes in conjunction with the transition to digital technologies. Personnel expectations upon their future work places also play a role. Nor for that matter should issues such as personnel recruitment policies and organisational goals be underestimated in the design process. A critical aspect of the Ringhals modernisation programme that had to be tackled with was the design development process adopted for design specification, design development and design verification of the MCR and HSI solutions. From the outset Ringhals has pursued the goal of applying an integrated user and human factors (HF) based design approach in the modernisation process's design activities. Therefore user participation in the design process as well as the application of the NUREG 0711 HF Design Process Model and other suitable guidelines for HFE design processes has been a guiding principle. Ringhals possibly represents an interesting example of the practical application of

  1. Prediction of beef marblingusing Hyperspectral Imaging (HSI and Partial Least Squares Regression (PLSR

    Directory of Open Access Journals (Sweden)

    Victor Aredo

    2017-01-01

    Full Text Available The aim of this study was to build a model to predict the beef marbling using HSI and Partial Least Squares Regression (PLSR. Totally 58 samples of longissmus dorsi muscle were scanned by a HSI system (400 - 1000 nm in reflectance mode, using 44 samples to build t he PLSR model and 14 samples to model validation. The Japanese Beef Marbling Standard (BMS was used as reference by 15 middle - trained judges for the samples evaluation. The scores were assigned as continuous values and varied from 1.2 to 5.3 BMS. The PLSR model showed a high correlation coefficient in the prediction (r = 0.95, a low Standard Error of Calibration (SEC of 0.2 BMS score, and a low Standard Error of Prediction (SEP of 0.3 BMS score.

  2. Application of Different HSI Color Models to Detect Fire-Damaged Mortar

    Directory of Open Access Journals (Sweden)

    H. Luo

    2013-12-01

    Full Text Available To obtain a better understanding of the effect of vehicle fires on rigid pavement, a nondestructive test method utilizing an ordinary digital camera to capture images of mortar at five elevated temperatures was undertaken. These images were then analyzed by “image color-intensity analyzer” software. In image analysis, the RGB color model was the basic system used to represent the color information of images. HSI is a derived-color model that is transformed from an RGB model by formulae. In order to understand more about surface color changes and temperatures after a vehicle fire, various transformation formulae used in different research areas were applied in this study. They were then evaluated to obtain the optimum HSI model for further studies of fire-damaged mortar through the use of image analysis.

  3. 2 mm range ESR of the transmutation-produced phosphorus impurity in 6HSiC

    International Nuclear Information System (INIS)

    Kalabukhova, E.N.; Lukin, S.N.; Mokhov, E.N.

    1993-01-01

    Phosphorus impurity is introduced into 6HSiC monocrystals via neutron transmutation doping. Parameters of ESR two spectra referred to ESR spectra of separated phosphorus atoms in the lattice cubic and hexagonal position are detected and determined in the specimens at T=4.2 K. variation dynamics of ESR spectra of phosphorus and nitrogen within 4.2-73 K temperature range is studied. Ionization energies of phosphorus atoms are determined to be less, than those of nitrogen atoms, and ionization energy of phosphorus atoms in hexagonal position is higher, than that of phosphorus atoms in cubic position

  4. Step 1: Human System Interface (HSI) Functional Requirements Document (FRD). Version 2

    Science.gov (United States)

    2006-01-01

    This Functional Requirements Document (FRD) establishes a minimum set of Human System Interface (HSI) functional requirements to achieve the Access 5 Vision of "operating High Altitude, Long Endurance (HALE) Unmanned Aircraft Systems (UAS) routinely, safely, and reliably in the National Airspace System (NAS)". Basically, it provides what functions are necessary to fly UAS in the NAS. The framework used to identify the appropriate functions was the "Aviate, Navigate, Communicate, and Avoid Hazards" structure identified in the Access 5 FRD. As a result, fifteen high-level functional requirements were developed. In addition, several of them have been decomposed into low-level functional requirements to provide more detail.

  5. Ab Initio Potential Energy Surfaces for Both the Ground (X̃1A′ and Excited (A∼1A′′ Electronic States of HSiBr and the Absorption and Emission Spectra of HSiBr/DSiBr

    Directory of Open Access Journals (Sweden)

    Anyang Li

    2012-01-01

    Full Text Available Ab initio potential energy surfaces for the ground (X̃1A′ and excited (A˜A′′1 electronic states of HSiBr were obtained by using the single and double excitation coupled-cluster theory with a noniterative perturbation treatment of triple excitations and the multireference configuration interaction with Davidson correction, respectively, employing an augmented correlation-consistent polarized valence quadruple zeta basis set. The calculated vibrational energy levels of HSiBr and DSiBr of the ground and excited electronic states are in excellent agreement with the available experimental band origins. In addition, the absorption and emission spectra of HSiBr and DSiBr were calculated using an efficient single Lanczos propagation method and are in good agreement with the available experimental observations.

  6. Synthesis and study of NH4[HSiUO6]·0.5H2O

    International Nuclear Information System (INIS)

    Chernorukov, N.G.; Kortikov, V.E.

    2000-01-01

    Previously unknown ammonium uranosilicate of NH 4 [HSiUO 6 ]·0.5H 2 O composition is synthesised by precipitation from aqueous solution containing ammonium chloride, uranyl nitrate and quartz glass with the size of granules ≤ 2. On evidence of X-ray diffraction ammonium uranosilicate is a full crystallographic analog of proper lithium and potassium derivatives with approaching parameters of crystal lattices: a= 7.01(2), b=7.03(8), c=6.65(9) A, β=105.6(0) Deg. Functional composition and peculiarity of ammonium uranosilicate structure are detected by IR spectroscopic study. Scheme of thermal decomposition of ammonium uranosilicate is demonstrated based on thermal gravimetric and X-ray diffraction measurements. NH 4 [HSiUO 6 ]·0.5H 2 O is among of morphotropic raw of A 1/k k HSiUO 6 ·nH 2 O [ru

  7. Butterfly Classification by HSI and RGB Color Models Using Neural Networks

    Directory of Open Access Journals (Sweden)

    Jorge E. Grajales-Múnera

    2013-11-01

    Full Text Available This study aims the classification of Butterfly species through the implementation of Neural Networks and Image Processing. A total of 9 species of Morpho genre which has blue as a characteristic color are processed. For Butterfly segmentation we used image processing tools such as: Binarization, edge processing and mathematical morphology. For data processing RGB values are obtained for every image which are converted to HSI color model to identify blue pixels and obtain the data to the proposed Neural Networks: Back-Propagation and Perceptron. For analysis and verification of results confusion matrix are built and analyzed with the results of neural networks with the lowest error levels. We obtain error levels close to 1% in classification of some Butterfly species.

  8. Principle of human system interface (HSI) design for new reactor console of PUSPATI TRIGA Reactor (RTP)

    International Nuclear Information System (INIS)

    Zareen Khan Abdul Jalil Khan; Ridzuan Abdul Mutalib; Mohd Idris Taib; Mohd Khairulezwan Abdul Manan; Nurfarhana Ayuni Joha; Mohd Sabri Minhat; Izhar Abu Hussin

    2013-01-01

    Full-text: This paper will describe the principle of human system interface design for new reactor console in control room at TRIGA reactor facility. In order to support these human system interface challenges in digital reactor console. Software-based instrumentation and control (I and C) system for new reactor console could lead to new human machine integration. The proposed of Human System Interface (HSI) which included the large display panels which shows reactor status, compact and computer-based workstations for monitoring, control and protection function. The proposed Human System Interface (HIS) has been evaluated using various human factor engineering. It can be concluded that the Human System Interface (HIS) is designed as to address the safety related computer controlled system. (author)

  9. A HyperSpectral Imaging (HSI) approach for bio-digestate real time monitoring

    Science.gov (United States)

    Bonifazi, Giuseppe; Fabbri, Andrea; Serranti, Silvia

    2014-05-01

    One of the key issues in developing Good Agricultural Practices (GAP) is represented by the optimal utilisation of fertilisers and herbicidal to reduce the impact of Nitrates in soils and the environment. In traditional agriculture practises, these substances were provided to the soils through the use of chemical products (inorganic/organic fertilizers, soil improvers/conditioners, etc.), usually associated to several major environmental problems, such as: water pollution and contamination, fertilizer dependency, soil acidification, trace mineral depletion, over-fertilization, high energy consumption, contribution to climate change, impacts on mycorrhizas, lack of long-term sustainability, etc. For this reason, the agricultural market is more and more interested in the utilisation of organic fertilisers and soil improvers. Among organic fertilizers, there is an emerging interest for the digestate, a sub-product resulting from anaerobic digestion (AD) processes. Several studies confirm the high properties of digestate if used as organic fertilizer and soil improver/conditioner. Digestate, in fact, is somehow similar to compost: AD converts a major part of organic nitrogen to ammonia, which is then directly available to plants as nitrogen. In this paper, new analytical tools, based on HyperSpectral Imaging (HSI) sensing devices, and related detection architectures, is presented and discussed in order to define and apply simple to use, reliable, robust and low cost strategies finalised to define and implement innovative smart detection engines for digestate characterization and monitoring. This approach is finalized to utilize this "waste product" as a valuable organic fertilizer and soil conditioner, in a reduced impact and an "ad hoc" soil fertilisation perspective. Furthermore, the possibility to contemporary utilize the HSI approach to realize a real time physicalchemical characterisation of agricultural soils (i.e. nitrogen, phosphorus, etc., detection) could

  10. Step 1: Human System Integration Pilot-Technology Interface Requirements for Weather Management

    Science.gov (United States)

    2005-01-01

    This document involves definition of technology interface requirements for Hazardous Weather Avoidance. Technology concepts in use by the Access 5 Weather Management Work Package were considered. Beginning with the Human System Integration (HIS) high-level functional requirement for Hazardous Weather Avoidance, and Hazardous Weather Avoidance technology elements, HSI requirements for the interface to the pilot were identified. Results of the analysis describe (1) the information required by the pilot to have knowledge of hazardous weather, and (2) the control capability needed by the pilot to obtain hazardous weather information. Fundamentally, these requirements provide the candidate Hazardous Weather Avoidance technology concepts with the necessary human-related elements to make them compatible with human capabilities and limitations. The results of the analysis describe how Hazardous Weather Avoidance operations and functions should interface with the pilot to provide the necessary Weather Management functionality to the UA-pilot system. Requirements and guidelines for Hazardous Weather Avoidance are partitioned into four categories: (1) Planning En Route (2) Encountering Hazardous Weather En Route, (3) Planning to Destination, and (4) Diversion Planning Alternate Airport. Each requirement is stated and is supported with a rationale and associated reference(s).

  11. Medical Image Segmentation using the HSI color space and Fuzzy Mathematical Morphology

    International Nuclear Information System (INIS)

    Gasparri, J P; Bouchet, A; Abras, G; Ballarin, V; Pastore, J I

    2011-01-01

    Diabetic retinopathy is the most common cause of blindness among the active population in developed countries. An early ophthalmologic examination followed by proper treatment can prevent blindness. The purpose of this work is develop an automated method for segmentation the vasculature in retinal images in order to assist the expert in the evolution of a specific treatment or in the diagnosis of a potential pathology. Since the HSI space has the ability to separate the intensity of the intrinsic color information, its use is recommended for the digital processing images when they are affected by lighting changes, characteristic of the images under study. By the application of color filters, is achieved artificially change the tone of blood vessels, to better distinguish them from the bottom. This technique, combined with the application of fuzzy mathematical morphology tools as the Top-Hat transformation, creates images of the retina, where vascular branches are markedly enhanced over the original. These images provide the visualization of blood vessels by the specialist.

  12. HSI for monitoring the critical safety functions status tree of a NPP

    International Nuclear Information System (INIS)

    Oliveira, Mauro Vitor de; Almeida, Jose Carlos Soares de; Augusto, Silas Cordeiro; Jaime, Guilherme Dutra Gonzaga

    2013-01-01

    Critical safety function (CSF) is the most significant design concept for prioritize operator actions based on the potential threat to the three barriers (fuel cladding, primary coolant system boundary, and containment) and allows the operator to respond to these threats prior to event diagnosis. CSF has a hierarchical information structure that organizes the system variables affecting the plant safety in terms of goal-means relations. It is important that the operator should be aware of various success paths associated with each CSF in order to respond to unanticipated system failures quickly. When an emergency occurs in NPPs, the operator should monitor CSFs periodically and identify possible success paths as necessary, and try to stabilize or safely shut down the plant using emergency operating procedure (EOP) that includes steps to check the CSFs. This implies that safety function status check may become a cognitively burdensome task that needs to be supported by proper information display. The advanced human-system interface (HSI) in nuclear power plants provides an information environment that supports the operators' burdensome cognitive tasks. This paper describes a CSFs interface design for supporting the operator's tasks to monitor and identify the associated success path for Westinghouse 3-loops NPP. (author)

  13. Medical Image Segmentation using the HSI color space and Fuzzy Mathematical Morphology

    Science.gov (United States)

    Gasparri, J. P.; Bouchet, A.; Abras, G.; Ballarin, V.; Pastore, J. I.

    2011-12-01

    Diabetic retinopathy is the most common cause of blindness among the active population in developed countries. An early ophthalmologic examination followed by proper treatment can prevent blindness. The purpose of this work is develop an automated method for segmentation the vasculature in retinal images in order to assist the expert in the evolution of a specific treatment or in the diagnosis of a potential pathology. Since the HSI space has the ability to separate the intensity of the intrinsic color information, its use is recommended for the digital processing images when they are affected by lighting changes, characteristic of the images under study. By the application of color filters, is achieved artificially change the tone of blood vessels, to better distinguish them from the bottom. This technique, combined with the application of fuzzy mathematical morphology tools as the Top-Hat transformation, creates images of the retina, where vascular branches are markedly enhanced over the original. These images provide the visualization of blood vessels by the specialist.

  14. Measuring Leaf Area in Soy Plants by HSI Color Model Filtering and Mathematical Morphology

    International Nuclear Information System (INIS)

    Benalcázar, M; Padín, J; Brun, M; Pastore, J; Ballarin, V; Peirone, L; Pereyra, G

    2011-01-01

    There has been lately a significant progress in automating tasks for the agricultural sector. One of the advances is the development of robots, based on computer vision, applied to care and management of soy crops. In this task, digital image processing plays an important role, but must solve some important problems, like the ones associated to the variations in lighting conditions during image acquisition. Such variations influence directly on the brightness level of the images to be processed. In this paper we propose an algorithm to segment and measure automatically the leaf area of soy plants. This information is used by the specialists to evaluate and compare the growth of different soy genotypes. This algorithm, based on color filtering using the HSI model, detects green objects from the image background. The segmentation of leaves (foliage) was made applying Mathematical Morphology. The foliage area was estimated counting the pixels that belong to the segmented leaves. From several experiments, consisting in applying the algorithm to measure the foliage of about fifty plants of various genotypes of soy, at different growth stages, we obtained successful results, despite the high brightness variations and shadows in the processed images.

  15. Measuring Leaf Area in Soy Plants by HSI Color Model Filtering and Mathematical Morphology

    Science.gov (United States)

    Benalcázar, M.; Padín, J.; Brun, M.; Pastore, J.; Ballarin, V.; Peirone, L.; Pereyra, G.

    2011-12-01

    There has been lately a significant progress in automating tasks for the agricultural sector. One of the advances is the development of robots, based on computer vision, applied to care and management of soy crops. In this task, digital image processing plays an important role, but must solve some important problems, like the ones associated to the variations in lighting conditions during image acquisition. Such variations influence directly on the brightness level of the images to be processed. In this paper we propose an algorithm to segment and measure automatically the leaf area of soy plants. This information is used by the specialists to evaluate and compare the growth of different soy genotypes. This algorithm, based on color filtering using the HSI model, detects green objects from the image background. The segmentation of leaves (foliage) was made applying Mathematical Morphology. The foliage area was estimated counting the pixels that belong to the segmented leaves. From several experiments, consisting in applying the algorithm to measure the foliage of about fifty plants of various genotypes of soy, at different growth stages, we obtained successful results, despite the high brightness variations and shadows in the processed images.

  16. Field Application of Cable Tension Estimation Technique Using the h-SI Method

    Directory of Open Access Journals (Sweden)

    Myung-Hyun Noh

    2015-01-01

    Full Text Available This paper investigates field applicability of a new system identification technique of estimating tensile force for a cable of long span bridges. The newly proposed h-SI method using the combination of the sensitivity updating algorithm and the advanced hybrid microgenetic algorithm can allow not only avoiding the trap of local minimum at initial searching stage but also finding the optimal solution in terms of better numerical efficiency than existing methods. First, this paper overviews the procedure of tension estimation through a theoretical formulation. Secondly, the validity of the proposed technique is numerically examined using a set of dynamic data obtained from benchmark numerical samples considering the effect of sag extensibility and bending stiffness of a sag-cable system. Finally, the feasibility of the proposed method is investigated through actual field data extracted from a cable-stayed Seohae Bridge. The test results show that the existing methods require precise initial data in advance but the proposed method is not affected by such initial information. In particular, the proposed method can improve accuracy and convergence rate toward final values. Consequently, the proposed method can be more effective than existing methods in terms of characterizing the tensile force variation for cable structures.

  17. New strategy for surface functionalization of periodic mesoporous silica based on meso-HSiO1.5.

    Science.gov (United States)

    Xie, Zhuoying; Bai, Ling; Huang, Suwen; Zhu, Cun; Zhao, Yuanjin; Gu, Zhong-Ze

    2014-01-29

    Organic functionalization of periodic mesoporous silicas (PMSs) offers a way to improve their excellent properties and wide applications owing to their structural superiority. In this study, a new strategy for organic functionalization of PMSs is demonstrated by hydrosilylation of the recently discovered "impossible" periodic mesoporous hydridosilica, meso-HSiO1.5. This method overcomes the disadvantages of present pathways for organic functionalization of PMSs with organosilica. Moreover, compared to the traditional functionalization on the surface of porous silicon by hydrosilylation, the template-synthesized meso-HSiO1.5 is more flexible to access functional-groups-loaded PMSs with adjustable microstructures. The new method and materials will have wider applications based on both the structure and surface superiorities.

  18. An Analysis of the Nonlinear Spectral Mixing of Didymium and Soda-Lime Glass Beads Using Hyperspectral Imagery (HSI) Microscopy

    Science.gov (United States)

    2014-05-01

    2001). Learning with Kernels: Support Vector Machines , Regularization, Optimization, and Beyond. The MIT Press, Cambridge, MA, 644 p. [26] Banerjee...A., Burlina, P., and Broadwater, J., (2007). A Machine Learning Approach for finding hyperspectral endmembers. Proceedings of the IEEE International... lime glass beads using hyperspectral imagery (HSI) microscopy Ronald G. Resmini1*, Robert S. Rand2, David W. Allen3, and Christopher J. Deloye1

  19. Continued development of a portable widefield hyperspectral imaging (HSI) sensor for standoff detection of explosive, chemical, and narcotic residues

    Science.gov (United States)

    Nelson, Matthew P.; Gardner, Charles W.; Klueva, Oksana; Tomas, David

    2014-05-01

    Passive, standoff detection of chemical, explosive and narcotic threats employing widefield, shortwave infrared (SWIR) hyperspectral imaging (HSI) continues to gain acceptance in defense and security fields. A robust and user-friendly portable platform with such capabilities increases the effectiveness of locating and identifying threats while reducing risks to personnel. In 2013 ChemImage Sensor Systems (CISS) introduced Aperio, a handheld sensor, using real-time SWIR HSI for wide area surveillance and standoff detection of explosives, chemical threats, and narcotics. That SWIR HSI system employed a liquid-crystal tunable filter for real-time automated detection and display of threats. In these proceedings, we report on a next generation device called VeroVision™, which incorporates an improved optical design that enhances detection performance at greater standoff distances with increased sensitivity and detection speed. A tripod mounted sensor head unit (SHU) with an optional motorized pan-tilt unit (PTU) is available for precision pointing and sensor stabilization. This option supports longer standoff range applications which are often seen at checkpoint vehicle inspection where speed and precision is necessary. Basic software has been extended to include advanced algorithms providing multi-target display functionality, automatic threshold determination, and an automated detection recipe capability for expanding the library as new threats emerge. In these proceedings, we report on the improvements associated with the next generation portable widefield SWIR HSI sensor, VeroVision™. Test data collected during development are presented in this report which supports the targeted applications for use of VeroVision™ for screening residue and bulk levels of explosive and drugs on vehicles and personnel at checkpoints as well as various applications for other secure areas. Additionally, we highlight a forensic application of the technology for assisting forensic

  20. Towards modelling the vibrational signatures of functionalized surfaces: carboxylic acids on H-Si(111) surfaces

    Science.gov (United States)

    Giresse Tetsassi Feugmo, Conrard; Champagne, Benoît; Caudano, Yves; Cecchet, Francesca; Chabal, Yves J.; Liégeois, Vincent

    2012-03-01

    In this work, we investigate the adsorption process of two carboxylic acids (stearic and undecylenic) on a H-Si(111) surface via the calculation of structural and energy changes as well as the simulation of their IR and Raman spectra. The two molecules adsorb differently at the surface since the stearic acid simply physisorbs while the undecylenic acid undergoes a chemical reaction with the hydrogen atoms of the surface. This difference is observed in the change of geometry during the adsorption. Indeed, the chemisorption of the undecylenic acid has a bigger impact on the structure than the physisorption of the stearic acid. Consistently, the former is also characterized by a larger value of adsorption energy and a smaller value of the tilting angle with respect to the normal plane. For both the IR and Raman signatures, the spectra of both molecules adsorbed at the surface are in a first approximation the superposition of the spectra of the Si cluster and of the carboxylic acid considered individually. The main deviation from this simple observation is the peak of the stretching Si-H (ν(Si-H)) mode, which is split into two peaks upon adsorption. As expected, the splitting is bigger for the chemisorption than the physisorption. The modes corresponding to atomic displacements close to the adsorption site display a frequency upshift by a dozen wavenumbers. One can also see the disappearance of the peaks associated with the C=C double bond when the undecylenic acid chemisorbs at the surface. The Raman and IR spectra are complementary and one can observe here that the most active Raman modes are generally IR inactive. Two exceptions to this are the two ν(Si-H) modes which are active in both spectroscopies. Finally, we compare our simulated spectra with some experimental measurements and we find an overall good agreement.

  1. Towards modelling the vibrational signatures of functionalized surfaces: carboxylic acids on H-Si(111) surfaces

    International Nuclear Information System (INIS)

    Tetsassi Feugmo, Conrard Giresse; Champagne, Benoît; Liégeois, Vincent; Caudano, Yves; Cecchet, Francesca; Chabal, Yves J

    2012-01-01

    In this work, we investigate the adsorption process of two carboxylic acids (stearic and undecylenic) on a H-Si(111) surface via the calculation of structural and energy changes as well as the simulation of their IR and Raman spectra. The two molecules adsorb differently at the surface since the stearic acid simply physisorbs while the undecylenic acid undergoes a chemical reaction with the hydrogen atoms of the surface. This difference is observed in the change of geometry during the adsorption. Indeed, the chemisorption of the undecylenic acid has a bigger impact on the structure than the physisorption of the stearic acid. Consistently, the former is also characterized by a larger value of adsorption energy and a smaller value of the tilting angle with respect to the normal plane. For both the IR and Raman signatures, the spectra of both molecules adsorbed at the surface are in a first approximation the superposition of the spectra of the Si cluster and of the carboxylic acid considered individually. The main deviation from this simple observation is the peak of the stretching Si-H (ν(Si-H)) mode, which is split into two peaks upon adsorption. As expected, the splitting is bigger for the chemisorption than the physisorption. The modes corresponding to atomic displacements close to the adsorption site display a frequency upshift by a dozen wavenumbers. One can also see the disappearance of the peaks associated with the C=C double bond when the undecylenic acid chemisorbs at the surface. The Raman and IR spectra are complementary and one can observe here that the most active Raman modes are generally IR inactive. Two exceptions to this are the two ν(Si-H) modes which are active in both spectroscopies. Finally, we compare our simulated spectra with some experimental measurements and we find an overall good agreement. (paper)

  2. Quality control by HyperSpectral Imaging (HSI) in solid waste recycling: logics, algorithms and procedures

    Science.gov (United States)

    Bonifazi, Giuseppe; Serranti, Silvia

    2014-03-01

    strategies. The problems arising when suitable HyperSpectral Imaging (HSI) based procedures have to be developed and implemented to solid waste products characterization, in order to define time efficient compression and interpretation techniques, are thus analyzed and discussed in the following. Particular attention was also addressed to define an integrated hardware and software (HW and SW) platform able to perform a non-intrusive, non-contact and real-time analysis and embedding a core of analytical logics and procedures to utilize both at laboratory and industrial scale. Several case studies, referred to waste plastics products, are presented and discussed.

  3. HSI2/VAL1 PHD-like domain promotes H3K27 trimethylation to repress the expression of seed maturation genes and complex transgenes in Arabidopsis seedlings.

    Science.gov (United States)

    Veerappan, Vijaykumar; Chen, Naichong; Reichert, Angelika I; Allen, Randy D

    2014-11-01

    The novel mutant allele hsi2-4 was isolated in a genetic screen to identify Arabidopsis mutants with constitutively elevated expression of a glutathione S-transferase F8::luciferase (GSTF8::LUC) reporter gene in Arabidopsis. The hsi2-4 mutant harbors a point mutation that affects the plant homeodomain (PHD)-like domain in HIGH-LEVEL EXPRESSION OF SUGAR-INDUCIBLE GENE2 (HSI2)/VIVIPAROUS1/ABI3-LIKE1 (VAL1). In hsi2-4 seedlings, expression of this LUC transgene and certain endogenous seed-maturation genes is constitutively enhanced. The parental reporter line (WT LUC ) that was used for mutagenesis harbors two independent transgene loci, Kan R and Kan S . Both loci express luciferase whereas only the Kan R locus confers resistance to kanamycin. Here we show that both transgene loci harbor multiple tandem insertions at single sites. Luciferase expression from these sites is regulated by the HSI2 PHD-like domain, which is required for the deposition of repressive histone methylation marks (H3K27me3) at both Kan R and Kan S loci. Expression of LUC and Neomycin Phosphotransferase II transgenes is associated with dynamic changes in H3K27me3 levels, and the activation marks H3K4me3 and H3K36me3 but does not appear to involve repressive H3K9me2 marks, DNA methylation or histone deacetylation. However, hsi2-2 and hsi2-4 mutants are partially resistant to growth inhibition associated with exposure to the DNA methylation inhibitor 5-aza-2'-deoxycytidine. HSI2 is also required for the repression of a subset of regulatory and structural seed maturation genes in vegetative tissues and H3K27me3 marks associated with most of these genes are also HSI2-dependent. These data implicate HSI2 PHD-like domain in the regulation of gene expression involving histone modifications and DNA methylation-mediated epigenetic mechanisms.

  4. Extraction of human factors issues caused by application of the advanced HSI technology and development of human factor issue management system

    Energy Technology Data Exchange (ETDEWEB)

    Suh, Sang Moon; Lee, Jung Woon; Park, Jae Chang; Oh, In Seok [Korea Atomic Energy Research Institute, Taejon (Korea)

    1999-01-01

    A comprehensive literature survey was performed in this study to collect human performance issues related to the advanced HSI design features. The literature from not only nuclear industry but also other industries was collected and reviewed. The issues were categorized into the following advanced HSI design features: devices characteristics, levels of automation, information design and management, display management, computerized controls, alarm systems, computerized procedures, staffing and crew coordination, and operator support systems. The classified issues were described with the description framework. Then, the relationship of issues to HSI design process such as human factors analyses, human factors design, and human factors verification and validation was investigated. Finally, the issue management system of server-client environment was developed using Microsoft's Active Server Page technology and Access 97. (author). 18 refs., 6 figs.

  5. Exploring the Nature of Silicon-Noble Gas Bonds in H3SiNgNSi and HSiNgNSi Compounds (Ng = Xe, Rn

    Directory of Open Access Journals (Sweden)

    Sudip Pan

    2015-03-01

    Full Text Available Ab initio and density functional theory-based computations are performed to investigate the structure and stability of H3SiNgNSi and HSiNgNSi compounds (Ng = Xe, Rn. They are thermochemically unstable with respect to the dissociation channel producing Ng and H3SiNSi or HSiNSi. However, they are kinetically stable with respect to this dissociation channel having activation free energy barriers of 19.3 and 23.3 kcal/mol for H3SiXeNSi and H3SiRnNSi, respectively, and 9.2 and 12.8 kcal/mol for HSiXeNSi and HSiRnNSi, respectively. The rest of the possible dissociation channels are endergonic in nature at room temperature for Rn analogues. However, one three-body dissociation channel for H3SiXeNSi and one two-body and one three-body dissociation channels for HSiXeNSi are slightly exergonic in nature at room temperature. They become endergonic at slightly lower temperature. The nature of bonding between Ng and Si/N is analyzed by natural bond order, electron density and energy decomposition analyses. Natural population analysis indicates that they could be best represented as (H3SiNg+(NSi− and (HSiNg+(NSi−. Energy decomposition analysis further reveals that the contribution from the orbital term (ΔEorb is dominant (ca. 67%–75% towards the total attraction energy associated with the Si-Ng bond, whereas the electrostatic term (ΔEelstat contributes the maximum (ca. 66%–68% for the same in the Ng–N bond, implying the covalent nature of the former bond and the ionic nature of the latter.

  6. Robust chemical and chemical-resistant material detection using hyper-spectral imager and a new bend interpolation and local scaling HSI sharpening method

    Science.gov (United States)

    Chen, Hai-Wen; McGurr, Michael; Brickhouse, Mark

    2015-05-01

    We present new results from our ongoing research activity for chemical threat detection using hyper-spectral imager (HSI) detection techniques by detecting nontraditional threat spectral signatures of agent usage, such as protective equipment, coatings, paints, spills, and stains that are worn by human or on trucks or other objects. We have applied several current state-of-the-art HSI target detection methods such as Matched Filter (MF), Adaptive Coherence Estimator (ACE), Constrained Energy Minimization (CEM), and Spectral Angle Mapper (SAM). We are interested in detecting several chemical related materials: (a) Tyvek clothing is chemical resistance and Tyvek coveralls are one-piece garments for protecting human body from harmful chemicals, and (b) ammonium salts from background could be representative of spills from scrubbers or related to other chemical activities. The HSI dataset that we used for detection covers a chemical test field with more than 50 different kinds of chemicals, protective materials, coatings, and paints. Among them, there are four different kinds of Tyvek material, three types of ammonium salts, and one yellow jugs. The imagery cube data were collected by a HSI sensor with a spectral range of 400-2,500nm. Preliminary testing results are promising, and very high probability of detection (Pd) and low probability of false detection are achieved with the usage of full spectral range (400- 2,500nm). In the second part of this paper, we present our newly developed HSI sharpening technique. A new Band Interpolation and Local Scaling (BILS) method has been developed to improve HSI spatial resolution by 4-16 times with a low-cost high-resolution pen-chromatic camera and a RGB camera. Preliminary results indicate that this new technique is promising.

  7. A direct methodology to establish design requirements for human–system interface (HSI) of automatic systems in nuclear power plants

    International Nuclear Information System (INIS)

    Anuar, Nuraslinda; Kim, Jonghyun

    2014-01-01

    Highlights: • A systematic method to identify the design requirements for human–system interface is proposed. • Eight combinations of control agents in each control stage (levels of automation) are defined. • The use of Itemized Sequence Diagram (ISD) is discussed for task allocation to control agents. • The design requirements of human–system interface are established based on the produced ISD. - Abstract: This paper suggests a systematic approach to establish design requirements for the human–system interface (HSI) between operators and automatic systems. The role of automation in the control of a nuclear power plant (NPP) operation is to support the human operator and act as an efficient team player to help reduce the human operator’s workload. Some of the problems related to the interaction between the human operator and automation are out-of-the-loop performance, mode errors, role change to supervisory role and final authority issues. Therefore, the design of HSI is critical to avoiding breakdowns in communication between the human operator and the system. In this paper, the design requirements for human–system interface of automatic systems are constructed with the help of a tool called Itemized Sequence Diagram (ISD). Eight levels of automation (LOA) are initially defined in the function allocation and an ISD is drawn for each of the LOA for task allocation. The ISD is a modified version of sequence diagram, which is widely used in systems engineering as well as software engineering. The ISD elements of arrows, messages, actors and alternative boxes collectively show the interactions between the control agents, which are decomposed into four different roles: information acquiring, plant diagnosing, response selecting and response implementing. Eleven design requirements to optimize the human–automation interaction are suggested by using this method. The design requirements produced from the identified interaction points in the ISD are

  8. Adaptive pseudo-color enhancement method of weld radiographic images based on HSI color space and self-transformation of pixels

    Science.gov (United States)

    Jiang, Hongquan; Zhao, Yalin; Gao, Jianmin; Gao, Zhiyong

    2017-06-01

    The radiographic testing (RT) image of a steam turbine manufacturing enterprise has the characteristics of low gray level, low contrast, and blurriness, which lead to a substandard image quality. Moreover, it is not conducive for human eyes to detect and evaluate defects. This study proposes an adaptive pseudo-color enhancement method for weld radiographic images based on the hue, saturation, and intensity (HSI) color space and the self-transformation of pixels to solve these problems. First, the pixel's self-transformation is performed to the pixel value of the original RT image. The function value after the pixel's self-transformation is assigned to the HSI components in the HSI color space. Thereafter, the average intensity of the enhanced image is adaptively adjusted to 0.5 according to the intensity of the original image. Moreover, the hue range and interval can be adjusted according to personal habits. Finally, the HSI components after the adaptive adjustment can be transformed to display in the red, green, and blue color space. Numerous weld radiographic images from a steam turbine manufacturing enterprise are used to validate the proposed method. The experimental results show that the proposed pseudo-color enhancement method can improve image definition and make the target and background areas distinct in weld radiographic images. The enhanced images will be more conducive for defect recognition. Moreover, the image enhanced using the proposed method conforms to the human eye visual properties, and the effectiveness of defect recognition and evaluation can be ensured.

  9. Adaptive pseudo-color enhancement method of weld radiographic images based on HSI color space and self-transformation of pixels.

    Science.gov (United States)

    Jiang, Hongquan; Zhao, Yalin; Gao, Jianmin; Gao, Zhiyong

    2017-06-01

    The radiographic testing (RT) image of a steam turbine manufacturing enterprise has the characteristics of low gray level, low contrast, and blurriness, which lead to a substandard image quality. Moreover, it is not conducive for human eyes to detect and evaluate defects. This study proposes an adaptive pseudo-color enhancement method for weld radiographic images based on the hue, saturation, and intensity (HSI) color space and the self-transformation of pixels to solve these problems. First, the pixel's self-transformation is performed to the pixel value of the original RT image. The function value after the pixel's self-transformation is assigned to the HSI components in the HSI color space. Thereafter, the average intensity of the enhanced image is adaptively adjusted to 0.5 according to the intensity of the original image. Moreover, the hue range and interval can be adjusted according to personal habits. Finally, the HSI components after the adaptive adjustment can be transformed to display in the red, green, and blue color space. Numerous weld radiographic images from a steam turbine manufacturing enterprise are used to validate the proposed method. The experimental results show that the proposed pseudo-color enhancement method can improve image definition and make the target and background areas distinct in weld radiographic images. The enhanced images will be more conducive for defect recognition. Moreover, the image enhanced using the proposed method conforms to the human eye visual properties, and the effectiveness of defect recognition and evaluation can be ensured.

  10. An Approach to Establish Design Requirements for Human-System Interface (HSI) of Automatic Systems in Nuclear Power Plants

    Energy Technology Data Exchange (ETDEWEB)

    Nuraslinda, Anuar; Kim, Jonghyun [KEPCO International Nuclear Graduate School, Ulsan (Korea, Republic of)

    2013-05-15

    This paper aims to demonstrate an approach to establish the design requirements for automatic systems in nuclear power plant (NPP) by using a powerful tool called Itemized Sequence Diagram (ISD). The process starts with function allocation by defining a set of levels of automation (LOAs). Then, task allocation is done using the ISD and finally the design requirements are established by examining the interaction points between human operator and automation, which are all located on the interface as modeled in the ISD. The strengths of this approach are discussed and a suggestion to integrate with that of the methodology employed to produce the existing guidelines or guidance is included in this paper. Some issues of automation have been addressed earlier in this paper and 12 design requirements that address human-system interaction were suggested by using the ISD as a tool to identify the interaction points between human operator and automation. The integration of the proposed approach in this paper with that of existing guidance could result in the new issue identification that would call for the establishment of new guidance. For example, Requirement 11 states that the HSI should provide the means for take-over from automatic to manual control was not mentioned in the existing guidance.

  11. Development of computational fluid dynamics--habitat suitability (CFD-HSI) models to identify potential passage--Challenge zones for migratory fishes in the Penobscot River

    Science.gov (United States)

    Haro, Alexander J.; Dudley, Robert W.; Chelminski, Michael

    2012-01-01

    A two-dimensional computational fluid dynamics-habitat suitability (CFD–HSI) model was developed to identify potential zones of shallow depth and high water velocity that may present passage challenges for five anadromous fish species in the Penobscot River, Maine, upstream from two existing dams and as a result of the proposed future removal of the dams. Potential depth-challenge zones were predicted for larger species at the lowest flow modeled in the dam-removal scenario. Increasing flows under both scenarios increased the number and size of potential velocity-challenge zones, especially for smaller species. This application of the two-dimensional CFD–HSI model demonstrated its capabilities to estimate the potential effects of flow and hydraulic alteration on the passage of migratory fish.

  12. Point-of-Care Determination of Acetaminophen Levels with Multi-Hydrogen Bond Manipulated Single-Molecule Recognition (eMuHSiR).

    Science.gov (United States)

    Zhang, Yan; Huang, Zhongyuan; Wang, Letao; Wang, Chunming; Zhang, Changde; Wiese, Tomas; Wang, Guangdi; Riley, Kevin; Wang, Zhe

    2018-04-03

    This work aims to face the challenge of monitoring small molecule drugs accurately and rapidly for point-of-care (POC) diagnosis in current clinical settings. Overdose of acetaminophen (AP), a commonly used over the counter (OTC) analgesic drug, has been determined to be a major cause of acute liver failure in the US and the UK. However, there is no rapid and accurate detection method available for this drug in the emergency room. The present study examined an AP sensing strategy that relies on a previously unexplored strong interaction between AP and the arginine (Arg) molecule. It was found that as many as 4 hydrogen bonds can be formed between one Arg molecule and one AP molecule. By taking advantages of this structural selectivity and high tenability of hydrogen bonds, Arg, immobilized on a graphene surface via electrostatic interactions, was utilized to structurally capture AP. Interestingly, bonded AP still remained the perfect electrochemical activities. The extent of Arg-AP bonds was quantified using a newly designed electrochemical (EC) sensor. To verify the feasibility of this novel assay, based on multihydrogen bond manipulated single-molecule recognition (eMuHSiR), both pharmaceutical and serum sample were examined. In commercial tablet measurement, no significant difference was seen between the results of eMuHSiR and other standard methods. For measuring AP concentration in the mice blood, the substances in serum, such as sugars and fats, would not bring any interference to the eMuHSiR in a wide concentration range. This eMuHSiR method opens the way for future development of small molecule detection for the POC testing.

  13. Operational Prediction of the Habitat Suitability Index (HSI) Distribution for Neon Flying Squid in Central North Pacific by Using FORA Dataset and a New Data Assimilation System SKUIDS

    Science.gov (United States)

    Igarashi, H.; Ishikawa, Y.; Wakamatsu, T.; Tanaka, Y.; Nishikawa, S.; Nishikawa, H.; Kamachi, M.; Kuragano, T.; Takatsuki, Y.; Fujii, Y.; Usui, N.; Toyoda, T.; Hirose, N.; Sakai, M.; Saitoh, S. I.; Imamura, Y.

    2016-02-01

    The neon flying squid (Ommastrephes bartramii) has a wide-spread distribution in subtropical and temperate waters in the North Pacific, which plays an important role in the pelagic ecosystem and is one of the major targets in Japanese squid fisheries. The main fishing areas for Japanese commercial vessels are located in the central North Pacific (35-45N, around the date line) in summer. In this study, we have developed several kinds of habitat suitability index (HSI) models of the neon flying squid for investigating the relationship between its potential habitat and the ocean state variations in the target area. For developing HSI models, we have used a new ocean reanalysis dataset FORA (4-dimensional variational Ocean Re-Analysis) produced by JAMSTEC/CEIST and MRI-JMA. The horizontal resolution is 0.1*0.1 degree of latitude and longitude with 54 vertical levels, which can provide realistic fields of 3-dimensional ocean circulation and environmental structures including meso-scale eddies. In addition, we have developed a new 4D-VAR (4-dimensional variational) ocean data assimilation system for predicting ocean environmental changes in the main fishing grounds. We call this system "SKUIDS" (Scalable Kit of Under-sea Information Delivery System). By using these prediction fields of temperature, salinity, sea surface height, horizontal current velocity, we produced daily HSI maps of the neon flying squid, and provided them to the Japanese commercial vessels in operation. Squid fishermen can access the web site for delivering the information of ocean environments in the fishing ground by using Inmarsat satellite communication on board, and show the predicted fields of subsurface temperatures and HSI. Here, we present the details of SKUIDS and the web-delivery system for squid fishery, and some preliminary results of the operational prediction.

  14. Managing Environmental Flows for Impounded Rivers in Semi-Arid Regions- A Habitat Suitability Index (HSI) Approach for the Assessment of River Habitat for Salmonid Populations

    Science.gov (United States)

    Pai, H.; Sivakumaran, K.; Villamizar, S. R.; Flanagan, J.; Guo, Q.; Harmon, T. C.

    2013-12-01

    Balancing ecosystem health in water-scarce, agriculturally dominated river basins remains a challenge. In dry water years, maintaining conditions for restored and sustained indigenous fish populations (a frequently used indicator for ecosystem health) is particularly challenging. Competing human demands include urban and agricultural water supplies, hydropower, and flood control. In many semi-arid regions, increasing drought intensity and frequency under future climate scenarios will combine with population increases to water scarcity. The goal of this work is to better understand how reservoir releases affect fish habitat and overall river aquatic ecosystem quality. Models integrating a diverse array of physical and biological processes and system state are used to forecast the river ecosystem response to changing drivers. We propose a distributed parameter-based Habitat Suitability Index (HSI) approach for assessing fish habitat quality. Our river ecosystem HSI maps are based on a combination of the following: (1) In situ data describing stream flow and water quality conditions; (2) Spatial observations, including surveyed cross-sections, aerial imagery and digital elevation maps (DEM) of the river and its riparian corridor; and (3) Simulated spatially distributed water depths, flow velocities, and temperatures estimated from 1D and 2D river flow and temperature models (HEC-RAS and CE-QUAL-W2, respectively). With respect to (2), image processing schemes are used to classify and map key habitat features, namely riparian edge and shallow underwater vegetation. HSI maps can be modified temporally to address specific life cycle requirements of indicator fish species. Results are presented for several reaches associated with the San Joaquin River Restoration Project, focusing on several components of the Chinook salmon life cycle. HSI maps and interpretations are presented in the context of a range of prescribed reservoir release hydrographs linked to California water

  15. Franck-Condon Simulations including Anharmonicity of the Ã(1)A''-X̃(1)A' Absorption and Single Vibronic Level Emission Spectra of HSiCl and DSiCl.

    Science.gov (United States)

    Mok, Daniel W K; Lee, Edmond P F; Chau, Foo-Tim; Dyke, John M

    2009-03-10

    RCCSD(T) and/or CASSCF/MRCI calculations have been carried out on the X̃(1)A' and Ã(1)A'' states of HSiCl employing basis sets of up to the aug-cc-pV5Z quality. Contributions from core correlation and extrapolation to the complete basis set limit were included in determining the computed equilibrium geometrical parameters and relative electronic energy of these two states of HSiCl. Franck-Condon factors which include allowance for anharmonicity and Duschinsky rotation between these two states of HSiCl and DSiCl were calculated employing RCCSD(T) and CASSCF/MRCI potential energy functions, and were used to simulate the Ã(1)A'' ← X̃(1)A' absorption and Ã(1)A'' → X̃(1)A' single vibronic level (SVL) emission spectra of HSiCl and DSiCl. Simulated absorption and experimental LIF spectra, and simulated and observed Ã(1)A''(0,0,0) → X̃(1)A' SVL emission spectra, of HSiCl and DSiCl are in very good agreement. However, agreement between simulated and observed Ã(1)A''(0,1,0) → X̃(1)A' and Ã(1)A''(0,2,1) → X̃(1)A' SVL emission spectra of DSiCl is not as good. Preliminary calculations on low-lying excited states of HSiCl suggest that vibronic interaction between low-lying vibrational levels of the Ã(1)A'' state and highly excited vibrational levels of the ã(3)A'' is possible. Such vibronic interaction may change the character of the low-lying vibrational levels of the Ã(1)A'' state, which would lead to perturbation in the SVL emission spectra from these vibrational levels.

  16. Computational fluid dynamics-habitat suitability index (CFD-HSI) modelling as an exploratory tool for assessing passability of riverine migratory challenge zones for fish

    Science.gov (United States)

    Haro, Alexander J.; Chelminski, Michael; Dudley, Robert W.

    2015-01-01

    We developed two-dimensional computational fluid hydraulics-habitat suitability index (CFD-HSI) models to identify and qualitatively assess potential zones of shallow water depth and high water velocity that may present passage challenges for five major anadromous fish species in a 2.63-km reach of the main stem Penobscot River, Maine, as a result of a dam removal downstream of the reach. Suitability parameters were based on distribution of fish lengths and body depths and transformed to cruising, maximum sustained and sprint swimming speeds. Zones of potential depth and velocity challenges were calculated based on the hydraulic models; ability of fish to pass a challenge zone was based on the percent of river channel that the contiguous zone spanned and its maximum along-current length. Three river flows (low: 99.1 m3 sec-1; normal: 344.9 m3 sec-1; and high: 792.9 m3 sec-1) were modelled to simulate existing hydraulic conditions and hydraulic conditions simulating removal of a dam at the downstream boundary of the reach. Potential depth challenge zones were nonexistent for all low-flow simulations of existing conditions for deeper-bodied fishes. Increasing flows for existing conditions and removal of the dam under all flow conditions increased the number and size of potential velocity challenge zones, with the effects of zones being more pronounced for smaller species. The two-dimensional CFD-HSI model has utility in demonstrating gross effects of flow and hydraulic alteration, but may not be as precise a predictive tool as a three-dimensional model. Passability of the potential challenge zones cannot be precisely quantified for two-dimensional or three-dimensional models due to untested assumptions and incomplete data on fish swimming performance and behaviours.

  17. Annual report of the international nuclear research initiative OSMOSE project (FY05).

    Energy Technology Data Exchange (ETDEWEB)

    Klann, R. T.; Hudelot, J. P.; Perret, G.; Drin, N.; Nuclear Engineering Division; Commissariat a l' Energie Atomique

    2007-10-03

    The goal of the OSMOSE program is to measure the reactivity effect of minor actinides in known neutron spectra of interest to the Generation-IV reactor program and other programs and to create a database of these results for use as an international benchmark for the minor actinides. The results are then compared to calculational models to verify and validate integral absorption cross-sections for the minor actinides. The OSMOSE program includes all aspects of the experimental program -- including the fabrication of fuel pellets and samples, the oscillation of the samples in the MINERVE reactor for the measurement of the reactivity effect, reactor physics modeling of the MINERVE reactor, and the data analysis and interpretation of the experimental results.

  18. Localized Corrosion of Alloy 22 -Fabrication Effects-FY05 Summary Report

    International Nuclear Information System (INIS)

    Rebak, R B

    2005-01-01

    This report deals with the impact of fabrication processes on the localized corrosion behavior of Alloy 22 (N06022). The four fabrication processes that were analyzed are: (1) Surface stress mitigation of final closure weld, (2) Manufacturing of the mockup container, (3) Black annealing of the container and (4) Use of different heats of Alloy 22 for container fabrication. Immersion and Electrochemical tests performed in the laboratory are generally aggressive and do not represent actual repository environments in Yucca Mountain. For example, to determine the intergranular attack in the heat affected zone of a weldment, tests are conducted in boiling acidic and oxidizing solutions according to ASTM standards. These solutions are used to compare the behavior of differently treated metallic coupons. Similarly for electrochemical tests many times pure sodium chloride or calcium chloride solutions are used. Pure chloride solutions are not representative of the repository environment. (1) Surface Stress Mitigation--When metallic plates are welded, for example using the Gas Tungsten Arc Welding (GTAW) method, residual tensile stresses may develop in the vicinity of the weld seam. Processes such as Low Plasticity Burnishing (LPB) and Laser Shock Peening (LSP) could be applied locally to eliminate the residual stresses produced by welding. In this study, Alloy 22 plates were welded and then the above-mentioned surface treatments were applied to eliminate the residual tensile stresses. The aim of the current study was to comparatively test the corrosion behavior of as-welded (ASW) plates with the corrosion behavior of plates with stress mitigated surfaces. Immersion and electrochemical tests were performed. Results from both immersion and electrochemical corrosion tests show that the corrosion resistance of the mitigated plates was not affected by the surface treatments applied. (2) Behavior of Specimens from a Mockup container--Alloy 22 has been extensively tested for general and localized corrosion behavior both in the wrought and annealed condition and in the as-welded condition. The specimens for testing were mostly prepared from flat plates of material. It was important to determine if the process of fabricating a full diameter Alloy 22 container will affect the corrosion performance of this alloy. Specimens were prepared directly from a fabricated container and tested for corrosion resistance. Results show that both the anodic corrosion behavior and the localized corrosion resistance of specimens prepared from a welded fabricated container were the same as from flat welded plates. That is, rolling and welding plates using industrial practices do not hinder the corrosion resistant of Alloy 22. (3) Effect of Black Annealing Oxide Scale--The resistance of Alloy 22 to localized corrosion, mainly crevice corrosion, has been extensively investigated in the last few years. This was done mostly using freshly polished specimens. At this time it was important to address the effect an oxide film or scale that forms during the high temperature annealing process or solution heat treatment (SHT) and its subsequent water quenching. Electrochemical tests such as cyclic potentiodynamic polarization (CPP) have been carried out to determine the repassivation potential for localized corrosion and to assess the mode of attack on the specimens. Tests have been carried out in parallel using mill annealed (MA) specimens free from oxide on the surface. The comparative testing was carried out in six different electrolyte solutions at temperatures ranging from 60 to 100 C. Results show that the repassivation potential of the specimens containing the black anneal oxide film on the surface was practically the same as the repassivation potential for oxide-free specimens. (4) Heat-to-Heat Variability--Testing of Ni-Cr-Mo Plates with varying heat chemistry: The ASTM standard B 575 provides the range of the chemical composition of Nickel-Chromium-Molybdenum (Ni-Cr-Mo) alloys such as Alloy 22 (N06022) and Alloy 686 (N06686). For example, the content of Mo is specified from 12.5 to 14.5 weight percent for Alloy 22 and from 15.0 to 17.0 weight percent for Alloy 686. It was important to determine how the corrosion rate of welded plates of Alloy 22 using Alloy 686 weld filler metal would change if heats of these alloys were prepared using several variations in the composition of the elements even though still in the range specified in B 575. All the material used in this report were especially prepared at Allegheny Ludlum Co. Seven heats of plate were welded with seven heats of wire. Immersion corrosion tests were conducted in a boiling solution of sulfuric acid plus ferric sulfate (ASTM G 28 A) using both as-welded (ASW) coupons and solution heat-treated (SHT) coupons

  19. Diabetes Prevention and Treatment Programs for Western PA FY04 and FY05

    Science.gov (United States)

    2009-05-01

    Monica m. Dinardo, Patrick Forte, Laura Bettencourt, Suzanne Rocks, Mary T . Korytkowski. Use of a Peri- Operative Treatment Prot ocol Improv es...Linda Siminerio, PhD Megan G. Marks, PhD This project was designed to develop a Diabetes Self- Managemen t Education program t o improve access...minimum 20 minutes), and required the addition of clinical, medication managemen t , patient snapshot, patient -provider interface and new lett er

  20. Novel catalysts for hydrogen fuel cell applications:Final report (FY03-FY05).

    Energy Technology Data Exchange (ETDEWEB)

    Thornberg, Steven Michael; Coker, Eric Nicholas; Jarek, Russell L.; Steen, William Arthur

    2005-12-01

    The goal of this project was to develop novel hydrogen-oxidation electrocatalyst materials that contain reduced platinum content compared to traditional catalysts by developing flexible synthesis techniques to fabricate supported catalyst structures, and by verifying electrochemical performance in half cells and ultimately laboratory fuel cells. Synthesis methods were developed for making small, well-defined platinum clusters using zeolite hosts, ion exchange, and controlled calcination/reduction processes. Several factors influence cluster size, and clusters below 1 nm with narrow size distribution have been prepared. To enable electrochemical application, the zeolite pores were filled with electrically-conductive carbon via infiltration with carbon precursors, polymerization/cross-linking, and pyrolysis under inert conditions. The zeolite host was then removed by acid washing, to leave a Pt/C electrocatalyst possessing quasi-zeolitic porosity and Pt clusters of well-controlled size. Plotting electrochemical activity versus pyrolysis temperature typically produces a Gaussian curve, with a peak at ca. 800 C. The poorer relative performances at low and high temperature are due to low electrical conductivity of the carbon matrix, and loss of zeolitic structure combined with Pt sintering, respectively. Cluster sizes measured via adsorption-based methods were consistently larger than those observed by TEM and EXAFS, suggesting , that a fraction of the clusters were inaccessible to the fluid phase. Detailed EXAFS analysis has been performed on selected catalysts and catalyst precursors to monitor trends in cluster size evolution, as well as oxidation states of Pt. Experiments were conducted to probe the electroactive surface area of the Pt clusters. These Pt/C materials had as much as 110 m{sup 2}/g{sub pt} electroactive surface area, an almost 30% improvement over what is commercially (mfg. by ETEK) available (86 m{sup 2}/g{sub pt}). These Pt/C materials also perform qualitatively as well as the ETEK material for the ORR, a non-trivial achievement. A fuel cell test showed that Pt/C outperformed the ETEK material by an average of 50% for a 300 hour test. Increasing surface area decreases the amount of Pt needed in a fuel cell, which translates into cost savings. Furthermore, the increased performance realized in the fuel cell test might ultimately mean less Pt is needed in a fuel cell; this again translates into cost savings. Finally, enhanced long-term stability is a key driver within the fuel cell community as improvements in this area must be realized before fuel cells find their way into the marketplace; these Pt/C materials hold great promise of enhanced stability over time. An external laser desorption ion source was successfully installed on the existing Fourier transform ion-cyclotron resonance (FT-ICR) mass spectrometer. However, operation of this laser ablation source has only generated metal atom ions, no clusters have been found to date. It is believed that this is due to the design of the pulsed-nozzle/laser vaporization chamber. The final experimental configuration and design of the two source housings are described.

  1. FY05 HPCRM Annual Report: High-Performance Corrosion-Resistant Iron-Based Amorphous Metal Coatings Evaluation of Corrosion Resistance FY05 HPCRM Annual Report No. Rev. 1DOE-DARPA Co-Sponsored Advanced Materials Program

    International Nuclear Information System (INIS)

    Farmer, J C; Haslam, J J; Day, S D

    2007-01-01

    New corrosion-resistant, iron-based amorphous metals have been identified from published data or developed through combinatorial synthesis, and tested to determine their relative corrosion resistance. Many of these materials can be applied as coatings with advanced thermal spray technology. Two compositions have corrosion resistance superior to wrought nickel-based Alloy C-22 (UNS No. N06022) in some very aggressive environments, including concentrated calcium-chloride brines at elevated temperature. Two Fe-based amorphous metal formulations have been found that appear to have corrosion resistance comparable to, or better than that of Ni-based Alloy C-22, based on breakdown potential and corrosion rate. Both Cr and Mo provide corrosion resistance, B enables glass formation, and Y lowers critical cooling rate (CCR). SAM1651 has yttrium added, and has a nominal critical cooling rate of only 80 Kelvin per second, while SAM2X7 (similar to SAM2X5) has no yttrium, and a relatively high critical cooling rate of 610 Kelvin per second. Both amorphous metal formulations have strengths and weaknesses. SAM1651 (yttrium added) has a low critical cooling rate (CCR), which enables it to be rendered as a completely amorphous thermal spray coating. Unfortunately, it is relatively difficult to atomize, with powders being irregular in shape. This causes the powder to be difficult to pneumatically convey during thermal spray deposition. Gas atomized SAM1651 powder has required cryogenic milling to eliminate irregularities that make flow difficult. SAM2X5 (no yttrium) has a high critical cooling rate, which has caused problems associated with devitrification. SAM2X5 can be gas atomized to produce spherical powders of SAM2X5, which enable more facile thermal spray deposition. The reference material, nickel-based Alloy C-22, is an outstanding corrosion-resistant engineering material. Even so, crevice corrosion has been observed with C-22 in hot sodium chloride environments without buffer or inhibitor. Comparable metallic alloys such as SAM2X5 and SAM1651 may also experience crevice corrosion under sufficiently harsh conditions. Accelerated crevice corrosion tests are now being conducted to intentionally induce crevice corrosion, and to determine those environmental conditions where such localized attack occurs. Such materials are extremely hard, and provide enhanced resistance to abrasion and gouges (stress risers) from backfill operations, and possibly even tunnel boring. The hardness of Type 316L Stainless Steel is approximately 150 VHN, that of Alloy C-22 is approximately 250 VHN, and that of HVOF SAM2X5 ranges from 1100-1300 VHN. These new materials provide a viable coating option for repository engineers. SAM2X5 and SAM1651 coatings can be applied with thermal spray processes without any significant loss of corrosion resistance. Both Alloy C-22 and Type 316L stainless lose their resistance to corrosion during thermal spraying. Containers for the transportation, storage and disposal of spent nuclear fuel (SNF) and high-level radioactive waste (HLW) with corrosion resistant coatings are envisioned. For example, an enhanced multi-purpose container (MPC) could be made with such coatings, leveraging existing experience in the fabrication of such containers. These coating materials could be used to protect the final closure weld on SNF/HLW disposal containers, eliminate need for stress mitigation. Integral drip shield could be produced by directly spraying it onto the disposal container, thereby eliminating the need for an expensive titanium drip shield. In specific areas where crevice corrosion is anticipated, such as the contact point between the disposal container and pallet, HVOF coatings could be used to buildup thickness, thereby selectively adding corrosion life where it is needed. Both SAM2X5 and SAM1651 have high boron content which enable them to absorb neutrons and therefore be used for criticality control in baskets. Alloy C-22 and 316L have no neutron absorber, and cannot be used for such functions. Borated stainless steel and G

  2. FY05 LDRD Final Report A Computational Design Tool for Microdevices and Components in Pathogen Detection Systems

    Energy Technology Data Exchange (ETDEWEB)

    Trebotich, D

    2006-02-07

    We have developed new algorithms to model complex biological flows in integrated biodetection microdevice components. The proposed work is important because the design strategy for the next-generation Autonomous Pathogen Detection System at LLNL is the microfluidic-based Biobriefcase, being developed under the Chemical and Biological Countermeasures Program in the Homeland Security Organization. This miniaturization strategy introduces a new flow regime to systems where biological flow is already complex and not well understood. Also, design and fabrication of MEMS devices is time-consuming and costly due to the current trial-and-error approach. Furthermore, existing devices, in general, are not optimized. There are several MEMS CAD capabilities currently available, but their computational fluid dynamics modeling capabilities are rudimentary at best. Therefore, we proposed a collaboration to develop computational tools at LLNL which will (1) provide critical understanding of the fundamental flow physics involved in bioMEMS devices, (2) shorten the design and fabrication process, and thus reduce costs, (3) optimize current prototypes and (4) provide a prediction capability for the design of new, more advanced microfluidic systems. Computational expertise was provided by Comp-CASC and UC Davis-DAS. The simulation work was supported by key experiments for guidance and validation at UC Berkeley-BioE.

  3. FY05 HPCRM Annual Report: High-Performance Corrosion-Resistant Iron-Based Amorphous Metal Coatings

    International Nuclear Information System (INIS)

    Farmer, J; Choi, J; Haslam, J; Day, S; Yang, N; Headley, T; Lucadamo, G; Yio, J; Chames, J; Gardea, A; Clift, M; Blue, G; Peters, W; Rivard, J; Harper, D; Swank, D; Bayles, R; Lemieux, E; Brown, R; Wolejsza, T; Aprigliano, L; Branagan, D; Marshall, M; Meacham, B; Aprigliano, L; Branagan, D; Marshall, M; Meacham, B; Lavernia, E; Schoenung, J; Ajdelsztajn, L; Dannenberg, J; Graeve, O; Lewandowski, J; Perepezko, J; Hildal, K; Kaufman, L; Boudreau, J

    2007-01-01

    New corrosion-resistant, iron-based amorphous metals have been identified from published data or developed through combinatorial synthesis, and tested to determine their relative corrosion resistance. Many of these materials can be applied as coatings with advanced thermal spray technology. Two compositions have corrosion resistance superior to wrought nickel-based Alloy C-22 (UNS No. N06022) in some very aggressive environments, including concentrated calcium-chloride brines at elevated temperature. Two Fe-based amorphous metal formulations have been found that appear to have corrosion resistance comparable to, or better than that of Ni-based Alloy C-22, based on breakdown potential and corrosion rate. Both Cr and Mo provide corrosion resistance, B enables glass formation, and Y lowers critical cooling rate (CCR). SAM1651 has yttrium added, and has a nominal critical cooling rate of only 80 Kelvin per second, while SAM2X7 (similar to SAM2X5) has no yttrium, and a relatively high critical cooling rate of 610 Kelvin per second. Both amorphous metal formulations have strengths and weaknesses. SAM1651 (yttrium added) has a low critical cooling rate (CCR), which enables it to be rendered as a completely amorphous thermal spray coating. Unfortunately, it is relatively difficult to atomize, with powders being irregular in shape. This causes the powder to be difficult to pneumatically convey during thermal spray deposition. Gas atomized SAM1651 powder has required cryogenic milling to eliminate irregularities that make flow difficult. SAM2X5 (no yttrium) has a high critical cooling rate, which has caused problems associated with devitrification. SAM2X5 can be gas atomized to produce spherical powders of SAM2X5, which enable more facile thermal spray deposition. The reference material, nickel-based Alloy C-22, is an outstanding corrosion-resistant engineering material. Even so, crevice corrosion has been observed with C-22 in hot sodium chloride environments without buffer or inhibitor. Comparable metallic alloys such as SAM2X5 and SAM1651 may also experience crevice corrosion under sufficiently harsh conditions. Accelerated crevice corrosion tests are now being conducted to intentionally induce crevice corrosion, and to determine those environmental conditions where such localized attack occurs. Such materials are extremely hard, and provide enhanced resistance to abrasion and gouges (stress risers) from backfill operations, and possibly even tunnel boring. The hardness of Type 316L Stainless Steel is approximately 150 VHN, that of Alloy C-22 is approximately 250 VHN, and that of HVOF SAM2X5 ranges from 1100-1300 VHN. These new materials provide a viable coating option for repository engineers. SAM2X5 and SAM1651 coatings can be applied with thermal spray processes without any significant loss of corrosion resistance. Both Alloy C-22 and Type 316L stainless lose their resistance to corrosion during thermal spraying. Containers for the transportation, storage and disposal of spent nuclear fuel (SNF) and high-level radioactive waste (HLW) with corrosion resistant coatings are envisioned. For example, an enhanced multi-purpose container (MPC) could be made with such coatings, leveraging existing experience in the fabrication of such containers. These coating materials could be used to protect the final closure weld on SNF/HLW disposal containers, eliminate need for stress mitigation. Integral drip shield could be produced by directly spraying it onto the disposal container, thereby eliminating the need for an expensive titanium drip shield. In specific areas where crevice corrosion is anticipated, such as the contact point between the disposal container and pallet, HVOF coatings could be used to buildup thickness, thereby selectively adding corrosion life where it is needed. Both SAM2X5 and SAM1651 have high boron content which enable them to absorb neutrons and therefore be used for criticality control in baskets. Alloy C-22 and 316L have no neutron absorber, and cannot be used for such functions. Borated stainless steel and G

  4. FY05 HPCRM Annual Report: High-Performance Corrosion-Resistant Iron-Based Amorphous Metal Coatings

    Energy Technology Data Exchange (ETDEWEB)

    Farmer, J; Choi, J; Haslam, J; Day, S; Yang, N; Headley, T; Lucadamo, G; Yio, J; Chames, J; Gardea, A; Clift, M; Blue, G; Peters, W; Rivard, J; Harper, D; Swank, D; Bayles, R; Lemieux, E; Brown, R; Wolejsza, T; Aprigliano, L; Branagan, D; Marshall, M; Meacham, B; Aprigliano, L; Branagan, D; Marshall, M; Meacham, B; Lavernia, E; Schoenung, J; Ajdelsztajn, L; Dannenberg, J; Graeve, O; Lewandowski, J; Perepezko, J; Hildal, K; Kaufman, L; Boudreau, J

    2007-09-20

    New corrosion-resistant, iron-based amorphous metals have been identified from published data or developed through combinatorial synthesis, and tested to determine their relative corrosion resistance. Many of these materials can be applied as coatings with advanced thermal spray technology. Two compositions have corrosion resistance superior to wrought nickel-based Alloy C-22 (UNS No. N06022) in some very aggressive environments, including concentrated calcium-chloride brines at elevated temperature. Two Fe-based amorphous metal formulations have been found that appear to have corrosion resistance comparable to, or better than that of Ni-based Alloy C-22, based on breakdown potential and corrosion rate. Both Cr and Mo provide corrosion resistance, B enables glass formation, and Y lowers critical cooling rate (CCR). SAM1651 has yttrium added, and has a nominal critical cooling rate of only 80 Kelvin per second, while SAM2X7 (similar to SAM2X5) has no yttrium, and a relatively high critical cooling rate of 610 Kelvin per second. Both amorphous metal formulations have strengths and weaknesses. SAM1651 (yttrium added) has a low critical cooling rate (CCR), which enables it to be rendered as a completely amorphous thermal spray coating. Unfortunately, it is relatively difficult to atomize, with powders being irregular in shape. This causes the powder to be difficult to pneumatically convey during thermal spray deposition. Gas atomized SAM1651 powder has required cryogenic milling to eliminate irregularities that make flow difficult. SAM2X5 (no yttrium) has a high critical cooling rate, which has caused problems associated with devitrification. SAM2X5 can be gas atomized to produce spherical powders of SAM2X5, which enable more facile thermal spray deposition. The reference material, nickel-based Alloy C-22, is an outstanding corrosion-resistant engineering material. Even so, crevice corrosion has been observed with C-22 in hot sodium chloride environments without buffer or inhibitor. Comparable metallic alloys such as SAM2X5 and SAM1651 may also experience crevice corrosion under sufficiently harsh conditions. Accelerated crevice corrosion tests are now being conducted to intentionally induce crevice corrosion, and to determine those environmental conditions where such localized attack occurs. Such materials are extremely hard, and provide enhanced resistance to abrasion and gouges (stress risers) from backfill operations, and possibly even tunnel boring. The hardness of Type 316L Stainless Steel is approximately 150 VHN, that of Alloy C-22 is approximately 250 VHN, and that of HVOF SAM2X5 ranges from 1100-1300 VHN. These new materials provide a viable coating option for repository engineers. SAM2X5 and SAM1651 coatings can be applied with thermal spray processes without any significant loss of corrosion resistance. Both Alloy C-22 and Type 316L stainless lose their resistance to corrosion during thermal spraying. Containers for the transportation, storage and disposal of spent nuclear fuel (SNF) and high-level radioactive waste (HLW) with corrosion resistant coatings are envisioned. For example, an enhanced multi-purpose container (MPC) could be made with such coatings, leveraging existing experience in the fabrication of such containers. These coating materials could be used to protect the final closure weld on SNF/HLW disposal containers, eliminate need for stress mitigation. Integral drip shield could be produced by directly spraying it onto the disposal container, thereby eliminating the need for an expensive titanium drip shield. In specific areas where crevice corrosion is anticipated, such as the contact point between the disposal container and pallet, HVOF coatings could be used to buildup thickness, thereby selectively adding corrosion life where it is needed. Both SAM2X5 & SAM1651 have high boron content which enable them to absorb neutrons and therefore be used for criticality control in baskets. Alloy C-22 and 316L have no neutron absorber, and cannot be used for such functions. Borated stainless steel and G

  5. Agile Port and High Speed Ship Technologies, Vol 1: FY05 Projects 3-6 and 8-10

    Science.gov (United States)

    2008-07-02

    Evaluation and Implementation Plan for Southern California Maglev Freight System..........................................................11 Project...accomplishments achieved in the technical projects. 1.1 Project 05-3: The Evaluation and Implementation Plan for Southern California Maglev ...Freight System This project builds upon work performed in the previous study that determined the technical feasibility of a high-speed Maglev system to

  6. Demonstration of Pipe Corrosion Sensors at Fort Bragg, NC: Final Report on Project AR-F-317 for FY05

    Science.gov (United States)

    2007-06-01

    y siga cuidadosamente estas instrucciones a fin de evitar accidentes personales y daños al instrumento. Las tareas de instalación y mantenimiento ...de evitar accidentes personales y daños al instrumento. Las tareas de instalación y mantenimiento descritas en la presente sección deberán ser

  7. Comparison on Classification Results Based on Data of TG-1 HSI and HJ-1 CCD%天宫一号高光谱成像仪数据与环境星CCD数据分类效果比较研究

    Institute of Scientific and Technical Information of China (English)

    刘新杰; 刘良云; 李绪志; 张九星

    2013-01-01

    本文以北京市通州区为例,利用最短距离法、最大似然法和支持向量机3种分类方法分别对天宫一号高光谱成像仪数据与HJ-A星CCD数据进行监督分类,通过比较分类结果发现,天宫一号高光谱成像仪数据在样本可分性度量、目视效果及分类精度3个方面均优于HJ-A星CCD数据,在土地利用类型分类应用中具有显著优势.%The TianGong-1 target spacecraft is equipped with a Hyperspectral Imager (HSI) which has the highest aggregative indicator of spectral and spatial resolution in China.In this paper,we used the case of Tongzhou,Beijing to compare the results of classification based on the data of TG-1 HSI and HJ-1A CCD.Three different methods (Minimum Distance,Maximum Likelihood,and Support Vector Machine) were used.The results based on the TG-1 HSI data performed better in the separability of the ROIs,the vision of the maps and the total accuracy of classification.The results of this study show the advantages of TG-1 HSI data in the application of classification.

  8. Demonstration of Ice-Free Cathodic Protection Systems for Water Storage Tanks at Fort Drum: Final Report on Project AR-F-318 for FY05

    Science.gov (United States)

    2007-06-01

    16-inch diameter ductile iron pipe, where inlet and outlet pressures are nominally 100 psi and 50 psi, respectively. A local contractor will hot...P-641-G -- Primer Coating ; Zinc Dust- Zinc Oxide (for Galvanized Surfaces) 1.1.3. Federal Technical Reports. ETL 1110-9-10(FR) – Cathodic Protection...American National Standards Institute (ANSI) Standards. ANSI C80.1 -- Rigid Steel Conduit - Zinc Coated 1.1.6. American Society for Testing

  9. FY-05 Second Quarter Report On Development of a Supercritical Carbon Dioxide Brayton Cycle: Improving PBR Efficiency and Testing Material Compatibility

    International Nuclear Information System (INIS)

    Chang Oh

    2005-01-01

    The objective of this research is to improve a helium Brayton cycle and to develop a supercritical carbon dioxide Brayton cycle for the Pebble Bed Reactor (PBR) that can also be applied to the Fast Gas-Cooled Reactor (FGR) and the Very-High-Temperature Gas-Cooled Reactor (VHTR). The proposed supercritical carbon dioxide Brayton cycle will be used to improve the PBR, FGR, and VHTR net plant efficiency. Another objective of this research is to test materials to be used in the power conversion side at supercritical carbon dioxide conditions. Generally, the optimized Brayton cycle and balance of plant (BOP) to be developed from this study can be applied to Generation-IV reactor concepts. Particularly, we are interested in VHTR because it has a good chance of being built in the near future

  10. A Qualitative Method to Estimate HSI Display Complexity

    International Nuclear Information System (INIS)

    Hugo, Jacques; Gertman, David

    2013-01-01

    There is mounting evidence that complex computer system displays in control rooms contribute to cognitive complexity and, thus, to the probability of human error. Research shows that reaction time increases and response accuracy decreases as the number of elements in the display screen increase. However, in terms of supporting the control room operator, approaches focusing on addressing display complexity solely in terms of information density and its location and patterning, will fall short of delivering a properly designed interface. This paper argues that information complexity and semantic complexity are mandatory components when considering display complexity and that the addition of these concepts assists in understanding and resolving differences between designers and the preferences and performance of operators. This paper concludes that a number of simplified methods, when combined, can be used to estimate the impact that a particular display may have on the operator's ability to perform a function accurately and effectively. We present a mixed qualitative and quantitative approach and a method for complexity estimation

  11. A Qualitative Method to Estimate HSI Display Complexity

    Energy Technology Data Exchange (ETDEWEB)

    Hugo, Jacques; Gertman, David [Idaho National Laboratory, Idaho (United States)

    2013-04-15

    There is mounting evidence that complex computer system displays in control rooms contribute to cognitive complexity and, thus, to the probability of human error. Research shows that reaction time increases and response accuracy decreases as the number of elements in the display screen increase. However, in terms of supporting the control room operator, approaches focusing on addressing display complexity solely in terms of information density and its location and patterning, will fall short of delivering a properly designed interface. This paper argues that information complexity and semantic complexity are mandatory components when considering display complexity and that the addition of these concepts assists in understanding and resolving differences between designers and the preferences and performance of operators. This paper concludes that a number of simplified methods, when combined, can be used to estimate the impact that a particular display may have on the operator's ability to perform a function accurately and effectively. We present a mixed qualitative and quantitative approach and a method for complexity estimation.

  12. Coincident Aerosol and H2O Retrievals versus HSI Imager Field Campaign ReportH2O Retrievals versus HSI Imager Field Campaign Report

    Energy Technology Data Exchange (ETDEWEB)

    Anderson, Gail P. [National Oceanic and Atmospheric Administration (NOAA), Washington, DC (United States); Cipar, John [Air Force Research Lab. (AFRL), Wright-Patterson AFB, OH (United States); Armstrong, Peter S. [Air Force Research Lab. (AFRL), Wright-Patterson AFB, OH (United States); van den Bosch, J. [Air Force Research Lab. (AFRL), Wright-Patterson AFB, OH (United States)

    2016-05-01

    Two spectrally calibrated tarpaulins (tarps) were co-located at a fixed Global Positioning System (GPS) position on the gravel antenna field at the U.S. Department of Energy (DOE) Atmospheric Radiation Measurement (ARM) Climate Research Facility’s Southern Great Plains (SGP) site. Their placement was timed to coincide with the overflight of a new hyperspectral imaging satellite. The intention was to provide an analysis of the data obtained, including the measured and retrieved spectral albedos for the calibration tarps. Subsequently, a full suite of retrieved values of H2O column, and the aerosol overburden, were to be compared to those determined by alternate SGP ground truth assets. To the extent possible, the down-looking cloud images would be assessed against the all-sky images. Because cloud contamination above a certain level precludes the inversion processing of the satellite data, coupled with infrequent targeting opportunities, clear-sky conditions were imposed. The SGP site was chosen not only as a target of opportunity for satellite validation, but as perhaps the best coincident field measurement site, as established by DOE’s ARM Facility. The satellite team had every expectation of using the information obtained from the SGP to improve the inversion products for all subsequent satellite images, including the cloud and radiative models and parameterizations and, thereby, the performance assessment for subsequent and historic image collections. Coordinating with the SGP onsite team, four visits, all in 2009, to the Central Facility occurred: • June 6-8 (successful exploratory visit to plan tarp placements, etc.) • July 18-24 (canceled because of forecast for heavy clouds) • Sep 9-12 (ground tarps placed, onset of clouds) • Nov 7-9 (visit ultimately canceled because of weather predictions). As noted, in each instance, any significant overcast prediction precluded image collection from the satellite. Given the long task-scheduling procedures (which were in place for each time period), coupled with other priorities and the satellite lifetime, no alternate SGP images could be obtained.

  13. An Integrated Human System Interaction (HSI) Framework for Human-Agent Team Collaboration, Phase II

    Data.gov (United States)

    National Aeronautics and Space Administration — As space missions become more complex and as mission demands increase, robots, human-robot mixed initiative teams and software autonomy applications are needed to...

  14. Current LWIR HSI Remote Sensing Activities at Defence R&D Canada - Valcartier

    Science.gov (United States)

    2009-10-01

    concentration; # If spectral signature exists; ** for e.g., potassium chlorate (other chlorates /perchlorates will be similar) A b s o rb a n c e...Spill To be measured Chlorates ** Explosive Solid MAYBE* Spill YES Nitric acid Precursor Vapor/Liquid YES* Leak/Spill YES Hydrogen peroxide

  15. Air Force Human Systems Integration (HSI) in Test and Evaluation (T&E)

    Science.gov (United States)

    2012-08-01

    hours with less than 3% errors. NASA TLX Workload assessment of five crews executing mission scenario number one (1). Piece validation using...Guard’s Distributed Training Operations Center (DTOC) to validate simulation. Measures to include: • NASA TLX Workload assessment • Eye tracking...at io n B om be r KSA: Sustainable Crew Workload Does the long- duration bomber system support operation by a two-person crew? Number of Crew

  16. On the estimation of the spherical contact distribution Hs(y) for spatial point processes

    International Nuclear Information System (INIS)

    Doguwa, S.I.

    1990-08-01

    RIPLEY (1977, Journal of the Royal Statistical Society, B39 172-212) proposed an estimator for the spherical contact distribution H s (s), of a spatial point process observed in a bounded planar region. However, this estimator is not defined for some distances of interest, in this bounded region. A new estimator for H s (y), is proposed for use with regular grid of sampling locations. This new estimator is defined for all distances of interest. It also appears to have a smaller bias and a smaller mean squared error than the previously suggested alternative. (author). 11 refs, 4 figs, 1 tab

  17. Color segmentation in the HSI color space using the K-means algorithm

    Science.gov (United States)

    Weeks, Arthur R.; Hague, G. Eric

    1997-04-01

    Segmentation of images is an important aspect of image recognition. While grayscale image segmentation has become quite a mature field, much less work has been done with regard to color image segmentation. Until recently, this was predominantly due to the lack of available computing power and color display hardware that is required to manipulate true color images (24-bit). TOday, it is not uncommon to find a standard desktop computer system with a true-color 24-bit display, at least 8 million bytes of memory, and 2 gigabytes of hard disk storage. Segmentation of color images is not as simple as segmenting each of the three RGB color components separately. The difficulty of using the RGB color space is that it doesn't closely model the psychological understanding of color. A better color model, which closely follows that of human visual perception is the hue, saturation, intensity model. This color model separates the color components in terms of chromatic and achromatic information. Strickland et al. was able to show the importance of color in the extraction of edge features form an image. His method enhances the edges that are detectable in the luminance image with information from the saturation image. Segmentation of both the saturation and intensity components is easily accomplished with any gray scale segmentation algorithm, since these spaces are linear. The modulus 2(pi) nature of the hue color component makes its segmentation difficult. For example, a hue of 0 and 2(pi) yields the same color tint. Instead of applying separate image segmentation to each of the hue, saturation, and intensity components, a better method is to segment the chromatic component separately from the intensity component because of the importance that the chromatic information plays in the segmentation of color images. This paper presents a method of using the gray scale K-means algorithm to segment 24-bit color images. Additionally, this paper will show the importance the hue component plays in the segmentation of color images.

  18. Financial Aid in Hispanic-Serving Institutions: Aligning Resources with HSI Commitments

    Science.gov (United States)

    Venegas, Kristan M.

    2015-01-01

    The purpose of this chapter is to review the literature related to Hispanic-serving institutions and financial aid. Based on this review, a framework for guiding HSIs that considers the role of financial aid in meeting the needs of Latino/a students is suggested.

  19. An Integrated Human System Interaction (HSI) Framework for Human-Agent Team Collaboration, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — The NASA commitment to a human presence in space exploration results in the interaction of humans with challenging environments in space, on lunar, and on planetary...

  20. Fast polarimetric dehazing method for visibility enhancement in HSI colour space

    Science.gov (United States)

    Zhang, Wenfei; Liang, Jian; Ren, Liyong; Ju, Haijuan; Bai, Zhaofeng; Wu, Zhaoxin

    2017-09-01

    Image haze removal has attracted much attention in optics and computer vision fields in recent years due to its wide applications. In particular, the fast and real-time dehazing methods are of significance. In this paper, we propose a fast dehazing method in hue, saturation and intensity colour space based on the polarimetric imaging technique. We implement the polarimetric dehazing method in the intensity channel, and the colour distortion of the image is corrected using the white patch retinex method. This method not only reserves the detailed information restoration capacity, but also improves the efficiency of the polarimetric dehazing method. Comparison studies with state of the art methods demonstrate that the proposed method obtains equal or better quality results and moreover the implementation is much faster. The proposed method is promising in real-time image haze removal and video haze removal applications.

  1. Characterization of Decision Making Behaviors Associated with Human Systems Integration (HSI) Design Tradeoffs: Subject Matter Expert Interviews

    Science.gov (United States)

    2014-11-18

    Anticipated/Diagnosed potential user difficulty with the design • Evaluated/Mentally simulated interface use to create a storyboard HFEs with...Compared and contrasted different technologies Conducted a prototype/ storyboard review Conducted a technology demonstration Generated design

  2. 20-Year Status Report on the Human Systems Integration (HSI)/Manpower and Personnel Integration (MANPRINT) Soldier Survivability Domain

    Science.gov (United States)

    2015-05-01

    using a Hellfire missile motor ). However, the necessary decision software and TTPs are in place for extending the range in future increments. 5.6...Engineering processes from the University of Texas at El Paso . Mr Richard “Rich” Zigler is a general engineer with 43 years of engineering

  3. The Development and Validation of a Human Systems Integration (HSI) Program for the Canadian Department of National Defence (DND)

    Science.gov (United States)

    2008-09-01

    can be animated. The Animation Module can animate a mannequin to visualise (through the mannequin’s eyes) the execution of a task or an operation...soldier commentary and audio clips, observe information presented in tables, graphs and schematics and view videos of soldiers in action. Key features

  4. Joint Service General Purpose Mask (JSGPM) Human Systems Integration (HSI) Evaluation: Comfort and Vision Correction Insert Stability Evaluation

    National Research Council Canada - National Science Library

    Garrett, Lamar; Harper, William H; Ortega, Samson V; White, Timothy L

    2006-01-01

    .... The JSGPM, together with personal protective equipment, allows the operators the flexibility to tailor their protection, based on mission threat, thereby minimizing weight, bulk, and heat stress...

  5. Human-Systems Integration (HSI) and the Network Integration Evaluations (NIEs), Part 2: A Deeper Dive into Mission Command Complexity and Cognitive Load

    Science.gov (United States)

    2015-03-01

    system or process more likely to break down or fail when faced with unusual or ambiguous situations. These cautions from the flight management arena...signs, and symbols, and other distinctions in human performance models . IEEE Transactions on Systems, Man and Cybernetics . 1983;13(3). 30 Salas E...itself is intrinsically complex and demanding. However, a work setting with a large number of design-related “rough edges” will give the impression of

  6. Non-U.S. Citizen, Community College Students: Their Federal Student Aid Status, Gender, Achievement, and Persistence at an Emerging HSI

    Science.gov (United States)

    Sanchez, Jafeth E.; Smith, Jeannette

    2017-01-01

    This study presents a quantitative, exploratory analysis of 535 students attending Truckee Meadows Community College in Northern Nevada who were eligible or ineligible for federal student aid and were non-U.S. citizens. Within a snapshot of the Fall 2015 through Fall 2016 semesters, we examined the variables of gender, grade point average (GPA),…

  7. Density functional theory with van der waals corrections study of the adsorption of alkyl, alkylthiol, alkoxyl, and amino-alkyl chains on the H:Si(111) surface.

    Science.gov (United States)

    Arefi, Hadi H; Nolan, Michael; Fagas, Giorgos

    2014-11-11

    Surface modification of silicon with organic monolayers tethered to the surface by different linkers is an important process in realizing future miniaturized electronic and sensor devices. Understanding the roles played by the nature of the linking group and the chain length on the adsorption structures and stabilities of these assemblies is vital to advance this technology. This paper presents a density functional theory (DFT) study of the hydrogen passivated Si(111) surface modified with alkyl chains of the general formula H:Si-(CH2)n-CH2 and H:Si-X-(CH2)n-CH3, where X = NH, O, S and n = (0, 1, 3, 5, 7, 9, 11), at half coverage. For (X)-hexane and (X)-dodecane functionalization, we also examined various coverages up to full monolayer grafting in order to validate the result of half covered surface and the linker effect on the coverage. We find that it is necessary to take into account the van der Waals interaction between the alkyl chains. The strongest binding is for the oxygen linker, followed by S, N, and C, irrespective of chain length. The result revealed that the sequence of the stability is independent of coverage; however, linkers other than carbon can shift the optimum coverage considerably and allow further packing density. For all linkers apart from sulfur, structural properties, in particular, surface-linker-chain angles, saturate to a single value once n > 3. For sulfur, we identify three regimes, namely, n = 0-3, n = 5-7, and n = 9-11, each with its own characteristic adsorption structures. Where possible, our computational results are shown to be consistent with the available experimental data and show how the fundamental structural properties of modified Si surfaces can be controlled by the choice of linking group and chain length.

  8. Moving Toward an Anti-Deficit Perspective: African American Science, Technology, Engineering, Mathematics (STEM) Students at Hispanic-Serving Institutions (HSI)

    Science.gov (United States)

    Mahoney, Melissa M.

    The increased demand for qualified STEM workers, necessitates addressing the bachelor's science, technology, engineering and mathematics (STEM) degree achievement among African Americans and other underrepresented populations. Using inquiry derived from Harper's (2010) Anti-Deficit Achievement Framework, this study sought to explore the factors that contribute to the successful degree completion of African American STEM students within a large comprehensive university system. Coding of the twelve semi-structured interviews revealed six major themes: a) K-12/precollege educational experiences, b) motivation to complete a STEM degree, c) systems of social support, d) extracurricular activities and out-of-class experiences, e) addressing stereotyping and discrimination, and f) faculty behaviors and dispositions. All themes were intertwined at each phase of participants' academic careers, thereby, highlighting the complexity of this population's experience and what is needed to address their low STEM degree attainment. Findings indicated that this student population benefits from positive, sustained faculty-student interactions, holistic STEM success programming, and genuine networks of social support. Furthermore, Harper's framework can be modified to explore the motivation of African American STEM students as well as the African American student's relationship with disability support services.

  9. Human-Systems Integration (HSI) and the Network Integration Evaluations (NIEs), Part 3: Mitigating Cognitive Load in Network-Enabled Mission Command

    Science.gov (United States)

    2016-06-01

    require higher levels of mental ability as well as higher levels of education , training, and experience for effective use . In short, ICT insertions such...the people using the gizmos” (Wallace 2005, p. 20). Personnel, training, and organization are important aspects of overall mission command system...organizational learning is important with respect to how well a test unit will use new equipment suites during an exercise such as the NIEs (Alberts

  10. Synthetic Environments for HSI Application, Assessment, and Improvement (Environnements synthetiques pour l’application, l’evaluation et l’amelioration de l’integration homme-systeme)

    Science.gov (United States)

    2015-06-01

    readiness as a dependent variable. Use-cases might include validating benchmarks with metrics, and blurring the distinction between training and...definitive results from experimentation. Yet simplification of the task for laboratory study is often criticized as not real or too sanitized to be...pieces fit together. For complex software systems like SEA, they are about protocols, data models, file formats, and service contracts. We made the

  11. A Tool for Visualizing Mobile Ad-Hoc Network Topology Definitions Files

    National Research Council Canada - National Science Library

    Nguyen, Binh Q

    2006-01-01

    This report documents a research and development effort that the U.S. Army Research Laboratory conducted in FY05 in support of the building of an emulated tactical mobile ad hoc network (MANET) research test bed...

  12. Hyperspectral imaging for non-contact analysis of forensic traces

    NARCIS (Netherlands)

    Edelman, G. J.; Gaston, E.; van Leeuwen, T. G.; Cullen, P. J.; Aalders, M. C. G.

    2012-01-01

    Hyperspectral imaging (HSI) integrates conventional imaging and spectroscopy, to obtain both spatial and spectral information from a specimen. This technique enables investigators to analyze the chemical composition of traces and simultaneously visualize their spatial distribution. HSI offers

  13. Department of the Army - The Fiscal Year 2008 Military Personnel, Army Appropriation and the Antideficiency Act

    Science.gov (United States)

    2010-06-22

    of the Army, U.S. Army Audit Agency, Budgeting for the Military Personnel, Army Appropriation, Report No. A-2010-0028- FFM (Jan. 6, 2010); Department...of the Army, U.S. Army Audit Agency, Military Personnel, Army FY 05 Subsistence Charges, Report No. A-2008-0037- FFM (Feb. 12, 2008); Department of

  14. Joint Department of Defense, Advance Planning Briefing to Industry, Held at Kissimmee, Florida, on 30 April - 2 May 1996

    Science.gov (United States)

    1996-05-01

    Systems 17 Motion Bases Upgraded Aero Misc > Contact Info • AMC, Lt Col Letica , Phone (618) 256-5696 L8 Upgrade Flow Plan Advance Planning Briefing...Projected Schedule: FY 05 > Requirement Document: AMMP >• Projected Program Size: ? < $40M > Funding Status/Stability: > POCs: • AMC, Lt Col Letica

  15. Training for Social Development Staff at the World Bank, Volume 1. Main Report

    OpenAIRE

    Daniel R. Gross; Matthew LeDuc

    2010-01-01

    The social development family is facing a major challenge given the significant increase in lending made by the Bank in the last five years. Lending overall has more than doubled between FY05 and FY09; investment lending has increased by 82 percent and infrastructure lending by 125 percent. In this report, International Evaluation Group (IEG) suggests that the World Bank's safeguard policies ...

  16. Training for Social Development Staff at the World Bank, Volume 2. Annexes

    OpenAIRE

    Gross, Daniel R.; LeDuc, Matthew

    2010-01-01

    The social development family is facing a major challenge given the significant increase in lending made by the Bank in the last five years. Lending overall has more than doubled between FY05 and FY09; investment lending has increased by 82 percent and infrastructure lending by 125 percent. In this report, International Evaluation Group (IEG) suggests that the World Bank's safeguard policies ...

  17. Quantitative validation of a habitat suitability index for oyster restoration

    Directory of Open Access Journals (Sweden)

    Seth eTheuerkauf

    2016-05-01

    Full Text Available Habitat suitability index (HSI models provide spatially explicit information on the capacity of a given habitat to support a species of interest, and their prevalence has increased dramatically in recent years. Despite caution that the reliability of HSIs must be validated using independent, quantitative data, most HSIs intended to inform terrestrial and marine species management remain unvalidated. Furthermore, of the eight HSI models developed for eastern oyster (Crassostrea virginica restoration and fishery production, none has been validated. Consequently, we developed, calibrated, and validated an HSI for the eastern oyster to identify optimal habitat for restoration in a tributary of Chesapeake Bay, the Great Wicomico River (GWR. The GWR harbors a high density, restored oyster population, and therefore serves as an excellent model system for assessing the validity of the HSI. The HSI was derived from GIS layers of bottom type, salinity, and water depth (surrogate for dissolved oxygen, and was tested using live adult oyster density data from a survey of high vertical relief reefs (HRR and low vertical relief reefs (LRR in the sanctuary network. Live adult oyster density was a statistically-significant sigmoid function of the HSI, which validates the HSI as a robust predictor of suitable oyster reef habitat for rehabilitation or restoration. In addition, HRR had on average 103-116 more adults m^−2 than LRR at a given level of the HSI. For HRR, HSI values ≥0.3 exceeded the accepted restoration target of 50 live adult oysters m^−2. For LRR, the HSI was generally able to predict live adult oyster densities that meet or exceed the target at HSI values ≥0.3. The HSI indicated that there remain large areas of suitable habitat for restoration in the GWR. This study provides a robust framework for HSI model development and validation, which can be refined and applied to other systems and previously developed HSIs to improve the efficacy of

  18. Dependence and motivation to stop smoking as predictors of success of a quit attempt among smokers seeking help to quit.

    Science.gov (United States)

    Ussher, Michael; Kakar, Geetanjali; Hajek, Peter; West, Robert

    2016-02-01

    It is not known how well motivation to stop smoking predicts abstinence in a clinical sample relative to the most widely used measure of cigarette dependence. A secondary analysis was conducted from a trial with 864 smokers making quit attempt. Fagerström Test of Cigarette Dependence (FTCD), Heaviness of Smoking Index (HSI), and motivation to stop smoking (composite of determination to quit and importance of quitting) were measured at baseline. Continuous smoking abstinence, validated by expired-air carbon monoxide, was assessed at 4weeks, 6months and 12months post-quit date. FTCD, HSI, non-HSI items in FTCD, and motivation were assessed as predictors of abstinence. In multiple-logistic regressions, controlling for age, gender and medication use, lower scores for FTCD, HSI and non-HSI all significantly predicted abstinence at all follow-ups, while motivation did not predict abstinence at any time. Likelihood ratio tests showed that the FTCD contributed most to the model at 4weeks and 6months; at 12months FTCD and non-HSI equally contributed most to the model. At 4weeks and 6months, predictions were improved by combining HSI and non-HSI components, compared with using these components alone. Cigarette dependence, measured by the FTCD, or by its HSI or non-HSI components, predicts both short-term and medium-term outcomes of attempts to stop smoking in treatment-seeking smokers involved in a clinical trial, whereas strength of motivation to stop predicts neither. Both the HSI and non-HSI components may be considered as briefer alternatives to the full FTCD. Copyright © 2015 The Authors. Published by Elsevier Ltd.. All rights reserved.

  19. OPTY

    International Nuclear Information System (INIS)

    Dabrowski, H.; Planeta, R.; Djaloeis, A.

    1980-01-01

    A computer code for the calculation of the optical model parameters, the S matrix and the transmission coefficient, partial and total elastic and absorption cross sections, and the differential elastic scattering cross sections for spinless particles is described. As potential a generalized Woods-Saxon potential is used. Furthermore the Fourier-Bessel series and spline functions are used for the calculation. (HSI) 891 HSI/HSI 892 MKO

  20. Joint annual report 2016 of the MLZ and FRM II

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2017-07-01

    The following topics are dealt with: Scientific highlights, materials science, quantum phenomena, soft matter, structure research, neutron methods, instrumental upgrades and services, reactor and industry. (HSI)

  1. Forschungszentrum Juelich, Institut fuer Kernphysik/COSY. Annual report 2009

    Energy Technology Data Exchange (ETDEWEB)

    Buescher, Markus; Hanhart, Christoph; Krewald, Siegfried; Machner, Hartmut; Maier, Rudolf; Meissner, Ulf G.; Ritman, James; Stockhorst, Hans; Stroeher, Hans (eds.)

    2010-05-15

    The following topics were dealt with: Physics at COSY, COSY operation and developments, further experimental activities, theoretical investigations, preparation of the HESR, the PANDA experiment. (HSI)

  2. XXth international workshop on deep-inelastic scattering and related topics. DIS 2012. Proceedings

    International Nuclear Information System (INIS)

    Brock, Ian C.

    2013-03-01

    The following topics were dealt with: Structure functions, diffraction and vector mesons, electroweak interactions, hadronic final states, heavy flavours, spin physics, future of deep inelastic scattering. (HSI)

  3. Occurence of non-Fermi-liquid behaviour in the f electron systems Ce1-xLaxNi9Ge4, UCu5-xPdx and UCu9Sn4

    International Nuclear Information System (INIS)

    Killer, U.

    2005-01-01

    In the present thesis the experimental determination of lattice parameters, electrical conductivity, magnetic susceptibility, and specific heat of the named substances at ultralow temperatures is described. (HSI)

  4. Forschungszentrum Juelich, Institut fuer Kernphysik/COSY. Annual report 2010

    Energy Technology Data Exchange (ETDEWEB)

    Buescher, Markus; Grzonka, Dieter; Hanhart, Christoph; Krewald, Siegfried; Maier, Rudolf; Meissner, Ulf G.; Ritman, James; Stockhorst, Hans; Stroeher, Hans (eds.)

    2011-04-15

    The following topics are dealt with: Physics at COSY, COSY operation and developments, further experimental activities, theoretical investigations, preparation of the HESR, the PANDA experiments. (HSI)

  5. Dicty_cDB: VFI753 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available y*hsi*r rynkivlithksfmenfkklkpskiali*ih*kyi Frame B: i*ifsiikiiv*cykmvpqskddvkiqlnvqeyiisndfenny...nvtisriinirykedii k*f**hikaswkilkklkpskiali*ih*kyiliiaqkk--- ---i*ifsiikiiv*cykmvpqskddvkiqlnvqeyiisndfenny

  6. Human-system interface design review guideline -- Process and guidelines: Final report. Revision 1, Volume 1

    Energy Technology Data Exchange (ETDEWEB)

    None

    1996-06-01

    NUREG-0700, Revision 1, provides human factors engineering (HFE) guidance to the US Nuclear Regulatory Commission staff for its: (1) review of the human system interface (HSI) design submittals prepared by licensees or applications for a license or design certification of commercial nuclear power plants, and (2) performance of HSI reviews that could be undertaken as part of an inspection or other type of regulatory review involving HSI design or incidents involving human performance. The guidance consists of a review process and HFE guidelines. The document describes those aspects of the HSI design review process that are important to the identification and resolution of human engineering discrepancies that could adversely affect plant safety. Guidance is provided that could be used by the staff to review an applicant`s HSI design review process or to guide the development of an HSI design review plan, e.g., as part of an inspection activity. The document also provides detailed HFE guidelines for the assessment of HSI design implementations. NUREG-0700, Revision 1, consists of three stand-alone volumes. Volume 1 consists of two major parts. Part 1 describes those aspects of the review process of the HSI design that are important to identifying and resolving human engineering discrepancies. Part 2 contains detailed guidelines for a human factors engineering review which identify criteria for assessing the implementation of an applicant`s or licensee`s HSI design.

  7. Forschungszentrum Juelich, Institut fuer Kernphysik/COSY. Annual report 2009

    International Nuclear Information System (INIS)

    Buescher, Markus; Hanhart, Christoph; Krewald, Siegfried; Machner, Hartmut; Maier, Rudolf; Meissner, Ulf G.; Ritman, James; Stockhorst, Hans; Stroeher, Hans

    2010-05-01

    The following topics were dealt with: Physics at COSY, COSY operation and developments, further experimental activities, theoretical investigations, preparation of the HESR, the PANDA experiment. (HSI)

  8. XXth international workshop on deep-inelastic scattering and related topics. DIS 2012. Proceedings

    Energy Technology Data Exchange (ETDEWEB)

    Brock, Ian C. [ed.

    2013-03-15

    The following topics were dealt with: Structure functions, diffraction and vector mesons, electroweak interactions, hadronic final states, heavy flavours, spin physics, future of deep inelastic scattering. (HSI)

  9. Forschungszentrum Juelich, Institut fuer Kernphysik/COSY. Annual report 2010

    International Nuclear Information System (INIS)

    Buescher, Markus; Grzonka, Dieter; Hanhart, Christoph; Krewald, Siegfried; Maier, Rudolf; Meissner, Ulf G.; Ritman, James; Stockhorst, Hans; Stroeher, Hans

    2011-04-01

    The following topics are dealt with: Physics at COSY, COSY operation and developments, further experimental activities, theoretical investigations, preparation of the HESR, the PANDA experiments. (HSI)

  10. Structure of hadrons. Proceedings

    International Nuclear Information System (INIS)

    Feldmeier, H.; Knoll, J.; Noerenberg, W.; Wambach, J.

    2001-01-01

    The following topics were dealt with: Hadronic reactions and resonances, structure of mesons, baryons, glueballs, and hybrids, physics with strange and charmed quarks, future projects and facilities. (HSI)

  11. Occurence of non-Fermi-liquid behaviour in the f electron systems Ce{sub 1-x}La{sub x}Ni{sub 9}Ge{sub 4}, UCu{sub 5-x}Pd{sub x} and UCu{sub 9}Sn{sub 4}; Auftreten von Nicht-Fermi-Fluessigkeitsverhalten in den f-Elektronen-Systemen Ce{sub 1-x}La{sub x}Ni{sub 9}Ge{sub 4}, UCu{sub 5-x}Pd{sub x} und UCu{sub 9}Sn{sub 4}

    Energy Technology Data Exchange (ETDEWEB)

    Killer, U.

    2005-07-01

    In the present thesis the experimental determination of lattice parameters, electrical conductivity, magnetic susceptibility, and specific heat of the named substances at ultralow temperatures is described. (HSI)

  12. Forschungszentrum Juelich, Institut fuer Kernphysik/COSY. Annual report 2007

    Energy Technology Data Exchange (ETDEWEB)

    Buescher, M.; Hanhart, C.; Krewald, S.; Machner, H.; Maier, R.; Meissner, U.G.; Ritman, J.; Stockhorst, H.; Stroeher, H. (eds.)

    2008-03-15

    The following topics are dealt with, Physics at COSY, external experiments, theoretical investigations. COSY operation and developments, preparation for FAIR. See hints under the relevant topics. (HSI)

  13. Photon science 2012. Highlights and annual report

    International Nuclear Information System (INIS)

    Appel, Karen; Gehrke, Rainer; Gutt, Christian; Incoccia-Hermes, Lucia; Laarmann, Tim; Morgenroth, Wolfgang; Roehlsberger, Ralf; Schulte-Schrepping, Horst; Vainio, Ulla; Zimmermann, Martin von

    2012-12-01

    The synchrotron-radiation research at DESY is reviewed. The following topics are dealt with: Research highlights, research platforms and outstations, light sources, new technologies and developments. (HSI)

  14. Radiometric characterization of space instrumentation; Radiometrische Charakterisierung von Weltrauminstrumentierung

    Energy Technology Data Exchange (ETDEWEB)

    Gottwald, Alexander [Physikalisch-Technische Bundesanstalt (PTB), Berlin (Germany). Arbeitsgruppe ' UV- und VUV-Radiometrie' ; Klein, Roman; Krumrey, Michael; Mueller, Peter; Paustian, Wolfgang; Reichel, Thomas; Scholze, Frank; Thornagel, Reiner

    2014-09-15

    The calibration of detectors for space experiments using synchrotron radiation is described. Especially considered are spectrographs for the solar radiometry and instruments for X-ray astronomy. (HSI)

  15. 5th Patras workshop on axions, WIMPs and WISPs (PATRAS 2009). Proceedings

    Energy Technology Data Exchange (ETDEWEB)

    Jaeckel, Joerg; Lindner, Axel; Redondo, Javier [eds.

    2010-06-15

    The following topics were dealt with: Direct searches for dark matter, indirect searches for WIMPS, photon generation and laser polarization experiments, direct axion signals, theoretic WISP developments. (HSI)

  16. 5th Patras workshop on axions, WIMPs and WISPs (PATRAS 2009). Proceedings

    International Nuclear Information System (INIS)

    Jaeckel, Joerg; Lindner, Axel; Redondo, Javier

    2010-06-01

    The following topics were dealt with: Direct searches for dark matter, indirect searches for WIMPS, photon generation and laser polarization experiments, direct axion signals, theoretic WISP developments. (HSI)

  17. Forschungszentrum Juelich, Institut fuer Kernphysik/COSY. Annual report 2007

    International Nuclear Information System (INIS)

    Buescher, M.; Hanhart, C.; Krewald, S.; Machner, H.; Maier, R.; Meissner, U.G.; Ritman, J.; Stockhorst, H.; Stroeher, H.

    2008-03-01

    The following topics are dealt with, Physics at COSY, external experiments, theoretical investigations. COSY operation and developments, preparation for FAIR. See hints under the relevant topics. (HSI)

  18. Human-system interface design review guideline -- Process and guidelines: Final report. Revision 1, Volume 1

    International Nuclear Information System (INIS)

    1996-06-01

    NUREG-0700, Revision 1, provides human factors engineering (HFE) guidance to the US Nuclear Regulatory Commission staff for its: (1) review of the human system interface (HSI) design submittals prepared by licensees or applications for a license or design certification of commercial nuclear power plants, and (2) performance of HSI reviews that could be undertaken as part of an inspection or other type of regulatory review involving HSI design or incidents involving human performance. The guidance consists of a review process and HFE guidelines. The document describes those aspects of the HSI design review process that are important to the identification and resolution of human engineering discrepancies that could adversely affect plant safety. Guidance is provided that could be used by the staff to review an applicant's HSI design review process or to guide the development of an HSI design review plan, e.g., as part of an inspection activity. The document also provides detailed HFE guidelines for the assessment of HSI design implementations. NUREG-0700, Revision 1, consists of three stand-alone volumes. Volume 1 consists of two major parts. Part 1 describes those aspects of the review process of the HSI design that are important to identifying and resolving human engineering discrepancies. Part 2 contains detailed guidelines for a human factors engineering review which identify criteria for assessing the implementation of an applicant's or licensee's HSI design

  19. A Status of NASA Rotorcraft Research

    Science.gov (United States)

    2009-09-01

    4(b/2), wheels above deck = 10 ft (full-scale). [Wadcock et al., 2004...lateral offset = 4(b/2), wheels above deck = 10 ft (full-scale). [Rajagopalan et al., 2005]. ............. 212 Figure 5.15. Azimuth-dependent PMI measured...mendation to Congress to Augment NASA 2006 and Beyond Runout of the FY05 Aeronautics Research Budget, Press Release, May 3, 2005. Wilkerson, J.; Montoro

  20. USAF Corrosion Prevention and Control Enterprise - Sustainability Links

    Science.gov (United States)

    2014-11-18

    projects and $84M  Example of potential synergy: From FY05-14, the DoD Corrosion Program funded 21 projects on hexavalent chromium reduction  OSD...coatings, effects on structural integrity, environmental effects, etc  Some topics of interest  Inhibitor mechanisms for mg-rich primer (non- chrome ...approach  Financial and engineering resources are limited  Potential costs of corrosion are significant  Supporting replacements for hexavalent

  1. DoD Generally Effective at Correcting Causes of Antideficiency Act Violations in Military Personnel Accounts, But Vulnerabilities Remain

    Science.gov (United States)

    2012-11-30

    U.S. Army Audit Agency Report No. A-2010-0143- FFM , “Follow-up Audit of FY 05 Subsistence Charges,” July 29, 2010 U.S. Army Audit Agency Report...2009 U.S. Army Audit Agency Report No. A-2008-0108- FFM , “Miscellaneous Credits for Reserve Component Pay,” April 29, 2008 Navy Naval Audit Service

  2. Logistics Modernization Program System Procure-to-Pay Process Did Not Correct Material Weaknesses

    Science.gov (United States)

    2012-05-29

    Prevalidation of DOD Commercial Payments,” March 2, 2007 Army U.S. Army Audit Agency Report No. A-2007-0205- FFM , “Logistics Modernization Program...Report No. A-2007-0163- FFM , “FY 03–FY 05 Obligations Recorded in the Logistics Modernization Program,” July 27, 2007 U.S. Army Audit Agency Report No

  3. Southeast Regional Carbon Sequestration Partnership

    Energy Technology Data Exchange (ETDEWEB)

    Kenneth J. Nemeth

    2006-08-30

    The Southeast Regional Carbon Sequestration Partnership's (SECARB) Phase I program focused on promoting the development of a framework and infrastructure necessary for the validation and commercial deployment of carbon sequestration technologies. The SECARB program, and its subsequent phases, directly support the Global Climate Change Initiative's goal of reducing greenhouse gas intensity by 18 percent by the year 2012. Work during the project's two-year period was conducted within a ''Task Responsibility Matrix''. The SECARB team was successful in accomplishing its tasks to define the geographic boundaries of the region; characterize the region; identify and address issues for technology deployment; develop public involvement and education mechanisms; identify the most promising capture, sequestration, and transport options; and prepare action plans for implementation and technology validation activity. Milestones accomplished during Phase I of the project are listed below: (1) Completed preliminary identification of geographic boundaries for the study (FY04, Quarter 1); (2) Completed initial inventory of major sources and sinks for the region (FY04, Quarter 2); (3) Completed initial development of plans for GIS (FY04, Quarter 3); (4) Completed preliminary action plan and assessment for overcoming public perception issues (FY04, Quarter 4); (5) Assessed safety, regulatory and permitting issues (FY05, Quarter 1); (6) Finalized inventory of major sources/sinks and refined GIS algorithms (FY05, Quarter 2); (7) Refined public involvement and education mechanisms in support of technology development options (FY05, Quarter 3); and (8) Identified the most promising capture, sequestration and transport options and prepared action plans (FY05, Quarter 4).

  4. 2007 Joint Service Power Expo Held in San Diego, California on April 24-26, 2007. Volume 4: Thursday Presentations

    Science.gov (United States)

    2007-04-26

    Ammonia Borane Core Attributes • Pellet Based Ammonia Borane • 12-14% Hydrogen Well Demonstrated • System Packaging Under Development Jadoo Power Systems...FY07 FY08 Pacing Technologies: Burner control/Heat- driven cooling Meso-components LW Blk III PM-MEP STEP Power...technology to the warfighter quicker” FY05 FY06 FY07 FY08 Pacing Technologies: Burner

  5. Seismicity in the Vicinity of Yucca Mountain, Nevada, for the Period October 1, 2004 to September 30, 2006

    International Nuclear Information System (INIS)

    Smith, Ken

    2007-01-01

    This report describes earthquake activity within approximately 65 km of Yucca Mountain site during the October 1, 2004 to September 30, 2006 time period (FY05-06). The FY05-06 earthquake activity will be compared with the historical and more recent period of seismic activity in the Yucca Mountain region. The relationship between the distribution of seismicity and active faults, historical patterns of activity, and rates of earthquakes (number of events and their magnitudes) are important components in the assessment of the seismic hazard for the Yucca Mountain site. Since October 1992 the University of Nevada has compiled a catalog of earthquakes in the Yucca Mountain area. Seismicity reports have identified notable earthquake activity, provided interpretations of the seismotectonics of the region, and documented changes in the character of earthquake activity based on nearly 30 years of site-characterization monitoring. Data from stations in the seismic network in the vicinity of Yucca Mountain is collected and managed at the Nevada Seismological Laboratory (NSL) at the University of Nevada Reno (UNR). Earthquake events are systematically identified and cataloged under Implementing Procedures developed in compliance with the Nevada System of Higher Education (NSHE) Quality Assurance Program. The earthquake catalog for FY05-06 in the Yucca Mountain region submitted to the Yucca Mountain Technical Data Management System (TDMS) forms the basis of this report

  6. Red Storm usage model :Version 1.12.

    Energy Technology Data Exchange (ETDEWEB)

    Jefferson, Karen L.; Sturtevant, Judith E.

    2005-12-01

    Red Storm is an Advanced Simulation and Computing (ASC) funded massively parallel supercomputer located at Sandia National Laboratories (SNL). The Red Storm Usage Model (RSUM) documents the capabilities and the environment provided for the FY05 Tri-Lab Level II Limited Availability Red Storm User Environment Milestone and the FY05 SNL Level II Limited Availability Red Storm Platform Milestone. This document describes specific capabilities, tools, and procedures to support both local and remote users. The model is focused on the needs of the ASC user working in the secure computing environments at Los Alamos National Laboratory (LANL), Lawrence Livermore National Laboratory (LLNL), and SNL. Additionally, the Red Storm Usage Model maps the provided capabilities to the Tri-Lab ASC Computing Environment (ACE) requirements. The ACE requirements reflect the high performance computing requirements for the ASC community and have been updated in FY05 to reflect the community's needs. For each section of the RSUM, Appendix I maps the ACE requirements to the Limited Availability User Environment capabilities and includes a description of ACE requirements met and those requirements that are not met in that particular section. The Red Storm Usage Model, along with the ACE mappings, has been issued and vetted throughout the Tri-Lab community.

  7. Construction of physical maps for the sex-specific regions of papaya sex chromosomes

    Directory of Open Access Journals (Sweden)

    Na Jong-Kuk

    2012-05-01

    Full Text Available Abstract Background Papaya is a major fruit crop in tropical and subtropical regions worldwide. It is trioecious with three sex forms: male, female, and hermaphrodite. Sex determination is controlled by a pair of nascent sex chromosomes with two slightly different Y chromosomes, Y for male and Yh for hermaphrodite. The sex chromosome genotypes are XY (male, XYh (hermaphrodite, and XX (female. The papaya hermaphrodite-specific Yh chromosome region (HSY is pericentromeric and heterochromatic. Physical mapping of HSY and its X counterpart is essential for sequencing these regions and uncovering the early events of sex chromosome evolution and to identify the sex determination genes for crop improvement. Results A reiterate chromosome walking strategy was applied to construct the two physical maps with three bacterial artificial chromosome (BAC libraries. The HSY physical map consists of 68 overlapped BACs on the minimum tiling path, and covers all four HSY-specific Knobs. One gap remained in the region of Knob 1, the only knob structure shared between HSY and X, due to the lack of HSY-specific sequences. This gap was filled on the physical map of the HSY corresponding region in the X chromosome. The X physical map consists of 44 BACs on the minimum tiling path with one gap remaining in the middle, due to the nature of highly repetitive sequences. This gap was filled on the HSY physical map. The borders of the non-recombining HSY were defined genetically by fine mapping using 1460 F2 individuals. The genetically defined HSY spanned approximately 8.5 Mb, whereas its X counterpart extended about 5.4 Mb including a 900 Kb region containing the Knob 1 shared by the HSY and X. The 8.5 Mb HSY corresponds to 4.5 Mb of its X counterpart, showing 4 Mb (89% DNA sequence expansion. Conclusion The 89% increase of DNA sequence in HSY indicates rapid expansion of the Yh chromosome after genetic recombination was suppressed 2–3 million years ago. The

  8. The intriguing electronic and optical properties modulation of hydrogen and fluorine codecorated silicene layers

    International Nuclear Information System (INIS)

    Yang, Qun; Tan, Chunjian; Meng, Ruishen; Jiang, Junke; Liang, Qiuhua; Sun, Xiang; Yang, Daoguo; Chen, Xianping

    2017-01-01

    Highlights: • The HSiF bilayer is very stable due to the high binding energy even larger than the ones of bilayer graphene. • The HSiF bilayer exhibits a moderate direct band gap of 0.296 eV much lower than that of HSiF monolayer. • All the HSiF layers have a direct band gap nature, irrespective of stacking pattern, thickness and external electric fields, which is an advantage over MoS 2 layers. Besides, it is advantageous to the application of HSiF layers in the field of optical devices. • The external electric field can effectively tune the band gaps of HSiF layers. Especially, even a semiconductor–metal transition occurs. • After the formation of HSiF bilayer, the complete electron-hole separation enhances the photocatalytic efficiency of HSiF bilayer and it exhibits a significantly improved visible light adsorption peak. - Abstract: First-principles calculations based on density-functional theory reveal some superior physical properties of hydrogen and fluorine co-decorated silicene (HSiF) monolayer and bilayer. Our simulated results reveal that the HSiF monolayer is a large direct band gap semiconductor greatly differing from the gapless semi-metallic silicene. There exists strong interlayer coupling in HSiF bilayer, leading to the good stabilities of HSiF bilayer even beyond bilayer graphene. The proposed HSiF bilayer exhibits a moderate direct band gap of 0.296 eV which is much lower than that of HSiF monolayer. Encouragingly, HSiF layers all have a direct band gap nature, irrespective of stacking pattern, thickness and external electric fields, which is an advantage over MoS 2 layers. Furthermore, an out-of-plane electric field has an evident impact on the band structures of the HSiF monolayer and bilayer. Especially, the band gap of HSiF bilayer can be effectively tuned by external electric field, even a semiconductor–metal transition occurs. More importantly, the HSiF bilayer exhibits a significant improved visible light adsorption peak with

  9. The intriguing electronic and optical properties modulation of hydrogen and fluorine codecorated silicene layers

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Qun; Tan, Chunjian [Faculty of Mechanical and Electrical Engineering, Guilin University of Electronic Technology, 541004 Guilin (China); Key Laboratory of Optoelectronic Technology & Systems, Education Ministry of China, Chongqing University and College of Opto-Electronic Engineering, Chongqing University, 400044 Chongqing (China); Meng, Ruishen; Jiang, Junke; Liang, Qiuhua; Sun, Xiang [Key Laboratory of Optoelectronic Technology & Systems, Education Ministry of China, Chongqing University and College of Opto-Electronic Engineering, Chongqing University, 400044 Chongqing (China); Yang, Daoguo [Faculty of Mechanical and Electrical Engineering, Guilin University of Electronic Technology, 541004 Guilin (China); Chen, Xianping, E-mail: xianpingchen@cqu.edu.cn [Faculty of Mechanical and Electrical Engineering, Guilin University of Electronic Technology, 541004 Guilin (China); Key Laboratory of Optoelectronic Technology & Systems, Education Ministry of China, Chongqing University and College of Opto-Electronic Engineering, Chongqing University, 400044 Chongqing (China)

    2017-03-15

    Highlights: • The HSiF bilayer is very stable due to the high binding energy even larger than the ones of bilayer graphene. • The HSiF bilayer exhibits a moderate direct band gap of 0.296 eV much lower than that of HSiF monolayer. • All the HSiF layers have a direct band gap nature, irrespective of stacking pattern, thickness and external electric fields, which is an advantage over MoS{sub 2} layers. Besides, it is advantageous to the application of HSiF layers in the field of optical devices. • The external electric field can effectively tune the band gaps of HSiF layers. Especially, even a semiconductor–metal transition occurs. • After the formation of HSiF bilayer, the complete electron-hole separation enhances the photocatalytic efficiency of HSiF bilayer and it exhibits a significantly improved visible light adsorption peak. - Abstract: First-principles calculations based on density-functional theory reveal some superior physical properties of hydrogen and fluorine co-decorated silicene (HSiF) monolayer and bilayer. Our simulated results reveal that the HSiF monolayer is a large direct band gap semiconductor greatly differing from the gapless semi-metallic silicene. There exists strong interlayer coupling in HSiF bilayer, leading to the good stabilities of HSiF bilayer even beyond bilayer graphene. The proposed HSiF bilayer exhibits a moderate direct band gap of 0.296 eV which is much lower than that of HSiF monolayer. Encouragingly, HSiF layers all have a direct band gap nature, irrespective of stacking pattern, thickness and external electric fields, which is an advantage over MoS{sub 2} layers. Furthermore, an out-of-plane electric field has an evident impact on the band structures of the HSiF monolayer and bilayer. Especially, the band gap of HSiF bilayer can be effectively tuned by external electric field, even a semiconductor–metal transition occurs. More importantly, the HSiF bilayer exhibits a significant improved visible light adsorption

  10. Reconstruction of hyperspectral image using matting model for classification

    Science.gov (United States)

    Xie, Weiying; Li, Yunsong; Ge, Chiru

    2016-05-01

    Although hyperspectral images (HSIs) captured by satellites provide much information in spectral regions, some bands are redundant or have large amounts of noise, which are not suitable for image analysis. To address this problem, we introduce a method for reconstructing the HSI with noise reduction and contrast enhancement using a matting model for the first time. The matting model refers to each spectral band of an HSI that can be decomposed into three components, i.e., alpha channel, spectral foreground, and spectral background. First, one spectral band of an HSI with more refined information than most other bands is selected, and is referred to as an alpha channel of the HSI to estimate the hyperspectral foreground and hyperspectral background. Finally, a combination operation is applied to reconstruct the HSI. In addition, the support vector machine (SVM) classifier and three sparsity-based classifiers, i.e., orthogonal matching pursuit (OMP), simultaneous OMP, and OMP based on first-order neighborhood system weighted classifiers, are utilized on the reconstructed HSI and the original HSI to verify the effectiveness of the proposed method. Specifically, using the reconstructed HSI, the average accuracy of the SVM classifier can be improved by as much as 19%.

  11. Evaluation of habitat quality for selected wildlife species associated with back channels.

    Science.gov (United States)

    Anderson, James T.; Zadnik, Andrew K.; Wood, Petra Bohall; Bledsoe, Kerry

    2013-01-01

    The islands and associated back channels on the Ohio River, USA, are believed to provide critical habitat features for several wildlife species. However, few studies have quantitatively evaluated habitat quality in these areas. Our main objective was to evaluate the habitat quality of back and main channel areas for several species using habitat suitability index (HSI) models. To test the effectiveness of these models, we attempted to relate HSI scores and the variables measured for each model with measures of relative abundance for the model species. The mean belted kingfisher (Ceryle alcyon) HSI was greater on the main than back channel. However, the model failed to predict kingfisher abundance. The mean reproduction component of the great blue heron (Ardea herodias) HSI, total common muskrat (Ondatra zibethicus) HSI, winter cover component of the snapping turtle (Chelydra serpentina) HSI, and brood-rearing component of the wood duck (Aix sponsa) HSI were all greater on the back than main channel, and were positively related with the relative abundance of each species. We found that island back channels provide characteristics not found elsewhere on the Ohio River and warrant conservation as important riparian wildlife habitat. The effectiveness of using HSI models to predict species abundance on the river was mixed. Modifications to several of the models are needed to improve their use on the Ohio River and, likely, other large rivers.

  12. Discrimination methods of biological contamination on fresh-cut lettuce based on VNIR and NIR hyperspectral imaging

    Science.gov (United States)

    Multispectral imaging algorithms were developed using visible-near-infrared (VNIR) and near-infrared (NIR) hyperspectral imaging (HSI) techniques to detect worms on fresh-cut lettuce. The optimal wavebands that detect worm on fresh-cut lettuce for each type of HSI were investigated using the one-way...

  13. Evaluation of habitat suitability models for forest passerines using demographic data

    Science.gov (United States)

    Chadwick D. Rittenhouse; Frank R., III Thompson; William D. Dijak; Joshua J. Millspaugh; Richard L. Clawson

    2010-01-01

    Habitat suitability is often used as a surrogate for demographic responses (i.e., abundance, survival, fecundity, or population viability) in the application of habitat suitability index (HSI) models. Whether habitat suitability actually relates to demographics, however, has rarely been evaluated. We validated HSI models of breeding habitat suitability for wood thrush...

  14. Spectral-spatial classification of hyperspectral image using three-dimensional convolution network

    Science.gov (United States)

    Liu, Bing; Yu, Xuchu; Zhang, Pengqiang; Tan, Xiong; Wang, Ruirui; Zhi, Lu

    2018-01-01

    Recently, hyperspectral image (HSI) classification has become a focus of research. However, the complex structure of an HSI makes feature extraction difficult to achieve. Most current methods build classifiers based on complex handcrafted features computed from the raw inputs. The design of an improved 3-D convolutional neural network (3D-CNN) model for HSI classification is described. This model extracts features from both the spectral and spatial dimensions through the application of 3-D convolutions, thereby capturing the important discrimination information encoded in multiple adjacent bands. The designed model views the HSI cube data altogether without relying on any pre- or postprocessing. In addition, the model is trained in an end-to-end fashion without any handcrafted features. The designed model was applied to three widely used HSI datasets. The experimental results demonstrate that the 3D-CNN-based method outperforms conventional methods even with limited labeled training samples.

  15. Habitat suitability index model of the sea cucumber Apostichopus japonicus (Selenka): A case study of Shandong Peninsula, China.

    Science.gov (United States)

    Zhang, Zhipeng; Zhou, Jian; Song, Jingjing; Wang, Qixiang; Liu, Hongjun; Tang, Xuexi

    2017-09-15

    A habitat suitability index (HSI) model for the sea cucumber Apostichopus japonicus (Selenka) was established in the present study. Based on geographic information systems, the HSI model was used to identify potential sites around the Shandong Peninsula suitable for restoration of immature (25g) A. japonicus. Six habitat factors were used as input variables for the HSI model: sediment classification, water temperature, salinity, water depth, pH and dissolved oxygen. The weighting of each habitat factor was defined through the Delphi method. Sediment classification was the most important condition affecting the HSI of A. japonicus in the different study areas, while water temperature was the most important condition in different seasons. The HSI of Western Laizhou Bay was relatively low, meaning the site was not suitable for aquaculture-based restoration of A. japonicus. In contrast, Xiaoheishan Island, Rongcheng Bay and Qingdao were preferable sites, suitable as habitats for restoration efforts. Copyright © 2017 Elsevier Ltd. All rights reserved.

  16. Hyperspectral imaging solutions for brain tissue metabolic and hemodynamic monitoring: past, current and future developments

    Science.gov (United States)

    Giannoni, Luca; Lange, Frédéric; Tachtsidis, Ilias

    2018-04-01

    Hyperspectral imaging (HSI) technologies have been used extensively in medical research, targeting various biological phenomena and multiple tissue types. Their high spectral resolution over a wide range of wavelengths enables acquisition of spatial information corresponding to different light-interacting biological compounds. This review focuses on the application of HSI to monitor brain tissue metabolism and hemodynamics in life sciences. Different approaches involving HSI have been investigated to assess and quantify cerebral activity, mainly focusing on: (1) mapping tissue oxygen delivery through measurement of changes in oxygenated (HbO2) and deoxygenated (HHb) hemoglobin; and (2) the assessment of the cerebral metabolic rate of oxygen (CMRO2) to estimate oxygen consumption by brain tissue. Finally, we introduce future perspectives of HSI of brain metabolism, including its potential use for imaging optical signals from molecules directly involved in cellular energy production. HSI solutions can provide remarkable insight in understanding cerebral tissue metabolism and oxygenation, aiding investigation on brain tissue physiological processes.

  17. 3D Spatial and Spectral Fusion of Terrestrial Hyperspectral Imagery and Lidar for Hyperspectral Image Shadow Restoration Applied to a Geologic Outcrop

    Science.gov (United States)

    Hartzell, P. J.; Glennie, C. L.; Hauser, D. L.; Okyay, U.; Khan, S.; Finnegan, D. C.

    2016-12-01

    Recent advances in remote sensing technology have expanded the acquisition and fusion of active lidar and passive hyperspectral imagery (HSI) from an exclusively airborne technique to terrestrial modalities. This enables high resolution 3D spatial and spectral quantification of vertical geologic structures for applications such as virtual 3D rock outcrop models for hydrocarbon reservoir analog analysis and mineral quantification in open pit mining environments. In contrast to airborne observation geometry, the vertical surfaces observed by horizontal-viewing terrestrial HSI sensors are prone to extensive topography-induced solar shadowing, which leads to reduced pixel classification accuracy or outright removal of shadowed pixels from analysis tasks. Using a precisely calibrated and registered offset cylindrical linear array camera model, we demonstrate the use of 3D lidar data for sub-pixel HSI shadow detection and the restoration of the shadowed pixel spectra via empirical methods that utilize illuminated and shadowed pixels of similar material composition. We further introduce a new HSI shadow restoration technique that leverages collocated backscattered lidar intensity, which is resistant to solar conditions, obtained by projecting the 3D lidar points through the HSI camera model into HSI pixel space. Using ratios derived from the overlapping lidar laser and HSI wavelengths, restored shadow pixel spectra are approximated using a simple scale factor. Simulations of multiple lidar wavelengths, i.e., multi-spectral lidar, indicate the potential for robust HSI spectral restoration that is independent of the complexity and costs associated with rigorous radiometric transfer models, which have yet to be developed for horizontal-viewing terrestrial HSI sensors. The spectral restoration performance is quantified through HSI pixel classification consistency between full sun and partial sun exposures of a single geologic outcrop.

  18. Label-free reflectance hyperspectral imaging for tumor margin assessment: a pilot study on surgical specimens of cancer patients

    Science.gov (United States)

    Fei, Baowei; Lu, Guolan; Wang, Xu; Zhang, Hongzheng; Little, James V.; Patel, Mihir R.; Griffith, Christopher C.; El-Diery, Mark W.; Chen, Amy Y.

    2017-08-01

    A label-free, hyperspectral imaging (HSI) approach has been proposed for tumor margin assessment. HSI data, i.e., hypercube (x,y,λ), consist of a series of high-resolution images of the same field of view that are acquired at different wavelengths. Every pixel on an HSI image has an optical spectrum. In this pilot clinical study, a pipeline of a machine-learning-based quantification method for HSI data was implemented and evaluated in patient specimens. Spectral features from HSI data were used for the classification of cancer and normal tissue. Surgical tissue specimens were collected from 16 human patients who underwent head and neck (H&N) cancer surgery. HSI, autofluorescence images, and fluorescence images with 2-deoxy-2-[(7-nitro-2,1,3-benzoxadiazol-4-yl)amino]-D-glucose (2-NBDG) and proflavine were acquired from each specimen. Digitized histologic slides were examined by an H&N pathologist. The HSI and classification method were able to distinguish between cancer and normal tissue from the oral cavity with an average accuracy of 90%±8%, sensitivity of 89%±9%, and specificity of 91%±6%. For tissue specimens from the thyroid, the method achieved an average accuracy of 94%±6%, sensitivity of 94%±6%, and specificity of 95%±6%. HSI outperformed autofluorescence imaging or fluorescence imaging with vital dye (2-NBDG or proflavine). This study demonstrated the feasibility of label-free, HSI for tumor margin assessment in surgical tissue specimens of H&N cancer patients. Further development of the HSI technology is warranted for its application in image-guided surgery.

  19. Proceedings of a workshop on fish habitat suitability index models

    Science.gov (United States)

    Terrell, James W.

    1984-01-01

    One of the habitat-based methodologies for impact assessment currently in use by the U.S. Fish and Wildlife Service is the Habitat Evaluation Procedures (HEP) (U.S. Fish and Wildlife Service 1980). HEP is based on the assumption that the quality of an area as wildlife habitat at a specified target year can be described by a single number, called a Habitat Suitability Index (HSI). An HSI of 1.0 represents optimum habitat: an HSI of 0.0 represents unsuitable habitat. The verbal or mathematical rules by which an HSI is assigned to an area are called an HSI model. A series of Habitat Suitability Index (HSI) models, described by Schamberger et al. (1982), have been published to assist users in applying HEP. HSI model building approaches are described in U.S. Fish and Wildlife Service (1981). One type of HSI model described in detail requires the development of Suitability Index (SI) graphs for habitat variables believed to be important for the growth, survival, standing crop, or other measure of well-being for a species. Suitability indices range from 0 to 1.0, with 1.0 representing optimum conditions for the variable. When HSI models based on suitability indices are used, habitat variable values are measured, or estimated, and converted to SI's through the use of a Suitability Index graph for each variable. Individual SI's are aggregated into an HSI. Standard methods for testing this type of HSI model did not exist at the time the studies reported in this document were performed. A workshop was held in Fort Collins, Colorado, February 14-15, 1983, that brought together biologists experienced in the use, development, and testing of aquatic HSI models, in an effort to address the following objectives: (1) review the needs of HSI model users; (2) discuss and document the results of aquatic HSI model tests; and (3) provide recommendations for the future development, testing, modification, and use of HSI models. Individual presentations, group discussions, and group

  20. The Hispanic Stress Inventory Version 2: Improving the assessment of acculturation stress.

    Science.gov (United States)

    Cervantes, Richard C; Fisher, Dennis G; Padilla, Amado M; Napper, Lucy E

    2016-05-01

    This article reports on a 2-phase study to revise the Hispanic Stress Inventory (HSI; Cervantes, Padilla, & Salgado de Snyder, 1991). The necessity for a revised stress-assessment instrument was determined by demographic and political shifts affecting Latin American immigrants and later-generation Hispanics in the United States in the 2 decades since the development of the HSI. The data for the revision of the HSI (termed the HSI2) was collected at 4 sites: Los Angeles, El Paso, Miami, and Boston, and included 941 immigrants and 575 U.S.-born Hispanics and a diverse population of Hispanic subgroups. The immigrant version of the HSI2 includes 10 stress subscales, whereas the U.S.-born version includes 6 stress subscales. Both versions of the HSI2 are shown to possess satisfactory Cronbach's alpha reliabilities and demonstrate expert-based content validity, as well as concurrent validity when correlated with subscales of the Brief Symptom Inventory (Derogatis, 1993) and the Patient Health Questionnaire-9 (Kroenke, Spitzer, & Williams, 2001). The new HSI2 instruments are recommended for use by clinicians and researchers interested in assessing psychosocial stress among diverse Hispanic populations of various ethnic subgroups, age groups, and geographic location. (PsycINFO Database Record (c) 2016 APA, all rights reserved).

  1. Human-system interface design review guideline -- Reviewer`s checklist: Final report. Revision 1, Volume 2

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-06-01

    NUREG-0700, Revision 1, provides human factors engineering (HFE) guidance to the US Nuclear Regulatory Commission staff for its: (1) review of the human system interface (HSI) design submittals prepared by licensees or applications for a license or design certification of commercial nuclear power plants, and (2) performance of HSI reviews that could be undertaken as part of an inspection or other type of regulatory review involving HSI design or incidents involving human performance. The guidance consists of a review process and HFE guidelines. The document describes those aspects of the HSI design review process that are important to the identification and resolution of human engineering discrepancies that could adversely affect plant safety. Guidance is provided that could be used by the staff to review an applicant`s HSI design review process or to guide the development of an HSI design review plan, e.g., as part of an inspection activity. The document also provides detailed HFE guidelines for the assessment of HSI design implementations. NUREG-0700, Revision 1, consists of three stand-alone volumes. Volume 2 is a complete set of the guidelines contained in Volume 1, Part 2, but in a checklist format that can be used by reviewers to assemble sets of individual guidelines for use in specific design reviews. The checklist provides space for reviewers to enter guidelines evaluations and comments.

  2. Human-system interface design review guideline -- Review software and user's guide: Final report. Revision 1, Volume 3

    International Nuclear Information System (INIS)

    1996-06-01

    NUREG-0700, Revision 1, provides human factors engineering (HFE) guidance to the US Nuclear Regulatory Commission staff for its: (1) review of the human system interface (HSI) design submittals prepared by licensees or applications for a license or design certification of commercial nuclear power plants, and (2) performance of HSI reviews that could be undertaken as part of an inspection or other type of regulatory review involving HSI design or incidents involving human performance. The guidance consists of a review process and HFE guidelines. The document describes those aspects of the HSI design review process that are important to the identification and resolution of human engineering discrepancies that could adversely affect plant safety. Guidance is provided that could be used by the staff to review an applicant's HSI design review process or to guide the development of an HSI design review plan, e.g., as part of an inspection activity. The document also provides detailed HFE guidelines for the assessment of HSI design implementations. NUREG-0700, Revision 1, consists of three stand-alone volumes. Volume 3 contains an interactive software application of the NUREG-0700, Revision 1 guidance and a user's guide for this software. The software supports reviewers during review preparation, evaluation design using the human factors engineering guidelines, and in report preparation. The user's guide provides system requirements and installation instructions, detailed explanations of the software's functions and features, and a tutorial on using the software

  3. Gas-phase Dehydration of Glycerol over Supported Silicotungstic Acids Catalysts

    International Nuclear Information System (INIS)

    Kim, Yong Tae; Park, Eun Duck; Jung, Kwang Deog

    2010-01-01

    The gas-phase dehydration of glycerol to acrolein was carried out over 10 wt % HSiW catalysts supported on different supports, viz. γ-Al 2 O 3 , SiO 2 -Al 2 O 3 , TiO 2 , ZrO 2 , SiO 2 , AC, CeO 2 and MgO. The same reaction was also conducted over each support without HSiW for comparison. Several characterization techniques, N 2 -physisorption, thermogravimetric analysis (TGA), differential scanning calorimetry (DSC), the temperature-programmed desorption of ammonia (NH 3 - TPD), temperature-programmed oxidation (TPO) with mass spectroscopy and CHNS analysis were employed to characterize the catalysts. The glycerol conversion generally increased with increasing amount of acid sites. Ceria showed the highest 1-hydroxyacetone selectivity at 315 .deg. C among the various metal oxides. The supported HSiW catalyst showed superior catalytic activity to that of the corresponding support. Among the supported HSiW catalysts, HSiW/ZrO 2 and HSiW/SiO 2 -Al 2 O 3 showed the highest acrolein selectivity. In the case of HSiW/ZrO 2 , the initial catalytic activity was recovered after the removal of the accumulated carbon species at 550 .deg. C in the presence of oxygen

  4. An ultrasensitive hollow-silica-based biosensor for pathogenic Escherichia coli DNA detection.

    Science.gov (United States)

    Ariffin, Eda Yuhana; Lee, Yook Heng; Futra, Dedi; Tan, Ling Ling; Karim, Nurul Huda Abd; Ibrahim, Nik Nuraznida Nik; Ahmad, Asmat

    2018-03-01

    A novel electrochemical DNA biosensor for ultrasensitive and selective quantitation of Escherichia coli DNA based on aminated hollow silica spheres (HSiSs) has been successfully developed. The HSiSs were synthesized with facile sonication and heating techniques. The HSiSs have an inner and an outer surface for DNA immobilization sites after they have been functionalized with 3-aminopropyltriethoxysilane. From field emission scanning electron microscopy images, the presence of pores was confirmed in the functionalized HSiSs. Furthermore, Brunauer-Emmett-Teller (BET) analysis indicated that the HSiSs have four times more surface area than silica spheres that have no pores. These aminated HSiSs were deposited onto a screen-printed carbon paste electrode containing a layer of gold nanoparticles (AuNPs) to form a AuNP/HSiS hybrid sensor membrane matrix. Aminated DNA probes were grafted onto the AuNP/HSiS-modified screen-printed electrode via imine covalent bonds with use of glutaraldehyde cross-linker. The DNA hybridization reaction was studied by differential pulse voltammetry using an anthraquinone redox intercalator as the electroactive DNA hybridization label. The DNA biosensor demonstrated a linear response over a wide target sequence concentration range of 1.0×10 -12 -1.0×10 -2 μM, with a low detection limit of 8.17×10 -14 μM (R 2 = 0.99). The improved performance of the DNA biosensor appeared to be due to the hollow structure and rough surface morphology of the hollow silica particles, which greatly increased the total binding surface area for high DNA loading capacity. The HSiSs also facilitated molecule diffusion through the silica hollow structure, and substantially improved the overall DNA hybridization assay. Graphical abstract Step-by-step DNA biosensor fabrication based on aminated hollow silica spheres.

  5. Handheld and mobile hyperspectral imaging sensors for wide-area standoff detection of explosives and chemical warfare agents

    Science.gov (United States)

    Gomer, Nathaniel R.; Gardner, Charles W.; Nelson, Matthew P.

    2016-05-01

    Hyperspectral imaging (HSI) is a valuable tool for the investigation and analysis of targets in complex background with a high degree of autonomy. HSI is beneficial for the detection of threat materials on environmental surfaces, where the concentration of the target of interest is often very low and is typically found within complex scenery. Two HSI techniques that have proven to be valuable are Raman and shortwave infrared (SWIR) HSI. Unfortunately, current generation HSI systems have numerous size, weight, and power (SWaP) limitations that make their potential integration onto a handheld or field portable platform difficult. The systems that are field-portable do so by sacrificing system performance, typically by providing an inefficient area search rate, requiring close proximity to the target for screening, and/or eliminating the potential to conduct real-time measurements. To address these shortcomings, ChemImage Sensor Systems (CISS) is developing a variety of wide-field hyperspectral imaging systems. Raman HSI sensors are being developed to overcome two obstacles present in standard Raman detection systems: slow area search rate (due to small laser spot sizes) and lack of eye-safety. SWIR HSI sensors have been integrated into mobile, robot based platforms and handheld variants for the detection of explosives and chemical warfare agents (CWAs). In addition, the fusion of these two technologies into a single system has shown the feasibility of using both techniques concurrently to provide higher probability of detection and lower false alarm rates. This paper will provide background on Raman and SWIR HSI, discuss the applications for these techniques, and provide an overview of novel CISS HSI sensors focused on sensor design and detection results.

  6. Study and application of human reliability analysis for digital human-system interface

    International Nuclear Information System (INIS)

    Jia Ming; Liu Yanzi; Zhang Jianbo

    2014-01-01

    The knowledge of human-orientated abilities and limitations could be used to digital human-system interface (HSI) design by human reliability analysis (HRA) technology. Further, control room system design could achieve the perfect match of man-machine-environment. This research was conducted to establish an integrated HRA method. This method identified HSI potential design flaws which may affect human performance and cause human error. Then a systematic approach was adopted to optimize HSI. It turns out that this method is practical and objective, and effectively improves the safety, reliability and economy of nuclear power plant. This method was applied to CRP1000 projects under construction successfully with great potential. (authors)

  7. Detecting brain tumor in pathological slides using hyperspectral imaging.

    Science.gov (United States)

    Ortega, Samuel; Fabelo, Himar; Camacho, Rafael; de la Luz Plaza, María; Callicó, Gustavo M; Sarmiento, Roberto

    2018-02-01

    Hyperspectral imaging (HSI) is an emerging technology for medical diagnosis. This research work presents a proof-of-concept on the use of HSI data to automatically detect human brain tumor tissue in pathological slides. The samples, consisting of hyperspectral cubes collected from 400 nm to 1000 nm, were acquired from ten different patients diagnosed with high-grade glioma. Based on the diagnosis provided by pathologists, a spectral library of normal and tumor tissues was created and processed using three different supervised classification algorithms. Results prove that HSI is a suitable technique to automatically detect high-grade tumors from pathological slides.

  8. Vesihuoltolaitosten vesimittareiden etäluenta

    OpenAIRE

    Korhonen, Joonas

    2015-01-01

    Tämä opinnäytetyö tehtiin Helsingin Seudun Ympäristöpalvelut -kuntayhtymän (HSY) vesihuollon toimialalle ja sen tarkoituksena oli selvittää millaisia hyötyjä HSY:n olisi mahdollista saavuttaa asiakkaidensa vedenkulutusta mittaavien vesimittareiden etäluennalla ja minkälaisia haasteita etäluentaan siirtymisellä on. Työn sisältö palvelee vesimittareiden etäluentaa harkitsevia vesilaitoksia. Tässä työssä on erityisesti kuvattu työn tilaajan HSY:n vesimittaroinnin nykytilaa ja etäluennan suht...

  9. Exploratory survey study of long-term users of nicotine replacement therapy in Danish consumers

    DEFF Research Database (Denmark)

    Borup, Gitte; Lyngby Mikkelsen, Kim; Tønnesen, Philip

    2015-01-01

    dependence. Method: Through advertisements in three national Danish newspapers, long-term NRT users were recruited to answer a short questionnaire about basic characteristics, health status and satisfaction with using NRT. A modified version of the Heaviness of Smoking Index (HSI) questionnaire was applied...... addicted and fear of adverse health effects. Scoring on the modified HSI scale was 22.0% low, 68.0% moderate and 9.3% high dependent. Of the respondents, 67.0% used NRT within the first 30 min after waking. A validation check found a significant linear association between the two items in the modified HSI...

  10. Exploratory survey study of long-term users of nicotine replacement therapy in Danish consumers

    DEFF Research Database (Denmark)

    Borup, Gitte; Christrup, Lona Louring; Lyngby Mikkelsen, Kim

    dependence. Method Through advertisements in three national Danish newspapers, long-term NRT users were recruited to answer a short questionnaire about basic characteristics, health status and satisfaction with using NRT. A modified version of the Heaviness of Smoking Index (HSI) questionnaire was applied...... and fear of adverse health effects. Scoring on the modified HSI scale was 22.0% low, 68.0% moderate and 9.3% high dependent. Of the respondents, 67.0% used NRT within the first 30 min after waking. A validation check found a significant linear association between the two items in the modified HSI...

  11. Medical hyperspectral imaging: a review

    Science.gov (United States)

    Lu, Guolan; Fei, Baowei

    2014-01-01

    Abstract. Hyperspectral imaging (HSI) is an emerging imaging modality for medical applications, especially in disease diagnosis and image-guided surgery. HSI acquires a three-dimensional dataset called hypercube, with two spatial dimensions and one spectral dimension. Spatially resolved spectral imaging obtained by HSI provides diagnostic information about the tissue physiology, morphology, and composition. This review paper presents an overview of the literature on medical hyperspectral imaging technology and its applications. The aim of the survey is threefold: an introduction for those new to the field, an overview for those working in the field, and a reference for those searching for literature on a specific application. PMID:24441941

  12. Influence of frailty-related diagnoses, high-risk prescribing in elderly adults, and primary care use on readmissions in fewer than 30 days for veterans aged 65 and older.

    Science.gov (United States)

    Pugh, Jacqueline A; Wang, Chen-Pin; Espinoza, Sara E; Noël, Polly H; Bollinger, Mary; Amuan, Megan; Finley, Erin; Pugh, Mary Jo

    2014-02-01

    To determine the effect of two variables not previously studied in the readmissions literature (frailty-related diagnoses and high-risk medications in the elderly (HRME)) and one understudied variable (volume of primary care visits in the prior year). Retrospective cohort study using data from a study designed to examine outcomes associated with inappropriate prescribing in elderly adults. All Veterans Affairs (VA) facilities with acute inpatient beds in fiscal year 2006 (FY06). All veterans aged 65 and older by October 1, 2005, who received VA care at least once per year between October 1, 2004, and September 30, 2006, and were hospitalized at least once during FY06 on a medical or surgical unit. A generalized linear interactive risk prediction model included demographic and clinical characteristics (mental health and chronic medical conditions, frailty-related diagnoses, number of medications) in FY05; incident HRME in FY06 before index hospitalization or readmission; chronic HRME in FY05; and FY05 emergency department (ED), hospital, geriatric, palliative, or primary care use. Facility-level variables were complexity, rural versus urban, and FY06 admission rate. The mean adjusted readmission rate was 18.3%. The new frailty-related diagnoses variable is a risk factor for readmission in addition to Charlson comorbidity score. Incident HRME use was associated with lower rates of readmission, as were higher numbers of primary care visits in the prior year. Frailty-related diagnoses may help to target individuals at higher risk of readmission to receive more-intensive care transition services. HRME use does not help in this targeting. A higher number of face-to-face primary care visits in the prior year, unlike ED and hospital use, correlates with fewer readmissions and may be another avenue for targeting prevention strategies. Published 2014. This article is a U.S. Government work and is in the public domain in the U.S.A.

  13. Inspector General, Department of Defense, Semiannual Report to the Congress, April 1, 2010 - September 30, 2010

    Science.gov (United States)

    2010-10-01

    Centers 06/21/2010 USAAA A-2010-0121-ALO Real Property Sustainment, Restoration, and Modernization 06/25/2010 USAAA A-2010-0124- FFM Review of Port...Supply Enhanced System, Project Manager, 07/07/2010 Cruise Missile Defense System USAAA A-2010-0131- FFM Agreed-Upon Procedures Attestation of Audit... FFM Follow-up Audit of FY 05 Subsistence Charges 07/29/2010 USAAA A-2010-0144-ALR Follow-up Audit of Property Accountability, Oklahoma Army National

  14. Insufficient Governance Over Logistics Modernization Program System Development

    Science.gov (United States)

    2010-11-02

    Controls Over the Prevalidation of DOD Commercial Payments,” March 2, 2007 Army USAAA Report No. A-2007-0205- FFM , “Logistics Modernization Program...0163- FFM , “FY 03–FY 05 Obligations Recorded in the Logistics Modernization Program,” July 27, 2007 USAAA Report No. A-2007-0154-ALR, “Follow up...Audit of Aged Accounts–U.S. Army Communications-Electronics Life Cycle Management Command,” July 2, 2007 USAAA Report No. A-2006-0234- FFM

  15. Scientific annual report 1980 DESY

    International Nuclear Information System (INIS)

    This annual report contains a survey about the organization of DESY, a description of the different experiments performed at DESY and the developments in accelerator technology and data processing, as well as a list of publications and speeches. (HSI) [de

  16. Theoretical science and the future of large scale computing

    International Nuclear Information System (INIS)

    Wilson, K.G.

    1983-01-01

    The author describes the application of computer simulation to physical problems. In this connection the FORTRAN language is considered. Furthermore the application of computer networks is described whereby the processing of experimental data is considered. (HSI).

  17. ECOOL 1984

    International Nuclear Information System (INIS)

    Poth, H.

    1984-07-01

    These proceedings contain the articles presented at the named workshop. They deal with electron cooling and its applications, especially in heavy ion storage rings. See hints under the relevant topics. (HSI)

  18. Proceedings of the 38th international symposium on multiparticle dynamics ISMD08

    International Nuclear Information System (INIS)

    Bartels, Jochen; Borras, Kerstin; Jung, Hannes; Kutak, Krzysztof; Levonian, Sergey; Mnich, Joachim

    2009-01-01

    The following topics are dealt with: Multiple production in particle production, high-energy heavy ion reactions, QCD calculations, search for new physics at the LHC, recent theoretical developments. (HSI)

  19. Lise Meitner

    International Nuclear Information System (INIS)

    2014-01-01

    This paper is a collection of articles concerning the biography of Lise Meitner with special regards to her cooperation with Otto Hahn in the discovery of nuclear fission, whereby the role of women in science, especially physics, are considered. (HSI)

  20. Considerations concerning the justification of quantum logic by the argumentative conditions of a scientific language

    International Nuclear Information System (INIS)

    Stachow, E.W.

    1980-01-01

    The author discusses the connection between dialogical logic and the empirical conditions of quantum mechanics. It is shown how this dialogue game leads to a nonclassical logical calculus, called the effective quantum logic. (HSI)

  1. Is the quantum logic of Mittelstaedt and Stachow an analytical theory

    International Nuclear Information System (INIS)

    Kamlah, A.

    1980-01-01

    The author studies the quantum logics of Mittelstaedt and Stachow considering the questions whether this theory is mathematical logics, whether their semantic foundations are self-consistent, and whether their application in quantum mechanics is inevitable. (HSI)

  2. Particles, fields and quantum theory

    International Nuclear Information System (INIS)

    Bongaarts, P.J.M.

    1982-01-01

    The author gives an introduction to the development of gauge theories of the fundamental interactions. Starting from classical mechanics and quantum mechanics the development of quantum electrodynamics and non-abelian gauge theories is described. (HSI)

  3. Relations between the simultaneous and sequential transfer of two nucleons

    International Nuclear Information System (INIS)

    Satchler, G.R.

    1982-01-01

    The author discusses the perturbative treatment of simultaneous and sequential two-nucleon transfer reactions with special regards to the DWBA. As examples the (t,p), (p,t), and (α,d) reactions are considered. (HSI)

  4. The international linear collider. Technical design report. Vol. 4. Detectors

    International Nuclear Information System (INIS)

    Behnke, Ties; Brau, James E.; Burrows, Philip; Fuster, Juan; Peskin, Michael; Stanitzki, Marcel; Sugimoto, Yasuhiro; Yamada, Sakue; Yamamoto, Hitoshi

    2013-01-01

    The following topics are dealt with: The Si Vertex detectors, the main tracker, calorimetry, muon detectors, the superconducting spectrometer magnet, the detector electronics and data acquisition, simulation and reconstruction, benchmarking, costs. (HSI)

  5. Measurement of charm and beauty production in deep inelastic scattering at HERA using semi-leptonic decays into muons

    Energy Technology Data Exchange (ETDEWEB)

    Bindi, Marcello

    2008-10-15

    In this thesis the experimental study of the process ep{yields}ec anti cX at HERA is described. The differential cross sections in dependence on the transverse momentum and rapidity of the decay muon are presented. (HSI)

  6. Feynman and physics. Life and research of an exceptional man

    International Nuclear Information System (INIS)

    Resag, Joerg

    2018-01-01

    The life of Feynman is described together with his work on path integrals, quantum electrodynmaics, helium at low temperatures, the weak interaction, the quark model, and computer-calculation methods, and his contribution to the Manhattan project. (HSI)

  7. Fermilab back in business

    International Nuclear Information System (INIS)

    Anon.

    1983-01-01

    The implementation of the energy saver into the Fermilab accelerator is described by which protons can be accelerated to 500 GeV. Furthermore the new experimental areas and the extraction system are described. (HSI).

  8. A tribute: The discovery of proton constituents

    International Nuclear Information System (INIS)

    Steinberger, J.

    1985-01-01

    The author describes the scientific achievements made with SLAC's electron beams and their context in current thinking. This talk covers the realization that the proton, far from being an indivisible particle, has a definite composite structure. (orig./HSI).

  9. A decade of colliding proton beams

    International Nuclear Information System (INIS)

    Anon.

    1981-01-01

    A description is given of the history of the CERN ISR. After the description of the performance including the application of superconducting magnets the physics studied with this storage ring are considered. (HSI).

  10. 12th international conference on elastic and diffractive scattering forward physics and QCD. Proceedings

    International Nuclear Information System (INIS)

    Bartels, J.; Borras, K.; Diehl, M.; Jung, H.

    2007-12-01

    The following topics are dealt with: Lepton-proton collisions, pp and anti pp collisions, heavy ion collisions, opportunities at future colliders, cosmic rays and astropoarticle physics, theoretical developments in high-energy QCD. (HSI)

  11. 12th international conference on elastic and diffractive scattering forward physics and QCD. Proceedings

    Energy Technology Data Exchange (ETDEWEB)

    Bartels, J; Borras, K; Diehl, M; Jung, H [eds.

    2007-12-15

    The following topics are dealt with: Lepton-proton collisions, pp and anti pp collisions, heavy ion collisions, opportunities at future colliders, cosmic rays and astropoarticle physics, theoretical developments in high-energy QCD. (HSI)

  12. Hyperspectral Image Classification Using Kernel Fukunaga-Koontz Transform

    Directory of Open Access Journals (Sweden)

    Semih Dinç

    2013-01-01

    images. In experiment section, the improved performance of HSI classification technique, K-FKT, has been tested comparing other methods such as the classical FKT and three types of support vector machines (SVMs.

  13. Exact renormalization group as a scheme for calculations

    International Nuclear Information System (INIS)

    Mack, G.

    1985-10-01

    In this lecture I report on recent work to use exact renormalization group methods to construct a scheme for calculations in quantum field theory and classical statistical mechanics on the continuum. (orig./HSI)

  14. Dibaryon resonances in photon induced reactions

    International Nuclear Information System (INIS)

    Schwille, W.J.

    1981-11-01

    The author gives a review about the production of dibaryon resonances in photon reactions on deuterium targets. Especially he considers the reactions γ + d → p + n, γ + d → p + X, and γ + d → p + N + π. (HSI)

  15. Guide to distribution network planning and system design. Development of decentralized electricity systems; Leitfaden zur Verteilnetzplanung und Systemgestaltung. Entwicklung dezentraler Elektrizitaetssysteme

    Energy Technology Data Exchange (ETDEWEB)

    Sillaber, Alfons

    2016-07-01

    The following topics are dealt with: Meet demand, robustness, economics, supply reliability, facility structures, transport capacity, voltage management, short-circuit management, net operation, planning techniques and systematics. (HSI)

  16. Experiments at CERN in 1981

    International Nuclear Information System (INIS)

    1981-08-01

    This report contains the preliminary abstracts of the current experiments at the CERN SPS synchrotron, the anti p colliding beams, the CERN ISR, the CERN PS synchrotron, and the CERN synchrocyclotron. See hints under the relevant topics. (HSI)

  17. GSI Scientific Report 2003

    Energy Technology Data Exchange (ETDEWEB)

    Grundinger, U [ed.

    2004-05-01

    The following topics are dealt with: Nuclear heavy ion physics, atomic physics with heavy ions, heavy ion research in other fields, accelerator experiments and developments, instruments and methods, the international FAIR project. (HSI)

  18. 363. WE-Heraeus seminar on neutron stars and pulsars - 40 years after the discovery. Posters and contributed talks

    International Nuclear Information System (INIS)

    Becker, W.; Huang, H.H.

    2007-01-01

    The following topics were dealt with: X-ray observation of pulsars, gamma-ray observation of pulsars, radio observations of pulsars, theory of neutron stars and pulsars, AXPs, SGRs, and strange stars, gravitayional waves, analysis tools with software. (HSI)

  19. The international linear collider. Technical design report. Vol. 4. Detectors

    Energy Technology Data Exchange (ETDEWEB)

    Behnke, Ties; Brau, James E.; Burrows, Philip; Fuster, Juan; Peskin, Michael; Stanitzki, Marcel; Sugimoto, Yasuhiro; Yamada, Sakue; Yamamoto, Hitoshi [eds.

    2013-10-01

    The following topics are dealt with: The Si Vertex detectors, the main tracker, calorimetry, muon detectors, the superconducting spectrometer magnet, the detector electronics and data acquisition, simulation and reconstruction, benchmarking, costs. (HSI)

  20. Subnuclear degrees of freedom in the nucleus

    International Nuclear Information System (INIS)

    Krewald, S.

    1985-03-01

    The aim of the present thesis is to study the possible influence of subnuclear degrees of freedom as the Δ 33 -resonance and relativistic effects on the structure of nuclear excited states. (orig./HSI) [de

  1. The CAMAC instrumentation for monitoring and control of the VICKSI accelerators

    International Nuclear Information System (INIS)

    Busse, W.; Kluge, H.; Bosch, A.; Herdam, G.; Klessmann, H.; Martini, M.; Wawer, W.

    1977-12-01

    After a general introduction the CAMAC system units and the CAMAC modules for interfacing pheripheral devices are described. Then the test equipment for these devices is described. Finally some special peripherals and auxiliary equipments are described. (HSI)

  2. Crystal Ball contributions to the 9th international workshop on photon-photon collisions, La Jolla, 23-26 March 1992

    International Nuclear Information System (INIS)

    Bienlein, J.K.

    1992-06-01

    This report contains two articles concerning new Crystal Ball data on resonance formation by γγ collisions and the representation of such results by helicity amplitudes. See hints under the relevant topics. (HSI)

  3. New Stanford collider starts at Z

    International Nuclear Information System (INIS)

    Anon.

    1989-01-01

    On 11 April the new SLC Stanford Linear Collider created its first Z particle, inaugurating high energy physics research at this novel machine based on the two-mile linac at the Stanford Linear Accelerator Centre, SLAC. (orig./HSI).

  4. Guide to distribution network planning and system design. Development of decentralized electricity systems

    International Nuclear Information System (INIS)

    Sillaber, Alfons

    2016-01-01

    The following topics are dealt with: Meet demand, robustness, economics, supply reliability, facility structures, transport capacity, voltage management, short-circuit management, net operation, planning techniques and systematics. (HSI)

  5. Hahn-Meitner-Institut Berlin, Ionenstrahllabor. Annual report 2003

    International Nuclear Information System (INIS)

    Bertschrat, H.H.; Roehrich, J.; Schiwietz, G.

    2004-01-01

    The following topics are dealt with: Material structure and dynamics, materials analysis, applications of ion beams in fabrications, nuclear physics, accelerator operations and technical developments, eye tumor therapy. (HSI)

  6. Hahn-Meitner-Institut Berlin, Ionenstrahllabor. Annual report 2003

    Energy Technology Data Exchange (ETDEWEB)

    Bertschrat, H H; Roehrich, J; Schiwietz, G

    2004-07-01

    The following topics are dealt with: Material structure and dynamics, materials analysis, applications of ion beams in fabrications, nuclear physics, accelerator operations and technical developments, eye tumor therapy. (HSI)

  7. Preparing for 1000 GeV physics at Fermilab

    International Nuclear Information System (INIS)

    Anon.

    1980-01-01

    The superconducting proton beams and the neutrino beams at Fermilab prepared for the research with 1000 GeV colliding proton and antiproton beams are described. Especially a new developed helium transfer line is described. (HSI).

  8. Gross properties of nuclei and nuclear excitations XXI

    International Nuclear Information System (INIS)

    Feldmeier, H.

    1993-01-01

    These proceedings contain the articles and contributed papers presented at the named workshop. They are concerned with highly excited nuclear matter and relativistic heavy ion reactions together with some related topics. See hints under the relevant topics. (HSI)

  9. Hirschegg '03: Nuclear structure and dynamics at the limits. Proceedings

    International Nuclear Information System (INIS)

    Feldmeier, H.; Knoll, J.; Noerenberg, W.; Wambach, J.

    2003-01-01

    The following topics were dealt with: Nuclear structure ans symmetries, nuclei near the drip line, halo nuclei and nuclear resonances, superheavy elements and fission, fragmentation and multifragmentation, nuclear astrophysics. (HSI)

  10. An Acquisition Approach to Adopting Human Systems Integration in the Railroad Industry

    Science.gov (United States)

    2018-02-01

    This report provides guidance on how the railroad industry can develop safer systems by acquiring new equipment based on human-centered design practices, or Human Systems Integration (HSI). If a railroads system design approach is focused on prope...

  11. The goal of theoretical physics. Pt. 2

    International Nuclear Information System (INIS)

    Anon.

    1981-01-01

    The author describes the inclusion of gravitational interactions into the concept of unified gauge theories. In this framework he discusses quantum black holes. Furthermore, he introduces the concept of supergravity. (HSI).

  12. To argumentate in quantum physics. Instruction-specific argumentation aids; Argumentieren in der Quantenphysik. Unterrichtsspezifische Argumentationshilfen

    Energy Technology Data Exchange (ETDEWEB)

    Friege, Gunnar; Scholz, Ruediger (eds.)

    2017-07-01

    In this book aids for the instruction of quantum physics are described. Especially considered are the conception of the photon, quantum interference, entanglement, the photoelectric effect, and coincidence experiments. (HSI)

  13. From the depths of the universe to the microcosm. An expedition through modern physics; Von den Tiefen des Alls in den Mikrokosmos. Ein Streifzug durch die moderne Physik

    Energy Technology Data Exchange (ETDEWEB)

    Povh, Bogdan [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany)

    2017-02-01

    The following topics are dealt with: Gravitation from the beginning of astronomy until dark energy, atoms from indivisible balls until quantum-mechanical systems, atomic nuclei, the earth planet, quarks and leptons, the expanding universe. (HSI)

  14. Systematic studies on the reconstruction efficiency and accuracy of a track drift chamber

    International Nuclear Information System (INIS)

    Appelshaeuser, H.

    1993-02-01

    The author has studied the reconstruction efficiency of the NA35-TPC by means of a simulation of the tracks by means of laser radiation. He has obtained results on the diffusion constant and the track resolution. (HSI) [de

  15. Phase space quantum mechanics and maximal acceleration

    International Nuclear Information System (INIS)

    Caianiello, E.

    1989-01-01

    My presentation is a synopsis of work done since 1979 in search of connections among information theory, systems theory, quantum mechanics and other matters. The aim was 'to extract geometry from quantum mechanics'. (orig./HSI)

  16. Berkeley research program on ion induction linacs for inertial fusion

    International Nuclear Information System (INIS)

    Keefe, D.; Rosenblum, S.S.

    1982-01-01

    Currently under study, is a driver example that relies on exactly sixteen beams from start to finish, and avoids the extra dilution that inevitably accompanies either beam-merging or beam-splitting. (orig./HSI)

  17. Hyperspectral Imaging and SPA-LDA Quantitative Analysis for Detection of Colon Cancer Tissue

    Science.gov (United States)

    Yuan, X.; Zhang, D.; Wang, Ch.; Dai, B.; Zhao, M.; Li, B.

    2018-05-01

    Hyperspectral imaging (HSI) has been demonstrated to provide a rapid, precise, and noninvasive method for cancer detection. However, because HSI contains many data, quantitative analysis is often necessary to distill information useful for distinguishing cancerous from normal tissue. To demonstrate that HSI with our proposed algorithm can make this distinction, we built a Vis-NIR HSI setup and made many spectral images of colon tissues, and then used a successive projection algorithm (SPA) to analyze the hyperspectral image data of the tissues. This was used to build an identification model based on linear discrimination analysis (LDA) using the relative reflectance values of the effective wavelengths. Other tissues were used as a prediction set to verify the reliability of the identification model. The results suggest that Vis-NIR hyperspectral images, together with the spectroscopic classification method, provide a new approach for reliable and safe diagnosis of colon cancer and could lead to advances in cancer diagnosis generally.

  18. Hydrophobically Modified siRNAs Silence Huntingtin mRNA in Primary Neurons and Mouse Brain

    Directory of Open Access Journals (Sweden)

    Julia F Alterman

    2015-01-01

    Full Text Available Applications of RNA interference for neuroscience research have been limited by a lack of simple and efficient methods to deliver oligonucleotides to primary neurons in culture and to the brain. Here, we show that primary neurons rapidly internalize hydrophobically modified siRNAs (hsiRNAs added directly to the culture medium without lipid formulation. We identify functional hsiRNAs targeting the mRNA of huntingtin, the mutation of which is responsible for Huntington's disease, and show that direct uptake in neurons induces potent and specific silencing in vitro. Moreover, a single injection of unformulated hsiRNA into mouse brain silences Htt mRNA with minimal neuronal toxicity. Thus, hsiRNAs embody a class of therapeutic oligonucleotides that enable simple and straightforward functional studies of genes involved in neuronal biology and neurodegenerative disorders in a native biological context.

  19. Annual report 1980

    International Nuclear Information System (INIS)

    1981-01-01

    This annual report contains a description of the named institute, the research programm, reports from the scientific establishments, a description of different cooperations, and a list of scientific publications. (HSI) [de

  20. 34. annual meeting of GUS 2005 on detection, simulation and evaluation of environmental impacts. Proceedings; 34. Jahrestagung der GUS 2005 'Umwelteinfluesse erfassen, simulieren, bewerten'. Tagungsband

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-07-01

    These proceedings contain the articles presented at the named conference. These concern foundations for the simulation of environment, functional behaviour and reliability of equipment and components, weather and thermal influences, and ways to the numerical simulation of environment. (HSI)

  1. Gross properties of nuclei and nuclear excitations

    International Nuclear Information System (INIS)

    Feldmeier, H.

    1989-01-01

    These proceedings contain the articles presented at the named workshop. These concern new developments in nuclear structure studies, relativistic heavy ion reactions, and advanced techniques for nuclear spectroscopy. (HSI)

  2. BENSC experimental reports 2003

    International Nuclear Information System (INIS)

    Kirschbaum, Y.; Tovar, M.; Bischoff, D.; Michaelsen, R.

    2004-04-01

    The following topics are dealt with: Magnetic structure and phase transitions, magnetic thin films, chemical structure, structural excitations, soft matter, biology, material science and industrial applications, development of instruments and methods, fundamental physics. (HSI)

  3. Compositeness: The supercollider frontier

    International Nuclear Information System (INIS)

    Peccei, R.D.

    1984-01-01

    In this report I discuss some of the reasons which point towards this 'nearby compositeness', and examine some of the physical phenomena that are connected with substructure which could be explored at a Supercollider. (orig./HSI)

  4. Proceedings of the 4th Patras workshop on axions, WIMPs and WISPs

    Energy Technology Data Exchange (ETDEWEB)

    Lindner, Axel; Redondo, Javier; Ringwald, Andreas [eds.

    2008-08-15

    The following topics were dealt with: Physical foundations for WIMPs, axions, and WISPS, signals from astrophysical sources, direct searches for dark matter WIMPs, new theoretical developments, new experimental approaches. (HSI)

  5. Proceedings of the 4th Patras workshop on axions, WIMPs and WISPs

    International Nuclear Information System (INIS)

    Lindner, Axel; Redondo, Javier; Ringwald, Andreas

    2008-08-01

    The following topics were dealt with: Physical foundations for WIMPs, axions, and WISPS, signals from astrophysical sources, direct searches for dark matter WIMPs, new theoretical developments, new experimental approaches. (HSI)

  6. Lise Meitner; Lise Meitner

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2014-11-15

    This paper is a collection of articles concerning the biography of Lise Meitner with special regards to her cooperation with Otto Hahn in the discovery of nuclear fission, whereby the role of women in science, especially physics, are considered. (HSI)

  7. Recent applications of hyperspectral imaging in microbiology.

    Science.gov (United States)

    Gowen, Aoife A; Feng, Yaoze; Gaston, Edurne; Valdramidis, Vasilis

    2015-05-01

    Hyperspectral chemical imaging (HSI) is a broad term encompassing spatially resolved spectral data obtained through a variety of modalities (e.g. Raman scattering, Fourier transform infrared microscopy, fluorescence and near-infrared chemical imaging). It goes beyond the capabilities of conventional imaging and spectroscopy by obtaining spatially resolved spectra from objects at spatial resolutions varying from the level of single cells up to macroscopic objects (e.g. foods). In tandem with recent developments in instrumentation and sampling protocols, applications of HSI in microbiology have increased rapidly. This article gives a brief overview of the fundamentals of HSI and a comprehensive review of applications of HSI in microbiology over the past 10 years. Technical challenges and future perspectives for these techniques are also discussed. Copyright © 2015 Elsevier B.V. All rights reserved.

  8. Symmetries in physics and harmonics

    International Nuclear Information System (INIS)

    Kolk, D.

    2006-01-01

    In this book the symmetries of elementary particles are described in relation to the rules of harmonics in music. The selection rules are described in connections with harmonic intervals. Also symmetry breaking is considered in this framework. (HSI)

  9. Symmetries in physics and harmonics; Symmetrien in Physik und Harmonik

    Energy Technology Data Exchange (ETDEWEB)

    Kolk, D.

    2006-07-01

    In this book the symmetries of elementary particles are described in relation to the rules of harmonics in music. The selection rules are described in connections with harmonic intervals. Also symmetry breaking is considered in this framework. (HSI)

  10. States, ideals and automorphisms of the algebra of test functions for quantum fields

    International Nuclear Information System (INIS)

    Yngvason, J.

    1984-01-01

    I report on two subjects: 1. Construction of positive, linear functionals on Borcher's tensor algebra satisfying parts of the linear Wightman conditions, and 2. a criterion for the existence of Euclidean invariant integral representations for Schwinger functionals. (orig./HSI)

  11. Spin in hadron physics

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2006-07-01

    The following topics were ealt with: Hadron physics with proton and deuteron probes, physics projects with Georgian participation, spin physics with antiprotons and leptons, spin filtering experiments, ISTC projects, technical issues for FAIR. (HSI)

  12. The discovery of 'heavy light'

    International Nuclear Information System (INIS)

    Anon.

    1983-01-01

    The history of the discoveries of fundamental quanta is described starting from Maxwell's theory of electromagnetism up to the development of a theory of weak interaction and the detection of the W and Z bosons. (HSI).

  13. 6th Patras workshop on axions, WIMPs and WISPs (PATRAS 2010). Proceedings

    Energy Technology Data Exchange (ETDEWEB)

    Baudis, Laura; Schumann, Marc (eds.)

    2010-11-15

    The following topics were dealt with: Axions, WIMPs, WISPs, and neutrinos in the universe, laboratory experimental searching for WISPs, astrophysical experimental searching for WISPs, direct and indirect detection of WIMPs, new ideas and developments, visions, large laboratories. (HSI)

  14. Manifold learning based feature extraction for classification of hyperspectral data

    CSIR Research Space (South Africa)

    Lunga, D

    2014-01-01

    Full Text Available in analysis of hyperspectral imagery. High spectral resolution and the typically continuous bands of hyperspectral image (HSI) data enable discrimination between spectrally similar targets of interest, provide capability to estimate within pixel abundances...

  15. 363. WE-Heraeus seminar on neutron stars and pulsars - 40 years after the discovery. Posters and contributed talks

    Energy Technology Data Exchange (ETDEWEB)

    Becker, W; Huang, H H [eds.

    2007-07-01

    The following topics were dealt with: X-ray observation of pulsars, gamma-ray observation of pulsars, radio observations of pulsars, theory of neutron stars and pulsars, AXPs, SGRs, and strange stars, gravitayional waves, analysis tools with software. (HSI)

  16. Submission under the United Nations framework convention on climate change and the Kyoto protocol 2013. National inventory report for the German greenhouse gas inventory 1990-2011; Berichterstattung unter der Klimarahmenkonvention der Vereinten Nationen und dem Kyoto-Protokoll 2013. Nationaler Inventarbericht zum Deutschen Treibhausgasinventar 1990-2011

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2013-05-15

    The following topics are dealt with: Trends of the greenhouse gases, energy production, industrial processes, solvents and other product application, agriculture, land usage and forestry, wastes and sewage. (HSI)

  17. Physikalisch-Technische Bundesanstalt (PTB). Annual report 2016; Physikalisch-Technische Bundesanstalt (PTB). Jahresbericht 2016

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2017-03-15

    The following topics are dealt with: Quality management, legal metrology, technology transfer, technical cooperation, mechanics and acoustics, chemical physics and explosion protection, optics, manufacturing measurement techniques, ionizing radiation, temperature and synchrotron radiation, medical physics and metrological information techniques. (HSI)

  18. Applications of neutron scattering in molecular biological research

    International Nuclear Information System (INIS)

    Nierhaus, K.H.

    1984-01-01

    The study of the molecular structure of biological materials by neutron scattering is described. As example the results of the study of the components of a ribosome of Escherichia coli are presented. (HSI) [de

  19. Equilibrium and stability of high-β plasmas in W7-AS

    International Nuclear Information System (INIS)

    Geiger, J.; Weller, A.; Nuehrenberg, C.; Werner, A.; Zarnstorff, M.; Kolesnichenko, Ya.I.

    2003-01-01

    In this paper the optimization of equilibrium and stability of high-β plasmas by means of the reduction of the Pfirsch-Schlueter currents is described. Furthermore the Alfven modes driven by neutral-beam injection are considered. (HSI)

  20. Darmstadt Linear Accelerator (DALINAC) Research Laboratory. Status report - July 1988

    International Nuclear Information System (INIS)

    Anon.

    1988-07-01

    The status of the DALINAC project is reviewed. The accelerator and the experimental facilities are described, and a free-electron laser project is considered. Furthermore, experiments on inelastic electron scattering on nuclei and atomic systems are listed. (HSI)

  1. The international linear collider. Technical design report. Vol. 1. Executive summary

    Energy Technology Data Exchange (ETDEWEB)

    Behnke, Ties; Brau, James E.; Foster, Brian; Fuster, Juan; Harrison, Mike; McEwan Paterson, James; Peskin, Michael; Stanitzki, Marcel; Walker, Nicholas; Yamamoto, Hitoshi (eds.)

    2013-07-01

    A review is given about the planned International Linear Collider. Especially described are the technical design, the accelerator layout and design, the R and D during the technical design phase, and the detectors. (HSI)

  2. Proceedings of the 38th international symposium on multiparticle dynamics ISMD08

    Energy Technology Data Exchange (ETDEWEB)

    Bartels, Jochen [Hamburg Univ. (Germany); Borras, Kerstin; Jung, Hannes; Kutak, Krzysztof; Levonian, Sergey; Mnich, Joachim (eds.) [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany); Gustafson, Goesta [Hamburg Univ. (Germany); Lund Univ. (Sweden)

    2009-01-15

    The following topics are dealt with: Multiple production in particle production, high-energy heavy ion reactions, QCD calculations, search for new physics at the LHC, recent theoretical developments. (HSI)

  3. Theory of elementary particles. Proceedings

    International Nuclear Information System (INIS)

    Luest, D.; Weigt, G.

    1994-03-01

    These proceedings contain most of the invited talks ans short communications presented at the named symposium. These concern developments in field theory in connection with string models, grand unification, and quantum gravity. See hints under the relevant topics. (HSI)

  4. Preparation of a bent crystal and its use in neutron scattering

    International Nuclear Information System (INIS)

    Kraxenberger, H.

    1980-01-01

    The aim of this thesis was the construction of a horizontally bendable neutron monochromator e.g. analyzator, the application to different measuring problem in neutron scattering, and the development of an exact theory. (HSI) [de

  5. Piecing together a theory

    International Nuclear Information System (INIS)

    Anon.

    1983-01-01

    The development of the unified theory of weak and electromagnetic interactions by Weinberg, Salam, and Glashow is described. In this connection the postulation of charmed particles is considered. (HSI).

  6. Universal hadron behaviour

    International Nuclear Information System (INIS)

    Anon.

    1983-01-01

    By means of dispersion relations the total cross sections of πp and pp interactions were extrapolated to energies above 1000 GeV using experimental data obtained from an experiment at the CERN SPS machine. (HSI).

  7. Study on the construction of a combined cooler-synchroton ring at the KFA Juelich (COSY study)

    International Nuclear Information System (INIS)

    Gaul, G.; Hagedoorn, H.; Heide, J.A. van der; Hinterberger, F.; Huber, M.; Jahn, R.; Mayer-Kuckuk, T.; Paetz genannt Schieck, H.; Berg, G.; Hardt, A.; Martin, S.; Osterfeld, F.; Prasuhn, D.; Riepe, G.; Rogge, M.; Rossen, P. von; Schult, O.W.B.; Speth, J.; Turek, P.

    1984-02-01

    The project of a storage ring for the extension of the nuclear physics research facilities at the KFA Juelich is presented. Together with the construction of the ring the possibilities for physical research are described. (HSI) [de

  8. Experimental studies on the photoemission of gallium arsenide crystals

    International Nuclear Information System (INIS)

    Westermann, M.

    2003-04-01

    In this thesis the study influence of residual gases on the lifetime, the temperature dependence of the quantum yield, and the influence of activation with potassium on both effects for GaAs-photocathodes is described. (HSI)

  9. HMI Section of Nuclear and Radiation Physics - annual report 1985

    International Nuclear Information System (INIS)

    1986-01-01

    This annual report contains extended abstracts about the work performed at the named institute concerning theoretical physics, nuclear reactions, hyperfine structure, atomic collisions, and developments of the VICKSI accelerator together with a list of publications and talks. (HSI) [de

  10. BENSC experimental reports 2006

    International Nuclear Information System (INIS)

    Stahnke, U.; Brandt, A.; Graf, H.A.

    2007-04-01

    The following topics are dealt with: Development of instruments and methods, magnetic structure and phase transitions, magnetic excitations, chemical structure, structural excitations, geological materials, biological materials, soft matter, nanostructures, strain and stresses, cultural heritage, fundamental physics. (HSI)

  11. Physikalisch-Technische Bundesanstalt (PTB). Annual report 2006

    International Nuclear Information System (INIS)

    2007-03-01

    The following topics are dealt with: Mechanics and acoustics, electricity, chemical physics and explosion protection, optics, manufacturing measureing techniques, ionizing radiation, temperature and synchrotron radiation, medical physics and metrological information techniques, the German calibration service, quality management. (HSI)

  12. Proceedings of the workshop on neutron scattering instrumentation for SNQ

    International Nuclear Information System (INIS)

    Scherm, R.; Stiller, H.

    1984-10-01

    These proceedings contain the articles presented at the named workshop. These concern instrumentation for neutron diffraction with special regards to small angle scattering, diffuse scattering, inelastic scattering, high resolution spectroscopy, and special techniques. (HSI)

  13. Angular correlations of coincident electron-positron pairs in heavy ion collisions

    International Nuclear Information System (INIS)

    Graf, O.

    1988-10-01

    In the present thesis angular correlations of coincident electron-positron pairsnin heavy ion collisions are studied. It is meant as a contribution to the answer of fundamental questions in the quantum electrodynamics of strong fields. (orig./HSI) [de

  14. Measurement of charm and beauty production in deep inelastic scattering at HERA using semi-leptonic decays into muons

    International Nuclear Information System (INIS)

    Bindi, Marcello

    2008-10-01

    In this thesis the experimental study of the process ep→ec anti cX at HERA is described. The differential cross sections in dependence on the transverse momentum and rapidity of the decay muon are presented. (HSI)

  15. Scientific annual report 1980

    International Nuclear Information System (INIS)

    1981-01-01

    This annual report contains a collection of the abstracts of the publications concerning research and development in the named institute together with a bibliography about further publications, contributions to conferences and speeches. (HSI) [de

  16. ELSA electron stretcher devices

    International Nuclear Information System (INIS)

    1979-10-01

    The use of an electron stretcher ring at the Bonn electron synchrotron is discussed. The construction of the proposed ring is described, and the costs are estimated. Possible experiments using this ring are discussed. (HSI)

  17. 75 FR 49484 - Office of Postsecondary Education; Asian American and Native American Pacific Islander-Serving...

    Science.gov (United States)

    2010-08-13

    ... DEPARTMENT OF EDUCATION Office of Postsecondary Education; Asian American and Native American Pacific Islander-Serving Institutions (AANAPISI), Native American-Serving Nontribal Institutions (NASNTI), Hispanic Serving Institutions-STEM and Articulation (HSI-STEM), and Predominantly Black Institutions (PBI...

  18. Feynman and physics. Life and research of an exceptional man; Feynman und die Physik. Leben und Forschung eines aussergewoehnlichen Menschen

    Energy Technology Data Exchange (ETDEWEB)

    Resag, Joerg

    2018-04-01

    The life of Feynman is described together with his work on path integrals, quantum electrodynmaics, helium at low temperatures, the weak interaction, the quark model, and computer-calculation methods, and his contribution to the Manhattan project. (HSI)

  19. Metrology with synchrotron radiation. A short introduction; Metrologie mit Synchrotronstrahlung. Eine kurze Einfuehrung

    Energy Technology Data Exchange (ETDEWEB)

    Richter, Mathias [Physikalisch-Technische Bundesanstalt (PTB), Berlin (Germany). Fachbereich ' Radiometrie mit Synchrotronstrahlung' ; Ulm, Gerhard

    2014-09-15

    The beam tubes and measuring places at the Metrology Light Source and BESSY II are listed together with their monochromator types, spectral ranges, spectral resolution powers, photon fluxes, beam sizes, and divergences. (HSI)

  20. Radiometry for the EUV lithography; Radiometrie fuer die EUV-Lithographie

    Energy Technology Data Exchange (ETDEWEB)

    Scholze, Frank [Physikalisch-Technische Bundesanstalt (PTB), Berlin (Germany). Arbeitsgruppe ' EUV-Radiometrie' ; Laubis, Christian; Barboutis, Annett; Buchholz, Christian; Fischer, Andreas; Puls, Jana; Stadelhoff, Christian

    2014-12-15

    The EUV reflectrometry at the PTB storage BESSY I and BESSY II is described. Results on the reflectivities of some EUV mirrors are presented. Finally the spectral sensitivities of different photodiodes used as EUV detectors are presented. (HSI)

  1. Metrology for environment and climate; Metrologie fuer Umwelt und Klima

    Energy Technology Data Exchange (ETDEWEB)

    Sommer, Klaus-Dieter [Physikalisch-Technische Bundesanstalt (PTB), Braunschweig (Germany). Abt. ' Chemische Physik und Explosionsschutz' ; Spitzer, Petra [Physikalisch-Technische Bundesanstalt (PTB), Braunschweig (Germany). Arbeitsgruppe ' Elektrochemie'

    2012-12-15

    The author describes the observation and monitoring systems developed by the EU and the Federal Republic of Germany. In this connection the metrological aims are described in connection with the activities of the PTB. (HSI)

  2. Metrology for the persevering production, distribution, and usage of energy; Metrologie fuer die nachhaltige Erzeugung, Verteilung und Nutzung von Energie

    Energy Technology Data Exchange (ETDEWEB)

    Sommer, Klaus-Dieter [Physikalisch-Technische Bundesanstalt (PTB), Braunschweig (Germany). Abt. ' Chemische Physik und Explosionsschutz'

    2012-12-15

    The author describes the metrological challenges given by the necessarily effective production, transport, distribution, consumption, conservation, and storage of energy, the latter is considered in connection with mobility. Finally the activities of the PTB in this connection are listed. (HSI)

  3. 6th Patras workshop on axions, WIMPs and WISPs (PATRAS 2010). Proceedings

    International Nuclear Information System (INIS)

    Baudis, Laura; Schumann, Marc

    2010-11-01

    The following topics were dealt with: Axions, WIMPs, WISPs, and neutrinos in the universe, laboratory experimental searching for WISPs, astrophysical experimental searching for WISPs, direct and indirect detection of WIMPs, new ideas and developments, visions, large laboratories. (HSI)

  4. Old soldiers

    International Nuclear Information System (INIS)

    Riordan, M.

    1987-01-01

    The author describes the history of the spectrometer installed at the SLAC 20-GeV-linac and its use from the study of the electroproduction of resonances to the study of the EMC effect with electrons. (HSI).

  5. Detector trends

    International Nuclear Information System (INIS)

    Charpak, G.

    1986-01-01

    The author describes briefly the development of detectors for high energy physics experiments. Especially considered are semiconductor microstrip detectors, drift tubes, holographic bubble chambers, scintillating fiber optics, and calorimeters. (HSI).

  6. Understanding modern physics by symmetry. A new approach to the fundamental theories; Durch Symmetrie die moderne Physik verstehen. Ein neuer Zugang zu den fundamentalen Theorien

    Energy Technology Data Exchange (ETDEWEB)

    Schwichtenberg, Jakob

    2017-09-01

    The following topics are dealt with: Special relativity theory, theory of Lie groups, the Lagrang formalism for field theories, quantum operators, quantum wave equations, the theory of interactions, quantum mechanics, quantum field theory, classical mechanics, electrodynamics. (HSI)

  7. Report on R + D activities in 1981

    International Nuclear Information System (INIS)

    1982-02-01

    A review is given about the work done at the named Institute. This concerns tokamak magnets, components of fusion reactors, magnets for research and development, foundations of superconductivity and cryotechnique. Furthermore, a list of publications is added. (HSI) [de

  8. The international linear collider. Technical design report. Vol. 1. Executive summary

    International Nuclear Information System (INIS)

    Behnke, Ties; Brau, James E.; Foster, Brian; Fuster, Juan; Harrison, Mike; McEwan Paterson, James; Peskin, Michael; Stanitzki, Marcel; Walker, Nicholas; Yamamoto, Hitoshi

    2013-01-01

    A review is given about the planned International Linear Collider. Especially described are the technical design, the accelerator layout and design, the R and D during the technical design phase, and the detectors. (HSI)

  9. The interplay of theory and experiment

    International Nuclear Information System (INIS)

    Jacob, M.

    1987-01-01

    The author reviews the interplay between theory and experiment in the development of the physics of elementary particles and gives an outlook on the possibilities of the new accelerators to study the yet unexplained phenomena of particle physics. (HSI).

  10. A gas monitoring facility with a quadrupole mass spectrometer for the ZEUS transition-radiation chambers

    International Nuclear Information System (INIS)

    Kapp, U.

    1988-07-01

    A gas analysis facility for the ZEUS transition-radiation chambers based on a quadrupole mass spectrometer is described. After a description of the spectrometer, the vacuum system, and the software, some test results are presented. (HSI)

  11. Josephson technology

    International Nuclear Information System (INIS)

    Drangeid, K.E.

    1983-01-01

    The author presents an introduction to Josephson junctions. After an introduction to the physical principles of superconductivity and the Josephson effect some applications are described with special regards to the implementation in digital circuits. (HSI)

  12. Human-system interface for CAREM nuclear reactor

    International Nuclear Information System (INIS)

    Abaurre, Norberto F.; Flury, Celso A.; Pierini, Juan P.; Etchepareborda, Andres; Breitembuecher, Alfredo J.; Lema, Fabian M.

    2009-01-01

    Associated with activities to be developed by our working group on the construction of the reactor training simulator for the CAREM, we have planned the design of human-system interface (HSI) of the main control room. The goal of this study is to describe the planning and methodology used for the HSI interface design. The products of this process are the layout specifications of the Control Room and the screens specifications for control software. (author)

  13. Software Independent Verification and Validation (SIV&V) Simplified

    Science.gov (United States)

    2006-12-01

    Midcourse Defense GOTS Government-Off-The-Shelf GSAM General Service Administration Acquisition Manual GTE General Telephone and Electronics GUI...Graphical User Interfaces HSI Hardware and Software Integration HSI Human Systems Integration HTP Hardware Test Plan HWCI Hardware...requirements are extracted and traced to the developer’s Software and Hardware Test Plans (STP and HTP ). This ensures adequacy of the test plans and also

  14. Wallerian degeneration of the corticodescending tract in the cerebral peduncle following a supratentorial cerebrovascular lesion detected by MRI; The relationship between Wallerian degeneration at the center of the cerebral peduncle and functional recovery of paresis

    Energy Technology Data Exchange (ETDEWEB)

    Waragai, Masaaki; Iwabuchi, Sadamu (Nanasawa Rehabilitation Hospital, Kanagawa (Japan))

    1993-11-01

    We studied Wallerian degeneration of the corticodescending tract in the cerebral peduncle following a supratentorial cerebrovascular lesion by MRI. A total of 57 patients with palsy following a supratenotorial cerebrovascular lesion were prospectively studied. Wallerian degeneration was detected as a high signal intensity (HSI) in 37 patients between 70 days and 100 days after the onset, but not detected in the remaining 27 patients. Patient with as HSI in all areas of the cerebral peduncle had a large lesion involving the hemisphere. Patient with an HSI at the center of the cerebral peduncle had a lesion confined to the paracentral gyrus, precentral gyrus, corona radiata or posterior limb of the internal capsule. Patient with an HSI at the lateral side of the cerebral peduncle had a lesion of parietal lobe or temporal lobe which spares the corticospinal tract originating from the paracentral gyrus, precentral gyrus, corona radiata or posterior limb of the internal capsule. These findings suggest that as HSI at the center of the cerebral peduncle may reveal Wallerian degeneration of the corticospinal tract, and an HSI at the lateral side of the cerebral peduncle may show Wallerian degeneration of the corticopontine tract. The functional recovery of paresis was poor in all patients with an HSI at the center of the cerebral peduncle, while it was good in all patients without an HSI in that region. Our data suggested that somatotopical localization of the corticodescending tract in the cerebral peduncle may be identified by detecting Wallerian degeneration following a supratentorial lesion, and the functional recovery of patients with paresis could be predicted according to presence or absence of Wallerian degeneration at the center of the cerebral peduncle. (author).

  15. Habitat Suitability Index Models: Red-winged blackbird

    Science.gov (United States)

    Short, Henry L.

    1985-01-01

    A review and synthesis of existing information were used to develop a Habitat Suitability Index (HSI) model for the red-winged blackbird (Agelaius phoeniceus L.). The model consolidates habitat use information into a framework appropriate for field application, and is scaled to produce an index between 0.0 (unsuitable habitat) to 1.0 (optimum habitat). HSI models are designed to be used with Habitat Evaluation Procedures previously developed by the U.S. Fish and Wildlife Service.

  16. Habitat Suitability Index Models: Yellow-headed blackbird

    Science.gov (United States)

    Schroeder, Richard L.

    1982-01-01

    Habitat preferences of the yellow-headed blackbird (Xanthocephalus xanthocephalus) are described in this publication. It is one of a series of Habitat Suitability Index (HSI) models and was developed through an analysis of available infomration on the species-habitat requirements of the species. Habitat use information is presented in a review of the literature, followed by the development of an HSI model, designed for use in impact assessment and habitat management activities.

  17. Short biceps femoris fascicles and eccentric knee flexor weakness increase the risk of hamstring injury in elite football (soccer): a prospective cohort study.

    Science.gov (United States)

    Timmins, Ryan G; Bourne, Matthew N; Shield, Anthony J; Williams, Morgan D; Lorenzen, Christian; Opar, David A

    2016-12-01

    To investigate the role of eccentric knee flexor strength, between-limb imbalance and biceps femoris long head (BFlh) fascicle length on the risk of future hamstring strain injury (HSI). Elite soccer players (n=152) from eight different teams participated. Eccentric knee flexor strength during the Nordic hamstring exercise and BFlh fascicle length were assessed at the beginning of preseason. The occurrences of HSIs following this were recorded by the team medical staff. Relative risk (RR) was determined for univariate data, and logistic regression was employed for multivariate data. Twenty seven new HSIs were reported. Eccentric knee flexor strength below 337 N (RR=4.4; 95% CI 1.1 to 17.5) and possessing BFlh fascicles shorter than 10.56 cm (RR=4.1; 95% CI 1.9 to 8.7) significantly increased the risk of a HSI. Multivariate logistic regression revealed significant effects when combinations of age, history of HSI, eccentric knee flexor strength and BFlh fascicle length were explored. From these analyses the likelihood of a future HSI in older athletes or those with a HSI history was reduced if high levels of eccentric knee flexor strength and longer BFlh fascicles were present. The presence of short BFlh fascicles and low levels of eccentric knee flexor strength in elite soccer players increases the risk of future HSI. The greater risk of a future HSI in older players or those with a previous HSI is reduced when they have longer BFlh fascicles and high levels of eccentric strength. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/.

  18. Wallerian degeneration of the corticodescending tract in the cerebral peduncle following a supratentorial cerebrovascular lesion detected by MRI

    International Nuclear Information System (INIS)

    Waragai, Masaaki; Iwabuchi, Sadamu

    1993-01-01

    We studied Wallerian degeneration of the corticodescending tract in the cerebral peduncle following a supratentorial cerebrovascular lesion by MRI. A total of 57 patients with palsy following a supratenotorial cerebrovascular lesion were prospectively studied. Wallerian degeneration was detected as a high signal intensity (HSI) in 37 patients between 70 days and 100 days after the onset, but not detected in the remaining 27 patients. Patient with as HSI in all areas of the cerebral peduncle had a large lesion involving the hemisphere. Patient with an HSI at the center of the cerebral peduncle had a lesion confined to the paracentral gyrus, precentral gyrus, corona radiata or posterior limb of the internal capsule. Patient with an HSI at the lateral side of the cerebral peduncle had a lesion of parietal lobe or temporal lobe which spares the corticospinal tract originating from the paracentral gyrus, precentral gyrus, corona radiata or posterior limb of the internal capsule. These findings suggest that as HSI at the center of the cerebral peduncle may reveal Wallerian degeneration of the corticospinal tract, and an HSI at the lateral side of the cerebral peduncle may show Wallerian degeneration of the corticopontine tract. The functional recovery of paresis was poor in all patients with an HSI at the center of the cerebral peduncle, while it was good in all patients without an HSI in that region. Our data suggested that somatotopical localization of the corticodescending tract in the cerebral peduncle may be identified by detecting Wallerian degeneration following a supratentorial lesion, and the functional recovery of patients with paresis could be predicted according to presence or absence of Wallerian degeneration at the center of the cerebral peduncle. (author)

  19. Real-time, wide-area hyperspectral imaging sensors for standoff detection of explosives and chemical warfare agents

    Science.gov (United States)

    Gomer, Nathaniel R.; Tazik, Shawna; Gardner, Charles W.; Nelson, Matthew P.

    2017-05-01

    Hyperspectral imaging (HSI) is a valuable tool for the detection and analysis of targets located within complex backgrounds. HSI can detect threat materials on environmental surfaces, where the concentration of the target of interest is often very low and is typically found within complex scenery. Unfortunately, current generation HSI systems have size, weight, and power limitations that prohibit their use for field-portable and/or real-time applications. Current generation systems commonly provide an inefficient area search rate, require close proximity to the target for screening, and/or are not capable of making real-time measurements. ChemImage Sensor Systems (CISS) is developing a variety of real-time, wide-field hyperspectral imaging systems that utilize shortwave infrared (SWIR) absorption and Raman spectroscopy. SWIR HSI sensors provide wide-area imagery with at or near real time detection speeds. Raman HSI sensors are being developed to overcome two obstacles present in standard Raman detection systems: slow area search rate (due to small laser spot sizes) and lack of eye-safety. SWIR HSI sensors have been integrated into mobile, robot based platforms and handheld variants for the detection of explosives and chemical warfare agents (CWAs). In addition, the fusion of these two technologies into a single system has shown the feasibility of using both techniques concurrently to provide higher probability of detection and lower false alarm rates. This paper will provide background on Raman and SWIR HSI, discuss the applications for these techniques, and provide an overview of novel CISS HSI sensors focusing on sensor design and detection results.

  20. The diagnostic role of high-speed vocal fold vibratory imaging.

    Science.gov (United States)

    Mendelsohn, Abie H; Remacle, Marc; Courey, Mark S; Gerhard, Friedrich; Postma, Gregory N

    2013-09-01

    Although high-speed imaging (HSI) has been identified as a valuable tool in phonatory biomechanics research, to date, there have only been a selected number of reports investigating the clinical utility of HSI. We aim to elucidate the role of HSI in the diagnosis of the dysphonic patient. The video files from 28 consecutive dysphonic patients with concurrently acquired videostroboscopy and HSI were retrospectively collected. Stroboscopy video files were edited to include vibratory motion only. Videos were then anonymously and randomly presented to four academic laryngologists. Experts were asked to assign a single best diagnosis for each video file. Assigned diagnoses were then compared with treatment diagnoses conferred based on medical history, phonatory evaluation, laryngeal examination, and response to treatment. Interrater analysis for the four laryngologists demonstrated significant and meaningful correlations for the diagnoses of polyps, cysts, nodules, and normal examination using stroboscopy (kappa > 0.40, P 0.40, P diagnostic accuracy above stroboscopy alone. Although specific laryngeal states such as presbyphonia may be better diagnosed with HSI, further studies are required to define HSI's precise role in the clinical setting. Copyright © 2013 The Voice Foundation. All rights reserved.

  1. The use of biomarkers for assessing effects of pollutant stress on fish species from a tropical river in Southeastern Brazil

    Directory of Open Access Journals (Sweden)

    Claudio Nona Morado

    2017-11-01

    Full Text Available Biomarkers are measurements within an organism that respond to environmental effects and are used as tools in bioassessment programs since they reflect physiological changes induced by exposure to pollutants. The hepatosomatic index (HSI and the condition factor (CF in three fish species Geophagus brasiliensis, Hypostomus affinis and Hypostomus auroguttatus were used to assess effects of pollutant stress in a tropical river during two seasons (dry and wet. Fish from the least disturbed sites had the lowest condition factor (CF and the lowest HSI, whereas those from sites near pollutant discharges had the highest CF and HSI. Higher HSI and lower CF occurred during the dry season. It is suggested that species adapted to stressful conditions take advantage on food availability from organic loads or unoccupied niches by lesser tolerant species, increasing CF. We concluded that higher HSI values were directly associated with environmental stress whereas the higher CF values are related to availability of food resources derived from organic loads or other sources. CF and HSI are simple and cost-effective, thus suitable as routine screening tools in pollution monitoring, but caution should be taken in relating changes in physiological measurements and any specific pollutant to prevent misinterpretation.

  2. Generative Adversarial Networks-Based Semi-Supervised Learning for Hyperspectral Image Classification

    Directory of Open Access Journals (Sweden)

    Zhi He

    2017-10-01

    Full Text Available Classification of hyperspectral image (HSI is an important research topic in the remote sensing community. Significant efforts (e.g., deep learning have been concentrated on this task. However, it is still an open issue to classify the high-dimensional HSI with a limited number of training samples. In this paper, we propose a semi-supervised HSI classification method inspired by the generative adversarial networks (GANs. Unlike the supervised methods, the proposed HSI classification method is semi-supervised, which can make full use of the limited labeled samples as well as the sufficient unlabeled samples. Core ideas of the proposed method are twofold. First, the three-dimensional bilateral filter (3DBF is adopted to extract the spectral-spatial features by naturally treating the HSI as a volumetric dataset. The spatial information is integrated into the extracted features by 3DBF, which is propitious to the subsequent classification step. Second, GANs are trained on the spectral-spatial features for semi-supervised learning. A GAN contains two neural networks (i.e., generator and discriminator trained in opposition to one another. The semi-supervised learning is achieved by adding samples from the generator to the features and increasing the dimension of the classifier output. Experimental results obtained on three benchmark HSI datasets have confirmed the effectiveness of the proposed method , especially with a limited number of labeled samples.

  3. Hyperspectral imaging and ankle: brachial indices in peripheral arterial disease.

    Science.gov (United States)

    Jafari-Saraf, Lida; Gordon, Ian L

    2010-08-01

    To evaluate the correlation between ankle:brachial indices (ABI) and visible light reflectance spectroscopy hyperspectral imaging (HSI) determinations of oxygenated and deoxygenated hemoglobin (oxyHgb and deoxyHgb) levels in the skin of the distal lower extremity. This is a prospective, open, comparator trial which took place at the Vascular laboratory of a Veterans Administration Hospital in Long Beach, USA. Fifty-eight patients (85 limbs) were referred for routine vascular laboratory studies including ABI had concomitant HSI. Limbs with noncompressible pedal signals were excluded from the analysis. ABI was determined with continuous wave Doppler ultrasound and leg blood pressure cuffs. A commercial HSI system (Oxu-Vu(R), Hypermed, Inc.) was used to measure oxyHgb, deoxyHgb, and percent oxygenated hemoglobin (%oxyHgb) in the dorsum of the foot and ankle. HSI measurements of volar forearm skin were also obtained to normalize the lower extremity HSI measurements in a manner comparable with ABI. For purposes of comparison, data sets were divided into 3 groups: ABI > 0.9 (n = 53), 0.45 failed to show a clinically useful correlation between HSI measurements of oxyHgb levels, further evaluation of this novel technology is warranted. Published by Elsevier Inc.

  4. High-k 3D-barium titanate foam/phenolphthalein poly(ether sulfone)/cyanate ester composites with frequency-stable dielectric properties and extremely low dielectric loss under reduced concentration of ceramics

    Science.gov (United States)

    Zheng, Longhui; Yuan, Li; Guan, Qingbao; Liang, Guozheng; Gu, Aijuan

    2018-01-01

    Higher dielectric constant, lower dielectric loss and better frequency stability have been the developing trends for high dielectric constant (high-k) materials. Herein, new composites have been developed through building unique structure by using hyperbranched polysiloxane modified 3D-barium titanate foam (BTF) (BTF@HSi) as the functional fillers and phenolphthalein poly(ether sulfone) (cPES)/cyanate ester (CE) blend as the resin matrix. For BTF@HSi/cPES/CE composite with 34.1 vol% BTF, its dielectric constant at 100 Hz is as high as 162 and dielectric loss is only 0.007; moreover, the dielectric properties of BTF@HSi/cPES/CE composites exhibit excellent frequency stability. To reveal the mechanism behind these attractive performances of BTF@HSi/cPES/CE composites, three kinds of composites (BTF/CE, BTF/cPES/CE, BTF@HSi/CE) were prepared, their structure and integrated performances were intensively investigated and compared with those of BTF@HSi/cPES/CE composites. Results show that the surface modification of BTF is good for preparing composites with improved thermal stability; while introducing flexible cPES to CE is beneficial to fabricate composites with good quality through effectively blocking cracks caused by the stress concentration, and then endowing the composites with good dielectric properties at reduced concentration of ceramics.

  5. Influence of polymer packaging films on hyperspectral imaging data in the visible-near-infrared (450-950 nm) wavelength range.

    Science.gov (United States)

    Gowen, A A; O'Donnell, C P; Esquerre, C; Downey, G

    2010-03-01

    Hyperspectral imaging (HSI) has recently emerged as a useful tool for quality analysis of consumer goods (e.g., food and pharmaceutical products). These products are typically packaged in polymeric film prior to distribution; however, HSI experiments are typically carried out on such samples ex-packaging (either prior to or after removal from packaging). This research examines the effects of polymer packaging films (polyvinyl chloride (PVC) and polyethylene terephthalate (PET)) on spectral and spatial features of HSI data in order to investigate the potential of HSI for quality evaluation of packaged goods. The effects of packaging film were studied for hyperspectral images of samples obtained in the visible-near-infrared (Vis-NIR, i.e., 450-950 nm) wavelength range, which is relevant to many food, agricultural, and pharmaceutical products. The dominant influence of the films tested in this wavelength range could be attributed to light scattering. Relative position of the light source, film, and detector were shown to be highly influential on the scattering effects observed. Detection of features on samples imaged through film was shown to be possible after some data preprocessing. This suggests that quality analysis of products packaged in polymer film is feasible using HSI. These findings would be useful in the development of quality monitoring tools for consumer products post-packaging using HSI.

  6. Effect of Al content on the gas-phase dehydration of glycerol over silica-alumina-supported silicotungstic acid catalysts

    International Nuclear Information System (INIS)

    Kim, Yong Tae; You, Su Jin; Park, Eun Duck; Jung, Kwangdeog

    2012-01-01

    The gas-phase dehydration of glycerol to acrolein was carried out over silicotungstic acid (H 4 SiW 12 O 40 ·xH 2 O, HSiW) catalysts supported on SiO 2 , η-Al 2 O 3 , and silica-alumina with different Al contents. The HSiW catalysts supported on silica-alumina showed higher glycerol conversions and acrolein yields during the initial 2 h at 315.deg.C than did SiO 2 - and η-Al 2 O 3 -supported HSiW catalysts. Among the tested catalysts, HSiW/Si 0.9 Al 0.1Ox exhibited the highest space-time yield during the initial 2 h. The loaded HSiW species can change the acid types and suppress the formation of carbonaceous species on Al-rich silica-alumina. The deactivated HSiW supported on silica-alumina can be fully regenerated after calcination in air at 500.deg.C. As long as the molar ratio between water and glycerol was in the range of 2-11, the acrolein selectivity increased significantly with increasing water content in the feed, while the surface carbon content decreased owing to the suppression of heavy compounds

  7. LINE-BASED REGISTRATION OF DSM AND HYPERSPECTRAL IMAGES

    Directory of Open Access Journals (Sweden)

    J. Avbelj

    2013-04-01

    Full Text Available Data fusion techniques require a good registration of all the used datasets. In remote sensing, images are usually geo-referenced using the GPS and IMU data. However, if more precise registration is required, image processing techniques can be employed. We propose a method for multi-modal image coregistration between hyperspectral images (HSI and digital surface models (DSM. The method is divided in three parts: object and line detection of the same object in HSI and DSM, line matching and determination of transformation parameters. Homogeneous coordinates are used to implement matching and adjustment of transformation parameters. The common object in HSI and DSM are building boundaries. They have apparent change in height and material, that can be detected in DSM and HSI, respectively. Thus, before the matching and transformation parameter computation, building outlines are detected and adjusted in HSI and DSM. We test the method on a HSI and two DSM, using extracted building outbounds and for comparison also extracted lines with a line detector. The results show that estimated building boundaries provide more line assignments, than using line detector.

  8. Aging and Phase Stability of Alloy 22 Welds FY04 SUMMARY REPORT

    International Nuclear Information System (INIS)

    El-Dasher, B S; Torres, S G; McGregor, M M; Edgecumbe, T S; Yang, N; Headley, T; Chames, J; Yio, J L; Gardea, A

    2006-01-01

    The work presented in this report consists of a compilation of individual activity reports sent to BSC at the conclusion of the FY04 fiscal year. A chapter is dedicated for each individual activity, and describes the accomplishments at the time of writing the original reports, and includes experimental data when appropriate. It is important to note that since work for most of the activities was intended for completion in FY05, no DTN numbers are given in the present report and the results presented here are to be considered preliminary at the time of their writing. Information and results presented in the FY05 Summary Report (UCRL-TR-217339) are more comprehensive and complete and supersede those given in the present report. The five activities addressed in this report are: (1) Preliminary evaluation of burnished and peened samples-metallurgy; (2) Preliminary heat-to-heat variability study-metallurgical; (3) Evaluation of FY00 mockup samples-metallurgy; (4) Weld stability with thick prototypical welds; and (5) Effect of solution annealing onweld metallurgy

  9. SOURCES & ORIGINS OF PPCPS: A COMPLEX ISSUE ...

    Science.gov (United States)

    There is no abstract for this product. If further information is requested, please refer to the bibliographic citation and contact the person listed under Contact field. The research focused on in the subtasks is the development and application of state-of the-art technologies to meet the needs of the public, Office of Water, and ORD in the area of Water Quality. Located In the subtasks are the various research projects being performed in support of this Task and more in-depth coverage of each project. Briefly, each project's objective is stated below.Subtask 1: To integrate state-of-the-art technologies (polar organic chemical integrative samplers, advanced solid-phase extraction methodologies with liquid chromatography/electrospray/mass spectrometry) and apply them to studying the sources and fate of a select list of PPCPs. Application and improvement of analytical methodologies that can detect non-volatile, polar, water-soluble pharmaceuticals in source waters at levels that could be environmentally significant (at concentrations less than parts per billion, ppb). IAG with USGS ends in FY05. APM 20 due in FY05.Subtask 2: Coordination of interagency research and public outreach activities for PPCPs. Participate on NSTC Health and Environment subcommittee working group on PPCPs. Web site maintenance and expansion, invited technical presentations, invited articles for peer-reviewed journals, interviews for media, responding to public inquiries. Subtask 3: T

  10. ORIGINS AND RAMIFICATIONS OF PHARMACEUTICALS & ...

    Science.gov (United States)

    There is no abstract available for this product. If further information is requested, please refer to the bibliographic citation and contact the person listed under Contact field. The research focused on in the subtasks is the development and application of state-of the-art technologies to meet the needs of the public, Office of Water, and ORD in the area of Water Quality. Located In the subtasks are the various research projects being performed in support of this Task and more in-depth coverage of each project. Briefly, each project's objective is stated below.Subtask 1: To integrate state-of-the-art technologies (polar organic chemical integrative samplers, advanced solid-phase extraction methodologies with liquid chromatography/electrospray/mass spectrometry) and apply them to studying the sources and fate of a select list of PPCPs. Application and improvement of analytical methodologies that can detect non-volatile, polar, water-soluble pharmaceuticals in source waters at levels that could be environmentally significant (at concentrations less than parts per billion, ppb). IAG with USGS ends in FY05. APM 20 due in FY05.Subtask 2: Coordination of interagency research and public outreach activities for PPCPs. Participate on NSTC Health and Environment subcommittee working group on PPCPs. Web site maintenance and expansion, invited technical presentations, invited articles for peer-reviewed journals, interviews for media, responding to public inquiries. S

  11. SYNTHETIC FRAGRANCES IN THE ENVIRONMENT ...

    Science.gov (United States)

    There is no abstract available for this product. If further information is requested, please refer to the bibliographic citation and contact the person listed under Contact field. The research focused on in the subtasks is the development and application of state-of the-art technologies to meet the needs of the public, Office of Water, and ORD in the area of Water Quality. Located In the subtasks are the various research projects being performed in support of this Task and more in-depth coverage of each project. Briefly, each project's objective is stated below.Subtask 1: To integrate state-of-the-art technologies (polar organic chemical integrative samplers, advanced solid-phase extraction methodologies with liquid chromatography/electrospray/mass spectrometry) and apply them to studying the sources and fate of a select list of PPCPs. Application and improvement of analytical methodologies that can detect non-volatile, polar, water-soluble pharmaceuticals in source waters at levels that could be environmentally significant (at concentrations less than parts per billion, ppb). IAG with USGS ends in FY05. APM 20 due in FY05.Subtask 2: Coordination of interagency research and public outreach activities for PPCPs. Participate on NSTC Health and Environment subcommittee working group on PPCPs. Web site maintenance and expansion, invited technical presentations, invited articles for peer-reviewed journals, interviews for media, responding to public inquiries. S

  12. ANTIBIOTICS IN THE ENVIRONMENTS; LESS RECOGNIZED ...

    Science.gov (United States)

    There is no abstract available for this product. If further information is requested, please refer to the bibliographic citation and contact the person listed under Contact field. The research focused on in the subtasks is the development and application of state-of the-art technologies to meet the needs of the public, Office of Water, and ORD in the area of Water Quality. Located In the subtasks are the various research projects being performed in support of this Task and more in-depth coverage of each project. Briefly, each project's objective is stated below.Subtask 1: To integrate state-of-the-art technologies (polar organic chemical integrative samplers, advanced solid-phase extraction methodologies with liquid chromatography/electrospray/mass spectrometry) and apply them to studying the sources and fate of a select list of PPCPs. Application and improvement of analytical methodologies that can detect non-volatile, polar, water-soluble pharmaceuticals in source waters at levels that could be environmentally significant (at concentrations less than parts per billion, ppb). IAG with USGS ends in FY05. APM 20 due in FY05.Subtask 2: Coordination of interagency research and public outreach activities for PPCPs. Participate on NSTC Health and Environment subcommittee working group on PPCPs. Web site maintenance and expansion, invited technical presentations, invited articles for peer-reviewed journals, interviews for media, responding to public inquiries. S

  13. Integrating Larval Dispersal, Permitting, and Logistical Factors Within a Validated Habitat Suitability Index for Oyster Restoration

    Directory of Open Access Journals (Sweden)

    Brandon J. Puckett

    2018-04-01

    Full Text Available Habitat suitability index (HSI models are increasingly used to guide ecological restoration. Successful restoration is a byproduct of several factors, including physical and biological processes, as well as permitting and logistical considerations. Rarely are factors from all of these categories included in HSI models, despite their combined relevance to common restoration goals such as population persistence. We developed a Geographic Information System (GIS-based HSI for restoring persistent high-relief subtidal oyster (Crassostrea virginica reefs protected from harvest (i.e., sanctuaries in Pamlico Sound, North Carolina, USA. Expert stakeholder input identified 17 factors to include in the HSI. Factors primarily represented physical (e.g., salinity and biological (e.g., larval dispersal processes relevant to oyster restoration, but also included several relevant permitting (e.g., presence of seagrasses and logistical (e.g., distance to restoration material stockpile sites considerations. We validated the model with multiple years of oyster density data from existing sanctuaries, and compared HSI output with distributions of oyster reefs from the late 1800's. Of the 17 factors included in the model, stakeholders identified four factors—salinity, larval export from existing oyster sanctuaries, larval import to existing sanctuaries, and dissolved oxygen—most critical to oyster sanctuary site selection. The HSI model provided a quantitative scale over which a vast water body (~6,000 km2 was narrowed down by 95% to a much smaller suite of optimal (top 1% HSI and suitable (top 5% HSI locations for oyster restoration. Optimal and suitable restoration locations were clustered in northeast and southwest Pamlico Sound. Oyster density in existing sanctuaries, normalized for time since reef restoration, was a positive exponential function of HSI, providing validation for the model. Only a small portion (10–20% of historical reef locations

  14. Bringing life course home: a pilot to reduce pregnancy risk through housing access and family support.

    Science.gov (United States)

    Allen, Deborah; Feinberg, Emily; Mitchell, Heavenly

    2014-02-01

    Proponents of life course comment that while the theory is persuasive, translating theory to practice is daunting. This paper speaks to the challenges and possibilities of intervention based on life course theory. It describes Healthy Start in Housing (HSiH), a partnership between the Boston Public Health Commission (BPHC) and the Boston Housing Authority (BHA) to reduce stress due to housing insecurity among low-income, pregnant women. HSiH seeks improved birth outcomes and long term health of mothers and infants. BHA goals are improved quality of life for participants, greater public housing stability and enhanced impact of housing on community well-being. HSiH is a 1 year pilot offering 75 housing units to pregnant women at risk of adverse birth outcomes and homelessness. BHA provides housing and expedites processing of HSiH applications; BPHC staff oversee enrollment, guide women through the application process, and provide enhanced, long-term case management. Of 130 women referred to HSiH to date, 53 were ineligible, 59 have submitted applications, 13 are preparing applications and 5 dropped out. Nineteen women have been housed. Among eligible women, 58 % had medical conditions, 56 % mental health conditions, and 14 % prior adverse outcomes; 30 % had multiple risks. Standardized assessments reflected high levels of depressive symptoms; 41 % had symptoms consistent with post-traumatic stress disorder. Life course theory provides both the framework and the rationale for HSiH. HSiH experience confirms the salience of daily social experience to women's health and the importance of addressing stressors and stress in women's lives.

  15. Human Systems Integration in Practice: Constellation Lessons Learned

    Science.gov (United States)

    Zumbado, Jennifer Rochlis

    2012-01-01

    NASA's Constellation program provided a unique testbed for Human Systems Integration (HSI) as a fundamental element of the Systems Engineering process. Constellation was the first major program to have HSI mandated by NASA's Human Rating document. Proper HSI is critical to the success of any project that relies on humans to function as operators, maintainers, or controllers of a system. HSI improves mission, system and human performance, significantly reduces lifecycle costs, lowers risk and minimizes re-design. Successful HSI begins with sufficient project schedule dedicated to the generation of human systems requirements, but is by no means solely a requirements management process. A top-down systems engineering process that recognizes throughout the organization, human factors as a technical discipline equal to traditional engineering disciplines with authority for the overall system. This partners with a bottoms-up mechanism for human-centered design and technical issue resolution. The Constellation Human Systems Integration Group (HSIG) was a part of the Systems Engineering and Integration (SE&I) organization within the program office, and existed alongside similar groups such as Flight Performance, Environments & Constraints, and Integrated Loads, Structures and Mechanisms. While the HSIG successfully managed, via influence leadership, a down-and-in Community of Practice to facilitate technical integration and issue resolution, it lacked parallel top-down authority to drive integrated design. This presentation will discuss how HSI was applied to Constellation, the lessons learned and best practices it revealed, and recommendations to future NASA program and project managers. This presentation will discuss how Human Systems Integration (HSI) was applied to NASA's Constellation program, the lessons learned and best practices it revealed, and recommendations to future NASA program and project managers on how to accomplish this critical function.

  16. On Spatial Resolution in Habitat Models: Can Small-scale Forest Structure Explain Capercaillie Numbers?

    Directory of Open Access Journals (Sweden)

    Ilse Storch

    2002-06-01

    Full Text Available This paper explores the effects of spatial resolution on the performance and applicability of habitat models in wildlife management and conservation. A Habitat Suitability Index (HSI model for the Capercaillie (Tetrao urogallus in the Bavarian Alps, Germany, is presented. The model was exclusively built on non-spatial, small-scale variables of forest structure and without any consideration of landscape patterns. The main goal was to assess whether a HSI model developed from small-scale habitat preferences can explain differences in population abundance at larger scales. To validate the model, habitat variables and indirect sign of Capercaillie use (such as feathers or feces were mapped in six study areas based on a total of 2901 20 m radius (for habitat variables and 5 m radius sample plots (for Capercaillie sign. First, the model's representation of Capercaillie habitat preferences was assessed. Habitat selection, as expressed by Ivlev's electivity index, was closely related to HSI scores, increased from poor to excellent habitat suitability, and was consistent across all study areas. Then, habitat use was related to HSI scores at different spatial scales. Capercaillie use was best predicted from HSI scores at the small scale. Lowering the spatial resolution of the model stepwise to 36-ha, 100-ha, 400-ha, and 2000-ha areas and relating Capercaillie use to aggregated HSI scores resulted in a deterioration of fit at larger scales. Most importantly, there were pronounced differences in Capercaillie abundance at the scale of study areas, which could not be explained by the HSI model. The results illustrate that even if a habitat model correctly reflects a species' smaller scale habitat preferences, its potential to predict population abundance at larger scales may remain limited.

  17. Item Response Theory analysis of Fagerström Test for Cigarette Dependence.

    Science.gov (United States)

    Svicher, Andrea; Cosci, Fiammetta; Giannini, Marco; Pistelli, Francesco; Fagerström, Karl

    2018-02-01

    The Fagerström Test for Cigarette Dependence (FTCD) and the Heaviness of Smoking Index (HSI) are the gold standard measures to assess cigarette dependence. However, FTCD reliability and factor structure have been questioned and HSI psychometric properties are in need of further investigations. The present study examined the psychometrics properties of the FTCD and the HSI via the Item Response Theory. The study was a secondary analysis of data collected in 862 Italian daily smokers. Confirmatory factor analysis was run to evaluate the dimensionality of FTCD. A Grade Response Model was applied to FTCD and HSI to verify the fit to the data. Both item and test functioning were analyzed and item statistics, Test Information Function, and scale reliabilities were calculated. Mokken Scale Analysis was applied to estimate homogeneity and Loevinger's coefficients were calculated. The FTCD showed unidimensionality and homogeneity for most of the items and for the total score. It also showed high sensitivity and good reliability from medium to high levels of cigarette dependence, although problems related to some items (i.e., items 3 and 5) were evident. HSI had good homogeneity, adequate item functioning, and high reliability from medium to high levels of cigarette dependence. Significant Differential Item Functioning was found for items 1, 4, 5 of the FTCD and for both items of HSI. HSI seems highly recommended in clinical settings addressed to heavy smokers while FTCD would be better used in smokers with a level of cigarette dependence ranging between low and high. Copyright © 2017 Elsevier Ltd. All rights reserved.

  18. Fatty liver index and hepatic steatosis index for prediction of non-alcoholic fatty liver disease in type 1 diabetes.

    Science.gov (United States)

    Sviklāne, Laura; Olmane, Evija; Dzērve, Zane; Kupčs, Kārlis; Pīrāgs, Valdis; Sokolovska, Jeļizaveta

    2018-01-01

    Little is known about the diagnostic value of hepatic steatosis index (HSI) and fatty liver index (FLI), as well as their link to metabolic syndrome in type 1 diabetes mellitus. We have screened the effectiveness of FLI and HSI in an observational pilot study of 40 patients with type 1 diabetes. FLI and HSI were calculated for 201 patients with type 1 diabetes. Forty patients with FLI/HSI values corresponding to different risk of liver steatosis were invited for liver magnetic resonance study. In-phase/opposed-phase technique of magnetic resonance was used. Accuracy of indices was assessed from the area under the receiver operating characteristic curve. Twelve (30.0%) patients had liver steatosis. For FLI, sensitivity was 90%; specificity, 74%; positive likelihood ratio, 3.46; negative likelihood ratio, 0.14; positive predictive value, 0.64; and negative predictive value, 0.93. For HSI, sensitivity was 86%; specificity, 66%; positive likelihood ratio, 1.95; negative likelihood ratio, 0.21; positive predictive value, 0.50; and negative predictive value, 0.92. Area under the receiver operating characteristic curve for FLI was 0.86 (95% confidence interval [0.72; 0.99]); for HSI 0.75 [0.58; 0.91]. Liver fat correlated with liver enzymes, waist circumference, triglycerides, and C-reactive protein. FLI correlated with C-reactive protein, liver enzymes, and blood pressure. HSI correlated with waist circumference and C-reactive protein. FLI ≥ 60 and HSI ≥ 36 were significantly associated with metabolic syndrome and nephropathy. The tested indices, especially FLI, can serve as surrogate markers for liver fat content and metabolic syndrome in type 1 diabetes. © 2017 Journal of Gastroenterology and Hepatology Foundation and John Wiley & Sons Australia, Ltd.

  19. Temporal habitat suitability modeling of Caspian shad (Alosa spp. in the southern Caspian Sea

    Directory of Open Access Journals (Sweden)

    Ali Haghi Vayghan

    2015-11-01

    Full Text Available To comprehensively manage an ecosystem such as that of the Caspian Sea, the world’s largest lake, detailed knowledge of the habitat traits of the living organisms in the ecosystem is essential. The present study examined environmental variables and used the Habitat Suitability Index (HSI model to determine the most preferred seasonal habitat and optimal environmental range of Caspian shad (Alosa spp. The fish preferred deep waters with low levels of total organic matter and sea level anomaly in winter and productive areas with a high concentration of chlorophyll-a (Chla and relatively high benthos biomass in spring. The number per unit area (NPUA-based HSI model determined that the geometric mean model (GMM was the optimal model for defining a suitable habitat in winter. For spring, the arithmetic mean model (or GMM in the NPUA-based HSI model most accurately predicted preferred habitat for Caspian shad. The average NPUA in both seasons increased with the HSI; areas with an HSI of between 0.4 and 0.6 in spring and between 0.6 and 0.8 in winter had a high percentage of total catch. Areas with an HSI of more than 0.5 had over 91% and 63% of the total catch in spring and winter, respectively, demonstrating the reliability of the NPUA-based HSI model in predicting Caspian shad habitat. The present study shows that remotely sensed data plus depth are the most critical environmental variables in Caspian shad habitats and that Chla and SLA are the most critical remotely sensed parameters for near real-time prediction of Caspian shad habitat.

  20. Risorse trofiche o disturbo antropico? Elaborazione preliminare e validazione di un indice di idoneità ambientale per l'orso bruno nell'Appennino

    Directory of Open Access Journals (Sweden)

    M. Bello

    2003-10-01

    Full Text Available In un'area di studio nell'Appennino abruzzese (ampia circa 250 km² sono state campionate variabili ambientali relative alla vegetazione, topografia, e presenza antropica in 2110 plot distribuiti lungo transetti da 1 km in 72 celle (1 km² selezionate casualmente dal reticolato geografico UTM. Utilizzando tematismi digitali sono state calcolate, tramite GIS, altre variabili ambientali relative alle stesse categorie. Le variabili sono state combinate in 14 indici (V1-14 utilizzati per calcolare un indice di idoneità ambientale relativo ai plot e alle celle campionate. Sono stati elaborati: A- un indice complessivo di idoneità (HSItotale e, B- 2 indici di idoneità relativi alla disponibilità di risorse trofiche e alla presenza umana (HSIcibo e HSIuomo, rispettivamente. Il valore medio di HSIcibo è stato pari a 0,23, in relazione ai valori medi degli indici di idoneità per la disponibilità di invertebrati (0,01, ghiande (0,004 e alla copertura percentuale di arbusti (0,06. Il valore medio di HSIuomo è risultato maggiore (0,32, soprattutto in relazione all'indice relativo alle variabili pendenza (0,69 e distanza dagli insediamenti umani (0,60. L'indice complessivo medio HSItotale è stato pari a 0,27. Il modello è stato validato comparando, per ogni cella, il valore dei tre indici con l'abbondanza relativa dell'orso bruno stimata lungo percorsi campione dal 1993 al 1998. Gli indici HSItotale e HSIuomo sono risultati significativamente e direttamente correlati con l'abbondanza relativa dell'orso (0,40 >rs< 0,44; p< 0,001; n= 72, mentre la frequentazione dell'orso non è risultata correlata significativamente all'indice HSIcibo (rs= 0,06; p> 0,5; n= 72. Questi dati preliminari, che saranno integrati dai risultati di ulteriori campionamenti in corso, indicano chiaramente che l

  1. A REVIEW OF HUMAN-SYSTEM INTERFACE DESIGN ISSUES OBSERVED DURING ANALOG-TO-DIGITAL AND DIGITAL-TO-DIGITAL MIGRATIONS IN U.S. NUCLEAR POWER PLANTS

    Energy Technology Data Exchange (ETDEWEB)

    Kovesdi, C.; Joe, J.

    2017-05-01

    The United States (U.S.) Department of Energy (DOE) Light Water Reactor Sustainability (LWRS) program is developing a scientific basis through targeted research and development (R&D) to support the U.S. nuclear power plant (NPP) fleet in extending their existing licensing period and ensuring their long-term reliability, productivity, safety, and security. Over the last several years, human factors engineering (HFE) professionals at the Idaho National Laboratory (INL) have supported the LWRS Advanced Instrumentation, Information, and Control (II&C) System Technologies pathway across several U.S. commercial NPPs in analog-to-digital migrations (i.e., turbine control systems) and digital-to-digital migrations (i.e., Safety Parameter Display System). These efforts have included in-depth human factors evaluation of proposed human-system interface (HSI) design concepts against established U.S. Nuclear Regulatory Commission (NRC) design guidelines from NUREG-0700, Rev 2 to inform subsequent HSI design prior to transitioning into Verification and Validation. This paper discusses some of the overarching design issues observed from these past HFE evaluations. In addition, this work presents some observed challenges such as common tradeoffs utilities are likely to face when introducing new HSI technologies into NPP hybrid control rooms. The primary purpose of this work is to distill these observed design issues into general HSI design guidance that industry can use in early stages of HSI design.

  2. Healthcare Seeking Intention if Diagnosed with HIV Among Young MSM in Taiwan: A Theory-Based Comparison by Voluntary Counseling and Testing Experience.

    Science.gov (United States)

    Li, Min-Jung; Huang, Jiun-Hau

    2018-05-28

    The number of HIV cases in Taiwan exceeded 30,000 in 2016. Per the UNAIDS 90-90-90 target, 81% of people living with HIV should receive medication. However, numerous previous studies focused on adherence rather than the initial healthcare seeking intention if diagnosed with HIV (HIV HSI). Based on the Theory of Planned Behavior (TPB), anonymous online survey data were collected from December 2016 through February 2017 from 2709 young MSM (YMSM) ages 15-39. Multivariate logistic regression found the significant factors and strengths of associations with HIV HSI varied by their HIV voluntary counseling and testing (VCT) experience. YMSM without VCT experience perceiving high support from salient others (AOR = 1.28) and high control under facilitating conditions (AOR = 2.73) had higher HIV HSI. YMSM with VCT experience perceiving high control under facilitating (AOR = 1.79) and constraining (AOR = 1.54) conditions had higher HIV HSI. Regardless of VCT experience, YMSM with positive attitudes toward positive healthcare seeking outcomes (AOR = 3.72-3.95) had highest HIV HSI, highlighting the importance of increasing positive outcome expectations in YMSM.

  3. Model for impact assessment in human factors engineering project of PWR plants with digital control

    International Nuclear Information System (INIS)

    Roedel, Frederico G.; Schirru, Roberto

    2017-01-01

    New nuclear power plants are being designed with the digital Instrumentation and Control (I and C) as the backbone for the functions of protection, control, monitoring and display and with digital Human-System Interface (HSI). In this new environment, rather than play physical control actions, the operators begin to act as decision makers and, within this context, the Human Factors Engineering (HFE) has become an integral part of the projects. As the operational experience with the use of digital I and C systems and HSI is limited since, besides the small number of applications, it is proprietary, the objective of this work is to carry out an assessment in order to identify the most relevant aspects of a digital HSI project. The proposed model is based on concepts of fuzzy logic, uses MATLAB for data processing, defines criteria for evaluation and quantification of impacts in the project and has been applied to the General Principles and the Guidelines presented in the NUREG-0700. The assessment indicated that the Guidelines for User-Interface Interaction and Management, for Information Display and for Computer-Based Procedures System should be carefully evaluated in the design of a digital HSI considering the new Users Tasks Demand, the Organization of HSI Elements and the Work Environment. (author)

  4. Hawadith Street Initiative: A unique Sudanese childhood charity experience.

    Science.gov (United States)

    Ahmed, Awad Mohamed; A-Rahman, Nada Hassan Ahmed

    2015-01-01

    Due to escalating conflicts and resultant economic constraints, different social services in low income and low-middle income countries have witnessed a decline in its standards, and increase in the costs. This situation has led to emergence of large numbers of patients and their families who cannot afford the costs of health services provided by public hospitals. On this background, and the old heritage of the Sudanese to help the needy, the Hawadith Street Initiative (HSI) was established. Named after the street on which it was founded - which translates indirectly to "Accidents Lane", HSI was established in 2012 by a group of youths, most of them in their twenties of age, and recently graduated. The main activity of the initiative is helping the needy hospital patients, especially with regards to their treatment costs, in Khartoum and other cities in Sudan. Starting with recreational programs for cancer patients, and public campaigns for donation of blood, the initiative's youths changed their activities. Using the social media, Facebook, they adopted the strategy of communication with potential donors, after sending posts containing brief anonymous presentations and call of help for needy cases. Currently HSI includes more than 2000 volunteers in Khartoum and 17 other cities. The most important achievement of HSI is the establishment of an intensive care unit at a children hospital in Omdurman city costing 435,880 US dollars. HSI demonstrates the possibility of delivering great services with minimum resources, and constitutes a unique organization, worldwide, in a new wave of Internet-based initiatives.

  5. Some aspects of digital I and C and digital human-system interface upgrades in nuclear power plants

    International Nuclear Information System (INIS)

    Mandic, D.

    2005-01-01

    Digital I and C technology introduces some new terms and new processes like software life cycle, process computer configuration control, digital human-system interface (HSI), software V and V (Verification and Validation), software common mode failure potential, software documentation, etc. Based on the experience from NEK, and other NPPs and published reports from other organizations, this paper sheds light on challenging tasks related to some aspects of the digital I and C upgrades and especially the NPP MCR/MCB HSI (Nuclear Power Plant Main Control Room / Main Control Board Human-System Interface) upgrade. The Ref. [1], EPRI Report TR-1008122 was used as a guidance to analyze original NEK MCR/MCB HSI design (1970s), to describe migration from the original MCR/MCB HSI design to the 2005 AS-BUILT status and to propose the authors vision for the key planning aspects for I and C upgrades and MCR modernization. This paper submits the justified proposal for the endpoint vision and the migration path applicable to NEK MCR/MCB HSI modernization, as well as some of the possible risks and lessons learned. (author)

  6. Hyperspectral Sensors Final Report CRADA No. TC02173.0

    Energy Technology Data Exchange (ETDEWEB)

    Priest, R. E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Sauvageau, J. E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2017-08-30

    This was a collaborative effort between Lawrence Livermore National Security, LLC as manager and operator of Lawrence Livermore National Laboratory (LLNL) and Science Applications International Corporation (SAIC), National Security Space Operations/SRBU, to develop longwave infrared (LWIR) hyperspectral imaging (HSI) sensors for airborne and potentially ground and space, platforms. LLNL has designed and developed LWIR HSI sensors since 1995. The current generation of these sensors has applications to users within the U.S. Department of Defense and the Intelligence Community. User needs are for multiple copies provided by commercial industry. To gain the most benefit from the U.S. Government’s prior investments in LWIR HSI sensors developed at LLNL, transfer of technology and know-how from LLNL HSI experts to commercial industry was needed. The overarching purpose of the CRADA project was to facilitate the transfer of the necessary technology from LLNL to SAIC thereby allowing the U.S. Government to procure LWIR HSI sensors from this company.

  7. Model for impact assessment in human factors engineering project of PWR plants with digital control

    Energy Technology Data Exchange (ETDEWEB)

    Roedel, Frederico G.; Schirru, Roberto, E-mail: froedel@nuclear.ufrj.br, E-mail: schirru@lmp.ufrj.br [Coordenacao de Pos-Graduacao e Pesquisa de Engenharia (COPPE/UFRJ), Rio de Janeiro, RJ (Brazil). Departamento de Engenharia Nuclear

    2017-07-01

    New nuclear power plants are being designed with the digital Instrumentation and Control (I and C) as the backbone for the functions of protection, control, monitoring and display and with digital Human-System Interface (HSI). In this new environment, rather than play physical control actions, the operators begin to act as decision makers and, within this context, the Human Factors Engineering (HFE) has become an integral part of the projects. As the operational experience with the use of digital I and C systems and HSI is limited since, besides the small number of applications, it is proprietary, the objective of this work is to carry out an assessment in order to identify the most relevant aspects of a digital HSI project. The proposed model is based on concepts of fuzzy logic, uses MATLAB for data processing, defines criteria for evaluation and quantification of impacts in the project and has been applied to the General Principles and the Guidelines presented in the NUREG-0700. The assessment indicated that the Guidelines for User-Interface Interaction and Management, for Information Display and for Computer-Based Procedures System should be carefully evaluated in the design of a digital HSI considering the new Users Tasks Demand, the Organization of HSI Elements and the Work Environment. (author)

  8. Personnel Selection Influences on Remotely Piloted Aircraft Human-System Integration.

    Science.gov (United States)

    Carretta, Thomas R; King, Raymond E

    2015-08-01

    Human-system integration (HSI) is a complex process used to design and develop systems that integrate human capabilities and limitations in an effective and affordable manner. Effective HSI incorporates several domains, including manpower, personnel and training, human factors, environment, safety, occupational health, habitability, survivability, logistics, intelligence, mobility, and command and control. To achieve effective HSI, the relationships among these domains must be considered. Although this integrated approach is well documented, there are many instances where it is not followed. Human factors engineers typically focus on system design with little attention to the skills, abilities, and other characteristics needed by human operators. When problems with fielded systems occur, additional training of personnel is developed and conducted. Personnel selection is seldom considered during the HSI process. Complex systems such as aviation require careful selection of the individuals who will interact with the system. Personnel selection is a two-stage process involving select-in and select-out procedures. Select-in procedures determine which candidates have the aptitude to profit from training and represent the best investment. Select-out procedures focus on medical qualification and determine who should not enter training for medical reasons. The current paper discusses the role of personnel selection in the HSI process in the context of remotely piloted aircraft systems.

  9. Associations of the fatty liver and hepatic steatosis indices with risk of cardiovascular disease: Interrelationship with age.

    Science.gov (United States)

    Kunutsor, Setor K; Bakker, Stephan J L; Blokzijl, Hans; Dullaart, Robin P F

    2017-03-01

    The fatty liver index (FLI) and the hepatic steatosis index (HSI), are biomarker-based algorithms developed as proxies for non-alcoholic fatty liver disease (NAFLD). We assessed associations of FLI and HSI with cardiovascular disease (CVD) risk. The FLI and HSI were estimated at baseline in the PREVEND cohort involving 6340 participants aged 28-75years without pre-existing CVD. During a median follow-up of 10.5years, 631 CVD events occurred. In age-and sex-adjusted analysis, the hazard ratio (HR) (95% CI) for CVD comparing FLI≥60 versus FLI36 versus HSI<30, the corresponding adjusted HRs were 1.29 (1.02-1.65), 0.84 (0.65-1.09) and 0.79 (0.55-1.13) respectively. Subgroup analyses suggested a positive association in younger participants (<50years) for FLI and inverse associations in older participants (≥50years) for both indices (P for interaction for all=0.001). Current data suggest age interactions in the association of NAFLD (as assessed by FLI or HSI) with CVD risk in a general Caucasian population. Copyright © 2017 Elsevier B.V. All rights reserved.

  10. The Relation between Hamstring Strain Injury and Physical Characteristics of Japanese Collegiate Sepak Takraw Players.

    Science.gov (United States)

    Kubo, Y; Nakazato, K; Koyama, K; Tahara, Y; Funaki, A; Hiranuma, K

    2016-11-01

    The aim of this study was to investigate the injuries in Japanese collegiate sepak takraw players. We primarily focused on hamstring strain injury (HSI), and investigated the associated physical characteristics. The study included 77 Japanese collegiate sepak takraw players who were interviewed; data were collected regarding injuries sustained by them during the game within the past year. The hip range of motion (ROM) was measured. The total number of injuries was 48 in a year. The rate of HSI was the highest (31.3%) among all the injuries. All HSIs occurred in the dominant leg because of the sunback spike. Using the Mann-Whitney U test, significant differences in age and sport-related experience were observed between the injured group and uninjured group. Upon using logistic regression analysis, the presence of a HSI was found to be associated with the sport-related experience (adjusted odds ratio [OR], 0.30; 95% confidence interval [CI], 0.12-0.77) and the hip extension ROM (adjusted OR, 0.81; 95% CI, 0.66-0.99) after adjusting for sex, sport-related experience, and the hip ROM. HSI is the most common injury in Japanese collegiate sepak takraw players. Short sport-related experience and small hip extension ROM are related with the occurrence of HSI. © Georg Thieme Verlag KG Stuttgart · New York.

  11. Hyperspectral imaging applied to complex particulate solids systems

    Science.gov (United States)

    Bonifazi, Giuseppe; Serranti, Silvia

    2008-04-01

    HyperSpectral Imaging (HSI) is based on the utilization of an integrated hardware and software (HW&SW) platform embedding conventional imaging and spectroscopy to attain both spatial and spectral information from an object. Although HSI was originally developed for remote sensing, it has recently emerged as a powerful process analytical tool, for non-destructive analysis, in many research and industrial sectors. The possibility to apply on-line HSI based techniques in order to identify and quantify specific particulate solid systems characteristics is presented and critically evaluated. The originally developed HSI based logics can be profitably applied in order to develop fast, reliable and lowcost strategies for: i) quality control of particulate products that must comply with specific chemical, physical and biological constraints, ii) performance evaluation of manufacturing strategies related to processing chains and/or realtime tuning of operative variables and iii) classification-sorting actions addressed to recognize and separate different particulate solid products. Case studies, related to recent advances in the application of HSI to different industrial sectors, as agriculture, food, pharmaceuticals, solid waste handling and recycling, etc. and addressed to specific goals as contaminant detection, defect identification, constituent analysis and quality evaluation are described, according to authors' originally developed application.

  12. Development of guidelines to review advanced human-system interfaces

    International Nuclear Information System (INIS)

    O'Hara, J.M.

    1993-01-01

    Advanced control rooms (ACRs) will utilize advanced human-system interface (HSI) technologies that may have significant implications for plant safety in that they will affect the operator's overall role in the system, the method of information presentation, and the ways in which operators interact with the system. The US Nuclear Regulatory Commission (NRC) reviews the HSI aspects of control rooms to ensure that they are designed to good human factors engineering principles and that operator performance and reliability are appropriately supported to protect public health and safety. The principal guidance available to the NRC, however, was developed more than 10 yr ago, considerably prior to these technological changes. Accordingly, the human factors guidance needs to be updated to serve as the basis for NRC review of these advanced designs. The purpose of this paper is to discuss the development, evaluation, and current status of the Advanced HSI Design Review Guideline

  13. Electron-positron interactions

    International Nuclear Information System (INIS)

    Wiik, B.; Wolf, G.

    1979-01-01

    This book is an introduction into the physics of electron-positron interactions. After a description of electron-positron storage rings pure electromagnetic e + e - interactions, and the total cross section are considered. Then low energy processes, the production of the J/psi and psi' particles including their radiative decay as well as the search for other narrow vector states are described. Then after the quark model interpretation of J/psi and psi' charmed mesons, the heavy lepton t, and the upsilon resonances are described. Thereafter inclusive hadron production and jet formation is discussed. Finally the next generation of e + e - colliding rings is described, and the first results from PETRA are presented. This book is suited for all physicists, who want to get a general review about e + e - physics. (HSI) 891 HSI/HSI 892 RKD

  14. Development of comprehensive HFE guidelines for the evaluation of NPP human systems interfaces

    International Nuclear Information System (INIS)

    O'Hara, J.M.; Brown, W.S.; Wachtel, J.

    1994-01-01

    Advanced control room (ACR) concepts are being developed in the commercial nuclear power industry as part of future reactor designs. The ACRs will use advanced human-system interface (HSI) technologies that may have significant implications for plant safety in that they will affect the ways in which the operator interacts with and supervises an increasingly complex system. The US Nuclear Regulatory Commission (NRC) reviews the HSI aspects of control rooms to ensure that they are designed to good human factors engineering principles and that operator performance and reliability are appropriately supported to protect public health and safety. The NRC is developing guidelines to support its review of these advanced designs. This paper discusses (1) the development of guidelines for advanced HSI review, (2) the integration of those guidelines with existing guidance, and (3) a methodology for further guidance development

  15. Volatility-constrained multifractal detrended cross-correlation analysis: Cross-correlation among Mainland China, US, and Hong Kong stock markets

    Science.gov (United States)

    Cao, Guangxi; Zhang, Minjia; Li, Qingchen

    2017-04-01

    This study focuses on multifractal detrended cross-correlation analysis of the different volatility intervals of Mainland China, US, and Hong Kong stock markets. A volatility-constrained multifractal detrended cross-correlation analysis (VC-MF-DCCA) method is proposed to study the volatility conductivity of Mainland China, US, and Hong Kong stock markets. Empirical results indicate that fluctuation may be related to important activities in real markets. The Hang Seng Index (HSI) stock market is more influential than the Shanghai Composite Index (SCI) stock market. Furthermore, the SCI stock market is more influential than the Dow Jones Industrial Average stock market. The conductivity between the HSI and SCI stock markets is the strongest. HSI was the most influential market in the large fluctuation interval of 1991 to 2014. The autoregressive fractionally integrated moving average method is used to verify the validity of VC-MF-DCCA. Results show that VC-MF-DCCA is effective.

  16. Hyperspectral Image Classification Using Discriminative Dictionary Learning

    International Nuclear Information System (INIS)

    Zongze, Y; Hao, S; Kefeng, J; Huanxin, Z

    2014-01-01

    The hyperspectral image (HSI) processing community has witnessed a surge of papers focusing on the utilization of sparse prior for effective HSI classification. In sparse representation based HSI classification, there are two phases: sparse coding with an over-complete dictionary and classification. In this paper, we first apply a novel fisher discriminative dictionary learning method, which capture the relative difference in different classes. The competitive selection strategy ensures that atoms in the resulting over-complete dictionary are the most discriminative. Secondly, motivated by the assumption that spatially adjacent samples are statistically related and even belong to the same materials (same class), we propose a majority voting scheme incorporating contextual information to predict the category label. Experiment results show that the proposed method can effectively strengthen relative discrimination of the constructed dictionary, and incorporating with the majority voting scheme achieve generally an improved prediction performance

  17. Towards a Sign Language Synthesizer: a Bridge to Communication Gap of the Hearing/Speech Impaired Community

    Science.gov (United States)

    Maarif, H. A.; Akmeliawati, R.; Gunawan, T. S.; Shafie, A. A.

    2013-12-01

    Sign language synthesizer is a method to visualize the sign language movement from the spoken language. The sign language (SL) is one of means used by HSI people to communicate to normal people. But, unfortunately the number of people, including the HSI people, who are familiar with sign language is very limited. These cause difficulties in the communication between the normal people and the HSI people. The sign language is not only hand movement but also the face expression. Those two elements have complimentary aspect each other. The hand movement will show the meaning of each signing and the face expression will show the emotion of a person. Generally, Sign language synthesizer will recognize the spoken language by using speech recognition, the grammatical process will involve context free grammar, and 3D synthesizer will take part by involving recorded avatar. This paper will analyze and compare the existing techniques of developing a sign language synthesizer, which leads to IIUM Sign Language Synthesizer.

  18. Deteksi Kematangan Buah Pisang Berdasarkan Fitur Warna Citra Kulit Pisang Menggunakan Metode Transformasi Ruang Warna HIS

    Directory of Open Access Journals (Sweden)

    Indarto

    2017-05-01

    Full Text Available Pengolahan citra mempunyai peranan penting di berbagai bidang. Aplikasi pengolahan citra berkaitan dengan pemrosesan citra berkaitan dengan transformasi warna. Dalam paper ini dijelaskan mengenai metode transformasi warna HSI untuk deteksi pisang dan mengklasifikasikan dalam fase kematangan. Data dalam penelitian ini menggunakan citra pisang ambon yang diambil dengan kamera yang nantinya akan diambil sebagian (cropping pada kulit, yang kemudian akan diekstrak ciri warnanya, dan dihitung tingkat kadar warna dari R (red, G (green, dan B (blue dan diubah ke HSI. Berdasarkan input pelatihan deteksi jenis warna kulit pisang ambon diperoleh dari pengolahan citra dengan metode transformasi warna HSI. Dari hasil penelitian 20 sampel buah dimana 10 buah pisang ambon mentah dan 10 buah pisang ambon matang dengan dihitung nilai rata-rata maksimal dan minimal H dan S diperoleh akurasi kesesuaian sebesar 85%.

  19. Fluorescence hyperspectral imaging technique for foreign substance detection on fresh-cut lettuce.

    Science.gov (United States)

    Mo, Changyeun; Kim, Giyoung; Kim, Moon S; Lim, Jongguk; Cho, Hyunjeong; Barnaby, Jinyoung Yang; Cho, Byoung-Kwan

    2017-09-01

    Non-destructive methods based on fluorescence hyperspectral imaging (HSI) techniques were developed to detect worms on fresh-cut lettuce. The optimal wavebands for detecting the worms were investigated using the one-way ANOVA and correlation analyses. The worm detection imaging algorithms, RSI-I (492-626)/492 , provided a prediction accuracy of 99.0%. The fluorescence HSI techniques indicated that the spectral images with a pixel size of 1 × 1 mm had the best classification accuracy for worms. The overall results demonstrate that fluorescence HSI techniques have the potential to detect worms on fresh-cut lettuce. In the future, we will focus on developing a multi-spectral imaging system to detect foreign substances such as worms, slugs and earthworms on fresh-cut lettuce. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  20. Development of guidelines to review advanced human-system interfaces

    International Nuclear Information System (INIS)

    O'Hara, J.M.

    1993-01-01

    Advanced control rooms (ACRS) will utilize advanced human-system interface (HSI) technologies that may have significant implications for plant safety in that they will affect the operators overall role in the system, the method of information presentation, and the ways in which operators interact with the system. The US Nuclear Regulatory Commission (NRC) reviews the HSI aspects of control rooms to ensure that they are designed to good human factors engineering principles and that operator performance and reliability are appropriately supported in order to protect public health and safety. The principal guidance available to the NRC, however, was developed more than ten years ago, well prior to these technological changes. Accordingly, the human factors guidance needs to be updated to serve as the basis for NRC review of these advanced designs. The purpose of this paper is to discuss the development, evaluation, and current status of the Advanced HSI Design Review Guideline, hereafter referred to as the ''Guideline.''

  1. Hyperspectral Image Classification With Markov Random Fields and a Convolutional Neural Network

    Science.gov (United States)

    Cao, Xiangyong; Zhou, Feng; Xu, Lin; Meng, Deyu; Xu, Zongben; Paisley, John

    2018-05-01

    This paper presents a new supervised classification algorithm for remotely sensed hyperspectral image (HSI) which integrates spectral and spatial information in a unified Bayesian framework. First, we formulate the HSI classification problem from a Bayesian perspective. Then, we adopt a convolutional neural network (CNN) to learn the posterior class distributions using a patch-wise training strategy to better use the spatial information. Next, spatial information is further considered by placing a spatial smoothness prior on the labels. Finally, we iteratively update the CNN parameters using stochastic gradient decent (SGD) and update the class labels of all pixel vectors using an alpha-expansion min-cut-based algorithm. Compared with other state-of-the-art methods, the proposed classification method achieves better performance on one synthetic dataset and two benchmark HSI datasets in a number of experimental settings.

  2. Gastric cancer target detection using near-infrared hyperspectral imaging with chemometrics

    Science.gov (United States)

    Yi, Weisong; Zhang, Jian; Jiang, Houmin; Zhang, Niya

    2014-09-01

    Gastric cancer is one of the leading causes of cancer death in the world due to its high morbidity and mortality. Hyperspectral imaging (HSI) is an emerging, non-destructive, cutting edge analytical technology that combines conventional imaging and spectroscopy in one single system. The manuscript has investigated the application of near-infrared hyperspectral imaging (900-1700 nm) (NIR-HSI) for gastric cancer detection with algorithms. Major spectral differences were observed in three regions (950-1050, 1150-1250, and 1400-1500 nm). By inspecting cancerous mean spectrum three major absorption bands were observed around 975, 1215 and 1450 nm. Furthermore, the cancer target detection results are consistent and conformed with histopathological examination results. These results suggest that NIR-HSI is a simple, feasible and sensitive optical diagnostic technology for gastric cancer target detection with chemometrics.

  3. TA-55 facility control system upgrade project - human-system interface functional requirements

    International Nuclear Information System (INIS)

    Atkins, W.H.; Pope, N.G.; Turner, W.J.; Brown, R.E.

    1995-11-01

    The functional requirements for that part of the Technical Area (TA)-55 Operations Center Upgrade Project that involves the human-system interface (HSI) are described in this document. The upgrade project seeks to replace completely the center's existing computerized data acquisition and display system, which consists of the field multiplexer units, Data General computer systems, and associated peripherals and software. The upgrade project has two parts-the Facility Data Acquisition Interface System (FDAIS) and the HSI. The HSI comprises software and hardware to provide a high-level graphical operator interface to the data acquisition system, as well as data archiving, alarm annunciation, and logging. The new system will be built with modern, commercially available components; it will improve reliability and maintainability, and it can be expanded for future needs

  4. Mapping rural community and dairy cow heat stress in Southern Ontario: A common geographic pattern from 2010 to 2012.

    Science.gov (United States)

    Bishop-Williams, Katherine E; Berke, Olaf; Pearl, David L; Kelton, David F

    2016-07-03

    Climate change has increased the occurrence of heat waves, causing heat stress among humans and livestock, with potentially fatal consequences. Heat stress maps provide information about related health risks and insight for control strategies. Weather data were collected throughout Southern Ontario, and the heat stress index (HSI) was estimated for 2010-2012. Geostatistical kriging was applied to map heat stress, heat waves, and control periods. Average HSI for each period ranged from 55 to 78 during control periods, and from 65 to 84 during heat waves, surpassing levels where morbidity is known to increase substantially. Heat stress followed a temporally consistent geographic pattern. HSI maps indicate high-risk areas for heat-related illness and indicate areas where agriculture and human health may be at increased risk in future.

  5. Measurement of some biophysical parameters in skin lesions of leprosy

    Directory of Open Access Journals (Sweden)

    A B Gupta

    1990-01-01

    Full Text Available Transepidermal water loss (TEWL, high frequency electrical conductance (HFC and the hydration state index (HSI were measured in sldn lesions of 30 paucibacillary leprosy patients and compared with the contralateral uninvolved skin. While the TEWL, HFC and HSI all showed lower values in the lesion site, as compared to the contralateral skin sites, the differences between the two sets of values significant in HFC and. HSI only at 2% and 1% level respectively. A significant positive correlation (r = 0.69 was found to eidst between these two parameters. The parameters correlate well with the known reduced sweating in skin lesions of TT and BT leprosy and may therefore be considered as good objective parameters to confirm hypohydrosis in suspected skin lesions ofleprosy.

  6. Carbon ion beam triggers both caspase-dependent and caspase-independent pathway of apoptosis in HeLa and status of PARP-1 controls intensity of apoptosis.

    Science.gov (United States)

    Ghorai, Atanu; Sarma, Asitikantha; Bhattacharyya, Nitai P; Ghosh, Utpal

    2015-04-01

    High linear energy transfer (LET) carbon ion beam (CIB) is becoming very promising tool for various cancer treatments and is more efficient than conventional low LET gamma or X-rays to kill malignant or radio-resistant cells, although detailed mechanism of cell death is still unknown. Poly (ADP-ribose) polymerase-1 (PARP-1) is a key player in DNA repair and its inhibitors are well-known as radio-sensitizer for low LET radiation. The objective of our study was to find mechanism(s) of induction of apoptosis by CIB and role of PARP-1 in CIB-induced apoptosis. We observed overall higher apoptosis in PARP-1 knocked down HeLa cells (HsiI) compared with negative control H-vector cells after irradiation with CIB (0-4 Gy). CIB activated both intrinsic and extrinsic pathways of apoptosis via caspase-9 and caspase-8 activation respectively, followed by caspase-3 activation, apoptotic body, nucleosomal ladder formation and sub-G1 accumulation. Apoptosis inducing factor translocation into nucleus in H-vector but not in HsiI cells after CIB irradiation contributed caspase-independent apoptosis. Higher p53 expression was observed in HsiI cells compared with H-vector after exposure with CIB. Notably, we observed about 37 % fall of mitochondrial membrane potential, activation of caspase-9 and caspase-3 and mild activation of caspase-8 without any detectable apoptotic body formation in un-irradiated HsiI cells. We conclude that reduction of PARP-1 expression activates apoptotic signals via intrinsic and extrinsic pathways in un-irradiated cells. CIB irradiation further intensified both intrinsic and extrinsic pathways of apoptosis synergistically along with up-regulation of p53 in HsiI cells resulting overall higher apoptosis in HsiI than H-vector.

  7. Performance evaluation and modeling of a conformal filter (CF) based real-time standoff hazardous material detection sensor

    Science.gov (United States)

    Nelson, Matthew P.; Tazik, Shawna K.; Bangalore, Arjun S.; Treado, Patrick J.; Klem, Ethan; Temple, Dorota

    2017-05-01

    Hyperspectral imaging (HSI) systems can provide detection and identification of a variety of targets in the presence of complex backgrounds. However, current generation sensors are typically large, costly to field, do not usually operate in real time and have limited sensitivity and specificity. Despite these shortcomings, HSI-based intelligence has proven to be a valuable tool, thus resulting in increased demand for this type of technology. By moving the next generation of HSI technology into a more adaptive configuration, and a smaller and more cost effective form factor, HSI technologies can help maintain a competitive advantage for the U.S. armed forces as well as local, state and federal law enforcement agencies. Operating near the physical limits of HSI system capability is often necessary and very challenging, but is often enabled by rigorous modeling of detection performance. Specific performance envelopes we consistently strive to improve include: operating under low signal to background conditions; at higher and higher frame rates; and under less than ideal motion control scenarios. An adaptable, low cost, low footprint, standoff sensor architecture we have been maturing includes the use of conformal liquid crystal tunable filters (LCTFs). These Conformal Filters (CFs) are electro-optically tunable, multivariate HSI spectrometers that, when combined with Dual Polarization (DP) optics, produce optimized spectral passbands on demand, which can readily be reconfigured, to discriminate targets from complex backgrounds in real-time. With DARPA support, ChemImage Sensor Systems (CISS™) in collaboration with Research Triangle Institute (RTI) International are developing a novel, real-time, adaptable, compressive sensing short-wave infrared (SWIR) hyperspectral imaging technology called the Reconfigurable Conformal Imaging Sensor (RCIS) based on DP-CF technology. RCIS will address many shortcomings of current generation systems and offer improvements in

  8. Quality of life improvement in HIV-1 patients treated with raltegravir in a real-life observational study: RACING.

    Science.gov (United States)

    Spire, Bruno; Nait-Ighil, Lella; Pugliese, Pascal; Poizot-Martin, Isabelle; Jullien, Vincent; Marcelin, Anne-Geneviève; Billaud, Eric

    2017-01-01

    Good efficacy and safety of raltegravir in person living with HIV was demonstrated in clinical trials over five years, but real-life data, particularly about quality of life (QoL), are lacking. QoL was evaluated over time in adult patients first treated or switched to regimens containing raltegravir in an observational cohort study. Patient QoL was evaluated using the Fatigue Impact Scale (FIS) and the HIV Symptom Index (HSI). Data were collected at baseline and at 1, 3, 6, 12, 18, and 24 months. Baseline FIS and HSI subscores were compared with the scores at each visit using the paired Wilcoxon test. The impact of time, sociodemographic and medical variables upon patient-perceived fatigue and symptoms was also assessed using mixed multivariate models. From baseline, all FIS and HSI subscores improved significantly after one month of treatment. In addition, psychosocial FIS subscores and both the frequency of bothersome symptoms and HSI subscores improved significantly at each visit. Physical FIS subscores also improved significantly, except at month 18, whereas both cognitive and total FIS subscores improved only after 6 months and 24 months, respectively. In multivariate analysis, employment was independently associated over time with improved improvement in both FIS and HSI subscores. Patient QoL improved significantly over a 24-month period of treatment with a raltegravir-containing regimen. FIS and HSI are sensitive tools to measure the impact of new antiretroviral combinations on a patient's perception of QoL.

  9. Vermont Biofuels Initiative: Local Production for Local Use to Supply a Portion of Vermont's Energy Needs

    Energy Technology Data Exchange (ETDEWEB)

    Sawyer, Scott; Kahler, Ellen

    2009-05-31

    The Vermont Biofuels initiative (VBI) is the Vermont Sustainable Jobs Fund's (VSJF) biomass-to-biofuels market development program. Vermont is a small state with a large petroleum dependency for transportation (18th in per capita petroleum consumption) and home heating (55% of all households use petroleum for heating). The VBI marks the first strategic effort to reduce Vermont's dependency on petroleum through the development of homegrown alternatives. As such, it supports the four key priorities of the U.S. Department of Energy's Multi-year Biomass Plan: 1.) Dramatically reduce dependence on foreign oil; 2.) Promote the use of diverse, domestic and sustainable energy resources; 3.) Reduce carbon emissions from energy production and consumption; 4.) Establish a domestic bioindustry. In 2005 VSJF was awarded with a $496,000 Congressionally directed award from U.S. Senator Patrick Leahy. This award was administered through the U.S. Department of Energy (DE-FG36- 05GO85017, hereafter referred to as DOE FY05) with $396,000 to be used by VSJF for biodiesel development and $100,000 to be used by the Vermont Department of Public Service for methane biodigester projects. The intent and strategic focus of the VBI is similar to another DOE funded organization-the Biofuels Center of North Carolina-in that it is a nonprofit driven, statewide biofuels market development effort. DOE FY05 funds were expensed from 2006 through 2008 for seven projects: 1) a feedstock production, logistics, and biomass conversion research project conducted by the University of Vermont Extension; 2) technical assistance in the form of a safety review and engineering study of State Line Biofuels existing biodiesel production facility; 3) technical assistance in the form of a safety review and engineering study of Borderview Farm's proposed biodiesel production facility; 4) technology and infrastructure purchases for capacity expansion at Green Technologies, LLC, a waste vegetable

  10. Increasing Safety and Reducing Environmental Damage Risk from Aging High-Level Radioactive Waste Tanks - 2005 Report

    International Nuclear Information System (INIS)

    Eric D. Steffler; Eric D. Steffler; Mark M. Rashid; Frank A. McClintock; Richard L Williamson; Mili Selimotic

    2005-01-01

    Cracks of various shapes and sizes exist in large high-level waste (HLW) tanks at several DOE sites. There is justifiable concern that these cracks could grow to become unstable causing a substantial release of liquid contaminants to the environment. Accurate prediction of crack growth behavior in the tanks, especially during accident scenarios, is not possible with existing analysis methodologies. This research project responds to this problem by developing an improved ability to predict crack growth in material-structure combinations that are ductile. This new model not only addresses the problem for these tanks, but also has applicability to any crack in any ductile structure. This report summarizes work progress through the fourth quarter of FY-05 (year 1 of a second 3-year funding period)

  11. Baseline ecological footprint of Sandia National Laboratories, New Mexico.

    Energy Technology Data Exchange (ETDEWEB)

    Coplen, Amy K.; Mizner, Jack Harry,; Ubechel, Norion M.

    2009-01-01

    The Ecological Footprint Model is a mechanism for measuring the environmental effects of operations at Sandia National Laboratories in Albuquerque, New Mexico (SNL/NM). This analysis quantifies environmental impact associated with energy use, transportation, waste, land use, and water consumption at SNL/NM for fiscal year 2005 (FY05). Since SNL/NMs total ecological footprint (96,434 gha) is greater than the waste absorption capacity of its landholdings (338 gha), it created an ecological deficit of 96,096 gha. This deficit is equal to 886,470lha, or about 3,423 square miles of Pinyon-Juniper woodlands and desert grassland. 89% of the ecological footprint can be attributed to energy use, indicating that in order to mitigate environmental impact, efforts should be focused on energy efficiency, energy reduction, and the incorporation of additional renewable energy alternatives at SNL/NM.

  12. Controller's 2006 annual report : fiscal year ending September 30, 2006.

    Energy Technology Data Exchange (ETDEWEB)

    Crooks, Jennifer Shuk-Ian

    2007-02-01

    I am pleased to present the CFO's FY06 Financial Report for Sandia National Laboratories (SNL). As a contractor to DOE and other government agencies, the bulk of SNL's revenue is from tax dollars. SNL's FY06 total revenue, total expenditures, and total employment levels were slightly below the FY05 record high levels. Throughout FY06, SNL business staff continued to improve SNL's financial stewardship of entrusted taxpayer funds through implementation of best-in-class practices in financial business operations and internal control policies and procedures to ensure compliance with all accounting standards and provide accountability to our customers. Our FY06 efforts focused on process certification and improvement, implementing OMB Circular A-123, achieving assurance activities, implementation of a Financial Management Competency Program throughout SNL, and continuous assessment of trends and emerging issues.

  13. Development of advanced MCR task analysis methods

    International Nuclear Information System (INIS)

    Na, J. C.; Park, J. H.; Lee, S. K.; Kim, J. K.; Kim, E. S.; Cho, S. B.; Kang, J. S.

    2008-07-01

    This report describes task analysis methodology for advanced HSI designs. Task analyses was performed by using procedure-based hierarchical task analysis and task decomposition methods. The results from the task analysis were recorded in a database. Using the TA results, we developed static prototype of advanced HSI and human factors engineering verification and validation methods for an evaluation of the prototype. In addition to the procedure-based task analysis methods, workload estimation based on the analysis of task performance time and analyses for the design of information structure and interaction structures will be necessary

  14. Evaluation method of human-system interface for nuclear power plants

    International Nuclear Information System (INIS)

    Tanji, Junichi; Kawai, Jun; Masui, Takao; Ezaki, Ikuko

    2000-01-01

    We have developed HSI evaluation method based on a model of human cognitive processes in order to provide the viewpoint of the evaluation on the operability of interface. The model describes systematically the human error categories of GEMS by Reason. Based on the model together with reference to the other published information such as NUREG-0700Rev.1, the evaluation items for HSI have embodied in the electronic handbook HIBISCUS. The applicability of HIBISCUS have been assessed by evaluating experimental results using a simulator equipped with control panel using CRTs and touch operations. From the results, the usefulness of the handbook has been confirmed. (author)

  15. Evaluation method of human-system interface for nuclear power plants

    Energy Technology Data Exchange (ETDEWEB)

    Tanji, Junichi [Nuclear Power Engineering Corp. (NUPEC), Tokyo (Japan); Kawai, Jun; Masui, Takao; Ezaki, Ikuko [Mitsubishi Research Inst., Tokyo (Japan)

    2000-10-01

    We have developed HSI evaluation method based on a model of human cognitive processes in order to provide the viewpoint of the evaluation on the operability of interface. The model describes systematically the human error categories of GEMS by Reason. Based on the model together with reference to the other published information such as NUREG-0700Rev.1, the evaluation items for HSI have embodied in the electronic handbook HIBISCUS. The applicability of HIBISCUS have been assessed by evaluating experimental results using a simulator equipped with control panel using CRTs and touch operations. From the results, the usefulness of the handbook has been confirmed. (author)

  16. Improvement of Janus Using Pegasus 1-Meter Resolution Database With a Transputer Network

    Science.gov (United States)

    1994-03-01

    Figure 4.9 shows the six jacks on the end of the HSI-card. Facing the back of the SPARC Station LINKO LINKI LINK2 LINK3 DOWN UP Figure 4.9: HSI-Card Link...shown in Figure 4.22. Facing the back of the Sun SPARC Station LINK0 LINKI LINK2 LINK3 DOWN UP "b Telephone Cable Facing the front of the Remote Tram...Holder LINKO LINKI LINK2 LINK3 DOWN UPI Figure 4.20: The Connection Between Sun SPARC Station and Remote Tram Holder 58 (3) Se.inu Up t• Link Speed

  17. Analysis of the quality of wastewater from the service stations located in the operative area of Helsinki Region Environmental Services Authority

    OpenAIRE

    Dahal, Karna

    2012-01-01

    The objective of this thesis was to analyse the data of pollutant parameters for waste water from the service stations situated in the operative area of the Viikinmäki and Suomenoja WWTPs in the Helsinki Region Environmental Services Authority (HSY). The main reason for this analysis was that HSY wanted to know about the quality of waste water discharged from the service stations into the influent of its WWTPs. The number of cars used in Finland is increasing day by day; hence, au...

  18. Spatial-Spectral Approaches to Edge Detection in Hyperspectral Remote Sensing

    Science.gov (United States)

    Cox, Cary M.

    This dissertation advances geoinformation science at the intersection of hyperspectral remote sensing and edge detection methods. A relatively new phenomenology among its remote sensing peers, hyperspectral imagery (HSI) comprises only about 7% of all remote sensing research - there are five times as many radar-focused peer reviewed journal articles than hyperspectral-focused peer reviewed journal articles. Similarly, edge detection studies comprise only about 8% of image processing research, most of which is dedicated to image processing techniques most closely associated with end results, such as image classification and feature extraction. Given the centrality of edge detection to mapping, that most important of geographic functions, improving the collective understanding of hyperspectral imagery edge detection methods constitutes a research objective aligned to the heart of geoinformation sciences. Consequently, this dissertation endeavors to narrow the HSI edge detection research gap by advancing three HSI edge detection methods designed to leverage HSI's unique chemical identification capabilities in pursuit of generating accurate, high-quality edge planes. The Di Zenzo-based gradient edge detection algorithm, an innovative version of the Resmini HySPADE edge detection algorithm and a level set-based edge detection algorithm are tested against 15 traditional and non-traditional HSI datasets spanning a range of HSI data configurations, spectral resolutions, spatial resolutions, bandpasses and applications. This study empirically measures algorithm performance against Dr. John Canny's six criteria for a good edge operator: false positives, false negatives, localization, single-point response, robustness to noise and unbroken edges. The end state is a suite of spatial-spectral edge detection algorithms that produce satisfactory edge results against a range of hyperspectral data types applicable to a diverse set of earth remote sensing applications. This work

  19. anti p production and collection

    International Nuclear Information System (INIS)

    Jones, E.

    1984-01-01

    Antiprotons emerge from the target, along with many other fundamental particles, and are focused by a cylindrical lens, called a magnetic horn, into the beam transport system. The latter consists of an arrangement of strong focusing quadrupoles and a spectrometer magnet. (orig./HSI)

  20. 1.4 million cubic metres of achievement

    International Nuclear Information System (INIS)

    Anon.

    1988-01-01

    After five years of civil engineering work, the accent at CERN's 26.7 kilometre LEP electron-positron collider is now on installation. The first 2.8 kilometre section is now virtually complete and awaits the first positron test beam this summer, while the preparations for the four big detectors enter their final phase. (orig./HSI).

  1. First fruits of LAA

    International Nuclear Information System (INIS)

    Anon.

    1988-01-01

    The LAA programme is divided into nine specialized areas - high precision tracking, calorimetry, large area devices, leading particle detection, special applications of integrated circuits, data acquisition and analysis, supercomputers and simulation studies, high magnetic fields, and high temperature superconductivity. (orig./HSI).

  2. Hamburg University, 2. Institute of Experimental Physics. Annual report 1985

    International Nuclear Information System (INIS)

    1985-12-01

    This annual report contains short descriptions of the work performed at the named institute together with a list of publications, contributions to conferences, dissertations, and diploma theses. The work concerns nuclear structure studies by hyperfine structure, experiments with synchrotron radiation, experiments at CERN, e + e - interactions at PETRA, and muon-nucleon interactions. (HSI) [de

  3. Annual report 1981

    International Nuclear Information System (INIS)

    1981-12-01

    This annual report contains short descriptions of the work done at the named institute. These concern the study of hyperfine interactions, experiments with synchroton radiation, experiments at storage rings, and experiments at CERN. Furthermore, a list of publications, contributions to conferences and these is presented. (HSI) [de

  4. Annual report 1984 of the 2. Institut fuer Experimentalphysik Universitaet Hamburg

    International Nuclear Information System (INIS)

    1984-12-01

    This annual report contains short descriptions of the work performed at the named institute together with a list of publications and theses. The work concern hyperfine structure and Moessbauer studies, synchrotron radiation experiments, contributions of this institute to the CHARM collaboration at CERN, e + e - interaction studies at PETRA, and detector developments. (HSI) [de

  5. The optical potential for thermal neutrons in second approximation

    International Nuclear Information System (INIS)

    Nowak, E.

    1980-01-01

    After the construction of an expansion of the transfer operator for neutron scattering in terms of the scattering length the optical potential for coherent scattering is derived whereby the corrections due to the dynamic properties of the scattering system are discussed. (HSI) [de

  6. Quantum mean-field theory of collective dynamics and tunneling

    International Nuclear Information System (INIS)

    Negele, J.W.; Massachusetts Inst. of Tech., Cambridge

    1981-01-01

    In collaboration with Shimon Levit and Zvi Paltiel, significant progress has been made recently in formulating the quantum many-body problem in terms of an expansion about solutions to time-dependent mean-field equations. The essential ideas, principal results, and illustrative examples will be summarized here. (orig./HSI)

  7. Fragmentation of quarks and gluons

    International Nuclear Information System (INIS)

    Soeding, P.

    1983-10-01

    The author presents a review about quark and gluon jets. He describes the particle contents of the different types of jets. Finally he considers the hadronization mechanism with special regards to three-jet events in e + e - annihilation and hadronization in nuclear matter. (HSI)

  8. Stanford's big new detector

    International Nuclear Information System (INIS)

    Anon.

    1984-01-01

    A detector constructed for the Standford Linear Collider is described. It consists of a central drift chamber in the field of a surrounding superconducting solenoid. Furthermore included are a Cherenkov ring imaging detector for particle identification and a liquid argon calorimeter. (HSI).

  9. Forschungszentrum Rossendorf, Institute of Ion Beam Physics and Materials Research. Annual report 2004

    International Nuclear Information System (INIS)

    Borany, J. von; Heera, V.; Helm, M.; Jaeger, H.U.; Moeller, W.

    2005-01-01

    The following topics are dealt with: Silicon based electrically driven microcavity LED, ultraviolet electroluminescence from a Gd-implanted Si-metal-oxide-semiconductor device, semiconductor quantum-cascade lasers, ion beam synthesis and morphology of semiconductor memories, ion implantation, films, sputtering, ion-beam induced destabilization of nanoparticles. (HSI)

  10. Muonium and neutral muonic helium

    International Nuclear Information System (INIS)

    Orth, H.

    1981-01-01

    In this brief article the current status on muonium spectroscopy with emphasis on recent developments will be summarized. The experimental and theoretical progress of the muonic helium atom will be reviewed. Future directions in this field of research will be discussed. (orig./HSI)

  11. Dye laser light for high-resolution classical photography

    International Nuclear Information System (INIS)

    Geissler, K.K.

    1982-01-01

    The test run with the bubble chamber HOLEBC in October 1981 offered the opportunity of checking the usefulness of de-speckled dye laser light for illumination purposes in high-resolution classical dark field photography of small bubble chambers. (orig./HSI)

  12. HASYLAB annual report 1987

    International Nuclear Information System (INIS)

    1988-01-01

    This annual report contains extended abstracts about the work performed at HASYLAB together with a list of publications, speeches, and theses. The work concerns technical developments, the study of the electronic structure of atoms, molecules, solids, surfaces, and liquids, X-ray structure studies of solids and interfaces, molecular biology, further applications of synchrotron radiation, and experimental developments. (HSI)

  13. Search for the pentaquarks states in lepton-nucleon scattering at HERMES

    International Nuclear Information System (INIS)

    Rubacek, L.

    2006-07-01

    In this thesis the search for a strange pentaquark Θ + , decaying into pK 0 S , in the process eN→e'Θ + anti K at 27.5 GeV, studied with a deuteron target. Preliminary results on the invariant-mass spectra are presented from which the Θ + can neither be confirmed nor ruled out. (HSI)

  14. Quantization of bosonic closed strings and the Liouville model

    International Nuclear Information System (INIS)

    Paycha, S.

    1988-01-01

    The author shows that by means of a reasonable interpretation of the Lebesgue measure describing the partition function the quantization of closed bosonic strings described by compact surfaces of genus p>1 can be related to that of the Liouville model. (HSI)

  15. Association between cumulative radiation dose, adverse skin reactions, and changes in surface hemoglobin among women undergoing breast conserving therapy

    Directory of Open Access Journals (Sweden)

    Michael S. Chin

    2017-06-01

    Conclusion: HSI demonstrates promise in the assessment of skin dose as well as an objective measure of skin reaction. The ability to easily identify adverse skin reactions and to modify the treatment plan may circumvent the need for detrimental treatment breaks.

  16. Fundamentals of QCD

    International Nuclear Information System (INIS)

    Taylor, J.C.

    1983-01-01

    The author introduces quantum chromodynamics as a SU(3)-Yang-Mills theory describing the interactions between the quarks. After a general introduction the Feynman rules are discussed. Then the Ward identity is considered. Thereafter the renormalization is described. Finally the beta function and asymptotic freedom are considered. (HSI)

  17. HMI Section of Nuclear and Radiation Physics - annual report 1988

    International Nuclear Information System (INIS)

    1988-01-01

    This annual report contains extended abstracts about the work performed in the named institute together with a list of publications and talks. The work concerns nuclear and atomic theory, heavy ion reactions, hyperfine-structure studies, ion collisions with atoms and solids, and developments on the VICKSI accelerator. (HSI)

  18. Quasi-algebras and general Weyl quantization

    International Nuclear Information System (INIS)

    Lassner, G.A.; Lassner, G.

    1984-01-01

    In this paper we show how the systematic use of the topological properties of the quasi-sup(*)-algebra L(S,S') leads to a systematization of the quantization procedure. With that as background, the multiplication of certain classes of pairs of operators of L(S,S') and the corresponding twisted product of their sybmols are defined. (orig./HSI)

  19. Study of an ep facility for Europe

    International Nuclear Information System (INIS)

    Amaldi, U.

    1979-08-01

    These proceedings contains the lectures and discussion held in the named meeting. These concern machine problems, superconducting magnets, the search of new currents and new particles, large q 2 physics and hadron structure, small q 2 physics and photoproduction, as well as detectors for charged and neutral current events. See hints under the relevant topics. (HSI)

  20. GSI-contributions to HCI-92

    International Nuclear Information System (INIS)

    1992-11-01

    This preprint comprises all the papers presented at the VIth International Conference on the Physics of Highly Charged Ions (Manhattan, Kansas, September 28 - October 2, 1992) reporting on results from experiments performed at the GSI heavy ion accelerator facilities. See hints under the relevant topics. (orig./HSI)

  1. Search for higher twist in γp interactions

    International Nuclear Information System (INIS)

    Hoeger, K.C.

    1989-01-01

    A comparison of the experimental observations of the inclusive production of charged particles in γp interactions with 70 GeV - γ << 170 GeV and hp (h=π, K) interactions with E=80 GeV and 140 GeV is presented. (HSI)

  2. Time reversal odd effects in semi-inclusive deep inelastic scattering

    International Nuclear Information System (INIS)

    Schlegel, M.

    2006-04-01

    In this thesis the semi-iclusive deep inelastic scattering l+h→l'+h+X is studied in the framework of the parton model. Especially sum rules are checked which contain transverse-momentum dependent parton distributions. Furthermore the influence of T-odd effects on the subleading order of a twist expansion are investigated. (HSI)

  3. Quark matter formation in high energy nucleus-nucleus collisions - predictions and observations

    International Nuclear Information System (INIS)

    Otterlund, I.

    1983-01-01

    In this talk I give a short summary of the recent discussion around predictions and possible observations of quark-gluon plasma and fireballs in ultrarelativistic nucleus-nucleus collisions. In particular this talk is focused on heavy ion reactions at 200 A GeV. (orig./HSI)

  4. Investigation of K{sup +} meson production in C+C collisions at 2 A GeV with HADES

    Energy Technology Data Exchange (ETDEWEB)

    Sadovsky, A.

    2007-12-28

    In this thesis the measurement of the double differential cross sections in K{sup +}V transverse momentum and rapidity in the reaction {sup 12}C+{sup 12}C{yields}K{sup +}+X at 2A GeV is described. (HSI)

  5. Critique of the quantum power of judgment. A transcendental foundation of quantum objectivity

    International Nuclear Information System (INIS)

    Pringe, H.

    2007-01-01

    In this book Kant's critique of pure ratio is considered in the framework of quantum mechanics. In this connections Bohr's thought is considered with a short view on the EPR paradox. Finally a transcendental foundation of quantum mechanics is presented. (HSI)

  6. Critique of the quantum power of judgment. A transcendental foundation of quantum objectivity

    Energy Technology Data Exchange (ETDEWEB)

    Pringe, H.

    2007-07-01

    In this book Kant's critique of pure ratio is considered in the framework of quantum mechanics. In this connections Bohr's thought is considered with a short view on the EPR paradox. Finally a transcendental foundation of quantum mechanics is presented. (HSI)

  7. Big research in new dimensions. Thinkers of our time about the actual elementary-particle physics at CERN; Grossforschung in neuen Dimensionen. Denker unserer Zeit ueber die aktuelle Elementarteilchenphysik am CERN

    Energy Technology Data Exchange (ETDEWEB)

    Kommer, Christoph (ed.) [Heidelberg Univ. (Germany); DKFZ, Heidelberg (Germany); Satz, Helmut [Bielefeld Univ. (Germany). Fakultaet fuer Physik; Blanchard, Philippe [Bielefeld Univ. (Germany). Abt. Theoretische Physik

    2016-07-01

    The following topics are dealt with: Research from the highest energies to the smallest particles at CERN, the laborious way to the Large Hadronic Collider, CERN as accelerator of techniques, culture, and society, a philosophical and sociological perspective of questions concerning CERN, quark matter research at CERN, the FAIR facility for antiproton and ion research. (HSI)

  8. Relativistic heavy ion research at Berkeley

    International Nuclear Information System (INIS)

    Anon.

    1981-01-01

    The project of a superconducting synchrotron for heavy ions with 1 TeV/amu is described. In this connection the physics is discussed which can be studied by this accelerator. Furthermore, the HISS-heavy ion spectrometer system and the Plastic Ball detector are described. (HSI).

  9. Nonlinear scalar field equations. Pt. 1

    International Nuclear Information System (INIS)

    Berestycki, H.; Lions, P.L.

    1983-01-01

    This paper as well as a subsequent one is concerned with the existence of nontrivial solutions for some semi-linear elliptic equations in Rsup(N). Such problems are motivated in particular by the search for certain kinds of solitary waves (stationary states) in nonlinear equations of the Klein-Gordon or Schroedinger type. (orig./HSI)

  10. Ultrarelativistic heavy-ion collisions. Proceedings of the International Workshop XXX on Gross Properties of Nuclei and Nuclear Excitations

    International Nuclear Information System (INIS)

    Buballa, M.; Noerenberg, W.; Schaefer, B.J.; Wambach, J.

    2002-01-01

    The following topics were dealt with: Experimental results on ultrarelativistic heavy ion collisions, QCD thermodynamics, equilibration in relativistic heavy ion collisions, lattice QCD, space- time evolution and Hanbury-Brown-Twiss correlations, vector meson production, high-p T and small-x physics. (HSI)

  11. An experimental study of a new multi-bunch damping mechanism in PETRA

    International Nuclear Information System (INIS)

    Heins, D.; Kohaupt, R.D.; Kriens, W.; Leneke, M.; Matthiesen, K.H.; Musfeldt, H.; Paetzold, S.

    1986-12-01

    In this article we describe the experiment which has been performed in PETRA in order to demonstrate the existence of the damping mechanism based on a combination of a narrow-band feedback system and frequency splitting between bunches. (orig./HSI)

  12. Scientific annual report 1979 DESY

    International Nuclear Information System (INIS)

    In this annaual report the experiments at the storage rings PETRA and DORIS as well at the other DESY accelerators together with the synchrotron radiation experiments are described. Furthermore some developments in data processing in medicine and new detection methods are considered. In addition a list of publications and speeches is given. (HSI) [de

  13. Institut fuer Kernchemie, Univ. Mainz. Annual report 1983

    International Nuclear Information System (INIS)

    Weber, M.

    1984-01-01

    This annual report contains extended abstracts about the work performed at the named institute together with a list of publications and speeches. The work concern fast chemical separations, the detection of short-lived nuclides, mass separations, nuclear spectroscopy, nuclear fission, heavy ion research, superheavy elements, radionuclide ecology, and the operation of the TRIGA Mainz reactor. (HSI) [de

  14. Central detectors

    International Nuclear Information System (INIS)

    Wagner, A.

    1980-09-01

    The author gives a review about the drift chambers used at the PETRA storage ring. Especially he discusses the conditions which limit the spatial resolution of these chambers. Furthermore he describes the electronics of these chambers. Finally he comments the particle identification through measurement of the energy losses in the drift chamber as well as the calibration of this chamber. (HSI)

  15. Acculturation-Related Stress and Mental Health Outcomes among Three Generations of Hispanic Adolescents

    Science.gov (United States)

    Cervantes, Richard C.; Padilla, Amado M.; Napper, Lucy E.; Goldbach, Jeremy T.

    2013-01-01

    Stress associated with acculturation and minority status among Hispanic youth is understudied. Using survey data from the Hispanic Stress Inventory-Adolescent Version (HSI-A), we examined psychosocial stress across eight domains including family economic stress and acculturation-gap stress in a national sample of three generations (first, second,…

  16. Examining Difference in Immigration Stress, Acculturation Stress and Mental Health Outcomes in Six Hispanic/Latino Nativity and Regional Groups.

    Science.gov (United States)

    Cervantes, Richard C; Gattamorta, Karina A; Berger-Cardoso, Jodi

    2018-02-27

    Little is known about the specific behavioral health impact of acculturation stressors that affect Hispanic/Latino immigrant sub-groups. These immigration-related stressors and traumatic events may have differential impact on depression depending on country/region of origin. Using a measure of immigration and acculturation stress, the current study sought to determine differences in the impact of stress on six sub-groups of Hispanic immigrants. Data on stress and depression were examined using a large, representative adult immigrant sample (N = 641). Controlling for age, gender and years in the US, factorial analysis of covariance revealed significant differences on total Hispanic Stress Inventory 2 (HSI2) stress appraisal scores based on country/region of origin. Pair wise comparisons between country/region of origin groups revealed that Mexicans had higher levels of stress compared to Cuban or Dominican immigrants. Several patterns of differential stress were also found within sub-domains of the HSI2. Using regression models, HSI2 stress appraisals and their interaction with country of origin proved to not be significant predictors of depression (PHQ9), while gender and age were significant. Differences in HSI2 stress that are based on nativity may be moderated by cultural resilience that ultimately serves a protective role to prevent the onset of depression.

  17. Scattering theory and automorphic functions

    International Nuclear Information System (INIS)

    Lachaud, G.

    1982-01-01

    After a consideration of the Fourier expansion of an automorphic function corresponding to the group SL(2,R) and a description of the Eisenstein series the author describes the application of these results to the quantum mechanical scattering theory using the group SO(2,R). (HSI)

  18. SIMCON 3.1. LLRF system control board measurements (for TESLA Test Facility)

    International Nuclear Information System (INIS)

    Pietrasik, R.

    2006-03-01

    The SIMCON control systems for superconducting cavity resonators are described. These systems consist of analog and digital I/O systems, a clock system, an Ethernet link, optical input systems, a RS232 interface, a VME section with booting FPGA devices, and a Virtex2Pro section. The measurements of different parameters by this system are described. (HSI)

  19. Argus-Fest. 20 years of B meson mixing 1987-2007. Proceedings

    Energy Technology Data Exchange (ETDEWEB)

    Lehner, F; Faverot-Spengler, S [eds.

    2007-11-15

    The following topics were dealt with: ARGUS data, launching DORIS and ARGUS, B physics, discovery of B mixing, sociology of the ARGUS collaboration, CLEO B physics, from ARGUS to B-meson factories, the B factory era, B physics at the Tevatron, future of B physics programs, future of flavour physics. (HSI)

  20. Argus-Fest. 20 years of B meson mixing 1987-2007. Proceedings

    International Nuclear Information System (INIS)

    Lehner, F.; Faverot-Spengler, S.

    2007-11-01

    The following topics were dealt with: ARGUS data, launching DORIS and ARGUS, B physics, discovery of B mixing, sociology of the ARGUS collaboration, CLEO B physics, from ARGUS to B-meson factories, the B factory era, B physics at the Tevatron, future of B physics programs, future of flavour physics. (HSI)

  1. Gross properties of nuclei and nuclear excitations

    International Nuclear Information System (INIS)

    Feldmeier, H.

    1991-01-01

    These proceedings contain the articles presented at the named workshop. They deal with nuclear multifragmentation, heavy ion reaction kinetics, breakup and transfer processes in heavy ion reactions, the production of hypernuclei, nuclear structure in the framework of the quark model and QCD, and particle production in nuclear reactions. (HSI)

  2. Quantum mechanics. Textbook for students of physics, mathematics and physical chemistry. 4. ed. Quantenmechanik. Studienbuch fuer Studierende der Physik, Mathematik und Physikalischen Chemie

    Energy Technology Data Exchange (ETDEWEB)

    Grawert, G.

    1985-01-01

    The aim of the textbook now present in fourth edition is the representation of the fundamental physical concepts of the theory of quantum mechanics. It is confined to the nonrelativistic quantum mechanics; however also themes are treated which are in an extended form important just for quantum field theory up to the modern development. (orig./HSI). With 22 figs.

  3. Heidelberg physicists report. Vol. 2. Reviews of research in physics and astronomy. Fundamental contributions to the physics of the atomic nuclei and the star atmospheres

    International Nuclear Information System (INIS)

    Appenzeller, Immo; Dubbers, Dirk; Siebig, Hans-Georg; Winnacker, Albrecht

    2018-01-01

    The following topics are dealt with: 50 years theoretical astrophysics, nuclear physics after the discovery of the shell model, from the small van de Graaf to the large HERA, from ''chamber physics'' to big research, reminiscences on physical research in Heidelberg. (HSI)

  4. Shape coexistence in light Xe-isotopes

    International Nuclear Information System (INIS)

    Gast, K.F.W.

    1982-01-01

    There are essentially four regions of problems which are discussed in the framework of this thesis. They can be entitled as follows: Backbending and the nature of the S-band, Nuclear softness and shape coexistence, the validity of the IBA-approximation, and the boson cutoff effect. (orig./HSI) [de

  5. Lepton-nucleon scattering

    International Nuclear Information System (INIS)

    Windmolders, R.

    1989-01-01

    In this paper the following topics are reviewed: 1. the structure functions measured in deep inelastic e-N, μ-N and ν-N scattering; 2. nuclear effects on the structure functions; 3. nuclear effects on the fragmentation functions; 4. the spin dependent structure functions and their interpretation in terms of nucleon constituents. (orig./HSI)

  6. Physics at the CERN collider using a ''minimum bias'' trigger

    International Nuclear Information System (INIS)

    Arnison, G.; Astbury, A.; Grayer, G.; Haynes, W.J.; Nandi, A.K.; Roberts, C.; Scott, W.; Shah, T.P.; Bezaguet, A.; Boeck, R.; Calvetti, M.; Carroll, T.; Cennini, P.; Centro, S.; Ceradini, F.; Cittolin, S.; Demoulin, M.; DiBitinto, D.; Ellis, N.; Hoffmann, H.; Jank, W.; Jorat, G.; Kowalski, H.; Kryn, D.; Lacava, F.; Markiewicz, T.; Maurin, G.; Muirhead, H.; Muller, F.; Naumann, L.; Norton, A.; Petrucci, G.; Placci, A.; Revol, J.P.; Rijssenbeek, M.; Rohlf, J.; Rossi, P.; Rubbia, C.; Sadoulet, B.; Schinzel, D.; Tao, C.; Timmer, J.; Meer, S. van der; Vialle, J.P.; Vuillemin, V.; Xie, G.Y.; Zurfluh, E.; Cochet, C.; DeBeer, M.; Denegri, D.; Givernaud, A.; Laugier, J.P.; Leveque, A.; Locci, E.; Loret, M.; Malosse, J.J.; Rich, J.; Sass, R.; Saudraix, J.; Savoy-Navarro, A.; Spiro, M.; Dobrzynski, L.; Fontaine, G.; Geer, S.; Ghesquiere, C.; Giraud-Heraud, Y.; Mendiburu, J.P.; Orkin-Lecourtois, A.; Sajot, G.; Vrana, J.; Bacci, C.; Bowcock, T.J.V.; Corden, M.; Dallman, D.; Di Ciaccio, A.; Dowell, J.D.; Edwards, M.; Eggert, K.; Eisenhandler, E.; Erhard, P.; Faissner, H.; Frey, R.; Fruehwirth, R.; Garvey, J.; Giboni, K.L.; Gibson, W.R.; Gutierrez, P.; Hansl-Kozanecka, T.; Hodges, C.; Hoffmann, D.; Homer, R.J.; Honma, A.; Kalmus, P.I.P.; Karimaeki, V.; Keeler, R.; Kenyon, I.; Kernan, A.; Kinnunen, R.; Kozanecki, W.; Lehmann, H.; Leuchs, K.; McMahon, T.; Moricca, M.; Paoluzi, L.; Piano Mortari, G.; Pimiae, M.; Radermacher, E.; Ransdell, J.; Reithler, H.; Salvi, G.; Salvini, G.; Strauss, J.; Sumorok, K.; Szoncso, F.; Smith, D.; Thompson, G.; Tscheslog, E.; Tuominiemi, J.; Wahl, H.D.; Watkins, P.; Wilson, J.

    1983-01-01

    In this paper the physics of the events collected using this ''minimum bias trigger'' is described. After a brief description of the detector, I present results concerning particle production (pseudorapidity distributions, multiplicity and KNO scaling). Transverse energy distributions, long and short range correlations, and finally high psub(t) physics and jets. (orig./HSI)

  7. MPI fuer Physik und Astrophysik. Werner-Heisenberg-Institut fuer Physik - annual report 1983

    International Nuclear Information System (INIS)

    1983-12-01

    This annual report contains short description of the work performed at the named institute together with a list of publications and speeches. The work concerns experiments at CERN and at the storage rings PETRA and CESR, theoretical work on unified field theories and supersymmetry, as well as developments of the ALEPH detector for the LEP storage ring. (HSI) [de

  8. Report on the results of research and development work 1983

    International Nuclear Information System (INIS)

    1984-02-01

    In this annual report the work performed at the named institute is described. This work concerns experiments with fast neutrons, studies of the e + e - interaction at PETRA, and the development of the spallation neutron source of the Rutherford Laboratory. Furthermore a list at publications is added. (HSI) [de

  9. Determination of the average lifetime of bottom hadrons

    Energy Technology Data Exchange (ETDEWEB)

    Althoff, M; Braunschweig, W; Kirschfink, F J; Martyn, H U; Rosskamp, P; Schmitz, D; Siebke, H; Wallraff, W; Eisenmann, J; Fischer, H M

    1984-12-27

    We have determined the average lifetime of hadrons containing b quarks produced in e e annihilation to be tausub(B)=1.83x10 S s. Our method uses charged decay products from both non-leptonic and semileptonic decay modes. (orig./HSI).

  10. Accurate reconstruction of hyperspectral images from compressive sensing measurements

    Science.gov (United States)

    Greer, John B.; Flake, J. C.

    2013-05-01

    The emerging field of Compressive Sensing (CS) provides a new way to capture data by shifting the heaviest burden of data collection from the sensor to the computer on the user-end. This new means of sensing requires fewer measurements for a given amount of information than traditional sensors. We investigate the efficacy of CS for capturing HyperSpectral Imagery (HSI) remotely. We also introduce a new family of algorithms for constructing HSI from CS measurements with Split Bregman Iteration [Goldstein and Osher,2009]. These algorithms combine spatial Total Variation (TV) with smoothing in the spectral dimension. We examine models for three different CS sensors: the Coded Aperture Snapshot Spectral Imager-Single Disperser (CASSI-SD) [Wagadarikar et al.,2008] and Dual Disperser (CASSI-DD) [Gehm et al.,2007] cameras, and a hypothetical random sensing model closer to CS theory, but not necessarily implementable with existing technology. We simulate the capture of remotely sensed images by applying the sensor forward models to well-known HSI scenes - an AVIRIS image of Cuprite, Nevada and the HYMAP Urban image. To measure accuracy of the CS models, we compare the scenes constructed with our new algorithm to the original AVIRIS and HYMAP cubes. The results demonstrate the possibility of accurately sensing HSI remotely with significantly fewer measurements than standard hyperspectral cameras.

  11. Experimental radiotherapy and clinical radiobiology. Vol. 16; Experimentelle Strahlentherapie und Klinische Strahlenbiologie. Bd. 16. Proceedings

    Energy Technology Data Exchange (ETDEWEB)

    Baumann, M; Dahm-Daphi, J; Dikomey, E; Petersen, C; Rodemann, H P; Zips, D [eds.

    2007-07-01

    The following topics were dealt with: DNA repair as therapeutical target in radiation therapy, biological imaging and tumor microenvironment, molecular factors of radiation therapy, molecular factors and modulation of the radiation reaction of normal tissues, experimental tumor therapy, EGFR inhibition, the endothel cell as primary target of radiation therapy, molecular and cellular foundations of the radiation biology of protons and ions. (HSI)

  12. Resonances, resonance functions and spectral deformations

    International Nuclear Information System (INIS)

    Balslev, E.

    1984-01-01

    The present paper is aimed at an analysis of resonances and resonance states from a mathematical point of view. Resonances are characterized as singular points of the analytically continued Lippman-Schwinger equation, as complex eigenvalues of the Hamiltonian with a purely outgoing, exponentially growing eigenfunction, and as poles of the S-matrix. (orig./HSI)

  13. Natural sciences in the focus IV. Foundations of atomistics, quantum mechanics, and chemistry; Naturwissenschaften im Fokus IV. Grundlagen der Atomistik, Quantenmechanik und Chemie

    Energy Technology Data Exchange (ETDEWEB)

    Petersen, Christian

    2017-07-01

    The following topics are dealt with: The electronic structure of the atom, the structure of the atomic nucleus together with radioactive decays, fission, and fusion, the elementary particles together with the standard model, the atomistic foundations of chemistrytogether with the binding types, and inorganic and organic chemistry. (HSI)

  14. Heidelberg physicists report. Vol. 1. Reviews of research in physics and astronomy. Ways to the modern physics; Heidelberger Physiker berichten. Bd. 1. Rueckblicke auf Forschung in der Physik und Astronomie. Wege zur modernen Physik

    Energy Technology Data Exchange (ETDEWEB)

    Appenzeller, Immo; Dubbers, Dirk; Siebig, Hans-Georg; Winnacker, Albrecht (eds.)

    2017-07-01

    The following topics are dealt with: Memories of the physics from 1945 until 1970, from the atomic nucleus until the fission of uranium, the emergence of the physics of the atomic nuclei, 43 years of elementary-particle physics, 60 years of research, elementary particles and forces of physics. (HSI)

  15. Content-Based Image Retrieval Benchmarking: Utilizing color categories and color distributions

    NARCIS (Netherlands)

    van den Broek, Egon; Kisters, Peter M.F.; Vuurpijl, Louis G.

    From a human centered perspective three ingredients for Content-Based Image Retrieval (CBIR) were developed. First, with their existence confirmed by experimental data, 11 color categories were utilized for CBIR and used as input for a new color space segmentation technique. The complete HSI color

  16. On Noethers theorem in quantum field theory

    International Nuclear Information System (INIS)

    Buchholz, D.; Doplicher, S.; Longo, R.

    1985-03-01

    Extending an earlier construction of local generators of symmetries in (S. Doplicher, 1982) to space-time and supersymmetries, we establish a weak form of Noethers theorem in quantum field theory. We also comment on the physical significance of the 'split property', underlying our analysis, and discuss some local aspects of superselection rules following from our results. (orig./HSI)

  17. Mayer expansions for Euclidean lattice field theory: Convergence properties and relation with perturbation theory

    International Nuclear Information System (INIS)

    Pordt, A.

    1985-10-01

    The author describes the Mayer expansion in Euclidean lattice field theory by comparing it with the statistical mechanics of polymer systems. In this connection he discusses the Borel summability and the analyticity of the activities on the lattice. Furthermore the relations between renormalization and the Mayer expansion are considered. (HSI)

  18. A look at LEP

    International Nuclear Information System (INIS)

    Anon.

    1986-01-01

    While work on the tunnel linking England and France under the English Channel has not yet begun, the 26.6 kilometre ring being built at CERN for the LEP electron-positron collider is one of Europe's major engineering projects. (orig./HSI).

  19. Kernforschungsanlage Juelich, Institut fuer Kernphysik: Annual report 1983

    International Nuclear Information System (INIS)

    Baur, G.; Mayer-Boericke, C.; Schult, O.; Seyfarth, H.; Speth, J.; Turek, P.

    1984-04-01

    This annual report contains extended abstracts of the work performed at the named institute together with a list of publications. The abstracts deal with nuclear reactions, nuclear spectroscopy, atomic collisions, solar energy, and technical developments. See hints under the relevant topics. (HSI) [de

  20. High energy physics and nuclear structure

    International Nuclear Information System (INIS)

    Measday, D.F.; Thomas, A.W.

    1980-01-01

    These proceedings contain the papers presented at the named conference. These concern eletromagnetic interactions, weak interactions, strong interactions at intermediate energy, pion reactions, proton reactions, strong interactions at high energy, as well as new facilities and applications. See hints under the relevant topics. (HSI)

  1. Stanford's linear collider

    International Nuclear Information System (INIS)

    Southworth, B.

    1985-01-01

    The peak of the construction phase of the Stanford Linear Collider, SLC, to achieve 50 GeV electron-positron collisions has now been passed. The work remains on schedule to attempt colliding beams, initially at comparatively low luminosity, early in 1987. (orig./HSI).

  2. Vector and parallel processors in computational science

    International Nuclear Information System (INIS)

    Duff, I.S.; Reid, J.K.

    1985-01-01

    These proceedings contain the articles presented at the named conference. These concern hardware and software for vector and parallel processors, numerical methods and algorithms for the computation on such processors, as well as applications of such methods to different fields of physics and related sciences. See hints under the relevant topics. (HSI)

  3. Annual report 1981

    International Nuclear Information System (INIS)

    1982-01-01

    In this annual report the work done at the named Institute is described. This concerns particle and fields in the solar system, infrared astronomy, X-ray astronomy, γ-astronomy, and molecule spectroscopy. A list of publications is added. (HSI)

  4. GSI scientific report 2004

    Energy Technology Data Exchange (ETDEWEB)

    Grosse, K [ed.

    2005-07-01

    the following topics are dealt with: The FAIR project, nuclear structure studies, nuclear and quark matter experiments, search for superheavy elements, atomic, plasma, and solid-state physics with heavy ions, radiation research and biophysics with heavy ions, accelerator operations and developments, radiation detection, cancer therapy with ion beams. (HSI)

  5. GSI scientific report 1985

    International Nuclear Information System (INIS)

    Grundinger, U.

    1986-03-01

    This annual report contains extended abstracts about the work performed at the named institute concerning nuclear physics, atomic physics, radiation effects, and developments in counting techniques and accelerator technology, as well as a list of publications, conference contributions, seminars, and lectures. (HSI) [de

  6. GSI scientific report 1987

    International Nuclear Information System (INIS)

    Grundinger, U.

    1988-03-01

    In this annual report extended abstracts are presented of the work performed at the named institute. They are concerned with nuclear structure studies of exotic nuclei and high spin states, heavy ion reactions, nuclear theory, positron production in heavy ion collisions, radiation effects in biological systems and solids, nuclear chemistry, experimental techniques, and accelerator developments. (HSI)

  7. GSI scientific report 1988

    International Nuclear Information System (INIS)

    Grundinger, U.

    1989-03-01

    This annual report contains extended abstracts about the work performed at the named institute. It concerns nuclear structure studies, heavy ion reactions, nuclear theory, atomic collisions, radiation effects in biological systems and solids, nuclear chemistry, as well as developments in counting techniques and accelerators. (HSI)

  8. Mind over matter: The intellectual content of experimental physics

    International Nuclear Information System (INIS)

    Telegdi, V.L.

    1990-01-01

    The author presents a new way of teaching experimental physics using Selenyi's experiment on dipole radiation, Michelson's optical demonstration of the earth rotation, the direct measurement of the helicity of the electron neutrino by Goldhaber, grodzins, and Sunyar and the determination of the helicity of the muonic neutrino by Grenas et al. (HSI)

  9. PHOTON09. Proceedings of the international conference on the structure and interactions of the photon including the 18th international workshop on photon-photon collisions and the international workshop on high energy photon linear colliders

    Energy Technology Data Exchange (ETDEWEB)

    Behnke, Olaf; Diehl, Markus; Schoerner-Sadenius, Thomas; Steinbrueck, Georg [eds.

    2010-01-15

    The following topics were dealt with: Electroweak and new physics, photon-collider technology, low-energy photon experiments, prompt photons, photon structure, jets and heavy flavours, vacuum polarization and light-by-light scattering, small-x processes, diffraction, total cross sections, exclusive channels and resonances, photons in astroparticle physics. (HSI)

  10. Quantum information. Teleportation - cryptography - quantum computer

    International Nuclear Information System (INIS)

    Koenneker, Carsten

    2012-01-01

    The following topics are dealt with: Reality in the test facility, quantum teleportation, the reality of quanta, interaction-free quantum measurement, rules for quantum computers, quantum computers with ions, spintronics with diamond, the limits of the quantum computers, a view in the future of quantum optics. (HSI)

  11. Nucleus fragmentation induced by a high-energy hadron. Pt. 2

    International Nuclear Information System (INIS)

    Zielinski, P.

    1981-09-01

    The author compares some experimental results concerning the emission of 8 Li nuclei in hadron induced reactions from nuclear emulsions. Especially he considers the vanishing of the Coulomb barrier, fission-like processes, and the rise of the heavy fragment yield with energy-transfer. (HSI) [de

  12. International conference on fifty years research in nuclear fission

    International Nuclear Information System (INIS)

    1989-02-01

    These proceedings contain extended abstracts of the papers presented at the named conference. They deal with static properties of fission, instrumentation for fission studies, fission in compound-nucleus reactions, fission dynamics, fission-like heavy ion reactions, and fusion reactions. See hints under the relevant topics. (HSI)

  13. Beta spectroscopy on neutron-rich nuclei of mass 93<=A<=100

    International Nuclear Information System (INIS)

    Pahlmann, B.

    1982-01-01

    In the present thesis for the first time measurements of the Qsub(β) value of the neutron-rich fission products sup(99,100)Sr and 99 Rb were performed. Preliminary results could be obtained on the beta decays of the nuclides 100 Rb and 100 Y. (orig./HSI) [de

  14. Separating spectral mixtures in hyperspectral image data using independent component analysis: validation with oral cancer tissue sections

    Science.gov (United States)

    Duann, Jeng-Ren; Jan, Chia-Ing; Ou-Yang, Mang; Lin, Chia-Yi; Mo, Jen-Feng; Lin, Yung-Jiun; Tsai, Ming-Hsui; Chiou, Jin-Chern

    2013-12-01

    Recently, hyperspectral imaging (HSI) systems, which can provide 100 or more wavelengths of emission autofluorescence measures, have been used to delineate more complete spectral patterns associated with certain molecules relevant to cancerization. Such a spectral fingerprint may reliably correspond to a certain type of molecule and thus can be treated as a biomarker for the presence of that molecule. However, the outcomes of HSI systems can be a complex mixture of characteristic spectra of a variety of molecules as well as optical interferences due to reflection, scattering, and refraction. As a result, the mixed nature of raw HSI data might obscure the extraction of consistent spectral fingerprints. Here we present the extraction of the characteristic spectra associated with keratinized tissues from the HSI data of tissue sections from 30 oral cancer patients (31 tissue samples in total), excited at two different wavelength ranges (330 to 385 and 470 to 490 nm), using independent and principal component analysis (ICA and PCA) methods. The results showed that for both excitation wavelength ranges, ICA was able to resolve much more reliable spectral fingerprints associated with the keratinized tissues for all the oral cancer tissue sections with significantly higher mean correlation coefficients as compared to PCA (p<0.001).

  15. Calorimetric determination of the water energy dosis

    International Nuclear Information System (INIS)

    Krauss, Achim

    2013-01-01

    The water calorimeter of the PTB is described, which consists of a water phantom operated at 4 C, whereby the radiation-induced temperature raise is measured by means of thermistors. As application example the determination of the radiation-quality dependent k Q factors of ionization chambers for all medical accelerators present in the PTB is described. (HSI)

  16. Measurement of the radiation in the accelerator-therapy room

    International Nuclear Information System (INIS)

    Zutz, Hayo

    2013-01-01

    The measurement of the scattering radiation in the accelerator-therapy room of the PTB is described. The accelerators are commercial linear accelerators of the firm Elektra of the type ''Precise''. The measurements were performed by means of secondary-normal ionization chambers and a special measurement technique developed in the PTB both with and without the used beam. (HSI)

  17. Introduction to gauge theories

    International Nuclear Information System (INIS)

    Wit, B. de

    1983-01-01

    In these lectures we present the key ingredients of theories with local gauge invariance. We introduce gauge invariance as a starting point for the construction of a certain class of field theories, both for abelian and nonabelian gauge groups. General implications of gauge invariance are discussed, and we outline in detail how gauge fields can acquire masses in a spontaneous fashion. (orig./HSI)

  18. Basic course in theoretical physics. Vol. 1

    International Nuclear Information System (INIS)

    Dietze, H.D.

    1973-01-01

    This book is the first volume of an edition of two volumes which concern theoretical physics. In this volume the mechanics of a point mass, electric and magnetic fields, and the mechanics of two point, masses, rig: 1 bodies, and deformable 50 lids are considered. This book is suited for students who want to get some fundamental knowledge of theoretical physics. (HSI)

  19. Investigation of the hadronic final state in electron-proton interactions at HERA

    International Nuclear Information System (INIS)

    Dake, A.

    1995-01-01

    The main subject of this thesis is the study of the hardronic final state in deep-inelastic electron-proton scattering. Theexperiment described in this thesis is performed with such a high resolution that the substructure of the proton is probed by the electron beam with a resolution of less than 10 -15 cm. (orig./HSI)

  20. Experimental tests of gauge theories

    International Nuclear Information System (INIS)

    Haidt, D.

    1984-11-01

    This series of five lectures is intended to provide the experimental basis to the theoretical courses on gauge symmetries delivered by C. Jarlskog and R. Petronzio. The framework is the standard model. The experimental material is taken mainly from lepton-hadron and e + e - -experiments. (orig./HSI)

  1. Projection operator techniques in nonequilibrium statistical mechanics

    International Nuclear Information System (INIS)

    Grabert, H.

    1982-01-01

    This book is an introduction to the application of the projection operator technique to the statistical mechanics of irreversible processes. After a general introduction to the projection operator technique and statistical thermodynamics the Fokker-Planck and the master equation approach are described together with the response theory. Then, as applications the damped harmonic oscillator, simple fluids, and the spin relaxation are considered. (HSI)

  2. The SPS panti p collider

    International Nuclear Information System (INIS)

    Gareyte, J.

    1984-01-01

    The purpose of this lecture is to give a general idea of how the collider works. The fact that one of the beams is composed of scarce precious antiprotons imposes strong constraints on the operation of such a machine. Solutions to these specific problems will be described. (orig./HSI)

  3. Microprocessors: From basic chips to complete systems

    International Nuclear Information System (INIS)

    Dobinson, R.W.

    1985-01-01

    These lectures aim to present and explain in general terms some of the characteristics of microprocessor chips and associated components. They show how systems are synthesized from the basic integrated circuit building blocks which are currently available; processor, memory, input-output (I/0) devices, etc. (orig./HSI)

  4. Probing the Pomeron

    International Nuclear Information System (INIS)

    Albrow, M.; Donnachie, A.; Geist, W.; Landshoff, P.; Schlein, P.

    1986-01-01

    The authors present the results from experiments on elastic pp scattering at s=52.8 GeV and panti p scattering at s=52.6 GeV and s=546 GeV. All results show a dip in the differential cross section which is interpreted as resulting from Pomerons. (HSI).

  5. Unveiling multiple solid-state transitions in pharmaceutical solid dosage forms using multi-series hyperspectral imaging and different curve resolution approaches

    DEFF Research Database (Denmark)

    Alexandrino, Guilherme L; Amigo Rubio, Jose Manuel; Khorasani, Milad Rouhi

    2017-01-01

    Solid-state transitions at the surface of pharmaceutical solid dosage forms (SDF) were monitored using multi-series hyperspectral imaging (HSI) along with Multivariate Curve Resolution – Alternating Least Squares (MCR-ALS) and Parallel Factor Analysis (PARAFAC and PARAFAC2). First, the solid-stat...

  6. Werner Heisenberg. A traveller between two worlds

    International Nuclear Information System (INIS)

    Fischer, Ernst Peter

    2015-01-01

    The following topics are dealt with: A night in Helgoland, no quietude ever, smart quantum jumps, three teachers and their pupil, life with two worlds, a young professor, the Nobel prize and the time of the Nazis, the atomic nucleus and its energy, finally to Munich, steps over boundaries. (HSI)

  7. Hahn-Meitner-Institut Berlin, Ionenstrahllabor. Annual report 2004

    International Nuclear Information System (INIS)

    Roehrich, J.; Schiwietz, G.; Sielemann, R.

    2005-06-01

    The following topics are dealt with: Ion-molecule and ion-solid interactions, materials modification, materials analysis and structural determination, operation and developments of the accelerator facility, radiation dosimetry and therapy, nuclear-structure studies of the isotopoes 14,16,17 C. (HSI)

  8. Quantum information. Teleportation - cryptography - quantum computer; Quanteninformation. Teleportation - Kryptografie - Quantencomputer

    Energy Technology Data Exchange (ETDEWEB)

    Koenneker, Carsten (comp.)

    2012-11-01

    The following topics are dealt with: Reality in the test facility, quantum teleportation, the reality of quanta, interaction-free quantum measurement, rules for quantum computers, quantum computers with ions, spintronics with diamond, the limits of the quantum computers, a view in the future of quantum optics. (HSI)

  9. SIMCON 3.1. LLRF system control board measurements (for TESLA Test Facility)

    Energy Technology Data Exchange (ETDEWEB)

    Pietrasik, R.

    2006-07-15

    The SIMCON control systems for superconducting cavity resonators are described. These systems consist of analog and digital I/O systems, a clock system, an Ethernet link, optical input systems, a RS232 interface, a VME section with booting FPGA devices, and a Virtex2Pro section. The measurements of different parameters by this system are described. (HSI)

  10. KfA Institute of Nuclear Physics. Annual report 1987

    International Nuclear Information System (INIS)

    Gruemmer, F.; Kilian, K.; Schult, O.; Seyfarth, H.; Speth, J.; Turek, P.

    1988-04-01

    This annual report contains extended abstracts about the work performed at the named institute together with a list of publications and speeches. The work concerns nuclear reactions, nuclear spectroscopy, intermediate-energy physics, nuclear structure, developments of the isochronous cyclotron and the ISIS ion source, construction of spectrometers, detectors, and targets, computer development, counting electronics, and radiation protection. (HSI)

  11. Probing the time scale of asymmetric fission

    International Nuclear Information System (INIS)

    Kamanin, D.

    1999-12-01

    The author describes the measurement of the mass-energy distributions of fission fragments in the reactions 197 Au( 14 N,X) at 34 A.MeV and 232 Th( 7 Li,X) at 43 A.MeV. He presents results on the mass-asymmetry and excitation energy sharing. (HSI)

  12. Fluorescence hyperspectral imaging technique for the foreign substance detection on fresh-cut lettuce

    Science.gov (United States)

    Nondestructive methods based on fluorescence hyperspectral imaging (HSI) techniques were developed in order to detect worms on fresh-cut lettuce. The optimal wavebands for detecting worms on fresh-cut lettuce were investigated using the one-way ANOVA analysis and correlation analysis. The worm detec...

  13. Particles, fields, quanta. From quantum mechanics to the Standard Model of particle physics; Teilchen, Felder, Quanten. Von der Quantenmechanik zum Standardmodell der Teilchenphysik

    Energy Technology Data Exchange (ETDEWEB)

    Ecker, Gerhard [Wien Univ. (Austria). Fakultaet fuer Physik

    2017-07-01

    The following topics are dealt with: Physics around 1900, the way to quantum mechanics, quantum field theory with quantum electrodynamics as prototype, the crisis of quantum field theory, from the beta decay to the electroweak gauge theory, quantum chromodynamics as quantum field theory of the strong nuclear force, the standard model of the fundamental interactions, physics beyond the standard model. (HSI)

  14. FZR annual report 2003: Research for men and environment

    International Nuclear Information System (INIS)

    2004-01-01

    The following topics are dealt with: A multi-purpose experimental facility for the model development of two-phase flows, the first nuclear-physics experiments with bremsstrahlung at the ELBE accelerator, the molecular mechanisms of vision and general principles of the cellular signal processing, colloids in environment, protein oxidation and sickness, nondestructive study on glass pretiosa using proton beams. (HSI)

  15. FZR annual report 2003: Research for men and environment; FZR-Jahresbericht 2003: Forschung fuer Mensch und Umwelt

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2004-03-01

    The following topics are dealt with: A multi-purpose experimental facility for the model development of two-phase flows, the first nuclear-physics experiments with bremsstrahlung at the ELBE accelerator, the molecular mechanisms of vision and general principles of the cellular signal processing, colloids in environment, protein oxidation and sickness, nondestructive study on glass pretiosa using proton beams. (HSI)

  16. Action-at-a-distance formulation of field theories for atomic nuclei

    International Nuclear Information System (INIS)

    Feldmeier, H.

    1994-06-01

    The author presents a Lagrangian describing the long-range attraction between nucleons by a scalar fields and the short-range repusion by a vector field. Also a relativistic time-dependent mean-field theory for the description of heavy ion reactions is considered in this framework. (HSI)

  17. 75 FR 26947 - Office of Postsecondary Education: Overview Information: Developing Hispanic-Serving Institutions...

    Science.gov (United States)

    2010-05-13

    .../cfr/waisidx_01/34cfr606_01.html . These regulations do not reflect the changes made to the HSI Program... either 12 point or larger or no smaller than 10 pitch (characters per inch). Use one of the following... remains after applying the tiebreaker mechanism above, priority will be given (a) for Individual...

  18. The superquantum theory. Candidate for the theory of everything. 2. ed.

    International Nuclear Information System (INIS)

    Bulut, Shevkinaz; Gorgels, Arno

    2008-05-01

    The following topics are dealt with: The search for the universal concept of the world formula, starting of the new physics era by the superquantum theory, number distance and potential field, set theory, the possible solution of the century problem of Cantor, gravitation, derivation of the imaginary unit j 2 =-1, background noise, eigenspaces, unification of the natural forces. (HSI)

  19. Physics 87

    International Nuclear Information System (INIS)

    Anon.

    1987-01-01

    A historical review about the physical research in the years 1687, 1887, and 1987 is given. In this connection the confirmation of Newton's Principia by Halley, the Michelson experiment, the discovery of radiowaves by Hertz, and the recent observation of a supernova are mentioned. (HSI).

  20. The goal of theoretical physics

    International Nuclear Information System (INIS)

    Hawking, S.

    1981-01-01

    After a short historical review the author describes the motivations for constructing unified field theories. Furthermore he describes the current efforts to unify the electroweak picture with that of quark dynamics. Finally he considers the problem of unifying the gravitational interactions with the other interactions. (HSI).

  1. Particle physics and cosmology

    International Nuclear Information System (INIS)

    Ellis, J.; Nanopoulos, D.

    1983-01-01

    The authors describe the connection between cosmology and particle physics in an introductory way. In this connection the big bang theory and unified gauge models of strong, electromagnetic, and weak interactions are considered. Furthermore cosmological nucleosynthesis is discussed in this framework, and the problem of cosmic neutrinos is considered with special regards to its rest mass. (HSI).

  2. HMI Section of Nuclear and Radiation Physics - annual report 1987

    International Nuclear Information System (INIS)

    1988-01-01

    This annual report contains extended abstracts of the scientific work performed at the named institute together with a list of publications and talks. The scientific work is concerned with the theory of nuclear and atomic processes with heavy ions, the experimental study of heavy ion reactions, nuclear structure studies, nuclear solid-state physics, atomic collisions, and the operation of VICKSI. (HSI)

  3. Beam and spin dynamics of hadron beams in intermediate-energy ring accelerators

    International Nuclear Information System (INIS)

    Lehrach, Andreas

    2008-01-01

    In this thesis beam and spin dynamics of ring accelerators are described. After a general theoretical treatment methods for the beam optimization and polarization conservation are discussed. Then experiments on spin manipulation at the COSY facility are considered. Finally the beam simulation and accelerator lay-out for the HESR with regards to the FAIR experiment are described. (HSI)

  4. Programme budget 1980

    International Nuclear Information System (INIS)

    1979-10-01

    The fields of research done in the Hahn-Meitner institute are described. These concern heavy ion physics, radiation and photochemistry, solid state physics, radiochemistry, data processing and nuclear electronics. In addition some facts concerning the infrastructure and financial planning are presented. (HSI)

  5. GSI research and development program 1989

    International Nuclear Information System (INIS)

    1989-01-01

    In the year 1989 the SIS will come into operation and the erection of the ESR will be finished. The construction of a new uranium injector for an independent low-energy program at UNILAC has begun. Furthermore the UNILAC is available for the SIS injection and an experimental low-energy program confined by this. (orig./HSI) [de

  6. Energy-Atlas Bavaria. Route planner for your energy transformation; Energie-Atlas Bayern. Routenplaner fuer Ihre Energiewende

    Energy Technology Data Exchange (ETDEWEB)

    Schneider, Michael [Bayerisches Landesamt fuer Umwelt, Augsburg (Germany). Oekoenergie-Institut; Bock, Melanie; Bleckmann, Friederike [Bayerisches Landesamt fuer Umwelt, Augsburg (Germany). Ref. 12 Kommunikation, internationale Zusammenarbeit

    2012-02-15

    The energy-atlas offers among others following contents: Overview about facilities for the production of renewable energies, favorable and less favorable sites for the production of renewable energies, foundations for the planning, contact persons and examples from practice, informations on technologies, fundings, and authorizations, tips for the correct proceeding in the application of renewable energies. (HSI)

  7. GSI research and development programme 1983-85

    International Nuclear Information System (INIS)

    1982-01-01

    In this report the research program of the GSI Darmstadt is described. This program concerns heavy ion reactions, atomic collisions with heavy ions, and applications of heavy ion beams in other fields of science. Furthermore the future development of accelerators and detection methods is described. (HSI) [de

  8. Introduction to the electroweak theory

    International Nuclear Information System (INIS)

    Paschos, E.A.

    1982-08-01

    The author gives an introduction to the Weinberg-Salam theory. After a description of the electromagnetic and weak currents the construction of the theory on the base of the Yang-Mills theory using the Higgs mechanisms is described. Then some predictions of this theory are presented. Finally the renormalization is discussed. (HSI)

  9. Nuclear reactions with large momentum transfers as a source of information about multiquark states in nuclei

    International Nuclear Information System (INIS)

    Baldin, A.M.

    1985-01-01

    We give a criterion which picks out a region of nuclear reactions where the quark-gluon degrees of freedom are predominant. The aim of the present talk is to show that the study of this region gives evidence of the quark-parton structure functions of nuclei as independent (irreducible to one-nucleon) objects of hadron physics. (orig./HSI)

  10. Particle localization using fibre optic hodoscopes

    International Nuclear Information System (INIS)

    Blumenfeld, H.; Bourdinaud, M.; Theevenin, J.C.

    1985-01-01

    The purpose of this talk is to give a brief tour of different detectors whose design is at present being actively pursued at Saclay, with an emphasis being placed on the problems encountered from the point of view of fiber technology. (orig./HSI)

  11. Hispanic Graduate Students' Mentoring Themes: Gender Roles in a Bicultural Context

    Science.gov (United States)

    Rudolph, Bonnie A.; Castillo, Carlos P.; Garcia, Vanessa G.; Martinez, Alina; Navarro, Fernando

    2015-01-01

    Male and female focus groups at a Hispanic Serving Institution (HSI) discussed mentoring of Hispanic graduate students. Using Thematic Analysis, investigators identified three main themes: Relationship Initiation and Development, Valued Relationship Qualities, and Context and Barriers. Relationship themes included mentor openness, trust,…

  12. An analysis of the habitat of the Greater One-horned Rhinoceros Rhinoceros unicorns (Mammalia: Perissodactyla: Rhinocerotidae at the Chitwan National Park, Nepal

    Directory of Open Access Journals (Sweden)

    V. Thapa

    2014-09-01

    Full Text Available We used Geographic Information Systems (GIS and landscape-level data obtained from remote sensing sources to build a habitat suitability index model (HSI for the Greater One-horned Rhinoceros Rhinoceros unicornis. The model was based primarily on important habitat requisites of the modeled species, especially food and cover. We extracted food and cover from land cover map and ran focal statistics to determine their proportion in a neighborhood of 70x70 pixels that accounts for the animal’s average mean annual home range, which is ~4km2 = 400 ha = 70x70 pixels x 900 m2 = 4410000/10000 = 441 ha. We used two arbitrarily selected parameters a and Tc to observe the impacts of food and cover on the HSI. We performed sensitivity analysis by varying values of parameters around their nominal, which revealed that the HSI value of a pixel is changed with uncertainty with very low values of a fraction of the food or cover. We identified four habitat types from the HSI map. We used patch and class metrics of FRAGSTATS program to estimate the amount and fragmentation of each habitat type. The metrics provided composition and configuration status for all four habitat types. We found a presence of a total of 476 patches with 517.82km2 belonging to suitable habitat type. These areas can be targeted for management, monitoring and improvement to provide habitat for the target and sympatric species.

  13. Institut fuer Festkoerperforschung. Scientific report 2006

    International Nuclear Information System (INIS)

    2006-01-01

    The following topics are dealt with: Quantum theory of materials, theoretical soft matter and biophysics, theory of structure formation, scattering methods, neutron scattering, electronic materials, soft condensed matter, microstructure, electronic properties, condensed matter physics, information technology with nanoelectronic systems, large-scale facilities for research with photons, neutrons, and ions. (HSI)

  14. Synchrotron radiation facilities at DESY, a status report

    International Nuclear Information System (INIS)

    Koch, E.E.

    1979-12-01

    A short summary of the developments which have led to the present extensive use of Synchrotron Radiation at DESY is presented and a description of the Synchrotron Radiation facilities presently available and under development is given with emphasis on the new HASYLAB project at the storage ring DORIS. (orig.) 891 HSI/orig. 892 MKO

  15. Grand unified theories. Pt. 2

    International Nuclear Information System (INIS)

    Ellis, J.

    1982-01-01

    The author gives an introduction to the construction of grand unified theories on the base of the SU(3)xSU(2)xU(1) model of the strong, weak, and electromagnetic interactions. Especially he discusses the proton decay, neutrino masses and oscillations, and cosmological implications in connection with grand unified theories. (orig./HSI)

  16. Multiscale habitat suitability index models for priority landbirds in the Central Hardwoods and West Gulf Coastal Plain/Ouachitas Bird Conservation Regions

    Science.gov (United States)

    John M. Tirpak; D. Todd Jones-Farrand; Frank R., III Thompson; Daniel J. Twedt; William B., III Uihlein

    2009-01-01

    Habitat Suitability Index (HSI) models were developed to assess habitat quality for 40 priority bird species in the Central Hardwoods and West Gulf Coastal Plain/Ouachitas Bird Conservation Regions. The models incorporated both site and landscape environmental variables from one of six nationally consistent datasets. Potential habitat was first defined from unique...

  17. Quantum matter

    International Nuclear Information System (INIS)

    Buechler, Hans Peter; Calcarco, Tommaso; Dressel, Martin

    2008-01-01

    The following topics are dealt with: Artificial atoms and molecules, tailored from solids, fractional flux quanta, molecular magnets, controlled interaction in quantum gases, the theory of quantum correlations in mott matter, cold gases, and mesoscopic systems, Bose-Einstein condensates on the chip, on the route to the quantum computer, a quantum computer in diamond. (HSI)

  18. From the atomic nucleus to the cosmos. How the strange laws of the quantum world form our reality

    International Nuclear Information System (INIS)

    Beckers, Mike

    2016-01-01

    The following topics are dealt with: The reality of nature, Hamlet in quantum world, the ene of the local realism, quantum jumps, a new quantum theory, string theory for solids, atomic nuclei between liquid and crystal, simulated quantum worlds, space-time entanglement, Einstein in the quantum test, quantum cryptography, quantum computers as code breaker. (HSI)

  19. Nuclear energy basic knowledge

    International Nuclear Information System (INIS)

    Volkmer, Martin

    2013-11-01

    The following topics are dealt with: Atoms, nuclear decays and radioactivity, energy, nuclear fission and the chain reaction, controlled nuclear fission, nuclear power plants, safety installations in nuclear power plants, fuel supply and disposal, radiation measurement and radiation exposition of man. (HSI)

  20. In the depths of the particle world. Searched for: New physics beyond the Higgs; In den Tiefen der Teilchenwelt. Gesucht: Eine neue Physik jenseits des Higgs

    Energy Technology Data Exchange (ETDEWEB)

    Beckers, Mike (comp.)

    2015-07-01

    The following topics are dealt with: Particle accelerators of the future, expected surprises from the LHC, the reality in quantum field theory, expected LHC results in string theory, the internal structure of the quarks, supersymmetry in the crisis, the search for ultralight particles, new physics with neutrinos, the still unknown properties of the neutrinos, the proton radius, the internal structure of the neutron. (HSI)

  1. Restart of the LHC. The Higgs particle and the Standard Model. The particle physics behind the world machine illustratively explained; Neustart des LHC. Das Higgs-Teilchen und das Standardmodell. Die Teilchenphysik hinter der Weltmaschine anschaulich erklaert

    Energy Technology Data Exchange (ETDEWEB)

    Knochel, Alexander

    2016-07-01

    The following topics are dealt with: The development of the Standard Model on the base of relativity theory, quantum theory, and the detection of new particles, the physics of the Standard Model, the production of new particles with the LHC, the importance of the discovery of a Higgs boson for our picture of the world. (HSI)

  2. Restart of the LHC. CERN and the accelerators. The world machine illustratively explained; Neustart des LHC. CERN und die Beschleuniger. Die Weltmaschine anschaulich erklaert

    Energy Technology Data Exchange (ETDEWEB)

    Hauschild, Michael

    2016-07-01

    The following topics are dealt with: The development of the European research center for particle physics CERN, the standard model of elementary-particle physics, the detection of the W and Z bosons with the SPS collider, the principles of particle accelerators, the way to the LHC. (HSI)

  3. The European X-ray free-electron laser. Technical design report

    Energy Technology Data Exchange (ETDEWEB)

    Altarelli, Massimo; Brinkmann, Reinhard; Chergui, Majed [and others

    2007-07-15

    The following topics are dealt with: TTF/FLASH in the XFEL context, general layout of the XFEL facility, the XFEL accelerator, undulators for SAES and spontaneous emission, photon beamlines and scientific instruments, infrastructure and auxiliary systems, commissioning and operation, project management and organization, cost and time schedule. (HSI)

  4. The European X-ray free-electron laser. Technical design report

    International Nuclear Information System (INIS)

    Altarelli, Massimo; Brinkmann, Reinhard; Chergui, Majed

    2007-07-01

    The following topics are dealt with: TTF/FLASH in the XFEL context, general layout of the XFEL facility, the XFEL accelerator, undulators for SAES and spontaneous emission, photon beamlines and scientific instruments, infrastructure and auxiliary systems, commissioning and operation, project management and organization, cost and time schedule. (HSI)

  5. Extreme Sparse Multinomial Logistic Regression: A Fast and Robust Framework for Hyperspectral Image Classification

    Science.gov (United States)

    Cao, Faxian; Yang, Zhijing; Ren, Jinchang; Ling, Wing-Kuen; Zhao, Huimin; Marshall, Stephen

    2017-12-01

    Although the sparse multinomial logistic regression (SMLR) has provided a useful tool for sparse classification, it suffers from inefficacy in dealing with high dimensional features and manually set initial regressor values. This has significantly constrained its applications for hyperspectral image (HSI) classification. In order to tackle these two drawbacks, an extreme sparse multinomial logistic regression (ESMLR) is proposed for effective classification of HSI. First, the HSI dataset is projected to a new feature space with randomly generated weight and bias. Second, an optimization model is established by the Lagrange multiplier method and the dual principle to automatically determine a good initial regressor for SMLR via minimizing the training error and the regressor value. Furthermore, the extended multi-attribute profiles (EMAPs) are utilized for extracting both the spectral and spatial features. A combinational linear multiple features learning (MFL) method is proposed to further enhance the features extracted by ESMLR and EMAPs. Finally, the logistic regression via the variable splitting and the augmented Lagrangian (LORSAL) is adopted in the proposed framework for reducing the computational time. Experiments are conducted on two well-known HSI datasets, namely the Indian Pines dataset and the Pavia University dataset, which have shown the fast and robust performance of the proposed ESMLR framework.

  6. Frontier detectors for frontier physics

    International Nuclear Information System (INIS)

    Cervelli, F.; Scribano, A.

    1984-01-01

    These proceedings contain the articles presented at the named meeting. These concern developments of radiation detectors and counting techniques in high energy physics. Especially considered are tracking detectors, calorimeters, time projection chambers, detectors for rare events, solid state detectors, particle identification, and optical readout systems. See hints under the relevant topics. (HSI)

  7. Neutron scattering. Lectures

    Energy Technology Data Exchange (ETDEWEB)

    Brueckel, Thomas; Heger, Gernot; Richter, Dieter; Roth, Georg; Zorn, Reiner [eds.

    2010-07-01

    The following topics are dealt with: Neutron sources, symmetry of crystals, diffraction, nanostructures investigated by small-angle neutron scattering, the structure of macromolecules, spin dependent and magnetic scattering, structural analysis, neutron reflectometry, magnetic nanostructures, inelastic scattering, strongly correlated electrons, dynamics of macromolecules, applications of neutron scattering. (HSI)

  8. Neutron scattering. Lectures

    International Nuclear Information System (INIS)

    Brueckel, Thomas; Heger, Gernot; Richter, Dieter; Roth, Georg; Zorn, Reiner

    2013-01-01

    The following topics are dealt with: Neutron sources, symmetry of crystals, nanostructures investigated by small-angle neutron scattering, structure of macromolecules, spin dependent and magnetic scattering, structural analysis, neutron reflectometry, magnetic nanostructures, inelastic neutron scattering, strongly correlated electrons, polymer dynamics, applications of neutron scattering. (HSI)

  9. Werner Heisenberg; Werner Heisenberg

    Energy Technology Data Exchange (ETDEWEB)

    Schiemann, G.

    2008-07-01

    This book contains a biography of Heisenberg, a description of the development of quantum mechanics, a consideration of connections of philosophy and physics, and a description of the scientific picture of the world. Finally a list of books written by Heisenberg respectively connected with his work is presented. (HSI)

  10. Control-Display Investigation of Complex Trajectory Flight Using the Microwave Landing System. Analysis Phase.

    Science.gov (United States)

    1979-12-01

    perspective to create the illusion of depth as the third dimension for mapping distance. The perspective treatment is limited to the depiction of a channel...0> -i > > 0 > ON s > ca6 INS CRS SEL INS CRSSEL SYS INS DRIFT Ifl --- imp ANGLE RADANS SW J]HSI DIRECT HDGSEL UNIT C MCDULE HOG SEL IL 0 N RAD CRS

  11. Evolution of control systems for accelerators

    International Nuclear Information System (INIS)

    Crowley-Milling, M.C.

    1983-01-01

    The author reviews the development of control systems for accelerators. After an historical survey and a general introduction the hardware and software of such systems is described. As example the control system of the CERN SP5 is considered. Finally an outlook is given to future developments with special regards to the LEP storage ring. (HSI)

  12. High energy density in matter produced by heavy ion beams

    International Nuclear Information System (INIS)

    1987-08-01

    This annual report summarizes the results of research carried out in 1986 within the framework of the program 'High Energy Density in Matter Produced by Heavy Ion Beams' which is funded by the Federal Ministry for Research and Technology. Its initial motivation and its ultimate goal is the question whether inertial confinement can be achieved by intense beams of heavy ions. (orig./HSI)

  13. Experimental HEP supercomputing at F.S.U

    International Nuclear Information System (INIS)

    Levinthal, D.; Goldman, H.; Hodous, M.F.

    1987-01-01

    We have developed a track reconstruction algorithm that will work with any 2-dimensional detector as long as the 2-dimensional projections of that detector are ''true'' projections. The program is implemented on a 2-pipe CDC CYBER-205 with 4 million words of memory. (orig./HSI)

  14. Bohr-Sommerfeld orbits in the moduli space of flat connections and the Verlinde dimension formula

    International Nuclear Information System (INIS)

    Jeffrey, L.C.; Weitsman, J.

    1992-01-01

    We show how the moduli space of flat SU(2) connections on a two-manifold can be quantized. The dimension of the quantization, given by the number of integral fibres of the polarization, matches the Verlinde formula, which is known to give the dimension of the quantization of this space in a Kaehler polarization. (orig./HSI)

  15. Discovery of high energy electrons in the radiation belt by devices with gas Cherenkov counters

    International Nuclear Information System (INIS)

    Kirillov-Ugryumov, V.G.; Galper, A.M.; Dmitrenko, V.V.

    1986-01-01

    A detailed study of the trapped electrons was undertaken with Bulgary-1300 satellite, the orbit altitude and the inclination being proportional900 km and 81 0 , respectively. The instrument axis in this case was perpendicular to the orbit plane. A scintillation-Cherenkov telescope, Electron, with parameters similar to that of Elena was used. (orig./HSI)

  16. Lise Meitner (1878-1968) 'Mother of nuclear structure physics'

    Energy Technology Data Exchange (ETDEWEB)

    Armbruster, P.

    2001-03-01

    A biography of Lise Meitner is given. Especially her work in cooperation with Otto Hahn concerning the discoveries of{sup 207}Tl and {sup 234}Pa by means of recoil separation and {beta}-spectrometry as well as the discovery of fission is described. Furthermore her confrontations with racism and sexism are considered. (HSI)

  17. Annual report 1982 of the 2. Institut fuer Experimentalphysik of Hamburg Univ

    International Nuclear Information System (INIS)

    1982-12-01

    This annual report contains short descriptions of the work done at the named Institute together with a list of publications and theses. The works concern studies on hyperfine structure by Moessbauer spectroscopy an νν angular correlation measurements, experiments with synchrotron radiation, experiments at the storage rings DORIS and PETRA, and neutrino experiments at CERN. (HSI) [de

  18. Assessment of Personality as a Requirement for Next Generation Ship Optimal Manning

    Science.gov (United States)

    2012-09-01

    Department of Test and Evaluation FFG Frigate Guided Missile FFM Five Factor Model FY HRO Fiscal Year High Reliability Organization HSI Human... FFM ) to classify personality and their associated scales provided a renewed foundation for personality trait research (Digman, 1990). Costa and...McCrae’s (1992) FFM of personality traits (openness, conscientiousness, extraversion, agreeableness, and emotional stability) has developed into the

  19. Detection of Glycoalkaloids and Chlorophyll in Potatoes (Solanum tuberosum L.) by Hyperspectral Imaging

    DEFF Research Database (Denmark)

    Kjær, Anders; Nielsen, Glenn; Stærke, Søren

    2017-01-01

    The purpose of the study was to investigate the use of hyperspectral imaging (HSI) to detect and quantify chlorophyll (Chl) and total glycoalkaloid concentrations (TGA) in potatoes. To create a set of tubers with different concentrations of Chl and TGA, potatoes of four varieties were wounded...

  20. Applications of QCD

    International Nuclear Information System (INIS)

    Landshoff, P.V.

    1983-01-01

    The author describes the application of quantum chromodynamics to deep inelastic lepton scattering, the Drell-Yan process, e + e - -annihilation, #betta##betta#-physics, large psub(T) processes, and wide angle quark-quark scattering. Furthermore higher order terms are considered. (HSI)

  1. Cutoff dependence in lattice phi44 theory

    International Nuclear Information System (INIS)

    Symanzik, K.

    1979-11-01

    The author discusses corrections to the high temperature expansion of the lattice phi 4 4 theory in 4 + epsilon dimensions using the renormalization group. He works with vertex functions, whose expansion is derived from an effective Lagrangian for large-cutoff behaviour. He concludes that the numerical phi 4 4 results offer a test of the idea of asymptotic freedom. (HSI)

  2. International workshop on calorimeter simulation

    International Nuclear Information System (INIS)

    Filges, D.; Cloth, P.

    1988-10-01

    The aim of the Juelich workshop was to provide an overview of the state of calorimeter simulation and the methods used. This resulted in 29 contributions to the following topics: Code systems relevant to calorimeter simulation, vectorization and code speed-up, simulation of calorimeter experiments, special applications of calorimeter simulation. This report presents the viewgraphs of the given talks. (orig./HSI)

  3. Results from PETRA

    International Nuclear Information System (INIS)

    Barlow, R.

    1987-02-01

    The author reviews the experiments at PETRA during 1986. Especially he considers the measurement of electroweak asymmetries, lifetime measurements with the TASSO vertex detector, charm production in two-photon collisions, QCD studies, and inclusive muon and heavy quark fragmentation. (HSI)

  4. Electronic structure of antiferromagnetic UN and UPtGe single crystals from optical and magneto-optical spectroscopy

    International Nuclear Information System (INIS)

    Marutzky, M.

    2006-01-01

    In this thesis the study of the magneto-optical Kerr effect and the determination of the optical constants by means of ellipsometry and Fourier-transformation infrared spectroscopy of UN and UPtGe is described. In UPtGe an optical anisotropy was detected over a spectral range from 6 meV to 32 eV. (HSI)

  5. 11th ECR ion source workshop

    International Nuclear Information System (INIS)

    1993-05-01

    This report contains four articles concerning the commissioning of the 14 GHz ECR at the new Unilac injector, the status of the PuMa-ECR, the redesigned 14 GHz ECR ion source and test bench, and the simulation of ion beam extraction from an ECR source. See hints under the relevant topics. (HSI)

  6. Detection of low momentum protons with the new HERMES recoil detector

    Energy Technology Data Exchange (ETDEWEB)

    Vilardi, Ignazio

    2008-10-15

    In this theis the recoil detector for the HERMES experiment at HERA is described. It consists of a silicon strip detector, a scintillating fiber tracker, and a photon detector for the {delta}{sup +} background rejection, all surrounded by a superconducting 1 Tesla solenoid. Results of cosmic ray tests are presented. (HSI)

  7. Automating the Human Factors Engineering and Evaluation Processes

    International Nuclear Information System (INIS)

    Mastromonico, C.

    2002-01-01

    The Westinghouse Savannah River Company (WSRC) has developed a software tool for automating the Human Factors Engineering (HFE) design review, analysis, and evaluation processes. The tool provides a consistent, cost effective, graded, user-friendly approach for evaluating process control system Human System Interface (HSI) specifications, designs, and existing implementations. The initial set of HFE design guidelines, used in the tool, was obtained from NUREG- 0700. Each guideline was analyzed and classified according to its significance (general concept vs. supporting detail), the HSI technology (computer based vs. non-computer based), and the HSI safety function (safety vs. non-safety). Approximately 10 percent of the guidelines were determined to be redundant or obsolete and were discarded. The remaining guidelines were arranged in a Microsoft Access relational database, and a Microsoft Visual Basic user interface was provided to facilitate the HFE design review. The tool also provides the capability to add new criteria to accommodate advances in HSI technology and incorporate lessons learned. Summary reports produced by the tool can be easily ported to Microsoft Word and other popular PC office applications. An IBM compatible PC with Microsoft Windows 95 or higher is required to run the application

  8. Renormalization theory in four dimensional scalar fields. Pt. 2

    International Nuclear Information System (INIS)

    Gallavotti, G.; Rome Univ.; Nicolo, F.; Universita 'La Sapienza', Rome

    1985-01-01

    We interpret the results of the preceding paper (1985) in terms of partial resummations of the perturbative series for the effective interaction. As an application we sketch how our resummation method leads to a simple summation rule leading to a convergent expansion for the Schwinger functions of the planar PHI 4 4 -theory. (orig./HSI)

  9. 11th international symposium on nuclei in the cosmos. Book of abstracts

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2010-07-01

    The following topics are dealt with: The big bang, the first stars, chemical evolution and stars, grains and {gamma}-ray observations, core-collapse supernovae, hypernovae and mergers, compact objects, the s-process, novae, X-ray bursts, explosive nucleosynthesis, type Ia supernovae, the p process ans exotic nuclei, the r-process, future facilities. (HSI)

  10. RF system of a synchrotron for protons and heavy ions

    International Nuclear Information System (INIS)

    Boehne, D.

    1987-12-01

    In this paper the potential and the constraints of producing many kilovolts of rf accelerating voltage for synchrotrons in a cumbersome board frequency range are reviewed from the electrical engineering standpoint. This paper elaborates on numbers and limits which determine cost and complexity of the rf system. (orig./HSI)

  11. Evolution of direct mechanisms with incident energy from the Coulomb-barrier to relativistic energies. - Two-center effects in nucleon transfer between nuclei. - Signatures of nucleon promotion in heavy ion reactions at barrier energies

    International Nuclear Information System (INIS)

    Oertzen, W. von; Voit, H.; Imanishi, B.

    1988-10-01

    This report contains a review article considering the evolution of direct mechanisms with incident energy in heavy ion reactions and two theoretical articles concerning two-center effects in transfer reactions between heavy ions and the nucleon promotion in heavy ion reactions. See hints under the relevant topics. (HSI)

  12. Proceedings of the workshop on crystalline ion beams

    International Nuclear Information System (INIS)

    Hasse, R.W.; Hofmann, I.; Liesen, D.

    1989-04-01

    The workshop consisted of mainly invited and some contributed papers. More informal discussions took place in three working groups on the following topics: beam cooling techniques; diagnostics of crystalline beams; storage rings for crystalline beams. The present volume collects all papers as well as the summaries of the working groups. See hints under the relevant topics. (orig./HSI)

  13. Fusion of spectra and texture data of hyperspectral imaging for the prediction of the water-holding capacity of fresh chicken breast filets

    Science.gov (United States)

    This study investigated the fusion of spectra and texture data of hyperspectral imaging (HSI, 1000–2500 nm) for predicting the water-holding capacity (WHC) of intact, fresh chicken breast filets. Three physical and chemical indicators drip loss, expressible fluid, and salt-induced water gain were me...

  14. Physics at HERA

    International Nuclear Information System (INIS)

    Wolf, G.

    1985-06-01

    The author reviews the physics, which can be studied by the HERA storage ring. Especially he considers deep inelastic electron scattering from protons, the production of new particles like heavy quarks, additional vector bosons, Higgs bosons, excited quarks and leptons, leptoquarks, and supersymmetric particles, as well as the detection of new processes. (HSI)

  15. Transformative Hispanic-Serving Institutions: Realizing Equity Praxis through Community Connections and Local Solutions

    Science.gov (United States)

    Ruiz, Marisol; Valverde, Michelle

    2012-01-01

    Schools serve as antidemocratic spaces where teacher, parent, community member, and student voices are typically disregarded. Instead, philanthropists and businesses are allowed to drive school and district agendas. An exploration of 3 local efforts that connect a Hispanic-Serving Institution (HSI) with prekindergarten to Grade 12 students and…

  16. Modular groups in quantum field theory

    International Nuclear Information System (INIS)

    Borchers, H.-J.

    2000-01-01

    The author discusses the connection of Lagrangean quantum field theory, perturbation theory, the Lehmann-Symanzik-Zimmermann theory, Wightman's quantum field theory, the Euclidean quantum field theory, and the Araki-Haag-Kastler theory of local observables with modular groups. In this connection he considers the PCT-theorem, and the tensor product decomposition. (HSI)

  17. Lattice gauge theory

    International Nuclear Information System (INIS)

    Mack, G.

    1982-01-01

    After a description of a pure Yang-Mills theory on a lattice, the author considers a three-dimensional pure U(1) lattice gauge theory. Thereafter he discusses the exact relation between lattice gauge theories with the gauge groups SU(2) and SO(3). Finally he presents Monte Carlo data on phase transitions in SU(2) and SO(3) lattice gauge models. (HSI)

  18. Infinite dimensional groups and algebras in quantum physics

    International Nuclear Information System (INIS)

    Ottesen, J.T.

    1995-01-01

    This book is an introduction to the application of infite-dimensional groups and algebras in quantum physics. Especially considered are the spin representation of the infinite-dimensional orthogonal group, the metaplectic representation of the infinite-dimensional symplectic groups, and Loop and Virasoro algebras. (HSI)

  19. Quantum field theory and parastatistics

    International Nuclear Information System (INIS)

    Ohnuki, Y.; Kamefuchi, S.

    1982-01-01

    This book is an introduction to the second quantization of the wave functions of particles obeying the parastatistics. After a general introduction to the canonical quantization for the case of paracommutation relations the nonrelativistic field theory is considered. Thereafter the extension to the relativistic range is discussed. Finally some special problems in connection with parafields are considered. (HSI)

  20. Some connections for manuals of empirical logic to functional analysis

    International Nuclear Information System (INIS)

    Cook, T.A.

    1981-01-01

    In this informal presentation, the theory of manuals of operations is connected with some familiar concepts in functional analysis; namely, base normed and order unit normed spaces. The purpose of this discussion is to present several general open problems which display the interplay of empirical logic with functional analysis. These are mathematical problems with direct physical interpretation. (orig./HSI)

  1. Forschungszentrum Juelich. Annual report 2008

    International Nuclear Information System (INIS)

    Frick, Frank; Roegener, Wiebke

    2009-07-01

    The following topics are dealt with: The precise lattice QCD mass calculation of protons and neutrons by means of the JUGENE supercomputer, the early diagnosis of morbus Alzheimer, the fabrication of vertebra-column implants consisting of porus titanium, software for the improvement of the spatial resolution in electron microscopy by means of aberration corrections. (HSI)

  2. Beschleunigerlaboratorium der Universitaet und der Technischen Universitaet Muenchen: Annual report 1984

    International Nuclear Information System (INIS)

    1984-01-01

    This annual report contains extended abstracts about the work performed at the named institute together with a list of publications and reports. The work concerns heavy ion reactions, reactions with light and polarized particles, nuclear spectroscopy, atomic physics, accelerator mass spectroscopy, the theory of nuclear reactions and nuclear structure, and developments of accelerators, radiation detectors, and data processing. (HSI) [de

  3. Die invloed van deelname aan fisieke aktiwiteit tydens vryetyd op ...

    African Journals Online (AJOL)

    A sedentary lifestyle can lead to the development of hypokinetic diseases, which include risk factor development of coronary heart diseases, which can lead to ill health and reduced productivity. This study analysed the impact of leisure-time physical activity (LTPA) on indices of health status (HSI), lifestyle (LSI) and coronary ...

  4. The fermion stochastic calculus I

    International Nuclear Information System (INIS)

    Streater, R.F.

    1984-01-01

    The author describes the stochastic calculus of quantum processes with fermions. After a description of the Clifford algebra as the csup(*)-algebra generated by spinor fields the damped harmonic oscillator with quantum noise is considered as example. Then the Clifford process is described. Finally the Ito-Clifford integral and the Ito-Clifford isometry are presented. (HSI)

  5. Antiprotons in the CERN intersecting storage rings

    International Nuclear Information System (INIS)

    Bryant, P.J.

    1984-01-01

    High-sensitivity electronics for TTl and ring 2 had been developed and installed, the original experimental stochastic cooling systems in the ISR were rebuilt and considerably improved, the split-field magnet (SFM) vacuum chamber was modified, some steering dipoles were designed, made and installed, and finally innumerable interlocks and computer programs were revised for antiproton operation. (orig./HSI)

  6. PHOTON09. Proceedings of the international conference on the structure and interactions of the photon including the 18th international workshop on photon-photon collisions and the international workshop on high energy photon linear colliders

    International Nuclear Information System (INIS)

    Behnke, Olaf; Diehl, Markus; Schoerner-Sadenius, Thomas; Steinbrueck, Georg

    2010-01-01

    The following topics were dealt with: Electroweak and new physics, photon-collider technology, low-energy photon experiments, prompt photons, photon structure, jets and heavy flavours, vacuum polarization and light-by-light scattering, small-x processes, diffraction, total cross sections, exclusive channels and resonances, photons in astroparticle physics. (HSI)

  7. A comparison of hyperspectral reflectance and fluorescence imaging techniques for detection of contaminants on leafy greens

    Science.gov (United States)

    Ensuring the supply of safe, contaminant free fresh fruit and vegetables is of importance to consumers, suppliers and governments worldwide. In this study, three hyperspectral imaging (HSI) configurations coupled with two multivariate image analysis techniques are compared for detection of fecal con...

  8. e+e- collisions at 500 GeV: The physics potential

    International Nuclear Information System (INIS)

    Zerwas, P.M.

    1992-08-01

    This report is the second part of the proceedings, which contain the articles presented at the named workshop. The articles in these proceedings concern extended gauge models; supersymmetry; alternative particle models; as well as beamstrahlung and photon-photon interactions. See hints under the relevant topics. (HSI)

  9. 75 FR 48405 - Self-Regulatory Organizations; NYSE Amex LLC; Notice of Filing and Immediate Effectiveness of...

    Science.gov (United States)

    2010-08-10

    ... Trina Solar Ltd......... 332 NKE NIKE Inc. 282 EWW iShares MSCI Mexico 335 FIS Fidelity National... Inc 316 CB Chubb Corp. 205 MA Mastercard Inc 320 ADM Archer-Daniels-Midland Co. 224 ATPG ATP Oil & Gas Corp/ 322 HSY Hershey Co/The. United States. 226 YUM Yum! Brands Inc......... 323 TXT Textron Inc. 232...

  10. 75 FR 47054 - Self-Regulatory Organizations; International Securities Exchange, LLC; Notice of Filing and...

    Science.gov (United States)

    2010-08-04

    ... Inc 280 TSL Trina Solar Ltd 332 NKE NIKE Inc 282 EWW iShares MSCI Mexico 335 FIS Fidelity National... 199 MBI MBIA Inc 316 CB Chubb Corp 205 MA Mastercard Inc 320 ADM Archer-Daniels-Midland Co 224 ATPG ATP Oil & Gas Corp/United 322 HSY Hershey Co/The States. 226 YUM Yum! Brands Inc 323 TXT Textron Inc...

  11. 75 FR 47670 - Self-Regulatory Organizations; The NASDAQ Stock Market LLC; Notice of Filing and Immediate...

    Science.gov (United States)

    2010-08-06

    ... NIKE Inc. 282 EWW iShares MSCI 335 FIS Fidelity Mexico National Investable Information Market Index... Inc. 316 CB Chubb Corp. 205 MA Mastercard Inc. 320 ADM Archer-Daniels- Midland Co. 224 ATPG ATP Oil & Gas 322 HSY Hershey Co./The Corp/United States 226 YUM Yum! Brands Inc 323 TXT Textron Inc. 232 RCL...

  12. X-ray sources

    International Nuclear Information System (INIS)

    Bonse, U.

    1979-11-01

    The author describes several possibilities for the production of X-radiation. Especially he discusses the use of bremsstrahlung at electron impact on solid targets and the synchrotron radiation. He presents some equations for the calculation of X-ray intensities. Especially the X-radiation from the DORIS storage ring is discussed. (HSI)

  13. Gross properties of nuclei and nuclear excitations

    International Nuclear Information System (INIS)

    Feldmeier, H.

    1986-01-01

    These proceedings contain the invited and contributed papers presented at the named workshop. They deal with special topics in high- and intermediate-energy nuclear physics. Especially considered are the quark-gluon plasma, ultrarelativistic heavy ion reactions, and the application of QCD to nuclear structure calculations. (HSI)

  14. High energy density physics with intense ion and laser beams. Annual report 2003

    International Nuclear Information System (INIS)

    Weyrich, K.

    2004-07-01

    The following topics are dealt with: Laser plasma physics, plasma spectroscopy, beam interaction experiments, atomic and radiation physics, pulsed power applications, beam transport and accelerator research and development, properties of dense plasma, instabilities in beam-plasma interaction, beam transport in dense plasmas, short-pulse laser-matter interaction. (HSI)

  15. Towards a covariant super-Reggeon calculus for the superstring

    International Nuclear Information System (INIS)

    Petersen, J.L.

    1988-10-01

    In this talk I outline our technique for calculating string amplitudes in perturbation theory around flat background space-time. Our approach consists in evaluating the Polyakov path integral in the BRST-formulation with specifically chosen boundary conditions corresponding to external coherent states. (orig./HSI)

  16. Gauge theories and their superspace quantization

    International Nuclear Information System (INIS)

    Falck, N.K.

    1984-01-01

    In this thesis the mathematical formalism for gauge theory is treated together with its extensions to supersymmetry. After a description of the differential calculus in superspace, gauge theories at the classical level are considered. Then the superspace quantization of gauge theories is described. (HSI)

  17. Direct photon experiments

    International Nuclear Information System (INIS)

    Boeggild, H.

    1986-11-01

    The author reviews the experiments on direct photon production in hadronic collisions. After a description of the experimental methods for the study of such processes he presents some results on differential cross sections and the γ/π 0 ratio in π - p, π + p, pp, and anti pp processes as well as in reactions of π - , π + , and p on carbon. (HSI)

  18. Moving at the speed of light

    International Nuclear Information System (INIS)

    Anon.

    1983-01-01

    A short survey is given about synchrotron radiation research. In this connection the US National Synchrotron light source is described. Then the application to angiography is considered. Furthermore some further synchrotron radiation sources in USA and the synchrotron radiation research in Novosibirsk are considered. Finally the development of Wigglers and undulators is discussed. (HSI).

  19. Proceedings of the lepton photon 2009 conference

    Energy Technology Data Exchange (ETDEWEB)

    Behnke, Ties; Mnich, Joachim [eds.

    2010-12-15

    The following topics were dealt with: Status of the LHC and the experiments there, lattice QCD, relativistic heavy ion collisions, neutrino telescopes, gravity-scale particle physics, dark energy and dark matter, the experimental status of the CKM matrix, rare B decays, heavy-flavor spectroscopy, physics of tau and charm, neutrino masses, deep inelastic scattering, search for Higgs bosons, SUSY searches. (HSI)

  20. Advanced Monte Carlo for radiation physics, particle transport simulation and applications. Proceedings

    International Nuclear Information System (INIS)

    Kling, A.; Barao, F.J.C.; Nakagawa, M.; Tavora, L.

    2001-01-01

    The following topics were dealt with: Electron and photon interactions and transport mechanisms, random number generation, applications in medical physisc, microdosimetry, track structure, radiobiological modeling, Monte Carlo method in radiotherapy, dosimetry, and medical accelerator simulation, neutron transport, high-energy hadron transport. (HSI)